2ROEA

Solution structure of thermus thermophilus hb8 ttha1718 protein in vitro
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy metal binding protein
publication title Protein structure determination in living cells by in-cell NMR spectroscopy
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Metal binding protein
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2roeA00
5B0FA 1OSDA 1YJTA 1TL5A 2PD1A 3K7RA 2W4DA 3E8OA 2K1RB 5B08A 1CC7A 4HH1A 4A4JA 2FTRA 2OFHX 2OMOA 3HFKA 4Y2IA 2K1RA 2BJEA 1N5VA 1Q8LA 2LQBA 3WDOA 1V3ZA 2N7YA 1ULRA 2PGCA 5K9FA 1Y0HA 1Q8BA 3IWLA 3CJKB 3TNVA 2CRLA 1YJVA 2XMJA 1OQ6A 4A46A 5A6WA 4DL0C 1XBWA 1OQ3A 2XMUA 4U9RA 4YEAA 2FIUA 2JDJA 2IFXA 2ZDPA 1TR0A 2AP6A 2LQ9A 5KAKA 2LDIA 3HDSA 5T7LA 2RILA 1Y3JA 2K7JA 5B0EA 2OAUA 3MZIA 5B0GA 3BN7A 5IXUA 3MCSA 2RSQA 2HLUA 3LGMA 1Q53A 2ROEA 2W4PA 4Y2MA 3I9ZA 1SB6A 1FE0A 2BUNA 1N5TA 1QUPA 4OJ3A 1URRA 2ZDOA 1AFIA 1U7LA 1N5QA 5B0BA 2AJ0A 4ZA1A 3HX9A 1YJRA 3KG1A 1X7VA 5A6PA 2HFNA 1FVSA 1S6OA 1X8DA 2QLXA 1FE4A 3BB5A 4QOTA 3DXSX 2L3MA 1JWWA 2OD4A 1FD8A 2GV1A 2IYGA 2ROGA 3BGUA 1TZ0A 1P8GA 5T7LB 3IWXA 3KNGA 1FEEA 2RU9A 3HHLD 1S6UA 4EFAC 2GO8A 2KYZA 1P6TA 2FB0A 3QGPA 1YRXA 4OJHA 2AW0A 2IYIA 4F67A 5B0DA 3FRYA 3VTIA 2OKQA 4OIXA 1K0VA 2VH7A 2XMWA 1GXTA 1GXUA 1CC8A 2HIQA 2N4DA 5B09A 4OJ1A 5F0WA 4YDXA 2LXFA 1APSA 2G9OA 1R6YA 3BM7A 4A48A 2OFGX 1AW0A 1IUJA 2XMTA 1Y9OA 1MWZA 2XMKA 1YJUA 4Y2KA 1VQYA 4FNHA 1OPZA 2ROPA 3BF4A 1LQ9A 2OP5A 1JK9B 2EW9A 3QMQA 4NL5A 1KVJA 3HHLA 2HFOA 1CPZA 4NPOA 2N4CA 3GZ7A 2GCFA 2K2PA 3DCAA 1RJJA 1KQKA 2W4CA 2KT2A 3FGVA 2FHMA 2KT3A 1SI9A 4OJGA 1AFJA 1N5SA 1VQSA 2BBEA 3BDEA 2KKHA 2ASYA 2VV5A 2HLTA 3KKFA 1Y3KA 3T9NA 2GGPB 3BR8A 4DPOA 3HF5A 4FNIA 3TRGA 3FMBA 1TUVA 2GFFA 2ACYA 4Q2LA 2GGPA 2QLWA 4HH0A 1WD6A 3HHLC 1FVQA 1X0PA 2GA7A 3CJKA 5B0CA 1W2IA 1KVIA 4HI1A 2BYCA 3KG0A 4HL9A 2BJDA 1YG0A 2AJ1A 3LO3A 5F0UA 4Q2MA 2Q3PA 1MWYA 2HQIA 2XMVA 1Q4RA 2K7KA 1TL4A 2RMLA 3HHLB 5B0AA 3TOQA 1SQEA 4A47A 4DN9A 2QIFA 2QYCA 3F44A 4ZOSA 3LGNA 3UDCA 4HI2A 2OD6A 1FESA 2XMMA
chains in the Genus database with same CATH superfamily
3TARA 1YLXA 4LBIA 4OYPA 4EU0A 1VC0A 4B9TA 4ZPTR 3UCZP 3CJ5A 3HSZA 5M2RA 2RSQA 3GV8B 1JLCB 1LFWA 2HIYA 4L76A 2FY1A 3CC7S 4J9SA 3BGLA 4XAKA 1JWWA 3DHXA 4DR7F 4ECQA 2HBQB 1E6YA 1S79A 1HR0J 3K57A 1C0UB 2Y0SD 1YGYA 3MECA 4A8YA 3AXKA 4X4RA 4DL6A 1O6XA 3DI6A 2VJUA 2L41A 5KFEA 2GQQA 2VPXB 1TL1A 3P8BB 4DPWA 2O3DA 4RWXA 4DUZJ 3TA2A 2NREA 2Z56B 1DLOB 1B4SA 4DU7A 1EARA 1W2IA 3O8WA 2Y1IA 1JB0C 1JLGA 1UETA 4I2PA 3OLBA 1SC1B 4FF1A 4H4OA 3G8QA 2CWKA 3F41A 2ZZTA 3M30A 2J9DE 3MMAA 2UVRA 4C8LA 4WFAQ 1UFLA 1LWCA 4KB7A 1GX6A 2DRBA 3HD1A 4NMLA 1U1KA 3GJQB 1S6PB 8AT1B 1W26A 2DNNA 3W66A 2DNOA 5A8WA 3LANA 4ZIVA 2FY8A 5ETKA 3H4BA 2M5YA 3DLJA 2W9BA 2QE5A 4N77A 1SJ1A 3L7OA 4Y2KA 1WKJA 3BQ1A 3NNCA 3LPEA 3QMQA 1RSCA 2JSXA 4NXNF 2PSZA 2W7AA 3VVUA 4DR4J 3N9UC 3SYZA 1FDNA 4ITSA 4LRBA 3D1QA 2DT9A 4IFVB 3ILLA 1MWYA 4DSEA 4I7FB 3T41A 1V5IB 2RKIB 3V6HA 4F0MA 2VKRA 2ZKTA 3DLLQ 1R6VA 3RBEA 2O1PA 5EDWA 1ULRA 2V94A 2XI2A 4DZ6A 2HS3A 1S1WA 2FJXA 3PW5A 2L9WA 3ETOA 4P71A 1HBMB 2G0IA 3FKBA 1R0BG 4AUKA 1VRUB 3BQ2A 1HMVB 2DJWA 1YJ9S 1C0UA 2EKYA 1Q8IA 2V8DA 3NMRA 2IM2A 3CC4S 5H9EJ 4V19X 5EWEA 3H25A 1SBRA 3FRYA 1K0VA 1Y10A 3HVWA 1A0OB 2V8PA 1DLOA 2ZE2A 2Y9HA 2YBVA 3C46A 1AA1B 3H4DA 4DQRA 1ZOTA 1F9EB 1KQKA 3ZNUA 5AXLA 5HP1B 3IRWP 2FLLA 2J7WA 2IDEA 4LF8F 2V6AA 4TYBA 3D0IE 4WIIA 4I64A 3LP1B 3DFEA 1BE4A 1YZ6A 4WU2A 1FXRA 1Q7LB 1S6PA 5FLXU 4FYVB 4QWDA 5LL6d 2MY7A 2IFXA 5I3PA 3DOKB 1QAIA 1RYSA 4XO0A 1LWXA 1VRTA 3KJVA 3BDPA 2ZVIA 4BCAA 4B3SJ 1SCJB 5KFTA 3TP2A 5HLFB 1L3VA 2FUG9 4ZDNA 4DV2F 2BR0A 3FSXA 5DGBA 4M5KA 4NA1A 4O44B 5KG3A 2HS4A 4DQQA 4FYDA 1YI2S 2WB1D 3BM7A 2JJ4D 1RP5A 4I0WA 3OVAA 4QPTA 4GO5X 3D67A 4IFVA 3OHAA 1XNQF 3SQGB 2EI5A 2RKIA 5JJBA 1EQMA 1C0TA 1NPRA 4OJGA 5L1LA 2UUAF 1UEKA 3LOUA 4DPOA 2F9DA 3A4TA 4OX7A 2OPPB 3M8YA 4O4GA 4CLTA 4YY3F 3D6MB 2XS5A 1QVGR 2V50A 2CUYA 1KC8T 4OX9F 4ZPBA 2JVOA 4Y3CA 1VRUA 4IDKB 4KO0B 4WCEQ 1HMVA 3BGOP 2K3KA 4ES1A 4Q0BB 4L74A 1R8CA 5K8PA 1RISA 3RU0A 3LAKA 4B9VA 2MQMA 2MPUA 1U0HB 3FCHA 3R7NB 4RUAA 4NLVA 4OZLA 3TR5A 1BGXT 4OHZA 1Q0NA 3HFZB 3OTBA 2QFJA 4LF4J 3M4XA 5B0DA 1RKJA 1IKWB 3KOAA 4JUZA 5KFPA 1VGYA 3HM9A 5FDLA 1UVNA 3MM9A 2MKYA 4V19J 4RKUC 4ED7A 1MWQA 2ZH2A 4UOCA 4ZVQB 1S0VA 4J9OA 3G8TA 3LP1A 2XSJB 4JV2A 3K17A 2RS8A 5L1JA 1RACB 3H5XA 3MURP 3BO2A 1S5ZA 3TEHB 4CZCA 2BYCA 3MD3A 1WELA 3DOKA 5AT1B 4PWUA 1AUDA 3FQKA 1GXLA 3TX8A 1UFWA 1IBLJ 2YQ3A 4EYIB 3CDWA 2FTRA 3T3FA 3SMZA 2JEFA 2HAIA 3NGUA 3MAAB 4QIGA 5HLFA 4CO5A 1VBKA 5A6WA 4ZIWA 3OQ2A 2R42A 4AL6A 1SH0A 3W8GA 3T5JA 2MYFA 1TAQA 4DUTA 3IM8A 1CJUB 3MMBA 3TA1A 2AYEA 3AY0A 3L9ZA 1D09B 4NXMF 4OIXA 4MFBA 2GVZB 1TVRB 5L1IA 2YKQA 3I82A 3LW5C 3W2WB 2QA4G 2BQ3A 2OPPA 1N32F 5IC4B 2HVZA 3SCLE 4X66F 3DGVA 3BYPA 2FVPA 2BBEA 2ZHOA 2HLTA 3MR7A 4IDKA 3LTOA 2ACYA 4LF6F 4OFZA 1KBRA 4Q0BA 3NCRA 1SJ4P 1QSYA 3I0RB 2D69A 1U0HA 3EDRB 3I55S 3K5PA 1RCOB 1Q8BA 1B64A 3I96A 2FIUA 2F9JA 2UV8A 1YTYA 5KFFA 4B3RJ 1YBTA 3BH7B 3PX4A 3G2XA 