2ROEA

Solution structure of thermus thermophilus hb8 ttha1718 protein in vitro
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination in living cells by in-cell NMR spectroscopy
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Metal binding protein
molecule keywords Heavy metal binding protein
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2roeA00
3E8OA 3K7RA 4YDXA 5B0BA 5B0CA 2XMJA 5IXUA 1KVJA 5T7LA 1IUJA 2VV5A 2K1RB 2N7YA 2RSQA 2AP6A 1K0VA 2PGCA 1APSA 1Y0HA 2XMWA 1GXTA 3FMBA 3WDOA 4DL0C 3FGVA 3KNGA 2CRLA 3DXSX 1P6TA 1TZ0A 1VQSA 1N5TA 2OD4A 2ROEA 4A46A 2OD6A 3UDCA 1WD6A 2IYIA 2BYCA 1FD8A 1Q4RA 1TUVA 4OJ1A 4FNHA 1YRXA 5B09A 3FRYA 3BB5A 2GGPB 1TL5A 4Y2KA 1JWWA 1FE0A 3QMQA 3CJKA 2KT2A 1Q8BA 4Y2MA 5B0DA 2ROGA 4A47A 2L3MA 5B0FA 2FB0A 4U9RA 1URRA 5A6PA 2RILA 1N5VA 3I9ZA 1SQEA 1YJTA 1XBWA 2OKQA 2W4CA 2ACYA 4FNIA 4A4JA 2OAUA 3BR8A 2XMVA 4Y2IA 1KQKA 3VTIA 1OSDA 5K9FA 2K7JA 1W2IA 2OP5A 2FHMA 1FVSA 3CJKB 1OQ6A 4NL5A 1LQ9A 1FE4A 2VH7A 2AJ1A 2HLUA 2GO8A 4YEAA 1CC8A 1YJUA 3LO3A 4HH0A 2RMLA 2XMMA 1P8GA 2EW9A 3BGUA 2W4PA 2N4DA 2QLXA 2K7KA 2JDJA 1AFJA 3BF4A 2QIFA 2RU9A 4HH1A 5F0WA 1X7VA 2K1RA 1CPZA 2GGPA 4DN9A 1OQ3A 3F44A 1SB6A 2LQ9A 4OJ3A 5B0AA 1U7LA 2IYGA 3BM7A 4OJHA 1N5QA 2BJEA 3GZ7A 3HHLC 2ZDOA 3HDSA 1V3ZA 3KKFA 3TOQA 3DCAA 3KG0A 5A6WA 2OFHX 4EFAC 1CC7A 1S6UA 2GFFA 1FEEA 2LXFA 3IWLA 3HHLA 2AJ0A 3BN7A 2HFNA 5B0EA 1Y3JA 2ZDPA 3BDEA 3HX9A 4OIXA 1OPZA 2BJDA 3IWXA 4OJGA 2G9OA 5KAKA 1KVIA 3HFKA 3QGPA 4A48A 2AW0A 2BUNA 2QLWA 2ROPA 3MCSA 2HQIA 4ZA1A 4HI2A 4Q2MA 2XMUA 3KG1A 1VQYA 2XMKA 2W4DA 2GA7A 2K2PA 2BBEA 3TRGA 1TL4A 2Q3PA 2XMTA 5B0GA 1Y9OA 1SI9A 2HLTA 1YJVA 2N4CA 2QYCA 5T7LB 2KT3A 1JK9B 4F67A 4DPOA 1Q53A 2OFGX 5B08A 3LGNA 1AW0A 1X0PA 2FTRA 1ULRA 2FIUA 1R6YA 2KKHA 4HL9A 3T9NA 4HI1A 1S6OA 2IFXA 5F0UA 3HHLB 1QUPA 2PD1A 3HHLD 3HF5A 1N5SA 2ASYA 3MZIA 4Q2LA 1Q8LA 4ZOSA 4NPOA 1FESA 1Y3KA 2HIQA 1GXUA 1X8DA 1MWYA 2OMOA 2GCFA 1FVQA 2LDIA 1RJJA 2LQBA 2KYZA 1TR0A 1MWZA 4QOTA 3LGMA 3TNVA 2GV1A 1AFIA 1YJRA 1YG0A 2HFOA
chains in the Genus database with same CATH superfamily
4BC7A 4OFZA 5J2QA 2ASDA 4LFAF 3RB4A 2HHQA 3GIIA 3CMAS 2H4WB 2QE5A 1X4BA 1KN6A 1F5BA 3BGRA 4ID8A 3HI9A 1K1SA 4MYTA 3CCVS 3AAWB 2XY7A 4NLGA 2CQ0A 2HGLA 3Q24A 1APSA 2GVDB 1C0UB 2CZ9A 3H2LA 4H4KC 4XTTA 3RBZA 4DN0A 4QPTA 1FRHA 2DNZA 3OPKA 5L46A 3D0GE 4PZVA 1YTYA 4PG8A 5BYSA 1J5OB 2ERRA 1M1KT 4LMZA 3EZ5A 3PFEA 2HW3A 2CPXA 2QA4G 2BXJA 2WK4A 2B56A 4I0WA 4X4OA 2CJYB 2O67A 3G4SS 4WFBQ 2RKIB 1L3SA 1HNXJ 2L3MA 4EGLA 2FB0A 4Z7CA 1IKYA 1RWKB 3PHTA 2W9BB 2D7SA 2VICA 4LF5F 2L08A 1SQEA 4CLPA 3CCRS 4DSLA 4LIRA 1XNRJ 3GJSB 4QW8A 2ACYA 1H74A 2BACA 2KO1A 1JJCB 3QT8A 4W98A 4JV1A 1TV6A 3MEDA 1XC9A 4Y2IA 4DR4J 4F0HA 2NSCA 5KT4A 1UTAA 2CYYA 4OV6A 3TP2A 4DL7A 4DG1A 2R7TA 4FDFA 3CVKA 5ETLA 3BPDA 3I5BA 4ATNA 1CS4B 1JLEB 2DNMA 2NUUG 4EO6A 3MUMP 2R7RA 2VG7A 1FTRA 3KG4A 4HTIA 2C2DA 5HVGA 1TKZA 3MMBA 3IR7B 1HW9A 4J9UE 3ICLA 1Z2ZA 4YEAA 4ZVUB 3MUVP 2KI2A 2A1BA 1YJ7A 2FZCB 2DNRA 2XMMA 4DDFA 2IAJA 4R25A 2NXEA 3OXFA 1N56A 1ELOA 4H54A 4NCAA 4M5MA 1ZBTA 4TKTA 1R31A 3H7HB 3V4MA 1WHWA 5GAEU 4DR1J 4KHPF 3RB6A 4JV0A 2AYBA 1FFSB 2HWTA 1N0UA 1CG2A 5D3GB 2EFQA 2VDIA 3C16B 2QL7B 3EVMA 1Y11A 4IRCA 4OJ3A 2ZBRA 4CLZA 2IYGA 4LF7F 4M95A 2XS7A 4ZCIA 3HDSA 1PC5A 3CCWA 1BHNA 2B3TB 4USKA 1PAUB 2ZKTA 4OX7A 3M6XA 1JLFB 5BYRA 3OTOF 2BX6A 4IO1A 3LTOA 4RNOA 3TQ1A 2KN4A 5KG0A 4DR6F 3PCOB 3J7AN 3EJMA 2I0XA 3FMWA 4OI4A 4ZCLA 2FC8A 5ETNA 4N8OA 4DMZA 4V19X 3KLHB 1CULB 4IG3A 4DFJA 2RRAA 4NLTA 3US5A 3MM6B 2AJ4A 3SQGB 1UWAA 1X4EA 3DGPA 2YKAA 3P8BB 4GKJF 2H4YB 2XZTB 2I5JB 3HVWA 3JS9A 2WW4A 1HBOA 4G1IA 3FBFA 5AE2A 4A8FA 2XS2A 2FGCA 4DV5F 2XNRA 3F0NA 5IC6B 2EI5A 2WVFA 2YQ3A 3IM9A 2A18A 2PEHA 5KG1A 2H3EB 2KT3A 3KMSA 1IKWB 3G71S 3D3CJ 3FZBA 4BWMA 2I6WA 1X4AA 2Q6CA 2JLEA 2FTRA 3ENWA 3L09A 2GX8A 1YGYA 2QLFB 1I5OB 2Z8QA 5DLGA 1IBKJ 4DSKA 2LVWA 5IQ6A 3LALA 4K0KJ 4DCOB 3MXHP 1G4CA 1LNQA 2HQ3A 4JBCA 4DHVA 4ZLLA 3TJAA 2P9EA 3C16A 3GYXB 4YUDA 2WOMA 2HURA 4MK7A 2FD2A 3HVTB 5LXYA 2DJWA 3SYZA 3CWJA 1QSSA 4B9NA 3RG6A 3V6KA 1KSPA 4CTAA 9ATCB 3DU5A 4CCHA 2FJEB 2B7BB 2RQ4A 2K06A 3TNVA 2C22A 1YJRA 2ADCA 2HFOA 3B54A 1YQHA 5HMZA 3BGLA 5B0CA 4ER8A 2PO4A 1UJ4A 3FC9A 4NLOA 2G1HA 4EMDA 5J1EB 4OL8A 3DOKB 1RADB 3Q8UA 2K1RB 1TL7B 4WXOA 1HKAA 2MKYA 4F4KA 4KO0A 3CJ4A 3MMCA 4O4GB 4NASA 2IC3A 2ZH8A 5CCMA 7FDRA 3FGVA 3R3TA 3QZ7A 2FVRA 1RU2A 1N32J 3M1VA 1FKAF 2YY3A 1GAOA 2Z57B 4V1Ak 3PJWA 1JLAA 4DV2J 3W9IA 1TK0A 4USHA 2M8HA 3JAMU 3SV3A 3BH6B 4I2PB 4DV0F 3CD7A 4X84A 3UD3P 4DV3J 1RT2B 2EFPA 2UXBF 2Z58B 2E44A 2ILYA 2LQ8A 3R5JB 3ILLA 3MPVA 4CLWA 2CDQA 2QSWA 4PUOA 1FE0A 3N28A 3QMQA 4ZJQA 1R6VA 3A3OB 3MR6A 5B0DA 4LFAJ 2ROGA 1UVIA 2UUAJ 1YIJS 4ZVGA 5HK4A 2DY1A 1YJNS 2MLXA 2BJ1A 2DIUA 4IFYB 1QUVA 2W8LA 1FNMA 1VQPS 1MMNA 3FEZA 4X64F 3DLBA 4EZ6A 2W7OA 2CNOB 3VR1A 1VQLS 3CTRA 1EP4A 1U26A 2EEYA 3MM7A 3NY0A 5HBMB 3CF5Q 2HGMA 2M5YA 2HNDA 2K7JA 1W2IA 2FJDB 2OGUA 4H4OB 3OVAA 4ES1A 4UOHA 5A2QY 3NCQA 1Y4ZB 2NUHA 6FD1A 4QIWD 1A7GE 1UFLA 1HI1A 4RW6B 2UXDJ 1MG7A 3R9LA 3GMGA 1T9YA 