4BHQA 1IKWA 2WAQD 4YB6A 3Q22A 3NBPB 2BE2B 1JNRB 1R0AA 4NLDA 1J5EF 3AB2B 1MMDA 3BGUA 4UOGA 1J2VA 2LCWA 5IWAF 1B0TA 2C28A 2E9ZA 1TAUA 4ZVUB 3I87A 4H4MA 2CA9A 2HNDB 2XSJA 3G71S 1FRLA 3ETMA 3US5A 1Q8KA 5HK4A 3RAMA 2ZH3A 3IBFB 5KFIA 2MLZA 5KFCA 3PEJA 4CO2A 1S1TB 1S9EA 2EFNA 1B7YB 4QWCA 3MAAA 2GGPA 1RBOB 3DLEB 2CQCA 2AJ1A 3TAPA 5DDOC 4EZ9A 2YTCA 4ZCKA 4CYUB 1VQ5S 3AJDA 3BO4A 2DR5A 3W2VB 1U2RA 1HWJA 2EC2A 4HH1A 4ECVA 3W5XA 4FF4A 1W7WA 1CJUA 4C8KA 4U7UD 2ZJRQ 5BXIA 5KG5A 3M6UA 4P2FA 5HMXA 4I1TA 1KDNA 4LT6A 3DRSB 1EAYC 4DQPA 4YOEA 2GVZA 1TVRA 3UR0A 3AXMA 4O23A 2BW2A 4F3OA 2PMZD 3HVTB 2VBXA 3MOJB 2J6TA 3W2WA 1P8GA 1T3NA 1FEEA 4F4YA 1S6QB 4DX7A 1KP6A 4NA3A 2NSBA 2H5JB 3MAHA 2VOPA 2DPIA 1DTTB 4M1KA 3W9HA 4K5RA 1X4CA 4GKKF 3GB0A 4WZQA 4U7UK 2KT3A 3I0RA 5DLGA 2G2OA 2B4VA 1UA1A 4ED8A 4MK7A 4B9LA 2DHGA 1Q82T 1HFEL 4MK8A 3M8ZA 2JWNA 3NBPA 2F40A 2BE2A 1Y0HA 3B78A 2RT3A 2WBRA 2ZOMA 5LJ5Y 3IO1A 4DS4A 2NQPA 2HNDA 1U7LA 2DRDA 1KQSR 5KFYA 4JI2F 4OZ1A 3KUHA 1OS5A 2IPOB 4LF2A 3QSIA 1SQGA 4A8OA 3HULA 1FNMA 4DPYA 2E5LJ 3RB4A 1NPPA 3JXOA 5LXRA 1N88A 3R5AA 4MKYA 1S1TA 4OZ0A 3CNQP 2UXBJ 3DLEA 1UAWA 3PYGA 4CYUA 5KG0A 3SQOP 3W2VA 5HBMA 2XB2D 3NGDA 1FDDA 5GVQA 2AYMA 1NM2A 4DOZA 1H7XA 4DMZA 1SUQB 2VQFF 1HNWF 1JLBB 4QQBA 2GS8A 2H1YA 3NY0A 3TVYA 4F4AA 1GTEA 1FWKA 1O51A 5K9FA 3KHRA 3HVTA 3F73A 5KT3A 2K8GA 1LEOA 3OUYA 5G4DA 1S6QA 2QLJB 2GJIA 1NO8A 1E6VB 4LF7J 4CO4A 2ABYA 2HQGA 7FD1A 1UVJA 1UCNA 2EWHA 4OL8A 2R7UA 2GV1A 1NEEA 1XNRJ 1KONA 1DTTA 3FEZA 1YRUA 3EXYA 4RU9A 2GHVC 3ZTRA 1Q86T 4CM0A 4DV1J 4AD6A 4LFBF 1FEHA 4LSNB 4JI4F 5IC6B 5KG1A 3FSYA 5T14A 1NNDA 3VQTA 5D4NA 2E1AA 3EGVA 3DLHA 5ADZA 1M5PC 3LQVA 3OTEA 1LNQA 1OYDA 2QSWA 2K2PA 3KK2A 3WHIA 2CNNB 5LJ3Y 4JV0A 1IXKA 2BRKA 2DNRA 3U1NA 4DR2F 3CJ0A 2MKIA 3IFEA 2XYGB 4OI2A 3ZZUA 2HBRB 1FJEB 3IG1B 3JSMB 2COLA 4Y65A 4ELTA 1IM6A 2F8HA 1RBLA 4PZVA 2CQ0A 1WG5A 2L08A 1U1LA 3MMCA 5J2QB 3DOLB 1X0FA 1BD6A 2HHVA 3M2VA 3TWZA 1XK8A 3D1HA 2LDIA 4EBDA 4EZ6A 4Y2MA 1HHSA 2XHCA 2WVBA 5GAHI 1HI0P 3GFZA 1NLKL 2P9CA 4QYRA 3QIPB 3MEKA 3CPWR 4PG8A 4U8VA 2EBGA 3J7Z5 5CD4H 5C25B 3HPOA 1RT7B 4P7TA 2XMWA 3FBCA 1RB0A 3HT0A 2RDJA 5C42B 5E0OA 3CCSS 5AXKA 3PIPQ 2QT7A 4B3TF 4UZCA 2MQQA 5KFLA 1SJQA 3IAS9 4A8MP 1SUQA 2J5AA 4AFFA 3OL6A 3KDOA 5DQGA 1JLBA 5KG2A 1N5YB 5IV3A 4LF5J 3BEGB 3BSOA 3N4WA 1F9HA 4JV5J 3BR8A 3R5DA 4FNIA 4K0KF 2MKCA 1T9UA 1Q95G 4ZOSA 1U45A 3DKDA 2FD2A 3Q24A 3AQOA 2DY9A 4U67Q 1H6KX 4P2SA 2DHXA 4LR7A 4NLSA 2YWHA 3ZTPA 2YKNB 2LQ9A 1Y5IB 4USHA 2VDHA 4UUWA 1JKHA 3CJSA 2KDOA 2ZH9A 4G1PA 5KFGA 3B82A 5E41A 4OLPA 2O66A 4LSNA 4FS2A 2YNFB 2B8QA 3IN5A 5DQHA 2VG6B 1YJNS 2KFZA 4IUFA 3IBWA 3HKZD 3HHLD 3UPFA 2V2VA 4J90A 3WC0A 3HP6A 3JSBA 1NHUA 3JSMA 3MFIA 3C6TB 5SUHA 1BY9A 4FVMA 3E01A 3WIVA 5GAGU 2M4MA 1SJFA 2GFFA 4RW4B 2HGLA 4CLYA 5U47A 1CLFA 2RQMA 5J2QA 3DOLA 2CQ3A 1RI7A 2D3O1 1QE1B 4DSLA 1AXQA 3IRXB 1JLFA 5E3QA 2EXUA 2YWEA 3QIPA 5LM7E 1KQFB 3MR2A 4FBUA 3A8KA 1R43A 2D3OR 3BO3A 2CG8A 3LH2S 2F4FA 1S1XB 3PW4A 1RT7A 2IMWP 3ENAA 1VDHA 4YMEA 5C42A 5LOQA 3VCDA 4YR0A 1R8AA 5IV4A 4HVZA 1NUEA 3J80Y 3CMES 3Q8QB 4PPZA 1XMBA 3TANA 5FIIA 1C1BA 2VC1A 2ZZNA 3L3CA 3EMTA 3OTDA 1QAYA 2XMAA 1OIAA 2RUSA 3NAIA 1AYEA 4OYIA 4DG1B 2ROPA 2WW8A 4KV8B 2KZMA 1HIYA 2N4CA 2IM3A 4MMOA 4ED1A 1UFKA 1X5SA 2C3PA 4M5DB 1GMUA 3RAQA 4AL7A 2LEPA 2VFTA 1XR7A 4EO6A 4MK9A 4F0KA 2YKNA 5B08A 2C2OB 4TY8B 1H3DA 1WNEA 2GIQA 1IWGA 4EWTA 3H20A 1MN7A 4ZCIA 2F1FA 2K1RA 1H38A 1VQNS 1T9WA 4URQU 2YNGB 5A0YB 5CYQA 3WBZA 1F2GA 2UUTA 2B7CB 3UO0A 1TL3A 1HR0F 3OL7A 2QA2A 5EGYA 2KG1A 1UZDA 2EFVA 1Y00A 1FI4A 3J81Y 1TZ0A 3I0SB 1HKAA 4DFKA 2Z0GA 4L72B 5MLCV 4K4WA 1SL2A 3V4IB 4F67A 4J9NA 3C6TA 3GLJA 3BKUA 4DUZF 4OLOA 2XC9A 5DZ7A 2I2YA 4TN2A 1ZTTA 4ZPAA 4RW4A 2BABA 2B9YA 3FEXB 2LA4A 1TKTB 1JK9B 4M5NA 3TUPA 3CMQA 4O3RA 1Z2LA 2KT2A 1QE1A 1FXLA 4YB1P 3IRXA 4RNOA 3KUGA 1L3TA 1FRXA 4CO1A 3MPWA 4PWDB 2UP1A 4MIBA 3JTNA 4DQIA 2Q43A 1QAXA 4YUDA 5L8RC 3EZUA 1S1XA 1SIWB 3G96A 2V9WA 2BJEA 3OBIA 3UFCX 2OHDA 1L5UA 1EETB 3R1LA 3DLGB 3Q8UA 2UUCJ 1VR6A 1UW9A 2MGZB 2DNGA 1RWUA 3W62A 1XR6A 4LJMA 1VQOS 2WHOA 3FVYA 3NCPA 4FBTA 4C8NA 1U4BA 3HK2A 4DG1A 5HMYA 5BYRA 2U1AA 4W4MA 2EVZA 4KV8A 4LFAJ 1TK5A 3QGPA 1RT4B 5M2PA 3EZOA 3M8QB 1DTQB 4H54A 4ZITA 1FJGJ 3G4SS 1QDUB 5DDPC 3GFXA 2I6WA 4DR4F 1MNEA 2AV5A 3QT7A 5E33A 3MM7A 4XK8C 2MZRA 3THVA 3CD7A 4TY8A 3QAUA 2VU5A 5C2CA 1SIZA 4F4KA 2WOMB 3MDFA 2MJUA 2KXNB 1JLQB 1M1KT 2G1HA 2YNGA 1QSLA 5A0YA 2DO4A 3GQCA 1SC4B 2MY8A 1FRKA 3T5KA 3CCUS 2OFHX 4ZLJA 2BA9A 3E51A 4F0HA 1N8RT 2QRRA 3W3SA 2HVIA 1WC6A 3VAGA 4Y6IA 1S9FA 2DIVA 2BJ3A 3KLIB 2IBOA 3ZNJ1 4WK1A 1UMJA 3V4IA 3JQKA 2CJKA 1X9SA 3QYYA 3CWJA 3ENWA 2HFNA 3VHQA 2JEIA 3DU5A 3EPGA 2LYVA 4DV4J 4UY85 4K4XA 4G1QB 1TKTA 2MEWA 1PJ5A 1FO1A 3CD5A 4Z2XA 2J0XA 2MZQA 4OI0A 3N6LA 2ZH5A 2XNRA 2UXCJ 4ED5A 3QRQA 4ZP6A 4PQUB 3TUIC 4PWDA 4C9DA 4YB5A 4CNYA 1N5SA 4PKDB 2VJVA 4O0NA 4LFCJ 2LMIA 1F1BB 3EXCX 2KRRA 1M5SA 2XWYA 1S72S 3U02A 2R8KA 3DLGA 2LFVA 2MMYA 2X7IA 1U1OA 4B3SF 1FX4A 4WIQA 5CZVA 2MGZA 5J1EB 1KLNA 3ITHB 4P74A 1TKDA 3B8HA 4IOCQ 4BWMA 4B3MJ 1FFGB 2YKOA 