2H48B 4Y0FA 4G1QB 1T3OA 1NSQA 4JI0F 2AF6A 3KLVA 1F1BB 1NJZA 1JLGA 5L9NA 2V9KA 4ZVPB 4CTAB 1U1PA 5ETSA 2KU7A 1T9TA 1RWOB 3X1LB 2EPIA 2C1EB 5IQQA 4LFBJ 3MURP 2EWHA 1T9VA 1WJ9A 4DBQA 2O1PA 2HFVA 3M32B 4UY8T 5LSLA 4RW6A 1EKSA 4QZVB 1F3VA 3EDRB 4WE1B 3PX6A 2MSSA 1Q7LB 5D77A 1SB6A 2DHGA 1R27B 2A6OA 3BQ0A 5ADZA 2O66A 3QNWB 2ZDOA 4LBPA 2P9CA 5EN1A 2DR7A 3O1LA 1Q78A 3TO8A 1VK8A 3BREA 5L1IA 4FS2A 1KQFB 3JTOA 2C2EA 5KOXA 3TUPA 3FCHA 3MEGA 2VU5A 2DT9A 3IWXA 3QSIA 2E9ZA 1NDCA 1U24A 4A48A 2R2TA 2Y8WA 4JI3F 3RGIA 2UUAF 2DNNA 3OTEA 4RBVA 4I69A 4A8OA 5HJYA 4KGMA 1C0UA 1RLCL 1E6YB 3QO9B 4KHMA 1JKHA 4IG0A 3HSZA 3GE9A 4NA2A 1VQ4S 2IRYA 2AHOB 2YX7A 3EUNA 5D4OA 3TQEA 2G13A 3IN5A 4B9UA 3ZZ0A 3BO4A 2CQPA 2UV8G 1E6YA 1SH2A 3GSIA 1C4CA 2FJBB 4ZN1A 3UDVA 3MPYA 1IXKA 3KJNB 4LRBA 4U8YA 4DOZA 2HVDA 1X0PA 2WHOA 2CQ4A 5HVHA 3MGJA 5F8NA 3MI7X 2V4JA 1BWEA 2WVCA 2DR8A 4USVA 4WIIA 2W7AA 5E2QA 3E01B 3SDEA 1N34F 2WSCC 2YX4A 1VQMS 1BUXA 1OJ4A 4JI8J 1S4EA 1RA7A 4K0KF 2AX0A 4IH5A 3FFIB 1HWKA 2VB6A 3ISND 4XK8C 1QE1B 4ZOSA 3Q22A 3CJ0A 2PMWA 2CJXB 3R5CA 4O3NA 2HS0A 3HFVA 5KT2A 1TUWA 1WF1A 5DQIA 1AFJA 1ZH5A 4DV5J 2QZ8A 2R7QA 1K9MT 1LWEB 3QLHA 2MKHA 3R7SB 3AT1B 1Q95G 2PSZA 2DGOA 1OS5A 4C3KA 3CCSS 2ZH2A 3L9ZA 1I6JA 6AT1B 4IRKA 4KV8A 5KFFA 2VFTA 2X3DA 2CQCA 1QAIA 4C8YA 4ANDA 4CT9A 1RXOB 1TZ0A 1EQMA 4CYUA 3C14A 5HMWA 2V63A 5KFVA 2GAGC 3W2VA 5KFNA 1T02A 2ZKUA 2BOPA 1IKWA 4XPEA 2ZC4A 3C19A 3HT0A 4WTOB 2DYAA 1JKHB 3IXQA 4IG0B 4JI3J 2DKOB 2CKWA 2EXUA 3Q86A 1RWNB 3HD2A 2D3UA 4OJ1A 1S6QB 3W9JA 1KRPA 3LPYA 4JI2F 2F5GA 1UWBA 4MK9A 5F0UA 1XK8A 2OSRA 2Q6BA 2IBOA 2VBXA 3M1VB 4W4MA 3A4TA 3THPA 3VZIA 2W9CA 1RK8A 2F7VA 4AUKA 5GMEA 2E1RA 2WVBA 2KM8B 4M63A 1NB7A 1O51A 4AYBD 2V69A 1AT1B 4DV4J 1CBKA 1TKTA 3BYPA 5DS7A 1XBWA 5KG6A 2GQQA 4KPCA 3A8JA 1S1VB 4HHUA 4LSNB 2PMZD 1PCAA 5LSOA 4DZ6A 3ZZRA 4X4UA 5C25B 1Q16B 1TQLA 1V5IB 5HQ8A 3X3UA 2ZJPQ 4JI8F 3QJLA 3DLGB 4TU9A 1RDRA 4FYWB 2DGVA 3I0RA 2BEFA 4I6AA 1A9NB 5D3GA 2DGXA 3M30B 1L3KA 1UP1A 2AJ1A 3NNCA 1RT3A 1CC8A 1YJUA 2EG1A 3MEKA 3QZ8A 4O0IA 3IG1B 5IV4A 1U1MA 3FBCA 1YBAA 1WTBA 3S1TA 2CADA 1FF2A 2JEJA 5ETMA 4ERDA 4X4SA 2V6AA 2XWXA 1KLMA 1U09A 1XMQJ 2R8JA 2ZITA 4K4XA 1KC8T 2XSJA 4HH1A 4K59A 3RW7A 3OQ2A 3BBBA 1HBNB 5LT5A 2OI2A 2OPQB 4C8ZA 4RX6A 3UNYA 3MAHA 3CDAA 2RQMA 2UUWA 4OJHA 4PWWA 4NLYA 5E5NA 5J1NA 2KG1A 5D0RA 1D8YA 2Y0BB 2HFZA 1DARA 1RBOB 2UU9J 2B9YA 2OFHX 2PFDA 3W62A 4DL5A 1FEEA 2B0GA 1K0TA 2OSQA 4F4AA 2OLWA 1HWLA 3O8WA 3M7VA 4EU0A 1NNDA 5KFJA 2FVCA 2P5VA 4KTQA 5DG7A 2IM0A 2F9JA 2E5JA 4ALZA 1FJ7A 1XTZA 4JI1F 2PI5A 4G3IA 1IR2A 3GJRB 5FD1A 1G1XA 4DCPB 4Q2MA 2XMUA 5K20B 1LXNA 3M2VB 3LP1B 1MSWD 3DRPA 2VBYA 1TKDA 3DLKB 3CC4S 1B0VA 4ZCMA 4IO9Q 1RE1B 2HQFA 3SCJE 1KKHA 1ZZFA 4DV1J 1FJCA 1TL1A 4ES3A 5J1PA 1SKSA 1QSLA 3G82A 2IC3B 1RB0A 3CIMA 1EZZB 4TY8A 4YR0A 2ALZA 3T9NA 3DLEB 2OTLS 4KIAA 4M5NA 4F25A 3MPDA 3K57A 5E3QA 1SL0A 2QT7A 1NJWA 3UI3A 1H2UX 1ROFA 2R7VA 3HHLB 1Q0NA 3D5MA 2PD1A 4J37A 3CJRA 3VF0B 1TK8A 1TU0B 2DPIA 1V5VA 4ZITA 3ZTOA 2J7KA 2JOQA 2OMOA 4IOBA 1JJ2R 1DZ5A 3I5CA 4QWDA 1W25A 3CC7S 1FFWB 2GV1A 1GNKA 2ZOGA 2ZZMA 4QPXA 3CW2C 4OHXA 5EWEA 2M7SA 3DU6A 3JQMA 3EPIA 1JX4A 1NB2A 2J6TA 3SZ2A 2HNZA 1VRUA 4GVBA 5BYQA 2J9CA 2V8DA 1FWLA 4NCGB 4OLPA 4KFBA 4JI1J 2E5HA 4DR1F 2W9BA 4KHPJ 3BBFA 2HNZB 3MM9B 1Y0HA 1RHQB 3PW5A 4DL4A 2EKYA 3HSGA 3NG8A 4HTJA 4C97A 3PV8A 3T1YF 2LQJA 2V8GA 3DXSX 4J9LA 3KJQB 2V8HA 3CJQA 1RTHB 3VVUA 5F8LA 4WWSA 1SCJB 3PO5A 4DV3F 1HNWF 3TVYA 1HA1A 4ZPCA 1HBOB 2E7WA 1S49A 5HLFB 1S1XA 3FRZA 4K4WA 2QA2A 2Z56B 3J7Z5 1OPIA 2QX0A 3SI8A 2OTJS 3N79A 5L9XA 3MM6A 5ETPA 3SQGA 1JWWA 2R7OA 4K2JA 5D0GA 4DU8A 2L9NA 5C2GA 3POTB 1FO1A 1FRXA 2EK6A 2YKNB 3KLIA 3GJQB 3LUYA 2VBWA 1FNXH 5GMKa 4FF1A 1SJFA 4LF6J 2OKQA 2VJVA 2HHVA 2OMLA 2QSFA 1NPPA 1RISA 3M8SA 3P5TL 3OUYB 1GQEA 4CI0B 3RW6A 1HHTP 2DCUB 2WSEC 1S1WA 3L7OA 3QPIA 4LVOP 3MHYA 3WZ0A 3CUNA 1ZTWA 4ANCA 5I3UB 3CJKB 4LSZB 5ETTA 1S5ZA 1T0TV 1Y5LB 5K8MA 4I4BA 1WC3A 3V81B 2MZTA 2VUGA 4LF1A 3VAIA 2J7WA 2VFVA 5BJRA 4RW8A 3W65A 2ASLA 2DY9A 4A8KA 3P4UB 2MKSA 3T41A 3M2RB 3OR2A 2XZDB 4CLTA 1NK4A 2EW9A 3MPUB 3TJ9A 2BQ3A 3THTA 3KXDA 3O44A 1PJ6A 2F63A 2K7KA 3DOMB 2HIYA 3DYAB 3EM1A 3MCNA 3PYFA 1GMWD 2QIFA 3KYLA 3CPWR 2JVRA 4X4NA 4C8LA 1DLOA 3DMJA 3D7SB 2K1RA 3DN9A 4QR2A 1T9UA 2JJ4D 1GTEA 2HVEA 1V6HA 1D8ZA 1VR6A 3IO1A 4ES2A 2HZAA 1DAXA 3UD4P 2VPWB 4Y2CA 5HATA 5K8PA 3J81Y 1BC6A 4Z2XA 3LP2A 1FXDA 4ILLA 2L41A 1OY8A 4JI4F 1PAEX 3HZGA 1T94A 2B4OA 3LAMA 4NE9C 4WK3A 5L39A 3B4MA 3BO3A 2B4UA 1VBKA 1DQ9A 3BZQA 3HX9A 2UXCF 4OI1A 5KAKA 1K44A 1LOUA 2MQPA 4YQWA 2CQ1A 4DR5J 1PO6A 1HNXF 4J9NA 2HZVA 2QLWA 2YQ0A 4JV5J 3M4XA 1RAAB 2MKJA 1UEUA 5HQMA 1VDHA 2XULA 2K2PA 4LSLB 5KTQA 1VFJA 1ZA1B 1RHUB 1YWXA 2PMHA 2F4FA 2A3JA 2NPIA 2P2CB 5EDWA 3MAAB 2AGQA 2YNFB 3ONQA 3PYGA 3FZ2A 4F8RA 2M9KA 2FHKA 2G0IA 3A8KA 3ILJA 3QIPB 3FNNA 4DFPA 4RW9A 3G8TA 3VAMA 4JI6F 1SL2A 1WACA 3KLFB 2ZZNA 3MM9A 1UMJA 3TI0A 1P27B 3AA8A 3S01A 4PABA 5J2QB 3CCUS 3HF5A 5I42A 4ZPVR 3CSKA 3LA0A 3M9MB 1ZTTA 3TR5A 2JNJA 4WYLA 3QWPA 5HL7Q 4DL6A 2XS5A 3GV8B 4RWXA 2E5IA 4QW9A 3C14B 3OFEA 1IJFB 2VKRA 2OUGA 1UJ5A 4X2BA 5B0BA 4EBDA 2LA4A 4P7VA 3VGSA 4DR2J 5T7LA 2QLBB 4RWWA 3ISZA 3HHKA 2DO4A 1IN0A 1Q79A 3MPWA 1X0FA 3CT9A 5BXIA 1SL1A 2DR5A 2VFUA 3NGDA 2MY7A 2RRNA 4ECYA 4JYAF 2VQFJ 4ZP8A 4KR0B 3PKYA 4LUBA 5A8WA 1M90T 5IT9U 1OMSA 2ROEA 2KB2A 5HBMA 1HYSA 5KG5A 4JUZA 5KFZA 3ADAC 3PRDA 1UPPA 1HQEB 2B8PA 1O6XA 2X1AA 3MDFA 3N6NA 2YH1A 1FNOA 2VPXB 1RAJA 3AHPA 1YRXA 3JSRA 3R5BA 1YLXA 3ZFVA 4E98A 1HNWJ 1Q86T 2OIHA 2CNNB 5DQGA 2Z2ZA 5IT9Y 2EBGA 5A0YA 4DX5A 2YBVA 2Z2LA 1U6ZA 1YDLA 3VGTA 4RZRA 2ADBA 1CQNA 2X7IA 3T19A 1DTTB 4LF9J 2HKEA 1FFGB 1JNZB 1R89A 2UV8A 4RW4B 3E51A 4A4JA 4CM2A 4DFMA 5F8JA 5IWAJ 2CDRB 5KFDA 5LMNF 1TK5A 1XNRF 3CDWA 5HMXA 3OVBA 4ETZA 4RBTA 3U02A 3W60A 1IKVB 2EBEA 3IM8A 3V6DA 1NUEA 2ZH6A 3KK2A 3I9V9 4FKXA 3RAXA 5C2CA 1K8AT 4NMLA 5AT1B 4DWIA 3NL0A 2W25A 2VL1A 3UN3A 4PAAA 1UA0A 4TXSA 3W5XA 5CD4A 4HYKA 3B4DA 2HZCA 3IFEA 4IFVB 4E2FB 4FF2A 4DUYF 3J80U 3SV4A 2C2RA 5DZ7A 4ETXA 4N56A 3K2YA 2DD8S 4WU2A 3RRHA 1M5SA 2VPYB 1VQ8S 4LF4J 5C42B 4KKOA 4IRDA 1XJWB 4AXJA 3FVYA 4C48A 2UVUA 2RDJA 4M5DA 4CIOA 2EKNA 2ZHAA 3R2DJ 2X1BA 2DGUA 1E6VA 1S0NA 1XMOJ 2POKA 2HHHJ 1KEKA 1N88A 4EUVA 1RWWB 3R1LA 4ICLB 2D9PA 1S9GB 3ISNC 3NWRA 3HO1A 5K8OA 3BM7A 4K8RA 2XY5A 2GJIA 5KFXA 2XO6A 1N8RT 2K3KA 2CJKA 2B8QA 1CSJA 3U1MA 1N5YA 5C24A 1UEVA 2MGZB 1SC6A 1S6UA 2C3YA 3S6EA 1KTQA 1RAHB 2B43A 3HHLA 5IZHA 1VQOS 4PXCA 3ILIA 3JSYA 4FYDA 1FEHA 1QVGR 4XPCA 3MTKA 4JI5J 4USJC 4H4OA 3SEOA 5F3ZA 2W9AA 1FI4A 2ZC3A 3L7PA 1WUUA 2A10A 1FDDA 3FKBA 2AGOA 2MJNA 1VBXA 4FYVB 2W9CB 1C1CA 3T9ZA 4DX6A 3ZZPA 4KYZA 1VC6A 2DH8A 4DV1F 2P6TA 3KK2B 1UCNA 1N33J 4J9VA 5LMNJ 3CCES 2KZMA 3NWGA 1CJUA 5FDLB 3UN5A 2R9LA 1R0AB 2B51A 1HNIB 1YZ7A 2CPEA 2M88A 2O5DA 1IR0A 1RI7A 3EVOA 3K89A 2ZE2A 3VZHA 4WF9Q 1L3UA 4O3RA 4I56A 5E0OA 2CXEA 4R0EA 1XEZA 1DTQA 3M8QA 2XSFA 2CQ2A 5D4NA 1HL6A 3H42A 5DGBA 4TYAA 3GTYX 2KYXA 4Q2LA 4WK1A 5E3CA 4DR5F 1WF0A 3TARA 2V9WA 3LP0A 3D28A 4YDDB 1GXUA 2F65A 2R8IA 2BJ9A 2L9DA 4O44A 3MMAB 4ZPBA 4ELTA 2HHTA 1AFIA 2H1YA 3IWLA 2APOA 2GVZB 1M5OC 1TFYA 1BQMB 3UE2A 1Y5IB 4Q0BB 1JMTA 1MN9A 3QBCA 4LFCJ 3SFUA 3I6PA 4Q5VA 2F1FA 2VHGA 1UVLA 2B4VA 1K0VA 3OTBA 2BRLA 2PGCA 3W1YC 4DL0C 4DSFA 4R0JA 3OL6A 1RSCA 3NGRA 1RT6A 1UJ6A 3KNGA 2MJUA 2XTJP 5L1JA 1QAYA 1QLNA 2Q66A 2XSJB 1YZ6A 4O44B 4GC6A 2B9EA 1R8PA 1IQTA 4WCEQ 1T05A 3V5RA 2LKZA 4I2QA 1SUQB 3I0RB 4M1KA 2NS1B 1S9GA 3MCMA 2AYEA 1NJYA 1MMDA 4WBFA 4UUWA 4FNHA 4YY3J 2IA6A 3G87A 3HCXA 1VBZA 3D0IE 3IG1A 3FSXA 3TAMA 3BEGB 1CJTA 1P9YA 2QMUB 3PTWA 1I3OB 2CFXA 3M8QB 1CEZA 1WKKA 4YHHF 4I6WA 3CJKA 2ZD1B 1LK5A 3C15A 4AT1B 1NKCA 1N33F 1PKUA 5D8HB 2CQBA 3OJUA 1URRA 3RUBL 3M8PB 1EETB 4TN2A 4ZVQB 2CWXA 3TA1A 2D3O1 1MN7A 1FKPA 3NAIA 4FNIA 1L3TA 4DR7F 3MM5A 3NBPA 4F4ZA 2J0XA 2V0NA 3NOGA 1DHMA 5THWA 2VQFF 1I51B 1C1BA 3HFZB 3C66A 3VTIA 3MWBA 4WFAQ 2DRBA 1LW0A 4ELUA 2OEKA 3W2WB 2D9OA 2RRBA 3ZZZA 2BE2B 7FD1A 2YWEA 3GFYA 4NL5A 2AMCB 2HG4A 1HQ2A 4BLGA 5KFWA 3J80Y 4AL6A 4NRUA 4OX6A 1HBMB 4KRWA 1WEYA 5FLXY 2BE9B 6FDRA 2QTWA 3E3XA 4OZ1A 3SMZA 1ZA2B 2AU0A 3GG0A 1O5JA 3QGGA 1P8GA 2V2VA 2W01A 2MY8A 4MFBA 3SCLE 4GC7A 5GADU 2HHSA 2W8KA 1NBEB 3NMAA 2FC9A 3NGSA 2DIVA 5KFQA 2J76E 3KTQA 4KPYA 4P7TA 4QQBA 4MIAA 3ZZOA 1ZPVA 3PO4A 2FDNA 4XDDA 1YHQS 1JXLA 2GIQA 1VYAA 3NNAA 3F44A 3R7BB 1HYSB 2RUGA 5SUHA 1FJGF 1WF2A 4DXLA 4ELVA 4U7UD 4RNHA 1UKUA 1WG4A 3GZ7A 2U2FA 2BANA 2GJ2A 3MECA 3Q89A 4M5DB 4OYXA 2MB0B 1N52B 4X4TA 1TVRA 2WRMA 1CC7A 3Q8RB 1B4SA 2LXFA 2KHDA 1CS4A 1JLEA 3GG1A 3BN7A 3I96A 3T1YJ 2KT5A 2UUBJ 3SBMA 1B70B 2RNEA 1Y00A 2MQMA 4O4RA 3OFFA 4OIXA 5H1SV 3HFKA 4OZ0A 3KUEA 5CABA 1MROA 1H7WA 3WC0A 2MQLA 2DH7A 2PE8A 2PN6A 1PYSB 3FUYA 3GLJA 4NYPA 5I4MA 1GX5A 2GNKA 2WW8A 3N6LA 5DDQC 2ASJA 1VQYA 2GA7A 1FKOB 5I3UA 2QL5B 2YWHA 1EQ0A 1YJVA 1HQUB 2ZUGA 1WKJA 2VG6B 2R8HA 4RUHA 3GIJA 1Q53A 2KRRA 2MZ1A 3CCTA 3OUYA 3DLKA 3EWGA 1U2FA 1FA0A 2VG6A 5LL6d 3ZZYA 2E66A 2BZ2A 4CM0A 4JI7J 4HL9A 3AD8C 3H40A 3W3SA 2J8SA 2RUSA 2WB4A 4NYZA 1F6TA 3TZXA 2Z2YB 5DGAA 3LH2S 2M2BA 3MEEA 4ZPTR 2XI3A 4C6AA 1H2VZ 3D1QA 3DOKA 2V5HG 3GB0A 5CD4H 1T7PA 2ZNYA 1U1QA 4IR9A 4RNMA 1Q81T 2RF2B 4PKDB 1F2GA 1YITS 5IC4B 1UA1A 5HMYA 1FRIA 4PRFA 2CJBA 4MJKA 5HP1B 3C3LA 4KAIA 1KD1T 3OXLA 3D6HB 5JJBA 3CJ3A 5EX3A 4UUXA 5FJ4A 3V6JA 1ZAWA 3Q0AA 2G2YA 2XGPA 1IKXB 4LRDA 5CZVA 5KFEA 2ZD1A 1REVA 1WC4A 3NGKA 5KFGA 2AJQA 1RBAA 1H2TZ 2WOMB 3PYEA 2VV5A 1I94J 2Q79A 4QIGA 4ZLPA 1XMBA 3K5LA 3DGVA 2QMXA 2AKWB 4LF5J 4KFBB 1R8BA 3AB4B 2COLA 1FRKA 3WIUA 3VVTA 5H9EJ 2PEBA 4Q8FA 4RU2A 3UDCA 4B02A 2DGTA 2JEFA 2J6SA 2ZH5A 1N36F 2HFSA 1BGXT 5HN0A 4CO3A 1KDNA 2H5EA 1SIWB 2Z4PA 1PC4A 2HGNA 2GHVC 1TL3B 2DHSA 1RUSA 2JSXA 3DGPB 3NCRA 2IM2A 4KGVB 1NM2A 4WPAA 5H9FJ 3WX4A 3IAS9 1KHVA 3GYNA 3WBZA 2DITA 4YHHJ 1EARA 2HBRB 5ETVA 2W7PA 3THVA 2W4CA 2KDOA 3UN2A 5IFMA 4YP3A 2HBYB 2KXFA 4DLEA 4B3SF 3C46A 4MIBA 3PJ9A 1RYRA 4WFZA 3W66A 1SXLA 4H4MB 5HANA 1NKBA 4MKBA 3A13A 3T6BA 5J2PA 4DUZF 1WEXA 4OQJA 2D3ZA 3CDEA 5CH7B 1U47A 4KJIA 1QDUB 4U6PA 4EI2A 3EXYA 3CCJS 1SJ3P 3FQLA 2XBPA 4P9SA 1RTIA 2DRAA 3RTVA 2IDLA 4Q44A 3C6TA 2YPYA 1CJUB 