1LW0B 3M8QA 1DTQA 4WFYA 3UNGC 3WC2A 2XG8A 4NEYA 2KHCA 4I68A 1HI1A 1ZM2A 4WYLA 2BV3A 3Q0AA 2BEFA 2HG4A 4ZMMA 3PRVA 2F5GA 3PZPA 2GIRA 4USIA 2J9EA 4DS5A 1RAHB 3GIRA 1YX2A 3E3XA 4ECWA 2WOMA 1R6YA 1DURA 4HTJA 2PFFB 3IC1A 1YIJS 4C97A 1VYAA 1JLQA 3WX4A 4OZJA 3PO5A 2V4QA 3N6NA 5HATA 2ILYA 1QD1A 2X1BA 1K0TA 1O8BA 3PW7A 1UVIA 1TV6A 1GMWD 3KLIA 2YKMB 3MEGA 2FB0A 3CB4A 3E8OA 1KD1T 3K5MA 2GC8A 1NKEA 3I4HX 3HFKA 4X4VA 4F8RA 2XZTB 4Y34A 4DL0C 3M8SA 4QPXA 2B3TB 2DEJA 4LF4F 3KFWX 2A2DA 4G1QA 3WIUA 2IA0A 2MQPA 2Y8WA 1Q53A 3K0JA 1VQLS 4EK2A 1X7VA 1VBZA 4DV2J 2BOAA 3O3LA 3DDKA 3R7BB 2G2YA 3W9IA 4PQUA 1Q5YA 4DSIA 3EICA 2PFDA 4DEZA 1CJTB 1P27B 4ID8A 2PIIA 1JX4A 2W2PP 4QR2A 2PA3A 2XMTA 3D54A 1U1NA 2JLEA 4BLGA 3KLHA 4DV7J 5D15A 1IBLF 1LKZA 1RT2B 1I3OB 4J91A 4HACB 1F2HA 2DO0A 3HVAA 1WJ9A 3FCWA 5K8MA 5J1EA 1UEVA 5F8JA 3ITHA 1YRTA 1U47A 2Z58B 1PCAA 4U7CA 4TLQA 3DRPB 4LQ3A 3PRDA 1M5HA 5IT0A 1Z1ZA 3PNIA 3VGUA 4QZVB 1LW0A 1LOUA 2OMOA 4CT9A 3R7SB 2R8HA 2ZFHA 3TNVA 3VZHA 1OQ6A 4IH7A 2M88A 3HZGA 1PC5A 3KK3B 2KH9A 4DV3J 2MTLA 3MCSA 2DR6A 1H2UX 2CJAA 4RL1A 4F04B 1VQ8S 1UL3A 2DXFA 2OH2A 2IVMA 2FZKB 3BSCA 3T5HA 3R5JB 2AKWB 2FC8A 4ANDA 5L9NA 4QIVA 3UW1A 2KZZA 5M2UA 2BXJA 1RTDB 2LU2A 3TUZC 1FKAF 3PX6A 3D5MA 5E7OB 2Y8YA 1RAEB 3MI7X 3PCOB 4FVCA 2V34A 2YKMA 4Y2AA 4WFXA 1BQMB 1KRPA 4RW9B 1CQNA 3J7AN 2V4JB 3MD1A 5KT7A 2MQNA 3ADAC 1ZTWA 2DGOA 1FFSB 2DB1A 4IOAQ 3V81B 4DN9A 4B3RF 1WUUA 2WK4A 4QR0A 3PRBA 2QJ3A 3DLKB 3QO9B 1WHXA 2CRLA 2BKOA 2NS1B 3NGSA 4NZ6A 2M8HA 4G65A 1VJWA 1NB7A 2R2SA 2LXIA 1CJTA 1TU0B 2R2TA 2BE9B 3Q8VA 3G6XA 2QLXA 2HHHJ 2HQFA 3MPYA 3ZO7A 4JBCA 4QW8A 1K8AT 4WP8A 1ZS6A 1SL0A 2IC3B 3A8JA 2HZVA 2B4UA 1B3TA 2LLZA 3PEHA 4L75A 3PR5B 4MJKA 2QLFB 3NWRA 4P72A 1RT2A 1CQMA 4PXDA 4HACA 4XPEA 3KLVA 1D9DA 2ZHBA 3CC2S 1J5OB 3H5SA 5A2QU 4LRFA 1H72C 3MHYA 1LWEB 5J2PB 3CMAS 3BDEA 2HEKA 2XO7A 3VGVA 4B3OA 3J80U 2MHNA 3KG0A 2CPXA 5E3PA 3CCMS 1Q4RA 2FQQB 2K7KA 3HT3A 4J5OA 3GPAA 3KK3A 3VAHA 4HI2A 3VVTA 1WWHA 5JVHQ 1GNKA 2EG2A 1PIEA 2BX6A 4M5HA 2XM3A 3H2UB 4TQSA 4ZN1A 4CLPA 1NBEB 2XLJA 2DISA 1G6BA 3HHDA 1HNIA 1RTDA 5CYMB 5KFRA 4CLUA 1HARA 2VG7B 4M94A 1J27A 2NZ4A 2C2ZB 3KLFB 4MAKA 1BQNB 4TQRA 5LSLA 2VD3A 5H9FJ 2ATLA 1XJWB 3X1LB 2QYGA 1BQMA 2VKZG 1HNXJ 1LXNA 2V4JA 3CCTA 4NLWA 2HRYA 1X31C 1F5AA 3D3CJ 3A12A 2D3UA 3V81A 3LAMA 1BWEA 1EHWA 3JAMY 3C6UB 3J81U 3WQPA 3I5AA 1Z4UA 2QV6A 1REGX 3DLKA 1HW9A 3QO9A 1NJYA 1Q5VA 1U6ZA 2P2CB 1RWOB 4ETXA 2UV8G 3MGJA 2HQDA 4ILLA 1MROA 3SSRA 3UR3C 3GYNA 1XQIA 3Q2TC 5K14B 5ETTA 4L6V3 2AZ3A 4PG6A 4DV0J 4IKAA 1L3SA 1TFYA 2Z2MA 1JQGA 4AT1B 3CULA 3BS9A 3RG6A 3HDSA 3C14B 4OZ2A 4DV6J 2IC3A 4LVOP 1Z2ZA 4ICLA 2RIJA 3J81j 3KG4A 4TVAB 3K8WA 4E2FB 1FRJA 1U0SA 2DPJA 3MPUB 2UXBF 2W24A 4P52A 4FXDA 1Q16B 1UKUA 2B51A 5KG6A 2VH7A 2N3OA 1LWEA 1HQEA 2CPIA 3EGZA 2AX0A 2YKAA 5HVGA 4K7QA 3OW2R 4TYAA 1TUWA 1RADB 1U2FA 4UQTA 5ETVA 4PQAA 3QSYB 3R2CJ 2AF6A 1ROFA 3EVMA 5IZHA 3T19A 3HF5A 3FMBA 3MCMA 3PO4A 5F8MA 2BJDA 2ZEJA 1TMJA 3NWGA 1I94J 4CLLA 1X4FA 1B0VA 4LF7F 2XZDB 5D4OA 2EK1A 2L9DA 4PXEA 1FK9B 2AQ4A 3GG0A 3A3NB 5CYMA 1T9VA 1VS3A 1EX8A 3NEKA 1XNRF 4ECRA 2VG7A 5IOLA 4HT5A 5D3GB 2DY1A 2GVDB 2IJRA 2W4PA 3KLFA 2G2ZA 1BQNA 4DV1F 2RRAA 3IWNC 2OPSB 2JVRA 1N6QB 1SQFA 3ZZ0A 4CDIA 2AJ0A 2IJNA 1T02A 2CPYA 5DO2A 2GO8A 3K5NA 3EJMA 3QT6A 4OZ5A 4C3KA 1SH3A 2GJ2A 4L73A 4A8WA 5F8GA 5K20B 1FFWB 2HVHA 4ZPWR 1Q7YT 2GCFA 4NLGA 3P49B 1IWAA 1RU2A 3H59A 4Q45A 1WD6A 2I9SA 4Q43A 1RWPB 1S59A 4X4OA 2KG0A 2AEJA 3UE2A 3C14A 2OPQB 2IM0A 1U25A 2VDIA 1CS4B 1T11A 2HFUA 3H5YA 3IS9A 4DJBA 1ICEB 2B9WA 2OTLS 3GIIA 1S1UB 1AFIA 3AA9A 3GE9A 1N34J 1ZETA 5A6PA 3DM2B 3KJFB 3CE8A 3CT9A 4G1IA 1FVSA 2DH9A 2ROGA 1ZYQA 2D9OA 1JLAB 4PCQA 2NXJA 2CADA 3OT9A 4LF5F 4JV5F 2A1BA 2DNLA 1I51B 1FRIA 2FJVA 2IM1A 2OMLA 4ES2A 1H2TZ 5DDQC 2ZM6J 1KVJA 3PDNA 1N54B 4DI6A 4DX8H 1NK5A 4IOBA 3KNAA 2GZOA 2KVIA 4Y2CA 3ET6B 4J37A 3T6BA 3K58A 4ELUA 3VR1A 2AX1A 2Q3PA 3JS9A 3BREA 2RMLA 1JXVA 5EUHA 1UJ5A 5D3GA 2GVDA 3IGVA 3JQMA 3P45B 2CQ2A 2OPSA 1CSJA 1N6QA 2DH7A 3DHWC 4UQGA 2LQBA 1DAXA 4ILRA 3QWPA 2QL7B 4C3LA 2KFNA 1XMQJ 5D0EA 3I9V9 4DL2A 1FTCA 2QTWA 2SXLA 2YWGA 3R5BA 2NYHA 3BN7A 4M63A 2HLUA 4ZVTB 4RBUA 3ZXWA 1VCTA 5J2MA 1S4FA 1WC5A 1V5VA 4V1Ak 1QAJA 2CPHA 2KJVA 5KFZA 1CG2A 3ILOA 4ZJLA 4DPTA 5DLFA 2EBEA 4DBQA 4QU6A 2FJWA 3OPKA 3AD8C 3BPSP 1HYSB 3I5BA 2LXFA 1U8WA 3TVKA 4OZ3A 1FXDA 3BF4A 2M2BA 1WDDA 3NS7B 2LEAA 4ZP7A 2OPQA 4LF1A 1DQ9A 2R7OA 3BBCA 4OX6A 4ENOA 1CS4A 1WEXA 1IQZA 1XEZA 2HQ3A 3D66A 2HS0A 2LEBA 1S10A 4N8NA 3B54A 3W5ZA 1GTHA 2ZNYA 4CLWA 4EEYA 5D4LA 1S1UA 2CQDA 1NKBA 2KTQA 1V3SA 3TI0A 3U1MA 1YJVA 4MKVA 2D3ZA 4KHPJ 5KT4A 2LQ5A 1JLAA 2CVEA 5DDRC 2NLWA 2Q6BA 4ID5B 4PXCA 4NCGA 1FKOB 1NJIT 4U6PA 1WC1A 3A1YG 5CABA 1FX2A 4NRTA 3G6YA 4KPYA 1X5PA 2W2MP 4DL4A 5KT5A 1E6YB 2C2EA 3SZ2A 4WKRA 1UWAA 2DGVA 2VBZA 3ET6A 3MECB 1HWKA 2FLOA 3PVXA 1R3NA 3LP2B 5LSOA 3MAQA 2CPEA 3BJYA 1U24A 2P8IA 3QFWA 3OFGA 1RJJA 2HPUA 2YWWA 4DX5A 1RQ0A 2E1PA 2PN6A 3AOCA 3KK1A 1RHUB 4R25A 1VC5A 4I2PB 2E29A 3DU6A 5KG7A 1P9YA 2DGTA 2YH0A 1VQ7S 4GKJJ 3RR7A 1LWCB 3G9CA 4C6AA 1JJ2R 3CCZA 4F4ZA 3DN9A 3TJ9A 5KFBA 2O5DA 1UVMA 5L39A 4B17A 4TKTA 2ZUAA 4RW6A 2YH1A 2UVWA 2W9BB 1PBUA 4WKYA 2I1RA 4N7TA 2HRUA 3DMJA 4NL5A 4NLQA 1HLWA 1FCAA 3EM1A 3VZIA 3CCJS 1SC3B 1C4CA 2V63A 3VF0B 4MYUA 3O2IA 1HNVA 4D3GA 4RBTA 4LRCA 5I42B 1WORA 5DG9A 3DC2A 2UUCF 2VQEJ 4CTAA 4Z7YA 4ID5A 5IM0B 2MKHA 1FKOA 3PM9A 1S1WB 4LMZA 1HBNB 1T0TV 2IDLA 2Q1LA 4LFAF 4J9LA 2AGPA 3VV2B 2OPRB 2V2QA 1FJGF 2U2FA 3MTJA 4WXWA 4UOHA 2BJ8A 1WDTA 2ADCA 1D1UA 4NLXA 3LP2A 3UDLA 5T7LB 1WHYA 3DOMA 4LBHA 1HBOA 4JI7F 4K4YA 3BGFA 3A8IA 1GXUA 2ZE2B 1W2BR 1PC4A 2DXDA 2JC1A 1YKWA 2IHR1 3LUYA 3VAFA 4LVNP 1OJ4A 2F8EX 4UZBA 5C24B 5JXSA 2FLPA 2J0QD 5EX3A 4HTIA 4FXVA 1PAEX 3H42A 3LO3A 2V69A 1T7PA 4UT4A 2F7VA 2W4DA 2FHJD 2WCXA 3OTOJ 2DNMA 4JB8B 3M9MB 2HHQA 4DV4F 3LWLA 2ZZMA 4YEAA 4PYAA 3JAMU 2VZ9A 1VRTB 3KJVB 3SSSA 4DL3A 5H9EK 2MKSA 4OJ3A 3JYTB 2ZOGA 2VOOA 3DRYA 2DNPA 4JI5J 1SXLA 2GNKA 1KQGB 2UXCF 1TKXB 2HFZA 1NJWA 1TK8A 4BC9A 4KC5A 3GWCA 2RQCA 4DR3J 1RT6B 2QL9B 4F2RA 1VLOA 4RNFA 4LFCF 2C3UA 4PYDA 1U1QA 2DCUB 5B7WA 2M52A 2RF2B 2XMKA 2ZD1B 3CD0A 2ZKUA 3EE3A 4RW7B 5I42A 1C0TB 4MYTA 3GZ7A 1X9WA 3I5CA 3D0GE 1HBUB 3W65A 2R9LA 1KFDA 3R5GA 4WE1B 4Q5VA 2PMWA 1F5BA 2B56A 2JHEA 5IM0A 4DWIA 4X62J 1IKVB 5A76A 1HBNA 1YG0A 4O4GB 1BMQB 2UUBJ 4B3MF 3LF0A 3Q8RB 2R2RA 2EFPA 2OPRA 4TNOA 2KVQE 2P6SA 1HL6A 4Y2IA 4ANEA 2JFDA 3R9LA 5ETPA 1YBUA 2Y1RI 2AP6A 2WTFA 5T7LA 2W25A 5B0EA 1U6BA 3BKTA 1WF2A 2DD8S 5IS2A 4F02A 2M0GB 2FJBB 1N5TA 1UVKA 1KWMA 2HSEB 3AQPA 1R8BA 4QWBA 3SBMA 4PEOA 1RE1B 3FEYB 3R2DJ 4CP5A 1P6TA 1KOHA 2M8DB 5FDLB 2PI4A 3EPIA 3MM9B 1K9MT 5C24A 1U48A 1AW0A 4UF4A 1VQYA 3GG1A 5GAGI 4Q8EA 2HMIB 4JP8A 1N4LA 2RNEA 1VBXA 2BJ1A 2DRAA 1URNA 2BANB 1TUVA 2MKKA 2YWKA 2DGQA 3PKYA 4HL9A 4R5PB 5HVFA 1QTMA 5L46A 2H48B 1AROP 1DQ8A 2KFYA 1XTZA 4KGXB 2C2DA 2L48A 3ZZOA 3JYTA 3P5TL 2XMJA 2CG4A 2B43A 1TKXA 1RT6A 4F50A 2UU9F 3IBCB 3L7PA 4KFBB 4DLGA 2BKNA 3MMBB 4IG3B 1JNZB 2GW8A 3AT1B 2RF2A 3AAWB 4ZS6A 2ZD1A 2WRMA 2C3OA 4RW7A 4MFBB 4DV7F 5E3AA 3VTIA 2UXDF 2OKQA 1HBUA 3PJWA 4H4KA 4WE1A 2IA6A 2Z4PA 1IKVA 1Q79A 3CDBA 3W1YC 3GFHA 1T95A 3OR2B 2QMXA 4LQ9A 2B4OA 2W7PA 4RW8B 2AYGA 2HFSA 4IO9Q 2R7QA 4BWJA 3M6VA 1TKZB 1BQXA 1F3VA 4C8ZA 4WK3A 2BQUA 3ILJA 4YB7A 4DV3F 2VA3A 2OEKA 2BM0A 2DYAA 1DFDA 1RDRA 4KQZA 3VQSA 5KFHA 1RWKB 1KSPA 3MWBA 2ZBQA 4KR0B 1VQKS 2AWZA 2GX8A 2CKWA 1YHQS 4JI8J 4M8LA 1R0AB 1ZPWX 1GT8A 3QT5A 3R8YA 4M5MA 5KFMA 2HVEA 1MW7A 1VI7A 4H4MB 2HMIA 2CJBA 2ZVSA 2MSSA 1RHMB 3O44A 2N4DA 3ONQA 2H51B 2BANA 2ZH6A 3V6KA 3QNWB 1RHQB 1RHRB 4X4TA 2HHUA 4R5PA 4YR3A 2DKOB 3OFEA 4L3KA 2D41A 2M3DA 2HKEA 1S9EB 3RBZA 4DR5J 2GGPB 2E5JA 2MXYA 1S77D 2DCLA 3K5OA 3RBXA 4M5IA 1FHTA 3CJRA 2JOQA 4DQSA 2F63A 2CQ4A 1RHKB 3CO9A 4URGA 4KFBA 2OSQA 1H2VZ 2HHHF 4Q7AA 4IG3A 2IBKA 3J7A1 1G2EA 4NWBA 5HROB 4ED4A 3K59A 1HHQA 2E1CA 1F9FA 8RUCA 4OHXA 3CUNA 1VHIA 1VJQA 3CCWA 2BDPA 3J7ZT 3OR2A 2Q6CA 1QTNB 4RW8A 1RUSA 4OJ1A 4YDXA 2LQJA 5HVHA 3LGHA 4X4UA 1IKYB 1NXIA 1TKZA 3CDEA 2CZVC 2R2UA 2H5EA 3UVJB 2R8JA 4USWA 1AUSL 1RABB 1RTIB 4J9UE 3ICLA 3K2YA 3HHLC 4TU7A 4DFJA 5F0UA 2J8AA 2ZWPA 1F60B 1B70B 4NYZA 2ZBPA 4WTOB 3TYTA 3OFHA 2WZ1A 1FKPA 1N33J 1MN9A 1YJWS 1B99A 3D3BJ 3HZEA 2IIHA 1LK5A 3VAMA 1FNOA 1TELA 4ECTA 1C1CA 1BC6A 5HL7Q 3AJ2A 4X4SA 2YX4A 2X3GA 3NMAA 1HNXF 4ATNA 2W2NP 4KYZA 3L09A 2HBZB 4A8QA 3PFOA 3KNGA 2H5IB 4OV6A 4WBFA 2AW0A 2AEMA 3OJUA 3IXQA 1S12A 4YS2A 2KN4A 2DHHA 2J6UA 2WBMA 1NK0A 3SV4A 4X4QA 3IMQJ 2CXEA 2W9CB 1Y9OA 1MWZA 4RO0A 5HBMB 5KFQA 2XSFA 4C0HA 1B0PA 4ECYA 3NS6A 2P9EA 4DV0F 2QC3A 2VFRA 4DV6F 4IFYB 4DN0A 5HROA 1I1GA 2HWTA 5KFSA 2VA2A 1Y5NB 2VFSA 5KFUA 5IQ6A 1XC9A 4Z7CA 1REVA 4AXIA 2MB0B 4HDHA 3NGRA 2Q66A 4DF4A 3GR1A 3OUYB 9RUBA 1I5OB 3VGTA 1RXOB 1OWXA 4ZVRB 3NG8A 4C0BA 1WC0A 4CIOA 1DY3A 3M1VA 2KM8C 4O4RA 1IBKJ 1HWLA 1BXNA 4FDFA 1SV5B 5KT6A 1IKYA 2PO4A 4ECUA 1XMOJ 1G3OA 2QZ8A 3UVJA 1O0PA 1RTIA 3W60A 4BC7A 3S01A 4NZ7A 4DCPB 5D6GA 1LWFB 3G8SA 3TX0A 4AXJA 3KK2B 3FRZA 2A6OA 4XDCA 1I94F 1YZ7A 4DUYJ 1WC4A 2IRUA 3EVWA 5HQLA 3CJ4A 4CO3A 3MOZA 1KVIA 5KG4A 3QQCD 1WTBA 3LGNA 1YITS 3HSGA 4QWEA 4RZRA 4ZN3A 3MMCB 1PILA 5AXNA 1V3ZA 3BR9A 3M2VB 4QW9A 4NCBA 4DU8A 3PX0A 1NSKL 3QT8A 4PXBA 5B0GA 4RUHA 3M9NB 2F4VJ 2J76E 3A8EA 5EN1A 1V9OA 2YX1A 4LIWA 2QLBB 4N56A 4IRKA 1U09A 3C8YA 2CFXA 1N52B 2DXEA 4N5SA 2W9CA 5AE2A 4FKXA 2XLKA 2VODA 4AE5A 3IR6B 3POTB 3R27A 4LF9J 5IT9Y 5L38A 2MLXA 4FZVA 4FNHA 1OPZA 2RVJA 9ATCB 5C7PA 5KFXA 1OY9A 4HLBA 4NPOA 2D9PA 4IFYA 2OLWA 1SKWA 3FGVA 1X4BA 2CPDA 1VQMS 2KL8A 1CULA 2ZBRA 3HKWA 2GA7A 1FT8A 1V6HA 2RQ4A 2FPHX 3HXMA 4DV5J 1TK0A 5ETOA 3RAXA 3QZ8A 4WPAA 4DDFA 4NEZA 4NLTA 1N34F 4A4JA 3OLAA 4ZLPA 3DLBA 5CCMA 3HVRA 1L3KA 2FVQA 3TUJC 1XBWA 1SV5A 1JKHB 3OL9A 4B9UA 1OY6A 1MSWD 3AH6A 1YDLA 2DK2A 1FD2A 3FQLA 3Q8YA 1G1XA 4IG0A 3OR1B 5AXMA 3KG1A 4KGKA 1GK8A 4P7VA 4PR6A 4O3SA 1FD8A 5DJBA 1LWFA 3CVKA 2CQ1A 4IH5A 3H98A 2ZM6F 2Y1JA 1VQPS 1UPPA 1ZM3A 3ZZZA 2R7WA 4RUBA 1C4AA 3T1AA 4C7QA 1RYRA 3JSYA 1QM9A 2WB4A 3QATA 4KSEB 2VPWB 4ZP8A 3R97A 3E01B 1C2PA 1SVDA 1S97A 2MQLA 1IKXB 2QO3A 4HH0A 1FF2A 4I56A 3OL8A 1UPMB 3I4PA 1XMQF 4KGVB 