3HLUA 4OZ3A 5FDLA 4GKJJ 2XLJA 2D69A 2AEJA 3BGUA 4X66F 2YKNA 2I9SA 4F4YA 4PG7A 4QU7A 2LP4A 1TUGB 4UQGA 4AD6A 1N0VC 3MR7A 3J81j 2ZWOA 3GU0A 1KLNA 4NEZA 1B7FA 3RU0A 3U1NA 3RR8A 4OI0A 4DN9A 1NK6A 2LCWA 5AXKA 4MMOA 1Q82T 1FD2A 2Z30B 3T1AA 3IRWP 1YBUA 4PQUB 2C3PA 2BJ7A 4QYZK 1PYOB 1U0SA 1RKIA 1KQSR 2DHHA 3A3PB 2DNOA 4QIFA 3PXGa 1S0VA 3J7YU 4WTYA 1YSJA 3BPSP 5CXTA 2BJDA 1YI2S 2MEWA 3LP0B 2CG8A 1M1GA 3PEHA 2XCAA 1R8HA 4YFUA 1O8BA 4PPZA 4I67A 1LWCB 2RHSB 2HQIA 5CYMA 4OI6A 2IJRA 1LEOA 3SSQA 1WEZA 3EE3A 1RT5A 2W4DA 4UF4A 3J7A1 3IA0A 5KFSA 1ACMB 3DI6B 3IS9A 5AE1A 1Z4UA 5K14B 1Y9OA 3G6XA 4DF8A 2Y1JA 2BQRA 3UD5A 4TNOA 2GMHA 2GIFA 1IBLF 2PI4A 1UW4A 4IFVA 4F2RA 2FIUA 3K17A 1KNZA 1RWVB 4QWBA 1S0MA 3PG9A 4CRJA 2PC6A 3J7YI 3G96A 1S6OA 2IFXA 2GO9A 3QAEA 2K8GA 3V2UC 2FVSA 2HSEB 2HWIA 4OX8A 1BLUA 4BS2A 3QRPA 4WFYA 4N76A 1F2HA 4UZCA 2IJNA 3EDQB 3HZEA 2CQHA 3KHRA 4DV6J 5SZTA 4G65A 2NXJA 2OELA 3LP1A 3RBXA 2KRBA 3KUHA 3PW0A 3C15B 2DH9A 1RT1B 1JJ4A 1RHMB 1RHJB 2B9XA 3BGOP 4MH8A 2XNQA 4OZ2A 3ET6A 5D0EA 1HARA 2DISA 1M5PC 4ZPAA 2CUYA 4C0HA 4I2PA 5DLFA 3CDBA 5A8KB 2RE1A 3BKTA 1D3WA 2ZOFA 4R5PB 3FMBA 2FUG9 4QWCA 1JQGA 4IH7A 4QYZJ 2MZQA 2Y9HA 5EWGA 2J9DE 3MTJA 2IM3A 3PW2A 1LKZA 3QRQA 4FF4A 2M70A 1WD6A 4LF2A 3AD7C 1CJKB 1YX2A 1XWLA 4OZJA 4TQSA 1ZPWX 3TUJC 3GILA 1TUVA 3QRRA 1PJ5A 2JFDA 5J2MB 4M94A 4PWDA 1IWAA 2XEXA 2DEIA 4CP5A 2GQ2A 4Q0BA 2DPJA 2ZH4A 2RQCA 3BH7B 2CPZA 3C6UA 4NLXA 2MHNA 4CO2A 4UOFA 2XMAA 5J2MA 2CNKB 1K73T 3R6LB 1RTDA 4DPYA 2WB1D 5KFYA 5GAGU 4W90B 4B17A 1RP5A 1N5VA 2XYHB 3I9ZA 4NEYA 1U0HB 1YJTA 2OPPB 4OI2A 2AYGA 4B3TF 2UVWA 1NK0A 4PXEA 2NZCA 2XMVA 5KG3A 1G6BA 1BXNA 2LU2A 1VRQC 3PW4A 4RW4A 1XERA 2QFJA 2LMIA 3QT5A 4NRTA 2FHMA 2BRKA 1DURA 4HR2A 4RUAA 1BQNB 1H73A 2E7VA 3PX4A 2V2KA 1SKRA 2AD9A 1LW0B 1FE4A 1RT1A 1RWUA 5LJ5Y 2EFNA 2JLFA 2P9GA 4LRFA 1VK3A 4MKVA 4F0KA 1Q8IA 4HH0A 1NPRA 1VLYA 1KTVA 3GIKA 3NS5A 2W4PA 1UZDA 4PG4A 5KFIA 3BO2A 1HQEA 1GT8A 1KQGB 2DR6A 4CH7A 3K59A 4UY85 1HR0F 4N5SA 2RU3A 5U47A 4K4UA 1ZOTA 2JC1A 3T5KA 1WTFA 3ITHA 1X7VA 1P1TA 2ACMA 3OLAA 3KK3A 3I82A 1RWMB 2WONA 5F8IA 3CMQA 4DI6A 1IBMF 2IBKA 2HPUA 2AZ3A 4URSA 1FWKA 4DZDA 3RAQA 2DEJA 2CQGA 3A3NB 3BYRA 4OZ5A 2FY8A 4WZQA 1CJVA 2XYPB 4AL7A 4ED3A 4CYUB 3KLGB 4B3OB 5A6WA 3TEHB 4AFFA 1T05B 1JB0C 1SH0A 2HRTA 3ENVA 2WSFC 3M2UB 4RJVA 3Q8YA 1DBDA 2ZDPA 2VONA 2HVZA 2HHWA 1RT3B 3NEKA 2Y1RI 3LF0A 1WI8A 3I5AA 3CO9A 3IBFB 4KC5A 4ECTA 1U45A 2RDIA 1S79A 4BBYA 3KMQA 2N82B 2I2YA 3QATA 1VISA 3CCZA 1S1TB 1PILA 2CJ9A 5C7PA 4ILRA 5T14A 2D1CA 1NCLA 2RAQA 3TRGA 1X60A 1X9SA 1FRJA 2DXEA 4EBCA 3DM2B 1T9XA 4JV5F 4A8WA 4BHQA 5IWAF 2V8VA 1JK9B 2O01C 3FFIA 2VG7B 2ZBIA 5AJ3J 1NK9A 2W2OP 3BN4A 5ETOA 5KFRA 3V6HA 4USWA 1H3DA 1REGX 1SV5B 2I5JA 4WIQA 4F36A 3VAKA 2E1MC 3PRVA 1BQNA 3R7NB 1X5SA 4F7VA 1X5OA 2XWYA 3OTOJ 1UL3A 4B9SA 2KFNA 4I7FA 4O23A 5ITHA 1LW2A 5KFCA 2DR9A 4WJBA 3EMTA 2MZSA 3VWSA 1C0TB 4FYXB 4A8XA 1XNQF 4K2XA 1FT8A 1SBRA 3HSJA 3OL9A 4C9DA 4RU9A 3Q8QB 4DSEA 2HHHF 4TVAB 1H0HB 4CO0A 3KDNA 3NGTA 3D68A 3EPGA 3FEXB 2RJZA 4KH0B 4RO0A 2YKPA 4FXWA 3U27A 4HT5A 1WOSA 4P2FA 4EO8A 2N7YA 3TVZA 3H2UB 2N3OA 3O5TB 3TANA 4G1PA 2BE7D 4RNNA 4R8UB 1TKXB 4JI6J 2P6SA 2V50A 3MMJA 5DJBA 2HVHA 5E33A 3M8YA 4A46A 1F9HA 1V9OA 4QWAA 2CG4A 1F9EB 1NSKL 2CPYA 4H4KA 4DU7A 1C4AA 1R8AA 1SJQA 2LYVA 3MMBB 1U25A 3OR1A 1O0PA 2VBZA 4RW8B 4Q8EA 1OYDA 1ZYQA 1QJHA 1NKEA 2GGPB 1LXJA 2V2QA 3DDIA 3E01A 3SDEB 4WP8A 2KT2A 1VRUB 1JLBB 4OZNA 5EUHA 4M5LA 4TQRA 1PSDA 2HFUA 4YB5A 3TAQA 1S10A 1VQ5S 1U1OA 2DNQA 1PYTA 4RLEA 3O6QA 4A8SA 1XMQF 2YXLA 2FHJA 3GQCA 1RQ0A 2QGFB 3W64A 5KFBA 1FDBA 2M0GB 3R8YA 1K47A 1EIYB 1Y5NB 3G8SA 2VOOA 2HWHA 5EX0A 3GFHA 3H4DA 3H90A 4K4ZA 2AV5A 3M9OB 3GONA 4ZPDA 4ZKAA 3VAFA 4LRAA 2AEMA 2JHEA 2L9WA 4CLYA 3TUZC 1F3FA 2PA8D 3HD1A 1M5HA 2RDDA 3LANA 5CA5A 1M5VC 4ZVEA 1FKPB 1HI0P 1GTHA 2OO4A 3CO0P 4IG3B 4OYIA 2JC0A 4FPIA 2KFZA 1J5OA 2DBBA 4K5SA 5D6GA 1NSPA 3N9UC 2E5LF 2OHDA 5C24B 4C0OC 3F56A 3HHEA 5EGYA 1YJ9S 4AXIA 4P2XA 2GGPA 1U6FA 3G9CA 3NKYA 3FJ2A 2QYGA 2A0FB 4WFXA 5KG7A 4F02A 1WNEA 4JI4J 4ZPWR 4XAKA 3TX8A 4B3MF 3KKFA 3F73A 1HNZJ 2FGOA 2HAFA 3DCAA 2I1RA 1E6VB 1U0HA 2D41A 1NAQA 2GHPA 1YRUA 2OPPA 3KG0A 5M2PA 5H9EK 2E9TA 2HFNA 1JLGB 2JL9A 3MMCB 3BDEA 3AH6A 1WDTA 2C3UA 4OHWA 3DDNA 4R8UA 5C42A 3KJVB 2R7UA 2JRSA 4OHVA 3OVSA 4D3HA 2LA6A 4J9PA 2BUNA 1JNRB 5F9LA 3CC2S 1HR0J 3AY0A 1KS2A 4LJMA 2HNDB 1I1GA 5GAHU 5IOLA 1Z2LA 2ZEJA 3DRSA 4IUFA 4LF8F 3D1OA 1VI7A 2GHWA 1D0EA 5B08A 1WSRA 1OY6A 2GC8A 1TV6B 4LF6F 1C0TA 3AJ1A 2IMWP 4JI5F 2EFOA 2WBMA 2OPRA 4X62J 5IM0A 3D54A 4ECRA 4Y00A 2X3GA 5J2PB 4GO7X 3T3FA 1VQNS 1H72C 2NYIA 4L6V3 2DRDA 4LR9A 1RBLA 1UPMB 3FCVA 3AA9A 4AQYJ 1RLDA 4PQAA 1HNVA 2GCFA 2H51B 5BR8J 1IBCB 2KYZA 1MWZA 1GMVA 1RAFB 4LSLA 3DLLQ 1GK8A 2CPIA 1Z1ZA 1CULA 1HD0A 3D6TB 2XY6A 4V19J 2IY5B 2ALYB 4YB7A 3PNIA 1U1KA 4HKQA 2RSQA 1S1XB 2YKOA 1VIOA 1RT7B 2J0WA 4KB7A 4LT6A 4DR3F 4DSJA 3DHWC 1HPZB 5T41A 2QL9B 3MM5B 4ZVHA 2O3DA 1C2PA 5FLXU 1VQSA 1WI6A 1N5TA 4LQ3A 4UT4A 3CJSA 2IYIA 4FZVA 1N36J 2F40A 3DNCA 1AB8A 3BR9A 3MUTP 1RTJA 3AB2B 2MSTA 2ZNZA 