2XI3A 1NSPA 2HBYB 2VG5B 3NAHA 2KI2A 2AU0A 1AB8A 3D6HB 1QY7A 1XERA 1JLFB 3OHBA 3BGRB 3NNAA 3P3DA 4P2MA 2CQBA 3GJSB 1NCLA 2C2NA 4P10A 2EFQA 4K5SA 5DETA 3POTA 5KT2A 1PG5B 3U7JA 4CT8A 2ZBCA 1JXLA 2O67A 2DIUA 4UY8T 4JI0J 2NZCA 3CIZA 2I5JB 4AL5A 2P9GA 1C1BB 1VK8A 2G9OA 4NYOA 2C3MA 2V5HG 4J9VA 3I32A 3PXGa 3RUBL 2LU1A 4B9NA 3P96A 3MUTP 4K2XA 4DLEA 3W5YA 2E5IA 3SDEA 3RB6A 5CYJA 4KBIA 4DXLA 5LXYA 5KFOA 4OYWA 4KHPF 1CJVA 1M0SA 3QBCA 2H9ZA 2WSEC 1DARA 3S8SA 2K1RB 2E5GA 3T9ZA 3OR1A 4J9QA 5CYQB 4YN3B 5LT5A 2ZDPA 2VF3A 3T1HJ 4G6VB 3D6TB 1TL3B 3SEOA 2VFUA 3Q23A 2A6MA 1LV5A 4I2QA 2B9XA 2E7XA 3L95X 2MLYA 4P9SA 3H8YA 3FUYA 3ISNC 4PRFA 2ZH7A 1A7GE 3DXSX 1KHVA 1ZZNA 3BKFA 1JXEA 3BH6B 3LP0B 1WSVA 1Y4ZB 2PC6A 2RD5C 2XYPB 2ALYB 3DGPB 2YPZA 1IKXA 3D9BA 1KS2A 2NCKL 3QRPA 1EKRA 1U8SA 4IR1A 1NZAA 3QGIA 1ZA1B 4MKAA 2GQ2A 2ATCB 2JZ5A 3EYZA 5I4MA 2VG5A 2AYBA 4C2MA 4QR1A 3GIKA 1QVFR 1CVJA 3BGRA 2B5JA 4GKJF 1N56A 3M2UB 2XMVA 4OYOA 4G3IA 4JYAJ 1RT1B 1VQ4S 4C8MA 2JRSA 5A2QY 1IQTA 3RBDA 4FPIA 3DRRB 3DXBA 3GYGA 3PG9A 2PGCA 3FFIB 2HQCA 1HNZJ 2R7SA 5HJYA 1SPBP 1WEYA 2PI5A 2XULA 5L9XA 3BSAA 2ROEA 2I5JA 2CQIA 1RWXB 1V3RA 1R8PA 1JLCA 1YJRA 5KTQA 1KLMB 1IJEB 3CJTA 3SFUA 2V9KA 2RU9A 2ZWOA 4A8FA 3A13A 2J7KA 2MHEA 4F25A 2QFIA 3G6ES 4CCHA 5D0GA 2H3EB 1APSA 4NYPA 3PW2A 1M5OC 2ASLA 4OMFG 3MM7B 2DEIA 2VBYA 1K47A 2VQEF 4Q44A 1S0MA 1EB0A 3W8PA 4KE5A 2XQCA 2ASJA 5ETMA 5GMEA 2KKHA 3AB4B 2QGFB 3TJ8A 2KRBA 4YQWA 3EWGA 3M6WA 3HHLB 4WXOA 4FKYA 1K73T 2C2RA 3UQSA 1U2CA 4FF2A 4ECZA 3KTQA 5BYSA 1EP4B 4B02A 1X4EA 2OSRA 4E0DA 4IH6A 2K7JA 4YFUA 3LP0A 2VC0A 2QX0A 3DGPA 3RRHA 5B0BA 3MR3A 2CNOB 2RHSB 4WP3A 5CA5A 1DZ5A 1VHFA 3IAM9 2ZUGA 1NMEB 1KKHA 2ZH1A 5T41A 1T94A 4F7VA 5CHCB 4O3NA 5KOXA 3FCVA 3QJPA 4NLYA 1RLCL 1O5JA 3QJLA 4TY9A 3M2UA 5AE3A 2EW9A 2MQ8A 3CIMA 1X9MA 1FJCA 1RT1A 3H7HB 2ZITA 3OTOF 4RNHA 1NJZA 2GQCA 4HT7A 3DRRA 1HI8A 3C66A 1KTQA 1YSJA 3FFIA 2N82B 3HJFA 1Q1KA 1MMLA 1G7CB 2OEMA 1U1RA 1SQEA 3IA0A 1WOPA 4HR2A 4I7FA 4QIFA 4CLZA 3RW6A 1OSDA 1WOOA 3D68A 3MXHP 2BQRA 4GVBB 4JI5F 4HYKA 3AOAA 1BLUA 1KLMA 3M6XA 4P73A 2J0SD 4DR3F 1X60A 4FS1A 2R7TA 4EI2A 1HBMA 2ZC4A 4ECSA 1R8HA 4PUOB 2JNJA 2RDIA 3BB5A 5AE1A 2KM8B 3NGTA 4CLKA 3VAKA 2XCAA 5KFDA 1S76D 4JI7J 4ZLNA 1OO0B 4WFZA 3E2EA 5CXTA 3GSIA 3IM9A 5F0WA 3PYDA 4A48A 4X62F 4NLRA 4O3QA 2UUBF 1RKIA 4JI3J 2UUWA 4ZK7M 4QYZK 3D7SB 4CH1A 3HHLA 2XNQA 2OTJS 4I67A 1AFJA 4OV1A 1LW2B 4CLSA 1EP4A 5HP1A 3JQJA 2XY7A 1JJCB 1TV6B 1YVFA 1VOMA 3MEGB 2F3JA 1HWUA 1JLEB 2V8VA 4WF9Q 2JEJA 4FYXB 3N5BA 3I56S 2XBPA 2H4YB 1RLDA 3GMGA 2E5HA 1P1TA 2CJ9A 5EWGA 2NXUA 5FD1A 1PKUA 2HZAA 2D1CA 1IN0A 1SL1A 1S99A 3ZTSA 1U6FA 4OYBA 1R31A 4J9KA 4O44A 4J7CA 3S6EA 4K2JA 3PKMA 2RB7A 2Y1LB 2QA1A 1YJUA 4QYZJ 2DGSA 3KLHB 2J9DA 3SQGA 1ZA2B 3FMWA 1F6TA 4E8UA 2X1AA 4C8OA 1RK8A 4USTA 4GVBA 4NLPA 3KMSA 3SI8A 2XZWA 4W98A 2A18A 2CJQA 5IT9U 4P75A 2LKZA 1NDPA 2ASDA 4QWAA 2HNYB 5IFMA 2CZ4A 1CC7A 3DRXA 2GAGC 5DG7A 4PUOA 3I31A 4KO0A 3UWTA 2JDJA 2CPZA 3VGSA 2ZHAA 3HHNB 2CQGA 2MSTA 3R5CA 4CQ1A 4MKBA 2KYXA 1EQ0A 1IR2A 5LMUJ 2VFVA 3MUMP 5D78A 4DR6J 1D9AA 3EUNA 4C3MA 3N6MA 3GV7B 3VALA 2Q79A 4LRDA 5GADU 1LW2A 2B4PA 2Z2ZA 3C15B 1CBKA 2CJXB 3ELHA 2AEFA 4UTGA 4JI1J 5F9LA 2M9KA 1ZH5A 4EUVA 1JLEA 2NXCA 4LR8A 1MMNA 3MR5A 3U27A 4IRDA 4C8YA 2I0XA 1XR5A 1X0PA 5HMZA 1UZHA 2GHWA 2XHWA 4Q2MA 2VB6A 1AT1B 4JI8F 3D6FB 3NLCA 3UN2A 3ZZTA 2LDYA 4KAIA 1TL7B 5ETLA 3GONA 3ZZRA 1F3FA 3OSNA 4J9PA 4R0JA 3UN3A 2ZH4A 5L1KA 1I6JA 5I3UB 2LQ8A 1NSQA 2XWXA 3CJ2A 2UU9J 2W8KA 1HA1A 3ZC4A 2AGOA 2G1DA 3BN4A 2A10A 2GO9A 2HW3A 3QLHB 4W90B 3IWXA 1YK9A 2KT5A 2UXDJ 2C22A 2YNHB 4C48A 4TU9A 2CZ9A 4DR5F 1M1GA 4RR5A 2EPIA 4YHHJ 2CAJA 4WJBA 4ZPDA 1SH2A 4ZPCA 1WC3A 2OP5A 4B08A 3C19A 2HWIA 1WOSA 1CPZA 4LSZB 2FHOB 5JUMA 4ANCA 2HNYA 1IM4A 1N36J 4B3OB 1S4EA 4K4SA 3N28A 1LK7A 2QYCA 1FDAA 5ETNA 1PGZA 4X64F 4IO1A 4OYXA 6AT1B 1ZM9A 3W61A 3OVSA 4ZPVR 1CJKB 2DGWA 4N8OA 3KHHA 2HVDA 4Y28C 2MKJA 5JMNA 1IR0A 2AZ1A 2X1GA 3UD5A 3W64A 1BHNA 4OYMA 2IVFB 2XLIA 2RILA 1FJ7A 4HHJA 3KUEA 1H0HB 1HNIB 4N76A 3M7VA 4ILMA 3LWMA 2WVDA 1RWNB 3C15A 3THPA 1W25A 3F56A 5K5MA 1X5OA 2XO6A 4C4WA 1GXTA 3RR8A 5D77A 4UUXA 1SJ3P 1NB2A 2HYIB 2HURA 2RJZA 5BR8J 4LUBA 3Q8PB 4NE9C 3MCNA 5E3CA 5FJ4A 4KHRA 1NHVA 1T3OA 5F8LA 4CO0A 4PAAA 4DR1J 3OD2A 2VV5A 3LA0A 4HHUA 1N33F 1XWLA 1RTHB 1TL7A 2HHPA 2CDQA 3H2VE 3VAIA 2CNKB 3NXZA 4DZDA 5ETSA 1SKSA 1TL4A 5B0AA 2QIFA 2R7XA 1MROB 5HQ8A 4KGMA 5I3UA 4K50A 2GHPA 5RUBA 3PYEA 3FBBA 1KFSA 3W7BA 3PY8A 2V8GA 1PJ7A 4X65J 4XIUA 1SJRA 3QLHA 3B4MA 4ICLB 4ERDA 2RH3A 3TQEA 5IXUA 1NPKA 4M95A 4E98A 1FE0A 4QIEA 2YNHA 3DRSA 3CJQA 2ZNZA 1G4CA 5H9FK 1D3WA 1WI6A 4ZCLA 1VRQC 5THWA 3CD6S 4BBYA 4EFAC 3IR5B 3H90A 1N0UA 1HQEB 1HQUB 1PYOB 1GAOA 4WZMA 4X4PA 1KVKA 3CCQS 3RB3A 3UNYA 1TTHB 3UCGA 2R4FA 1VBYA 5CZXA 1UW4A 5F41A 3GYXB 6FD1A 2B6AB 1RAFB 1CJKA 3T1YJ 4ER8A 1FVQA 4F36A 4HI1A 1EJ7L 2V2KA 4DSFA 2YX7A 1FNXH 3MM8B 2HRTA 5EX0A 1IBKF 2HWHA 3BZQA 1H73A 2XS2A 3RZAA 3ZZPA 4ALZA 1GMWA 3FSIA 1FRMA 4ZKAA 3LALA 1XMOF 3AFGA 5D0HA 1RBAA 4I69A 4USKA 4M5LA 1NK6A 4TLRA 1S0OA 4WP9A 3K5LA 