1KONA 3AOAA 5CAAA 2EK1A 4IKAA 4Q7AA 3FBBA 4U95A 2FVPA 3L4BC 2EG2A 2WBRA 1UVKA 3NS6A 1Q8BA 4KBIA 4F2SA 4U7UK 4C11A 4F3MA 5DG8A 5E3PA 4HDHA 5EHHA 3GV7B 3HSDA 3H4BA 2YPZA 2J6UA 1SH3A 4TLQA 5IV3A 3H5YA 2VFSA 5F9NA 5AXMA 1HHQA 5HP1A 2XYGB 1ZZNA 1HHSA 1KR4A 2BMBA 1KHWA 1HPZA 1RA6A 1KVKA 2I38A 2YVSA 1VIXA 3B78A 1L5UA 2HRYA 2XQCA 2AQ4A 5F8MA 4ED1A 1QAJA 4ED0A 1B0PA 1YBTA 5FIIA 1JLQB 2J7UA 3HULA 3LGHA 4I1TA 4QWEA 1VQ9S 3BSAA 4KGXB 1U2RA 2FHOB 4NLWA 4U96A 3J81U 1KFSA 4UOGA 2YKQA 1T9WA 4NMXA 3PJXA 4PWUA 4DUTA 3BSOA 4USUA 2E9RX 4LF8J 4P6QA 1LFPA 2E1PA 1U1LA 1S6PB 4QU6A 1NHUA 3VAGA 2UVVA 2OEMA 5E41A 4DR3J 1T95A 3I31A 1DTQB 3L3CA 5KFAA 3KK1A 3VALA 3DFEA 5C5JA 3Q8PB 4DX8H 4WKRA 3MAQA 4C3LA 1OYEA 2J9DA 4ENOA 4EYIB 2VD3A 1HMVA 2AGPA 2OPSB 3VAHA 3JSMB 1U2CA 2CZ4A 1NSAA 2HYIB 2LEBA 5CQGA 1SC1B 2WZ1A 1RHRB 4A8MP 2ZVIA 1NK7A 2CWKA 2ILZA 2QV6A 3FEYB 3GIRA 3MFHA 4IR1A 2GW8A 1TMJA 1UFKA 5I3PA 3SCKE 2HNYA 2IMOA 2DCLA 1JXEA 3CDUA 4ZCKA 5A76A 4IQXA 4M8LA 5LJ3Y 2ZH3A 1WG5A 4IOCQ 4FBUA 1BMQB 2L48A 2MZJA 4NXNJ 4NLDA 1HBUB 4ZA1A 2VKZG 4U67Q 2CVIA 5LM7E 2AJFE 4KY3A 1PJ7A 3N6MA 1SC4B 3NAHA 2XMTA 3IGNA 1XIQA 2R4FA 3MF5A 5B0GA 1KOHA 4DL2A 1SI9A 4EK2A 5I42B 3M30A 3LGNA 5KFKA 2HQDA 4FN5A 4LR8A 5LOQA 3JYTB 4B3OA 4G1QA 2MDAA 5M2UA 2I8EA 3MOZA 5D4LA 4F26A 2CPDA 4C4WA 2DGQA 4WP9A 3M6VA 2C3MA 3GFXA 4S0MA 2MMYA 1L3VA 1SQFA 3G8QA 3OJSA 1NJXA 3MR2A 1VMBA 2FJWA 5JMNA 5CYQA 1EJ7L 2ASYA 3IC1A 3OT9A 4GMKA 3VQTA 4ZHRB 5L1KA 1VQ7S 4C98A 1J2VA 3D66A 1X9MA 1TKXA 2HBQB 2NXNA 1AROP 1FRMA 1H38A 3W63A 1WELA 4ED2A 3H20A 4CLSA 1UEKA 5HAOA 1VRTB 3AFGA 3E8OA 1EKRA 3AODA 3FSYA 4TYBA 2A6MA 5HVFA 4DPOA 1MNEA 2XMJA 3L7UA 2FY1A 3T5LA 4MTPA 3HM9A 1VQ6S 3EGZA 4F0MA 1IUJA 2W2QP 2X1GA 1RACB 2AP6A 4URGA 3H25A 3NNHA 2X51A 3M8ZA 3IBWA 2LEPA 3WDOA 1HI8A 3EGNA 2B5JA 2CRLA 1NZAA 3DRYA 3M32A 1LW2B 3N5FA 3WIVA 2ZH9A 1VC5A 4NZ0A 3ZNUA 5F8GA 1D9FA 1DTTA 2MYFA 3IGVA 1TMMA 4BWJA 3A8IA 5A8RB 2AT1B 5A0YB 4I2QB 1DLOB 5B09A 2VC1A 4ED6A 2MKIA 2BM1A 3BB5A 4HVZA 4Z37A 1SJ4P 4ZVFA 4PXDA 1M0SA 3TUIC 3I0SB 2IIHA 3D6FB 4HACB 4PYAA 3K5PA 2IA0A 2PIIA 4F50A 3Q8VA 2JZ5A 5JUMA 4DJBA 4M5KA 1QD1A 3BKFA 3IP0A 2MQNA 4YR2A 4DQIA 4MAKA 1G2EA 2M8DB 1GX6A 2OAUA 3V81A 4HLBA 3UFCX 1TL1B 5D78A 3MR5A 4QJVA 4C3MA 3KHGA 3GR1A 1U48A 2OP5A 2Q43A 2WVEA 3D0HE 3CCLS 4USIA 4P72A 4M5HA 3V4IB 1RYSA 1FWPA 3GCXP 4X4RA 4B9TA 2ZJRQ 1KOOA 3TW0A 4G6VB 3NRBA 3NMRA 4OYOA 1GH8A 2VH7A 3KLGA 1X4GA 2BM0A 2HLUA 3ZTRA 4X65F 3QJPA 3BQ1A 1R3NA 2QA4S 3PYDA 1FHTA 4L75A 2G1DA 3ZC4A 5HQLA 5KT3A 5IT4A 2DXFA 1CQMA 2R2SA 2FZGB 2CPHA 1OWXA 4DQPA 3LW5C 4JB8B 4WKYA 3ZNJ1 3PR4A 1UFWA 4B9VA 3QJJA 5GAEI 4OHYA 3M8RA 4ECVA 1CPZA 2MTLA 2Y3YA 3LOUA 4TU8A 4CO5A 3CB4A 4ZVOB 2GMJA 2DNGA 1SKUB 1N5QA 2W2MP 4K4YA 1AYEA 3WC2A 4PUOB 2VFRA 4NA1A 2OH2A 4IYQA 1V3ZA 4HHJA 3TOQA 4CQ1A 3K5MA 3R2CJ 1UZHA 3TA0A 3H98A 3MM8A 3CIZA 2BV3A 1KLMB 2DTJA 5CHCB 3FQKA 2AJ0A 4USMA 3CD5A 1Y3JA 4DUZJ 3VGUA 3VQSA 2NLWA 3HT3A 2M52A 2A2CA 2NYHA 5HLFA 2UVRA 2KTQA 3IR5B 1S1TA 4FVMA 2G9OA 4OJGA 4GVBB 4B9LA 4ICLA 5DG9A 1CJTB 2C3OA 2AW0A 4BCAA 3JTNA 1HFEL 4CT8A 1JXVA 3BJYA 3JQJA 4DQRA 2E7XA 4OV1A 3KG1A 4X66J 1R43A 2V8PA 4FBTA 4NXNF 1S48A 2GQCA 2Q3PA 3KWMA 2B9WA 3OR1B 4JP8A 4L72B 2QYCA 1RWPB 2AWZA 2FJAB 3M05A 4NCGA 3SIPB 1GMWA 5E3AA 3U7JA 3PW7A 2QEXS 2RQKA 2OFGX 2AJ2A 3TX0A 3GV5B 2DNHA 4LSNA 2YTCA 4N47A 3RBDA 4C8KA 1SVDA 1ULRA 5JVHQ 5DZ6A 2YKMA 3OL7A 1IWGA 2DNPA 3UVJB 2Y1LB 1FCAA 3OFGA 3NOCA 1HWJA 3A12A 3PFOA 1NHKL 2KVIA 3A1YG 4TY8B 1WHYA 2DGWA 3UR3C 2R2UA 2VPZB 1BQMA 3RB0A 3PVXA 1UVNA 3CULA 3DOMA 4CWBA 3QGIA 1S9EB 2JX2A 3MD1A 4JI2J 3LPEA 3KLFA 2JVOA 4YY3F 1J5EF 4P74A 4NLQA 4U8VA 1FVQA 1PBUA 1RJJA 1SJ1A 2C2KB 5CZXA 5M2RA 4YR3A 2Z2MA 4PEOA 5HROA 1YG0A 2J0SD 3K7RA 4FYYB 4RNFA 5KFMA 5KT6A 1WORA 1X4FA 4ED4A 5MAOA 3GPAA 3H5SA 1RHKB 2RHQB 1WC5A 4I7FB 1S77D 3OSNA 1WHVA 1Q5VA 2C2ZB 3HKZD 2IVFB 3SXLA 1IM4A 1NH8A 1NK5A 2ZE2B 2XMWA 4A8YA 5ETRA 4NWBA 5G0RB 1PIEA 3DRRA 4K4VA 3AOCA 1IBKF 3PIPQ 2CPFA 2QJ3A 1LWEA 2OD6A 3BSCA 3U1LA 1EX8A 4ZP7A 3LAKA 2YNGB 2R8KA 2FZKB 4Y65A 4PR6A 4I64A 4UZBA 2J5AA 2BDPA 3Q2SC 4DL3A 3P49B 1SC3B 2G0JA 2VC0A 4UW2A 4NZ6A 4ZK7M 3C2PA 1FJEB 1XN9A 2YKMB 1VGYA 3PM9A 1MLAA 3FRYA 3QGHA 2ABYA 4Y2KA 1TKZB 2H5JB 2PA3A 5A8WB 5JVGQ 2DNYA 4DV6F 3LWMA 1NMEB 3HP6A 1S9FA 4ITSA 3RJMB 1GEHA 2YWGA 1WOPA 3KJFB 2EFGA 5B0FA 2ZJQQ 3CJ5A 3NP5A 3Q83A 3DI6A 4UQTA 1FDNA 5KFTA 2RILA 3C8YA 2MLZA 2UP1A 3DRXA 5L8RC 3ETMA 2VZ9A 2ZHOA 3NLCA 3OSPA 4DR2F 2R8GA 2ZUAA 2G4BA 3TJ8A 3D67A 4NLPA 2IM1A 4URQU 4CDIA 4F3QA 3AOBA 1F60B 1WOOA 2VG5A 4N8NA 3ULHA 4F4XA 2R42A 1GMUA 4C11B 3KHHA 1YVFA 5HI7A 2LEAA 1WDDA 1URNA 1FVSA 2NZ4A 2Q1LA 1VBYA 1T03A 1N6QA 1VS3A 2UUBF 2VJUA 3R1HA 3AXMA 3SCIE 4E0DA 1TAUA 3HHNB 1NPKA 2GO8A 4DQSA 2D74B 3QIPA 4XIUA 4P52A 4P75A 1EP4B 3MM7B 2UXBJ 2F9DA 1U8SA 3B82A 3SSRA 3NBPB 4DV0J 1BD6A 2CPJA 2YX1A 1N5YB 2UUCF 3DLGA 4IFYA 1JLCA 3DHXA 4WXWA 2FLPA 3FBEA 3BF4A 5BR8F 2RF2A 4OYZA 7AT1B 2XHWA 2V2ZA 1IKVA 1F5AA 3DM2A 3V6DB 4B3RJ 2LQ9A 5B0AA 4JI7F 4X64J 2LFVA 3OHAA 2DO0A 4DPTA 3QYYA 4FS1A 3R97A 1Y10A 2HAIA 1TL3A 2NXUA 1DQ8A 2PDAA 1JLAB 5K14A 4AL5A 5A2QU 4P2SA 3EYZA 3CD6S 3LWLA 4DUYJ 5L38A 3UCUP 4AQYF 5E7OB 4O3PA 4LF4F 5CYMB 4ED7A 1MMLA 8ATCB 2ZHBA 4ZJLA 1YJWS 3HJFA 4NXMF 2C2MB 3G86A 2R2RA 3AQPA 4MK8A 2XMKA 4LFBF 2WONB 3EXCX 5GVQA 1IBLJ 2DNLA 4F3OA 1S97A 2EC0A 2QMWA 5KOWA 1TP7A 4U7CA 3HXMA 1QE1A 3SQOP 3M2RA 3OR2B 4F67A 1IKXA 4DQQA 2JWNA 2ZBPA 3DRSB 3CJTA 1VJQA 4MT1A 3QT7A 1G3OA 3QFHA 4NOHA 3FK4A 4D3GA 3GJTB 4YOEA 2KKHA 2HQGA 2WCXA 3D6MB 1W2BR 4KHRA 4DG1B 4Q45A 1DFDA 2N3LA 1HBNA 4CH0S 3OXGA 3RZAA 2F8MA 2J8AA 3GCWP 1H7XA 1TELA 2KL8A 4IOAQ 4ZMMA 3KJVA 1S0OA 3M6WA 3WX8A 1S7HA 3DKDA 3CMES 1F9FA 4NLRA 3W7BA 2ZM6F 1U1RA 5B7WA 3C6TB 4I6YA 2BKOA 3WHIA 2W2PP 4PG5A 4ED8A 2LDIA 1S6PA 2NCKL 2E29A 1YRTA 2FJXA 3DOLB 5AE3A 1N48A 1RAEB 3D3BJ 4B3RF 5CYJA 3ZXWA 3POTA 2ZFHA 1HQUA 1KVJA 2V34A 2DHAA 5AJ3F 4WYWA 3HMJG 2HQCA 1SV5A 2B7CB 3MEGB 2DVIA 4YB6A 3BSNA 1HLWA 4B3SJ 5MLCV 1R8CA 3C6UB 3NCPA 2CNLB 1B99A 2F4VF 1ZAVA 2MHEA 4ZHRA 2DGSA 1RABB 3BV8A 3N0VA 1FD8A 2NSBA 3D1HA 1Q4RA 2JFKA 3MEEB 2BKPA 1WHXA 2MKKA 1HIYA 1XNQJ 2XLKA 3IS9B 1PGZA 2KZZA 1CJKA 4QR0A 2QN6B 4LQ9A 1ZAXA 2H65B 5K5MA 4QBUA 5IT0A 3EICA 3K8WA 4CLLA 4RUCA 3AQOA 3TWZA 3W61A 2HS4A 4J9RA 1MWQA 1VHIA 3TEGA 3MCOA 4MKYA 3GWCA 5A6PA 2YWKA 1ZM3A 5A8KA 1T03B 2E5GA 1N6QB 4KT0C 1R0CB 2LQ5A 2CJQA 5AXNA 2MXYA 4DR4F 3H2VE 1ITPA 3BR8A 4NLVA 4RR5A 5LMUJ 4WU3A 2D3OR 3MD3A 3UW1A 1NRKA 3W8GA 3DLHA 4ID5A 3QT6A 2Y0SD 1VCTA 4B08A 5KFPA 4Z7YA 4DR6J 2QA1A 1LQ9A 1KWMA 1SJRA 2FYXA 5K8NA 2XC9A 2KH9A 4N41A 4USTA 2CIMA 5GMDA 2HNYB 2IPOB 1MW7A 3G2XA 3UNGC 3DRRB 2JLGA 1HMVB 3CCQS 2UXCJ 4DSIA 5KFUA 3W8PA 1XQIA 3R27A 2N4DA 3QQCD 3T5HA 1JIHA 3LQVA 1FK9A 4ZP9A 4J9OA 2ZWPA 4DV7F 1B3TA 1Q7YT 2UUTA 4OYMA 1IQZA 4ZS6A 1RT2A 2X1FA 1U1NA 3GSDA 1H6KX 5F8HA 1V3SA 1IJEB 1OQ3A 1TAQA 2HVIA 4EYHB 3H5UA 3HHLC 1FXRA 2IVMA 3AD9C 3DOLA 4OYPA 4CNZA 1LWCA 3QWUA 4J90A 5DM6Q 1NZ8A 3TAPA 2HHUA 1HBMA 2AEFA 2KFYA 2VODA 1S57A 3I55S 1FK9B 2FHJD 4Y3CA 4B3MJ 4Q43A 1HWIA 1RTDB 2BABA 1RAIB 2UUCJ 4DFKA 4ZDNA 3QIDA 3QGPA 3DLJA 4C8NA 2BJ8A 3MR3A 1P9QC 3BGRB 1XR7A 4NYOA 4NX9A 3G6ES 3T5JA 2QFIA 5G4DA 3AJDA 3FCWA 3PEJA 1EETA 2U1AA 5A8RA 1DY3A 2HLTA 2MKCA 4DCJB 4J9KA 1N54B 3MEDB 1VOMA 2RS8A 3AXKA 3O3LA 5D15A 2YH0A 3CCMS 3R5AA 4M5GA 3OTCA 4RL1A 4PPDA 3MMAA 2RD5C 3IRXB 1AXQA 2B5JB 3P45B 3UDEA 3UR0A 3K58A 2BVZA 3PDNA 4P73A 4TLRA 3BKUA 4PCQA 4O3SA 3JSBA 1SUQA 1X31C 3K8VA 1QUPA 2NXCA 4CNYA 4DF4A 1J5EJ 2VIHA 4X62F 1REVB 2FJVA 3NS7B 1QM9A 3ILOA 4PQUA 1FDAA 1NU4A 1RTJB 2HIQA 4J9QA 1MWYA 1FRLA 3OBIA 2R7XA 5IS2A 3P3DA 2R7SA 3O2IA 3QSYB 4LF9F 3PACA 4YDXA 4GO5X 2BE2A 1BY9A 2KVQE 3PKMA 1RAGB 5CYQB 3QAUA 3TYTA 4GKKF 1X9WA 2MLYA 3IMQJ 4DPXA 1UWBB 2R7WA 4JOUA 2W1BA 1HNVB 2XI2A 2YWFA 4F04B 1C1BB 2B4PA 1WC0A 1EHWA 4KQZA 4ZJOA 3G6YA 2UU9F 1RTIB 2NR0A 5F41A 4TY9A 4LR7A 1M5KC 1RKJA 2LDYA 4RW7B 4K50A 1S6QA 1T8EA 3L95X 5KFLA 2HHPA 3V4IA 1M1HA 1NDKA 4KGKA 4NA3A 4OI3A 1FKOA 4C7QA 3I87A 8AT1B 3CJ8A 1F5CA 2ZM6J 4A8QA 2UXDF 1OY9A 2QC3A 1AUSL 4OYBA 1HNIA 2KG0A 5GAGI 3P96A 2ATLA 4A47A 5KG2A 3IRXA 4WP3A 1S7IA 3DYAA 2HEKA 4QCLA 3OLBA 1OO0B 4GVLA 4DS4A 1WC6A 1FX2A 1I94F 4BDPA 2ZBQA 2IVYA 1QTMA 2LECA 2BW7A 4FKYA 3UWTA 1N32F 1YK9A 4P10A 5E3RA 1IBMJ 3RR7A 1FTCA 4ZLNA 1NXIA 2V4RA 2BANB 3MECB 4OYAA 4KKOB 4O3QA 3UVJA 3W9HA 1U49A 4LBIA 2NPFA 2FLNA 4HACA 9RUBA 3OW2R 4E8UA 2Y1IA 2XZWA 4AE5A 2WAQD 4ZIVA 4J9MA 3VV2B 4C0BA 1N4LA 2LXIA 3LO3A 2K3IA 1IM6A 2MPUA 1YKWA 1RCXB 4M5JA 4QIEA 3Q8SB 4YMEA 1HWUA 3TZZA 3HK2A 1AA1B 4DX7A 3TZWA 4FXDA 1OIAA 5RUBA 2AX1A 1LWFA 1S1UB 2C2OB 3KUGA 2FLLA 2VF3A 1Q8KA 2DXDA 2GS8A 1PBAA 3N5BA 5F3TA 5C25A 4CO4A 1VQKS 2BJEA 4NLUA 5DO2A 1SIZA 4RW9B 2JEIA 3GP9A 1N34J 3VHQA 2GFFA 5ETKA 3EZUA 3OL8A 2RS2A 2XCPA 1FERA 4J5OA 3R5DA 4PG6A 1AZSA 1S9EA 4ECSA 1KVIA 1NDLA 1NDPA 1VLOA 2XHCA 3UQSA 3JYTA 5DDPC 1SKWA 3CNQP 4K5RA 3PZPA 2H54B 4HI2A 1QAXA 4B9MA 2YNHB 3PY8A 4UTGA 3EZOA 1HW8A 1CVJA 3EGWB 2FPHX 2HK2A 5T7LB 1WKLA 2E1AA 2BOAA 5DDRC 2RB7A 4UOCA 1UVJA 1S12A 1AW0A 1D1UA 1NHVA 1NH7A 4Y28C 1CJVB 3KFWX 1B64A 5J2NB 1NLKL 4NLSA 1VC0A 4FF3A 4EEYA 4ZVSB 4ANEA 4EBEA 3KK3B 1EAYC 3HHLD 4FXVA 1N5SA 3I32A 2XO7A 2CQ3A 1S4FA 2GZOA 2C2NA 3I4HX 4LIWA 2VQEF 2C28A 2FVQA 1FESA 2IHR1 4ZIWA 2IAJB 3W5YA 4OMFG 3E2EA 4K4TA 3K5NA 3MM8B 1WSVA 1UW9A 1T3NA 4L76A 4QOTA 3LGMA 3RAMA 1LFWA 2YNGA 4PXBA 3M2VA 4HEA9 4QYRA 1U02A 4L3NA 3MAAA 2R3VA 3PIOQ 4K4SA 3SSSA 4IH6A 3PHEA 2B6AA 4NI2A 1QY7A 4Y6IA 1RTZA 5G0RA 2JH3A 4DV4F 2V4JB 3M8PA 4ECUA 1J27A 2XB2D 1GXTA 3R5GA 3HVAA 3NXZA 4L3KA 1Y7PA 3UPFA 1X5PA 1NK8A 3D4JA 3IBCB 1P6TA 2G0CA 2OD4A 2Y8YA 3RB3A 1SPBP 4CLUA 3ZTPA 2CVEA 4RPFA 2QG9B 2BYCA 4TU7A 1R0AA 1IKYB 4OYWA 1RCOB 1QSYA 2VASA 2UZAA 4P2MA 1B0TA 3H8YA 4NI2B 2RKIA 1Q1KA 3EVWA 4Y34A 1ZM4A 3GR0A 3KLIB 4KO0B 4O4GA 3LP2B 4YB1P 1TL5A 4RBUA 2ZH7A 2YNFA 3UCZP 5J1EA 1JLCB 2KJVA 2KJWA 1JLQA 3OHBA 1MU2B 2HHXA 2ZBCA 4PYDA 5KT7A 5LMUF 2NQPA 2OJ3A 2EVZA 3DMJB 2BW2A 2KXHA 2N7CA 3NGUA 2H5IB 4JYAJ 2GVDA 1KQKA 3J7ZT 5K9FA 4ZVRB 3BQ2A 1HNZF 2CQIA 2ZH1A 1OQ6A 3SFGA 2VG5B 2VA2A 4DPWA 1RU1A 2KM8C 2BQUA 5D4PA 2AYMA 3HVTA 4OX9F 2V4QA 3VGVA 1S72S 