1D9FA 2QL5B 4XPCA 2ZBIA 1WG4A 4DSKA 4I6YA 2H65B 5EWFA 5D0RA 2GMJA 4PG5A 1RTZA 1U1MA 3LPYA 4DUYF 4FXWA 2V4RA 4Q8FA 2BMBA 3PV8A 2BM1A 5K8NA 2DR8A 1RTHA 3GFYA 3U1LA 1ITPA 1RT5B 5IQQA 3K89A 1IBMF 2W01A 1KOOA 2DNQA 3HD2A 3DCAA 5KOWA 3PTWA 2M70A 2ZH8A 4F2SA 3C2PA 2HHWA 5LMNJ 5D4PA 2FJAB 3TRGA 2Y0BB 3ENVA 4RWWA 3MEEB 3RRKA 3W63A 5HI7A 4ZVSB 2VHGA 3NCQA 2BE7D 2F4VF 3H0PA 4FPRA 1T9XA 1S0NA 2VIHA 1DBDA 1RWWB 5MAOA 3TEGA 2W9AA 2MQOA 3UCUP 3THTA 3IS9B 1OQ3A 2PEBA 1X4GA 1TR0A 1DRZA 1SKUB 1QSSA 3KJNB 3NS5A 2DHSA 4RBVA 4LF9F 1HQUA 3TJAA 3BBFA 2I38A 1E6VA 4K59A 1RAGB 3Q83A 4XTTA 2L3MA 3R3TA 5E3RA 2MZJA 1FDBA 2V68A 3HI9A 2QN6B 5CAAA 2KYZA 4H4KC 3QIDA 4CI0B 3L4BC 3CTRA 1P9QC 3ENQA 1OMSA 4QJVA 1CC8A 2AMCB 2B6AA 2E66A 4C0OC 1K44A 2GMLA 1RAAB 1FTRA 1IUJA 4X2BA 3EGWB 4UW2A 4DV5F 3AOBA 3BPDA 4PABA 4F4WA 3IR7B 3CCLS 4ZLLA 1L3UA 3GR0A 1ZPVA 2G13A 3MM8A 1OSCA 1H98A 4JV1A 4F3MA 1S57A 1HPZB 4D3HA 2MZSA 5LSRA 2FJEB 3IG1A 4ECXA 1VLYA 3HJVA 5H1SV 4LBPA 5F9NA 1D8ZA 1N5VA 2R8IA 1IBCB 4AQYF 4ZP9A 3CCRS 3GILA 3UDVA 4GC7A 2DNKA 2AGQA 2RRNA 3KHGA 1RAOA 5J2MB 1KR4A 4DL5A 5J2NB 2OELA 2IYGA 3M9OB 4MTPA 1RT5A 2HAFA 3MCOA 4QCLA 1NK7A 3G6VA 4ZVFA 3A3OB 3O6QA 5C25A 2FZCB 4DX6A 7FDRA 2E7VA 5I3QA 1DHMA 5AJ3J 2VONA 3MEEA 2AHOB 3CCVS 4NI2B 1UTAA 2HK2A 3GCXP 2DTJA 1WSRA 2JFKA 3MM5B 1N5YA 3KKFA 1Y7PA 1Y3KA 2XTJP 3MM6B 2DNYA 5GMDA 2W2QP 3ZTQA 2Z2LA 2EKNA 3HO1A 1NKCA 2AJ2A 2XY6A 2XCPA 2OIHA 4JI6J 2DNZA 1TL5A 3K7RA 2RS2A 2QG9B 5KFJA 3B6BA 2W8LA 3M05A 4JI0F 5KFVA 2PEHA 4JOUA 4CH7A 3V5RA 4NCGB 3KLEB 1SB6A 1QUPA 3GTYX 2EK6A 3GIMA 3KJQB 1NAQA 1S6OA 2V8HA 2DVIA 2YNFA 3TZZA 2HNZB 1GFWB 2VG6A 4KGZB 1GX5A 2JLGA 4DPXA 3HLUA 2H4WB 1WEZA 2B7BB 5DM7Q 1HQ2A 4UOFA 1FRHA 1QJHA 2OFGX 2WVCA 4PG7A 3ILIA 2PMHA 1HPZA 3M8RA 2MZ1A 2AT1B 2C1EB 3F0NA 3BSNA 1SI9A 2FJDB 3S7RA 2CPJA 5KFNA 5DRKA 5ETQA 4NOHA 3KK1B 3OXGA 3TAQA 5GMKa 3T1HF 2BJ9A 4CM2A 3J7YI 2KO1A 5B09A 2HZCA 1Q8LA 5J2NA 3IWLA 3N0VA 3DDIA 3QRRA 3WZ0A 3P6YC 3V4MA 2PT0A 1ZZFA 3OXLA 3UN5A 4OI3A 2NR0A 2P6TA 4IR9A 1PAUB 2WVEA 4ZVEA 3W9JA 4PWWA 4OHVA 1FE4A 3AD7C 3NL0A 3OTCA 1PBAA 4RW6B 3MTKA 4NI2A 1PO6A 3MM5A 1S49A 3EVOA 4GMKA 4FYYB 5CCLA 2EC0A 3DMJB 3MM6A 4P2XA 3HCXA 4DR7J 2CIMA 4JYAF 3OVBA 3A3PB 2FVSA 2BJ7A 1RWVB 4C98A 4IYQA 3T9NA 4GC6A 1NK4A 4M5DA 5DM6Q 4Q2LA 1HNVB 1HNZF 3H2LA 4KTQA 1U02A 3TW0A 4FYWB 3CJ8A 4FN5A 4LR9A 2XGQA 3Q2SC 4CTAB 1IJFB 3GIJA 3KLEA 2ZJPQ 4NASA 2FVCA 4A8XA 4DF8A 4FF3A 3CJKB 2FGCA 1GH8A 2OJ3A 1MU2B 3SCKE 1NZ8A 2G0CA 2HNZA 2N3LA 1GMVA 1RWMB 2ERRA 3HSJA 1URRA 4CNZA 2FHKA 4ZA1A 2OI2A 1WHWA 2POKA 2DNHA 4WFNQ 4OYZA 1A6LA 3DOMB 1HBOB 3GP9A 3I0SA 2BVZA 1Y11A 4U95A 5DZ6A 4KRWA 2J0WA 1H7WA 2E44A 3RJMB 2JL9A 1ZAVA 7AT1B 2Y3YA 1JJHA 4NLUA 3V2UC 1VQ9S 3AD9C 2CVIA 1NU4A 1T9TA 5ITHA 2HGMA 5C2GA 1RAIB 3RB0A 2YQ1A 2C2KB 2BW7A 4DCOB 3CF5Q 2E9RX 1NDCA 3QFHA 1NDKA 3TQ1A 2W7OA 4NXNJ 3TAMB 5BJRA 1YQHA 4L3NA 1YJTA 3OSPA 3AJ1A 4DCJB 1HD1A 4F3QA 4U9RA 3KHLA 1EETA 3TZXA 3H40A 4NA2A 1NRKA 2HHXA 2CYYA 2DH8A 4S0MA 3UD3P 5JVGQ 1RHJB 5F8HA 2B9EA 1JMTA 2Z57B 2VASA 3GJRB 3DDNA 1BWVA 5A8KB 1RT4A 4O3OA 4LREA 2GJFA 1BUXA 4OI6A 1NK8A 2E1RA 2NPIA 2YXLA 2APOA 3PFEA 1P1LA 1ZAWA 4IRCA 2DR9A 4USUA 4M5JA 1FWLA 1IR1A 4BDPA 2IMOA 3FK4A 2AJ4A 2NUHA 3PJ9A 4ZHRB 4OI4A 2IJFA 2PDAA 3CJKA 2JEGA 3H5UA 1HWIA 1MU2A 2B8PA 3DYAB 1Q81T 3N79A 1D0EA 1PSDA 2EFOA 3O1LA 5HO4A 1FESA 3AODA 4GO7X 1NH8A 3PJXA 2QA4S 4F4XA 3WDOA 4DPUA 4LF8J 3NP5A 3ISND 4ED0A 5KFWA 4NX9A 2BOPA 1UJ6A 1ZAXA 2WW4A 3CSKA 4I6WA 4QOTA 2KXHA 4JI3F 2RE1A 2CQHA 5K8OA 1FERA 2G4BA 2XEXA 2HIQA 3BYRA 4FP9A 4GVLA 4Y00A 2OO4A 2LVWA 3KXDA 3P5BP 3PHTA 2YKPA 2FGOA 2RUGA 3AA8A 3D4JA 3TAMA 2PA8D 2WSCC 4TU8A 2D7SA 1M5KC 1XNQJ 3UDCA 5GAEI 2CPFA 2DGXA 2FZGB 4K8RA 3M2RB 2Z30B 2UUAJ 3ZTOA 3RTVA 3VAJA 1S1VB 2IVYA 5J1NA 5E2QA 4EO8A 4NMXA 3QGGA 4F26A 2CDRB 3MZIA 2PE8A 1ZM4A 3SXLA 4YY3J 1HHTP 5A8KA 5HAOA 2R7VA 1U1PA 4OX9J 1S9GB 3HX9A 2XYHB 1QUVA 2AJQA 2CWXA 2VPYB 2K3IA 2FYXA 4ZVHA 1T03B 4ZVOB 4EYHB 4ZHRA 3ULHA 2BZ2A 1F5CA 4ED2A 1YWXA 2IY5B 4WU3A 3HMJG 3DYAA 2KB2A 3PHEA 3QZ7A 1CEZA 4RU2A 2F65A 2IAJB 5E5NA 1FA0A 3CCES 2MDAA 1SC6A 2UVVA 2AD9A 2EFGA 3HHEA 4PG4A 3WX8A 3TOQA 4RLEA 5G0RB 2CNLB 1D8YA 3OXFA 3CO0P 3JTOA 4RPFA 5LMUF 2N7YA 3JSRA 3SCIE 3N01A 4DR6F 5IT4A 2FVRA 2LXUA 2IRXA 4KJIA 1JJ4A 2G0JA 1NK9A 2DR7A 4KIAA 2XGPA 1YBAA 3SV3A 4M5GA 3HSDA 2W2OP 1S48A 3FJ2A 4JI1F 5GAHU 6FDRA 1A9NB 2AJFE 4MIWA 4LIRA 1N0VC 5DQIA 2J8SA 2XY5A 4XDDA 1JIHA 4KPCA 4NXMJ 4ETZA 4KH1B 4GRSA 3KLGB 3M2RA 2FC9A 2FDNA 1AZSB 4ES3A 4IQXA 3MPDA 2GMHA 4B9MA 1RU1A 2BKPA 3V6DB 1S1VA 4A47A 3DRPA 1N32J 3TO8A 3PACA 4X66J 2X3DA 1X4DA 3HHKA 2EG1A 3FBFA 4URSA 1QLNA 1S9GA 2UZAA 4NZ0A 2V0NA 4LF6J 3EX7B 3QPIA 4USMA 3PIOQ 5HMWA 4K4TA 1X4AA 1UEUA 2WONB 2HFVA 4ZJQA 1T03A 2ZDOA 1RA7A 4MIAA 4YHHF 4HDGA 3G86A 2HHSA 1XN9A 3G82B 5DGAA 2ADBA 4OZNA 1TMMA 2JH3A 3DNCA 2IAJA 1K1SA 1WF0A 1N36F 4DFMA 4WWSA 4DHVA 1NSAA 2HK3A 4J9RA 1J5EJ 1RA6A 4KY3A 5IWAJ 1KEKA 4ED3A 1RAJA 2RAQA 3SFGA 2P5VA 2HGNA 2NUUG 1WG1A 5G0RA 4OHYA 1UWBB 2C2MB 1TUGB 2ZC3A 2NXNA 1R7IA 4ZCMA 4RW9A 1WHVA 5ETRA 1UVLA 1N48A 