3FSIA 4ILMA 3UO0A 4RUBA 3ENQA 2RMLA 1D09B 1WWHA 4YN3B 3DC2A 2FLOA 5GADI 3H59A 3OV7A 1X4DA 4KE5A 1RT7A 3IR6B 3RRKA 3TVKA 3UCGA 1TKTB 2YWWA 1HBUA 2M4MA 5KFHA 1P1LA 1XR5A 4EZ9A 1MU2A 3TZYA 3OD2A 1AUDA 4B3TJ 4C8OA 5H9FK 4LBHA 3TA2A 4O0NA 2IJFA 1R0BG 4DS5A 3BBCA 1AZSB 3H5XA 2RIJA 2W24A 5DETA 2V67A 3KLHA 3ENAA 4ED5A 1C1CB 3GYGA 2CJAA 4GKKJ 2HS3A 2DK2A 2A2DA 4WFNQ 2JEGA 4ECXA 1FX4A 3H0PA 3K5OA 5LXRA 2CAJA 3K0JA 5CCLA 4ZVTB 5B0EA 5LSRA 4OLOA 4X4PA 2XM3A 1BQXA 3ETOA 2ZOMA 2OPRB 3KNAA 1UAWA 1DJ0A 2QO3A 1OPZA 3T1HF 1GXLA 2C42A 3D9BA 3S7RA 3S8SA 3HPOA 3KLEB 2GIRA 4OZLA 5GAHI 1RGVA 1D9AA 5HSPA 2BKNA 1S99A 4MIWA 1KBRA 2BBEA 4C8MA 1TL4A 2DB1A 5IM0B 2KXNB 3VAJA 4X4QA 1Q5YA 1V3RA 2M3DA 4JV2A 1S76D 1QTNB 2IRXA 4GRSA 2ATCB 1TFWA 4N7TA 4CO1A 4N77A 1ZS6A 2GAHC 4NZ7A 5ETQA 3HHDA 1WC1A 2YNIB 1R6YA 2F4VJ 4PWDB 4W92B 2BA9A 4FVCA 3JAMY 3R6GB 4LRCA 4IDKB 4JI0J 4J9SA 3CEDA 3I0SA 1FXLA 4CZCA 2DNKA 4K7QA 1RTHA 5HJXA 1PG5B 1Q8LA 4ZN3A 2YQ1A 4ECQA 3JXOA 4IDKA 1LV5A 1ICEB 1Y3KA 3M9NB 2OEJA 1X4HA 2VOPA 3DLEA 1TVRB 2CA9A 1XMOF 2LQBA 2YNIA 1TR0A 1IVZA 3KDOA 1RAOA 2EC2A 3JSMA 4DLGA 1ZM2A 1NJIT 5IXUA 1OSCA 4R5PA 2BJ3A 2CZVC 2Z0GA 2LXUA 3M8WA 3KK1B 8RUCA 2RT3A 1F0XA 4DPUA 2LU1A 5HROB 2IRUA 1W26A 4ZP6A 3PX0A 4KSEB 3KLEA 1LK7A 2F8HA 3P5BP 4HHHA 4J91A 1ZETA 1U4BA 4BC9A 4YS2A 1VRTA 4ECWA 4QR1A 3KOAA 1VHFA 2HK3A 5I3QA 3JQKA 1XR6A 3EGVA 2F3JA 3HVRA 2GJFA 3ZTSA 2J0QD 2KHCA 1S1UA 2PFFB 4ECZA 4Y2AA 3W2WA 4X65J 4Y2MA 3B8HA 3GFZA 4F4WA 4X4VA 2XG8A 4L74A 4KH1B 4U9RA 3DRPB 3JTPA 4LVNP 2H9ZA 3ZZTA 2E1CA 1JLFA 2DHXA 4LREA 3AJ2A 4ID5B 2IDEA 4LFCF 1R7IA 3M2UA 4WZMA 1HD1A 4MYUA 4I68A 1UETA 3W5ZA 2WVDA 3W2VB 3CXCR 4ZLJA 1OSDA 4KGZB 3F41A 2VA3A 1RT5B 5D0HA 3OTDA 3ZZUA 2PT0A 2QLJB 3WQPA 1D9DA 2BR0A 3DDKA 1KP6A 4HDGA 1WG1A 3TAMB 3ITHB 5DM7Q 5L1LA 3G6VA 2RVJA 3DXBA 3EX7B 2LLZA 1U8WA 1NEEA 3MFIA 4L73A 2V68A 2MQ8A 2SXLA 3CJ2A 2NREA 4OX9J 5AXLA 1CLFA 2XGQA 1T11A 4P71A 4OHZA 5KG4A 3UDLA 3JB9k 2J9EA 4XO0A 3D2WA 3VCDA 2QLXA 2OPQA 3IAM9 3ZTQA 4C2MA 1RT6B 1KFDA 2HBZB 2JDJA 2XLIA 2RU9A 1A6LA 1RZMA 1B7YB 1EB0A 4LF7J 3Q2TC 1LWXA 2AIRB 5F0WA 2HRUA 2OPSA 1K1QA 5DQHA 2G2OA 4XDCA 4FPRA 4DR7J 1U7LA 1VJWA 3G82B 3Q23A 3N4WA 1LWFB 1RT4A 2CQDA 2GVZA 4IQMA 4O3OA 4CLFA 2MQOA 3BDPA 5KT5A 2GMLA 4FP9A 4EFAC 4RW7A 1UVMA 4RKUC 4MKAA 2HMIB 4EWTA 1G7CB 5DRKA 5JXSA 4HT7A 1U6BA 1W7WA 2EFVA 5KFOA 2HMIA 3I4PA 3N01A 4H4MA 1BE4A 3QO9A 2RH3A 1BWVA 1TL7A 1S1VA 2ROPA 3M6UA 3MCSA 3T1HJ 1RT4B 3OFHA 2FQQB 2P8IA 1A0OB 4DEZA 1MROB 1NO8A 4CLKA 3CGIA 2E5LJ 1RWXB 3KHLA 3T6JA 5DDOC 3GIMA 3RRGA 3QFWA 2N4CA 2B6AB 3HKWA 5HO4A 2WTFA 3ELHA 4J7CA 2MQQA 3QLHB 2V94A 3PR5B 2MZRA 2VDHA 3CD0A 1FJGJ 3FDSA 3P6YC 4HI1A 3BGFA 4CH1A 3PRBA 3RYLA 2F8EX 4QIVA 3ZO7A 2VQEJ 4NCBA 4M5IA 1DQAA 2QRRA 4WE1A 1TTHB 4DV2F 2AZ1A 1QVFR 2ZZTA 3MZIA 3ET6B 2G2ZA 5EWFA 1S59A 3B6BA 1X5TA 1SQGA 3HJVA 1JJHA 4NPOA 3I56S 1X4CA 1H98A 3RBEA 1X8DA 3IWNC 3MOJB 4KV8B 2YNHA 1ZM9A 2W2NP 2MGZA 4DV7J 5J2NA 4MFBB 3A8EA 1DRZA 3CE8A 2ZVSA 1JLBA 4NXMJ 1S1WB 1GFWB 3BS9A 1IR1A
chains in the Genus database with same CATH topology
4BC7A 4OFZA 5J2QA 2ASDA 4LFAF 3RB4A 2HHQA 3GIIA 3CMAS 2QE5A 1X4BA 1KN6A 1F5BA 3BGRA 4ID8A 3HI9A 1K1SA 4MYTA 3CCVS 3AAWB 2XY7A 4NLGA 2CQ0A 2HGLA 3Q24A 1APSA 1C0UB 3H2LA 4H4KC 4DN0A 4QPTA 1FRHA 2DNZA 3OPKA 3D0GE 1YTYA 4PG8A 5BYSA 1J5OB 2ERRA 1M1KT 4LMZA 3EZ5A 3PFEA 2HW3A 2CPXA 2QA4G 2BXJA 2WK4A 2B56A 4I0WA 2O67A 3G4SS 4WFBQ 2RKIB 1L3SA 2L3MA 4EGLA 2FB0A 1IKYA 2W9BB 2D7SA 2L08A 1SQEA 3CCRS 4DSLA 4LIRA 4QW8A 2ACYA 2BACA 2KO1A 4JV1A 4K4UA 1TV6A 3MEDA 1XC9A 4Y2IA 2NSCA 5KT4A 2CYYA 4DL7A 3TP2A 4DG1A 2R7TA 3CVKA 3I5BA 4ATNA 1JLEB 2DNMA 4EO6A 2NUUG 3MUMP 2R7RA 2VG7A 1FTRA 3KG4A 4HTIA 2C2DA 1TKZA 3MMBA 3IR7B 1HW9A 4YEAA 3ICLA 1Z2ZA 3MUVP 2KI2A 2A1BA 4DDFA 2DNRA 2XMMA 2IAJA 4R25A 3OXFA 1N56A 1ELOA 4H54A 4NCAA 1ZBTA 4TKTA 1R31A 3V4MA 1WHWA 5GAEU 4KHPF 3RB6A 4JV0A 2AYBA 2HWTA 1N0UA 1CG2A 5D3GB 2EFQA 4IRCA 4OJ3A 4LF7F 4M95A 2IYGA 2XS7A 4ZCIA 3HDSA 1PC5A 3CCWA 2B3TB 5BYRA 2ZKTA 3OTOF 4OX7A 3M6XA 1JLFB 4K4YA 4PUOB 4IO1A 4RNOA 3TQ1A 2KN4A 5KG0A 4DR6F 4OI4A 2I0XA 3FMWA 4ZCLA 2FC8A 4N8OA 4DMZA 4V19X 3KLHB 2RRAA 4IG3A 4DFJA 4NLTA 3US5A 3MM6B 2AJ4A 3SQGB 1X4EA 3DGPA 2YKAA 4GKJF 2I5JB 3HVWA 4G1IA 4A8FA 1HBOA 5AE2A 2XS2A 2FGCA 4DV5F 2XNRA 2EI5A 2YQ3A 5KG1A 2A18A 2PEHA 3KMSA 3G71S 2KT3A 1IKWB 3FZBA 4BWMA 1X4AA 2Q6CA 2JLEA 2FTRA 3ENWA 3L09A 2GX8A 1YGYA 2Z8QA 5DLGA 2R7UA 4DSKA 2LVWA 5IQ6A 3LALA 3MXHP 2HQ3A 4JBCA 4DHVA 2P9EA 3GYXB 4YUDA 2WOMA 4MK7A 2FD2A 3HVTB 5LXYA 2DJWA 3SYZA 3CWJA 1QSSA 4B9NA 3V6KA 1KSPA 4CTAA 3DU5A 4CCHA 2FJEB 2B7BB 2RQ4A 3TNVA 2C22A 1YJRA 2ADCA 2HFOA 1YQHA 5HMZA 3BGLA 5B0CA 2PO4A 1UJ4A 4NLOA 5J1EB 4OL8A 3DOKB 2K1RB 4WXOA 4F4KA 4KO0A 3CJ4A 3MMCA 4O4GB 2IC3A 2ZH8A 5CCMA 7FDRA 3FGVA 3R3TA 3QZ7A 2FVRA 3M1VA 1FKAF 2YY3A 1GAOA 3PJWA 1JLAA 1TK0A 4USHA 2M8HA 3SV3A 4I2PB 4DV0F 3CD7A 4X84A 3UD3P 1RT2B 2EFPA 2UXBF 2E44A 2ILYA 4PUOA 3MPVA 2CDQA 2QSWA 1FE0A 3N28A 3QMQA 3MR6A 5B0DA 2ROGA 1UVIA 1YIJS 4ZVGA 1YJNS 2DIUA 4IFYB 1QUVA 2W8LA 1FNMA 1VQPS 1MMNA 3FEZA 4X64F 3DLBA 