2I8EA 3PW0A 3M32B 4OX8A 3SCJE 4WTYA 2VICA 1FKPB 5HSPA 3L7UA 4KKOB 3M8PB 4EGLA 1MG7A 2AIRB 4R0EA 1M5VC 3R6LB 1C1CB 2R3VA 5BYQA 2OAUA 2VL1A 1EIYB 3LGMA 2Z8QA 4RJVA 5DS7A 2ILZA 5CD4A 2J7UA 2FHJA 1TP7A 3OV7A 5BR8F 1PJ6A 2HHTA 1X8DA 5CH7B 2OD4A 1ZBTA 1RTJB 3D0HE 4MH8A 1S6UA 2VPZB 3FZ2A 4HEA9 2E5LF 4DR1F 1XIQA 1GEHA 3KLGA 1ACMB 1AZSA 3HFVA 1ELOA 3IGNA 4ZJOA 2QMUB 4YDDB 1J5OA 2RU3A 1KNZA 3V6DA 3BBBA 3S1TA 4ZVGA 2WSFC 3GV5B 2DITA 2W4CA 5J2PA 4X65F 3CGIA 5B0CA 4DFPA 2NXEA 2XS7A 2EEYA 2KXFA 3PR4A 3C16B 4J9MA 4X64J 4QIWD 4GKKJ 2WONA 3D2WA 1REVB 1K1QA 1VK3A 1FWPA 2XMUA 5F3TA 4EMDA 4DSJA 3G82A 4LRAA 4TXSA 4RX6A 3EZ5A 3B4DA 3X3UA 3M1VB 5EHHA 2YQ0A 3GU0A 1VFJA 1WF1A 3GSDA 2C42A 1PYSB 2NYIA 2F8MA 2LP4A 2VUGA 1YJ7A 3FDSA 1RGVA 1T9YA 3GJTB 3N5FA 2X51A 4NRUA 1UWBA 1VIXA 1VIOA 3TZWA 3T1YF 1GQEA 2YY3A 4JI2J 1UP1A 2JC0A 2RQKA 5CQGA 3M32A 1NDLA 2HFOA 1EZZB 4C11B 5FLXY 1T05B 4DL7A 4RNMA 3C6UA 2ASYA 3MPVA 4KKOA 3M8PA 3V6JA 3J7YU 5F8IA 4EBCA 2IRYA 2V67A 2R7RA 2XMMA 5B0FA 4BS2A 4W92B 4O3PA 2JX2A 1X4HA 5K14A 1U49A 2NPFA 4WYWA 5A8RB 4HHHA 3CDUA 4EBEA 2VQFJ 1RTJA 3CEDA 1HNWJ 5C5JA 3MR6A 3RW7A 3UDEA 1KHWA 2BUNA 2RHQB 1M90T 1OYEA 3NOGA 2W1BA 2K06A 3EGNA 3FZBA 1KTVA 1DQAA 1OY8A 5HANA 1LFPA 4RUCA 3VWSA 1YRXA 1HD0A 1OPIA 1RZMA 2ACMA 2DGUA 2YPYA 4USJC 5LMNF 3EDQB 3D1OA 3I6PA 4X84A 4R8UB 2X1FA 4U96A 3MF5A 1B7FA 5DG8A 3MFHA 2H54B 1PYTA 1R0CB 3FNNA 2BACA 3JB9k 3C16A 3QGHA 4LSLB 2LECA 1CULB 2UVUA 4OYAA 4A8KA 4LFBJ 1S7HA 2QLWA 4JI4J 3SSQA 4AYBD 1M1HA 1R89A 5HJXA 2N7CA 5F8NA 2OUGA 2M7SA 3QJJA 4K4UA 1F0XA 3UI3A 1VMBA 4DR2J 8ATCB 1WTFA 1FK9A 3O5TB 1H74A 2A2CA 2NSCA 4OHWA 4PPDA 4NCAA 1KN6A 3QWUA 1Y3JA 3ZFVA 3NNHA 3TZYA 3I9ZA 3MEDB 2YNIB 4IG0B 1LXJA 4YP3A 1N5QA 3P4UB 2V2ZA 4CRJA 1TQLA 4OI1A 4ED6A 5GADI 1MLAA 2CQPA 2QMWA 4Y0FA 3RYLA 4C11A 1T05A 4N41A 4OQJA 2A0FB 1UJ4A 5KFKA 5HQMA 3MUVP 4HKQA 2RDDA 2MJNA 4QBUA 2GAHC 4K4ZA 1IBMJ 2BRLA 4RNNA 2E7WA 3QAEA 4QU7A 2ALZA 3OJSA 5KFAA 4WFBQ 3BV8A 1VQSA 2FLNA 1VC6A 4O0IA 3D28A 5F3ZA 3NRBA 3M8WA 4K4VA 1EKSA 4B3TJ 5A8RA 3MMJA 2L9NA 2B0GA 3Q86A 1RT3B 3CJ3A 1NJXA 4P6QA 5J1PA 1HW8A 1T8EA 3UD4P 3R1HA 1RCXB 4K0KJ 2DHAA 4A46A 1S7IA 4CLFA 1X5TA 3K8VA 5KAKA 2E9TA 1UA0A 5D8HB 3T6JA 3CXCR 3CW2C 5SZTA 2RRBA 4X4NA 2KJWA 3C3LA 5AJ3F 4R8UA 4CWBA 3DM2A 3R6GB 2YWFA 3OFFA 4I6AA 3KWMA 1TFWA 3KMQA 2QSFA 2J9CA 4KT0C 4OJHA 2IYIA 2GIFA 1VISA 3BQ0A 3Q89A 2VBWA 3NKYA 4LSLA 4I4BA 1WACA 2DBBA 1U26A 2YVSA 3TVZA 2J6SA 2ZOFA 4JI6F 3SDEB 4MT1A 3RRGA 4KH0B 3KYLA 5HN0A 3KDNA 3PYFA 2A3JA 4B9SA 3DI6B 3ZZYA 2CJYB 1VQ6S 1CJVB 2HQIA 4N47A 1TL1B 2D74B 1IVZA 2OD6A 4Z37A 4NLOA 3Q8SB 2PD1A 3ISZA 4ZVPB 3MEDA 2YNIA 3T5LA 1Q78A 4AQYJ 2WVFA 2OEJA 3IP0A 4USVA 2MZTA 1JLGB 2KU7A 4I2QB 3TA0A 4H4OB 1WKLA 2LA6A 4U8YA 2Z2YB 2C3YA 3CDAA 3M30B 2JLFA 3MMAB 4YR2A 3AHPA 1DJ0A 3FC9A 3JTPA 2ZJQQ 4IQMA 2OGUA 3G87A 4ELVA 1NHKL 1HYSA 3SIPB 5A8WB 1LQ9A 2O01C 3GCWP 1RT3A 1WI8A 3FBEA 2E1MC 1Y5LB 2FHMA 2R8GA 3NOCA 3RGIA 2B5JB 4CH0S 2KHDA 4KHMA 1SKRA 1WKKA 1NH7A 5GAEU 2QEXS 4A8SA 3F44A 3NGKA 1R27B
chains in the Genus database with same CATH topology
2JOQA 3TARA 4FPRA 4DQSA 2CQ4A 4B3SF 1U1OA 3CO9A 1S0NA 1DBDA 4URGA 5CZVA 5MAOA 2MGZA 4KFBA 2W9AA 2MQOA 5J1EB 2OSQA 1H2VZ 3UCUP 3THTA 1KLNA 2HHHF 3ITHB 4EU0A 1VC0A 3IS9B 4Q7AA 4IG3A 2IBKA 3J7A1 1G2EA 4B9TA 1OQ3A 1X4GA 4ZPTR 1TR0A 1TKDA 3B8HA 1DRZA 3UCZP 4NWBA 4IOCQ 3CJ5A 5HROB 4BWMA 5M2RA 1QSSA 3NS5A 2YKOA 2RSQA 1LW0B 2DHSA 3K59A 4RBVA 4LF9F 1HQUA 3M8QA 3GV8B 1DTQA 1JLCB 1LFWA 4WFYA 3UNGC 2E1CA 2XG8A 2I38A 2FY1A 1E6VA 1F9FA 2KHCA 4I68A 3WC2A 4K59A 4OHXA 1HI1A 3CUNA 1ZM2A 3CC7S 4J9SA 3BGLA 4XAKA 1JWWA 4WYLA 2BV3A 2L3MA 3Q0AA 3R3TA 2HG4A 3DHXA 5E3RA 4DR7F 2MZJA 1FDBA 3HI9A 3CCWA 4ZMMA 4ECQA 2BDPA 2KYZA 4H4KC 3PZPA 1E6YA 2GIRA 4USIA 2J9EA 3J7ZT 4DS5A 3QIDA 4CI0B 3OR2A 1S79A 3CTRA 1P9QC 3ENQA 4QJVA 1CC8A 2B6AA 3E3XA 2Q6CA 3K57A 2E66A 4ECWA 4C0OC 4RW8A 2GMLA 1C0UB 4OJ1A 2Y0SD 4YDXA 2LQJA 2WOMA 1FTRA 1R6YA 1DURA 4HTJA 1YGYA 2PFFB 4X4UA 1IUJA 3IC1A 3MECA 1YIJS 1IKYB 4X2BA 1TKZA 4C97A 3CDEA 4A8YA 3EGWB 4X4RA 1JLQA 4DL6A 4UW2A 4DV5F 3DI6A 3WX4A 2CZVC 2L41A 2R2UA 5KFEA 4OZJA 2GQQA 2V4QA 3PO5A 3N6NA 2VPXB 2H5EA 1TL1A 4F4WA 3IR7B 2R8JA 3CCLS 1L3UA 2ILYA 3GR0A 1ZPVA 2G13A 3MM8A 1RTIB 3ICLA 2X1BA 2O3DA 4RWXA 1K0TA 1OSCA 1H98A 1O8BA 3TA2A 2NREA 4JV1A 4F3MA 1DLOB 3PW7A 3K2YA 3HHLC 1HPZB 4TU7A 1UVIA 1W2IA 4D3HA 4DFJA 2MZSA 1TV6A 5F0UA 2J8AA 5LSRA 3O8WA 2FJEB 3IG1A 2Y1IA 1JB0C 4ECXA 3KLIA 1F60B 1VLYA 2YKMB 3MEGA 4NYZA 2FB0A 1JLGA 1UETA 4I2PA 3TYTA 3OFHA 3OLBA 3CB4A 4FF1A 3E8OA 4H4OA 3G8QA 1KD1T 3K5MA 2GC8A 5H1SV 1NKEA 3I4HX 1FKPA 3HFKA 4X4VA 5F9NA 1D8ZA 1N5VA 2R8IA 3F41A 4AQYF 1YJWS 4F8RA 3HZEA 4ZP9A 4DL0C 4Y34A 3CCRS 3M30A 2J9DE 1LK5A 3M8SA 4QPXA 2B3TB 3MMAA 3VAMA 4LF4F 2UVRA 3KFWX 4C8LA 4WFAQ 1FNOA 2A2DA 4G1QA 3GILA 4ECTA 1C1CA 2IA0A 1BC6A 4GC7A 1UFLA 2DNKA 1LWCA 5HL7Q 3AJ2A 2MQPA 2AGQA 2RRNA 1Q53A 2YX4A 4KB7A 4X4SA 3K0JA 2X3GA 1GX6A 3KHGA 1VQLS 2DRBA 3NMAA 5J2MB 1KR4A 4DL5A 4NMLA 1U1KA 1HNXF 4ATNA 1S6PB 5J2NB 1X7VA 1VBZA 3L09A 2DNNA 3O3LA 2DNOA 3DDKA 5A8WA 3LANA 4A8QA 2IYGA 3M9OB 4MTPA 3PFOA 4PQUA 1RT5A 4DSIA 3KNGA 3H4BA 4QCLA 2M5YA 1NK7A 3G6VA 4DEZA 2AW0A 4ZVFA 3O6QA 5C25A 3OJUA 3IXQA 1P27B 4ID8A 2KN4A 2PIIA 3DLJA 2J6UA 2WBMA 7FDRA 3SV4A 2W9BA 1NK0A 2QE5A 1JX4A 4N77A 4QR2A 2PA3A 4X4QA 1SJ1A 2XMTA 5I3QA 1DHMA 1Y9OA 3L7OA 2W9CB 1MWZA 3D54A 4Y2KA 1U1NA 2VONA 3MEEA 3BQ1A 2JLEA 3NNCA 3CCVS 3QMQA 2JSXA 3KLHA 4NXNF 5HBMB 5KFQA 2XSFA 2PSZA 2DTJA 2JFKA 2W7AA 1IBLF 4C0HA 1LKZA 3MM5B 1RT2B 1B0PA 4ECYA 3N9UC 1N5YA 3NS6A 3KKFA 1Y7PA 3SYZA 1Y3KA 1FDNA 4ITSA 2DO0A 3D1QA 3HVAA 2P9EA 2DT9A 3MM6B 5J1EA 2DNYA 5K8MA 4DV0F 1UEVA 5F8JA 3ITHA 1YRTA 1U47A 4U7CA 4IFVB 4TLQA 3DRPB 1MWYA 2Z2LA 2VFRA 4DSEA 4DV6F 4LQ3A 3PRDA 1M5HA 4I7FB 1NKCA 4IFYB 4DN0A 5IT0A 5HROA 2RKIB 1I1GA 2XY6A 3HO1A 2HWTA 1Z1ZA 3PNIA 5KFSA 2XCPA 3V6HA 1Y5NB 2OIHA 2VFSA 2VA2A 4QZVB 1LW0A 2DNZA 1TL5A 5KFUA 5IQ6A 1LOUA 2VKRA 2ZKTA 3K7RA 2RS2A 1XC9A 3DLLQ 2OMOA 4CT9A 5KFJA 3RBEA 2O1PA 5EDWA 1REVA 4AXIA 2R8HA 2MB0B 2ZFHA 4HDHA 1ULRA 3TNVA 2Q66A 2V94A 3VZHA 4DF4A 2XI2A 1OQ6A 3GR1A 2M88A 4IH7A 2HS3A 1S1WA 3OUYB 2FJXA 3HZGA 2W8LA 3PW5A 1PC5A 2L9WA 3M05A 3KK3B 4JI0F 2KH9A 3ETOA 1HBMB 3MCSA 5KFVA 2PEHA 4JOUA 1OWXA 4CH7A 3V5RA 1H2UX 3NG8A 4NCGB 3KLEB 1SB6A 2CJAA 4C0BA 1QUPA 4CIOA 2EK6A 4AUKA 3GIMA 1VQ8S 1UL3A 1VRUB 3M1VA 2OH2A 2IVMA 2KM8C 3BQ2A 1HMVB 3BSCA 2DJWA 4O4RA 3T5HA 1YJ9S 1C0UA 1NAQA 1S6OA 2EKYA 1HWLA 1Q8IA 1SV5B 2FC8A 5KT6A 2V8DA 1IKYA 2V8HA 2PO4A 2YNFA 2DVIA 2HNZB 5L9NA 2IM2A 4ECUA 4QIVA 5H9EJ 3CC4S 4V19X 3NMRA 2VG6A 5EWEA 3UW1A 1GX5A 3H25A 2JLGA 2KZZA 1SBRA 3FRYA 1G3OA 2QZ8A 3HLUA 2BXJA 5M2UA 2LU2A 1RTDB 1K0VA 1O0PA 1WEZA 3HVWA 2B7BB 3TUZC 5DM7Q 1RTIA 1FKAF 4BC7A 1FRHA 1QJHA 3S01A 2OFGX 4NZ7A 5D6GA 4PG7A 1DLOA 1LWFB 2ZE2A 3G8SA 2PMHA 1HPZA 3M8RA 3PX6A 3D5MA 3C46A 2MZ1A 4AXJA 3KK2B 5E7OB 3FRZA 3H4DA 4XDCA 1I94F 4DQRA 3MI7X 3BSNA 1ZOTA 4FVCA 1KQKA 2YKMA 4Y2AA 4WFXA 1BQMB 5AXLA 1SI9A 1KRPA 5HP1B 4RW9B 1CQNA 2FJDB 3IRWP 2FLLA 2J7WA 2V4JB 3MD1A 3S7RA 5KT7A 2CPJA 2IRUA 2MQNA 5KFNA 3CJ4A 1ZTWA 5DRKA 4CO3A 2DGOA 3MOZA 2DB1A 4LF8F 4IOAQ 4NOHA 3KK1B 3OXGA 3TAQA 4TYBA 1KVIA 5KG4A 5GMKa 3T1HF 3V81B 3D0IE 4WIIA 4DN9A 4B3RF 4I64A 3LP1B 1WTBA 3DFEA 3LGNA 1YITS 3J7YI 4QWEA 2KO1A 5B09A 4RZRA 2WK4A 4QR0A 3PRBA 2HZCA 3MMCB 1PILA 3DLKB 5AXNA 1Q8LA 3QO9B 4WU2A 1FXRA 1Q7LB 1S6PA 1V3ZA 5J2NA 3BR9A 3IWLA 3N0VA 1WHXA 3M2VB 2CRLA 4QW9A 4QWDA 4NCBA 5LL6d 2NS1B 2MY7A 2IFXA 5I3PA 3WZ0A 3PX0A 3P6YC 3V4MA 2PT0A 3DOKB 1QAIA 1ZZFA 1RYSA 3OXLA 4PXBA 4XO0A 4NZ6A 4OI3A 2M8HA 2NR0A 5B0GA 2P6TA 4RUHA 3M9NB 4IR9A 1VJWA 1VRTA 3KJVA 2J76E 1NB7A 3A8EA 5EN1A 2R2SA 2LXIA 1V9OA 2YX1A 3BDPA 4LIWA 4BCAA 2R2TA 4ZVEA 4N56A 4IRKA 5KFTA 3TP2A 5HLFB 1U09A 3C8YA 2CFXA 3G6XA 1L3VA 2FUG9 4OHVA 4ZDNA 4DV2F 2QLXA 3MPYA 1FE4A 1N52B 4JBCA 4QW8A 2BR0A 4N5SA 3OTCA 2W9CA 3FSXA 1K8AT 3NL0A 5AE2A 1SL0A 2XLKA 2IC3B 2VODA 4RW6B 5DGBA 2B4UA 3MTKA 4AE5A 2LLZA 3IR6B 3PEHA 3PR5B 4MJKA 4NA1A 3POTB 3R27A 4O44B 2HS4A 5KG3A 4DQQA 1PO6A 5IT9Y 3MM5A 1RT2A 4FYDA 1S49A 1CQMA 4PXDA 4XPEA 1YI2S 3KLVA 5L38A 2WB1D 4GMKA 2ZHBA 1D9DA 3BM7A 2JJ4D 1RP5A 4FZVA 5CCLA 3CC2S 2EC0A 3DMJB 3MM6A 4I0WA 1J5OB 4FNHA 3OVAA 1OPZA 4QPTA 2RVJA 3H5SA 4GO5X 3OHAA 4IFVA 1XNQF 5KFXA 2CIMA 4HLBA 4JYAF 4NPOA 3OVBA 2D9PA 3MHYA 2EI5A 4IFYA 2RKIA 3SQGB 2FVSA 5JJBA 1C0TA 2OLWA 1LWEB 1SKWA 5J2PB 3FGVA 1X4BA 4OJGA 2CPDA 4C98A 3CMAS 5L1LA 3LOUA 2UUAF 3BDEA 4IYQA 2XO7A 1VQMS 3T9NA 4DPOA 3HKWA 4GC6A 1NK4A 4M5DA 5DM6Q 2F9DA 4Q2LA 4B3OA 1HNVB 1HNZF 3H2LA 2GA7A 1FT8A 1V6HA 2RQ4A 2FPHX 3HXMA 2MHNA 3KG0A 4KTQA 2CPXA 5E3PA 4OX7A 3CCMS 1TK0A 3TW0A 2OPPB 1Q4RA 3HT3A 2K7KA 4O4GA 4J5OA 3KK3A 4FN5A 2XGQA 3Q2SC 3VAHA 4CTAB 4HI2A 4YY3F 3RAXA 3QZ8A 1QVGR 4DDFA 1IJFB 2XS5A 4NLTA 1WWHA 1KC8T 3GIJA 3KLEA 5JVHQ 2ZJPQ 1N34F 4OX9F 1GNKA 4ZPBA 2JVOA 4A4JA 2FVCA 4Y3CA 4A8XA 2EG2A 1VRUA 4ZLPA 3OLAA 4IDKB 4KO0B 4DF8A 4WCEQ 1HMVA 4FF3A 2K3KA 3CJKB 3DLBA 5CCMA 3H2UB 3HVRA 4TQSA 1L3KA 2FGCA 3TUJC 2FVQA 1XBWA 2OJ3A 4ES1A 1GH8A 4Q0BB 1MU2B 1R8CA 1SV5A 5K8PA 3SCKE 1JKHB 2XLJA 2G0CA 2DISA 1G6BA 1RISA 2HNZA 2N3LA 3RU0A 3OL9A 3LAKA 4B9UA 3HHDA 4B9VA 2MQMA 2ERRA 2MPUA 1MSWD 3AH6A 1HNIA 2DK2A 1RTDA 1FD2A 1URRA 4CNZA 2FHKA 3FCHA 3FQLA 1G1XA 4IG0A 4ZA1A 3OR1B 1WHWA 3KG1A 4KGKA 5AXMA 2POKA 5CYMB 4RUAA 2DNHA 4NLVA 4OZLA 4WFNQ 3TR5A 1A6LA 5KFRA 4P7VA 4PR6A 1BGXT 4OHZA 4O3SA 3OTBA 1FD8A 5DJBA 1HARA 1LWFA 2VG7B 3CVKA 4M94A 2CQ1A 4IH5A 1HBOB 2NZ4A 2QFJA 3H98A 2ZM6F 3M4XA 2Y1JA 3I0SA 1VQPS 2BVZA 5B0DA 3KLFB 4MAKA 1ZM3A 1BQNB 4TQRA 1RKJA 1IKWB 3ZZZA 5LSLA 2VD3A 4KRWA 3KOAA 5H9FJ 4JUZA 5KFPA 2ATLA 3X1LB 2R7WA 1VGYA 2J0WA 1BQMA 2VKZG 3HM9A 1H7WA 2E44A 5FDLA 1C4AA 1LXNA 2V4JA 3T1AA 2JL9A 1UVNA 3MM9A 1ZAVA 3CCTA 4V19J 4NLWA 2HRYA 4C7QA 1F5AA 4RKUC 1RYRA 4ED7A 3JSYA 1JJHA 1QM9A 2WB4A 4UOCA 2ZH2A 4NLUA 1S0VA 2D3UA 3V2UC 3V81A 4KSEB 2VPWB 1VQ9S 4ZP8A 4J9OA 3LAMA 3G8TA 1BWEA 3E01B 1C2PA 3LP1A 2XSJB 4JV2A 2CVIA 2RS8A 3JAMY 3C6UB 1NU4A 1S97A 2MQLA 5ITHA 5L1JA 1IKXB 2HGMA 2QO3A 3H5XA 3I5AA 1Z4UA 2QV6A 3DLKA 3MURP 1HW9A 3QO9A 4HH0A 3RB0A 1NJYA 1FF2A 4I56A 3BO2A 3OL8A 1U6ZA 4CZCA 2BYCA 3I4PA 4ETXA 3CF5Q