4EZ6A 2W7OA 3VR1A 1VQLS 3CTRA 1EP4A 1U26A 3MM7A 5HBMB 3CF5Q 2HGMA 2M5YA 2HNDA 2K7JA 1W2IA 2FJDB 4H4OB 3OVAA 4ES1A 5A2QY 3NCQA 1Y4ZB 2NUHA 6FD1A 4QIWD 1A7GE 1UFLA 1HI1A 4RW6B 3GMGA 4Y0FA 4G1QB 1T3OA 4JI0F 2AF6A 3KLVA 1NJZA 1JLGA 5L9NA 2V9KA 4CTAB 1U1PA 2KU7A 3X1LB 2EPIA 5IQQA 3MURP 2EWHA 4DBQA 2O1PA 3M32B 4UY8T 5LSLA 4RW6A 4QZVB 4WE1B 3PX6A 2MSSA 1Q7LB 5D77A 1SB6A 2DHGA 1R27B 3BQ0A 5ADZA 2O66A 2ZDOA 2P9CA 5EN1A 2DR7A 3O1LA 1Q78A 3TO8A 1VK8A 3BREA 5L1IA 4FS2A 1KQFB 3JTOA 2C2EA 5KOXA 3FCHA 3MEGA 2DT9A 3IWXA 2E9ZA 1U24A 4A48A 2R2TA 4JI3F 2UUAF 2DNNA 3OTEA 4RBVA 4I69A 4A8OA 4KGMA 1C0UA 3PZPA 1E6YB 3QO9B 4KHMA 1JKHA 4IG0A 4NA2A 3GE9A 1VQ4S 2IRYA 2YX7A 3EUNA 5D4OA 3IN5A 4B9UA 2G13A 4N41A 3ZZ0A 3BO4A 2CQPA 2UV8G 1E6YA 1SH2A 1C4CA 2FJBB 3MPYA 1IXKA 4DOZA 1X0PA 2WHOA 2CQ4A 3MGJA 5F8NA 3MI7X 2V4JA 1BWEA 5E2QA 4WIIA 2W7AA 3E01B 3SDEA 1N34F 2WSCC 2YX4A 1VQMS 1RA7A 4K0KF 2AX0A 4IH5A 3FFIB 1HWKA 2VB6A 3ISND 4XK8C 1QE1B 4ZOSA 3Q22A 3CJ0A 3R5CA 4O3NA 2HS0A 5KT2A 1WF1A 5DQIA 1AFJA 1ZH5A 2QZ8A 2R7QA 1K9MT 1LWEB 3QLHA 2MKHA 4LF5F 2PSZA 2DGOA 1OS5A 4C3KA 3CCSS 2ZH2A 4IRKA 4KV8A 5KFFA 2VFTA 2CQCA 1QAIA 4C8YA 4CT9A 1TZ0A 5HMWA 5KFVA 3W2VA 5KFNA 1T02A 2ZKUA 2BOPA 1IKWA 4XPEA 2ZC4A 3IXQA 1JKHB 4IG0B 2CKWA 1KRPA 4OJ1A 2D3UA 1S6QB 3LPYA 4JI2F 1UWBA 4MK9A 1XK8A 2OSRA 2Q6BA 2IBOA 2VBXA 3M1VB 3THPA 3VZIA 2W9CA 1RK8A 2F7VA 4AUKA 2E1RA 2KM8B 4M63A 1NB7A 1O51A 4AYBD 1TKTA 5DS7A 1XBWA 5KG6A 2GQQA 1S1VB 2PMZD 4LSNB 4X4UA 5LSOA 3ZZRA 5C25B 1Q16B 1TQLA 5HQ8A 3X3UA 2ZJPQ 4JI8F 3DLGB 4TU9A 1RDRA 2DGVA 3I0RA 4I6AA 1A9NB 5D3GA 2DGXA 3M30B 1L3KA 1UP1A 2AJ1A 1RT3A 1CC8A 1YJUA 2EG1A 3MEKA 3QZ8A 4O0IA 3IG1B 1U1MA 1YBAA 1WTBA 3S1TA 1FF2A 2JEJA 4ERDA 4X4SA 2XWXA 1KLMA 1U09A 2R8JA 2ZITA 4K4XA 1KC8T 2XSJA 4HH1A 4K59A 3RW7A 3OQ2A 5LT5A 1HBNB 4C8ZA 2OPQB 4RX6A 3MAHA 3CDAA 2RQMA 2UUWA 4OJHA 4NLYA 5E5NA 5J1NA 2KG1A 1D8YA 2HFZA 1DARA 2B9YA 2OFHX 4DL5A 1FEEA 2B0GA 2OSQA 2OLWA 1HWLA 3O8WA 4EU0A 1NNDA 5KFJA 2FVCA 2P5VA 4KTQA 5DG7A 2IM0A 2F9JA 2E5JA 4ALZA 1FJ7A 1XTZA 4JI1F 2PI5A 4G3IA 5FD1A 1G1XA 4Q2MA 2XMUA 1LXNA 3M2VB 3LP1B 1MSWD 3DRPA 2VBYA 1TKDA 3DLKB 3CC4S 1B0VA 4ZCMA 4IO9Q 3SCJE 1ZZFA 1FJCA 1TL1A 4ES3A 5J1PA 1SKSA 1QSLA 2IC3B 3CIMA 4TY8A 4YR0A 2ALZA 3T9NA 3DLEB 2OTLS 4KIAA 4F25A 3K57A 5E3QA 1SL0A 2QT7A 1NJWA 3UI3A 1H2UX 1ROFA 2R7VA 3HHLB 3D5MA 2PD1A 4J37A 3VF0B 1TK8A 2DPIA 2J7KA 2JOQA 2OMOA 4IOBA 1JJ2R 1DZ5A 3I5CA 4QWDA 1W25A 3CC7S 2GV1A 2ZOGA 1GNKA 2ZZMA 4QPXA 4OHXA 5EWEA 1JX4A 2M7SA 3DU6A 3EPIA 2J6TA 3SZ2A 2HNZA 1VRUA 5BYQA 2J9CA 2V8DA 4NCGB 4OLPA 4KFBA 2E5HA 4DR1F 2W9BA 2HNZB 3MM9B 1Y0HA 3PW5A 4DL4A 2EKYA 3NG8A 4HTJA 4C97A 3PV8A 3T1YF 2LQJA 2V8GA 3DXSX 4J9LA 2V8HA 5F8LA 1RTHB 3PO5A 4DV3F 1HNWF 3TVYA 1HA1A 4ZPCA 1HBOB 2E7WA 1S49A 5HLFB 1S1XA 3FRZA 4K4WA 2QA2A 3J7Z5 1OPIA 3SI8A 2OTJS 3N79A 5L9XA 3MM6A 3SQGA 1JWWA 2R7OA 2L9NA 3POTB 1FO1A 1FRXA 2EK6A 2YKNB 3KLIA 3LUYA 2VBWA 1FNXH 5GMKa 4FF1A 1SJFA 2OKQA 2HHVA 2OMLA 2QSFA 1RISA 3M8SA 3P5TL 3OUYB 1GQEA 4CI0B 3RW6A 1HHTP 2DCUB 2WSEC 1S1WA 3L7OA 3QPIA 4LVOP 3MHYA 3WZ0A 3CUNA 1ZTWA 5I3UB 3CJKB 1Y5LB 5K8MA 4I4BA 3V81B 2VUGA 2MZTA 3VAIA 2J7WA 2VFVA 5BJRA 4RW8A 2ASLA 4A8KA 4JI5F 2MKSA 1NK4A 3M2RB 3OR2A 2EW9A 2BQ3A 3THTA 3O44A 2K7KA 3DYAB 3KYLA 3CPWR 2QIFA 2JVRA 4X4NA 4C8LA 1DLOA 3DMJA 2K1RA 3DN9A 4QR2A 1GTEA 1V6HA 2JJ4D 1D8ZA 2E9RX 3IO1A 4ES2A 1DAXA 3UD4P 2VPWB 4Y2CA 5K8PA 3J81Y 1BC6A 4Z2XA 3LP2A 1FXDA 4ILLA 2L41A 4JI4F 3HZGA 3LAMA 1T94A 2B4OA 3BO3A 3QJLA 4WK3A 5L39A 3B4MA 2B4UA 3HX9A 1DQ9A 3BZQA 2UXCF 4OI1A 5KAKA 1LOUA 2MQPA 4YQWA 2CQ1A 1PO6A 1HNXF 4J9NA 2QLWA 3M4XA 2MKJA 1UEUA 2XULA 2K2PA 4LSLB 5KTQA 1VFJA 1YWXA 2PMHA 2A3JA 2NPIA 5EDWA 2AGQA 1N5YA 2YNFB 3ONQA 3FZ2A 2M9KA 2FHKA 3QIPB 3FNNA 4DFPA 4RW9A 3G8TA 3VAMA 4JI6F 1SL2A 1WACA 2ZZNA 3MM9A 1UMJA 3TI0A 1P27B 3AA8A 3S01A 5J2QB 3CCUS 3HF5A 5I42A 4ZPVR 3CSKA 3M9MB 1ZTTA 3TR5A 4WYLA 3QWPA 5HL7Q 4DL6A 2XS5A 3GV8B 4RWXA 2E5IA 4QW9A 3OFEA 1IJFB 2VKRA 1UJ5A 4X2BA 5B0BA 4EBDA 2LA4A 4P7VA 5T7LA 4RWWA 3ISZA 3HHKA 2DO4A 1IN0A 1Q79A 3MPWA 1X0FA 3CT9A 1SL1A 2DR5A 2VFUA 3NGDA 2MY7A 2RRNA 4ECYA 4JYAF 4ZP8A 4KR0B 3PKYA 4LUBA 5A8WA 1M90T 2ROEA 2KB2A 5HBMA 5KG5A 4JUZA 5KFZA 3PRDA 1HQEB 2X1AA 3MDFA 3N6NA 2YH1A 1FNOA 2VPXB 1RAJA 3AHPA 1YRXA 3JSRA 3R5BA 3ZFVA 4E98A 1Q86T 2OIHA 5DQGA 5IT9Y 2EBGA 5A0YA 2Z2LA 1U6ZA 4RZRA 2ADBA 1CQNA 3T19A 1DTTB 1JNZB 1R89A 2UV8A 4RW4B 3E51A 4A4JA 4DFMA 5F8JA 5KFDA 1TK5A 5LMNF 1XNRF 3OVBA 3CDWA 5HMXA 4ETZA 4RBTA 3U02A 1IKVB 2EBEA 3V6DA 2ZH6A 3KK2A 3I9V9 3RAXA 1K8AT 4NMLA 4DWIA 3NL0A 2W25A 2VL1A 1UA0A 4TXSA 4HYKA 3B4DA 2HZCA 3IFEA 4IFVB 4FF2A 4DUYF 3SV4A 2C2RA 4N56A 4ETXA 3RRHA 3K2YA 2DD8S 4WU2A 1M5SA 2VPYB 1VQ8S 5C42B 4KKOA 4IRDA 4AXJA 3FVYA 2UVUA 2RDJA 4M5DA 4CIOA 2ZHAA 2X1BA 2DGUA 1E6VA 1S0NA 2POKA 1KEKA 1N88A 4EUVA 3R1LA 4ICLB 2D9PA 1S9GB 3ISNC 3HO1A 5K8OA 3BM7A 2XY5A 2GJIA 5KFXA 1N8RT 2K3KA 2CJKA 1CSJA 3U1MA 5C24A 1UEVA 2MGZB 1SC6A 1S6UA 2C3YA 3S6EA 1KTQA 2B43A 3HHLA 5IZHA 1VQOS 4FYDA 4PXCA 3JSYA 1FEHA 1QVGR 4XPCA 3MTKA 4USJC 4H4OA 3SEOA 5F3ZA 2W9AA 2ZC3A 3L7PA