2ROEA

Solution structure of thermus thermophilus hb8 ttha1718 protein in vitro
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
b'MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy metal binding protein
publication title Protein structure determination in living cells by in-cell NMR spectroscopy
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Metal binding protein
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2roeA00
2RMLA 1YJRA 2IYGA 1SQEA 2ROPA 4DPOA 1GXUA 3LO3A 1Q4RA 1P6TA 2XMTA 5A6WA 1Y0HA 2OAUA 3FGVA 2KYZA 4QOTA 2AW0A 4ZA1A 4Q2LA 5B08A 1JK9B 2RSQA 2KKHA 1CC8A 5B0BA 3KKFA 1YJVA 2FTRA 4HI1A 2KT3A 2N4CA 1TR0A 3FMBA 3BR8A 2GO8A 1ULRA 2GGPB 2OD4A 5T7LA 2IYIA 2VH7A 2K1RA 5F0UA 5T7LB 2CRLA 1P8GA 1SI9A 1V3ZA 1FD8A 1YJUA 2K1RB 1GXTA 3HX9A 3KG0A 1R6YA 2GV1A 2AJ1A 5B0FA 1YRXA 3HDSA 3QGPA 2BBEA 2K7KA 2ZDPA 2OMOA 2QIFA 2HQIA 2XMKA 4HH0A 1Y3JA 2IFXA 3HHLC 1KQKA 2K2PA 2ROEA 4F67A 1OQ3A 1WD6A 2HFOA 2OFGX 3BDEA 2AJ0A 4DL0C 4YDXA 1MWYA 3IWLA 1Y3KA 2OP5A 2EW9A 4Q2MA 5A6PA 5F0WA 4A47A 2ROGA 2VV5A 3F44A 5B0DA 2OFHX 4A48A 1FVSA 1VQSA 2KT2A 4Y2KA 3GZ7A 1KVIA 2RILA 2W4CA 2LXFA 2K7JA 1N5VA 3MZIA 1Q53A 1FESA 1XBWA 2LQBA 4A4JA 5KAKA 2FB0A 1OSDA 2FHMA 2XMVA 3KG1A 1LQ9A 1TL5A 3BF4A 4NPOA 2OKQA 2HFNA 3HHLA 4OJ3A 1OPZA 1RJJA 2GA7A 3HHLB 4OJGA 2LDIA 2HIQA 2W4DA 3IWXA 2L3MA 3HF5A 1IUJA 1FEEA 4Y2IA 2XMWA 2XMMA 3BM7A 4EFAC 2ACYA 4HH1A 4NL5A 4OJHA 3I9ZA 4FNIA 1APSA 1OQ6A 2HLUA 4OJ1A 1N5QA 2AP6A 1QUPA 3QMQA 2G9OA 3LGNA 4U9RA 3TNVA 2HLTA 4HI2A 5B0CA 1TL4A 3FRYA 3BGUA 1S6UA 2BYCA 2GFFA 1TUVA 5B09A 1N5TA 1URRA 2QYCA 1FE0A 3HFKA 4YEAA 2QLXA 2BJDA 3BN7A 3KNGA 4A46A 2BUNA 2LQ9A 1SB6A 1S6OA 2OD6A 3K7RA 1X7VA 3E8OA 3TRGA 1FE4A 2BJEA 3DCAA 2ASYA 1Y9OA 1YJTA 2ZDOA 3HHLD 1CC7A 1Q8LA 3DXSX 4HL9A 1FVQA 3BB5A 2W4PA 1AFJA 1AW0A 1CPZA 2XMJA 4FNHA 4ZOSA 2FIUA 5B0EA 2PGCA 3UDCA 1KVJA 1TZ0A 3TOQA 1U7LA 1VQYA 2RU9A 4DN9A 2N4DA 2XMUA 4OIXA 1X8DA 1N5SA 3MCSA 4Y2MA 2GGPA 2PD1A 1JWWA 1MWZA 1X0PA 2JDJA 2QLWA 3CJKA 5IXUA 3CJKB 1YG0A 5B0AA 2GCFA 1W2IA 2N7YA 5B0GA 5K9FA 1AFIA 3T9NA 1K0VA 1Q8BA 3VTIA 3LGMA 2Q3PA 3WDOA
chains in the Genus database with same CATH superfamily
3BZQA 2Z0GA 4DL5A 4NOHA 3PRVA 3IG1A 1VYAA 3LQVA 4F3MA 1VQ9S 1UVLA 5AE3A 1TAUA 4C0OC 1RA7A 3VF0B 5GADI 3W9HA 1ZZNA 1FX4A 3VAFA 5T7LB 2DYAA 5KFDA 1CJVA 2QLBB 3SFGA 2H5JB 4LIRA 2HBYB 3KLVA 2QIFA 1Y3JA 2ROEA 2Z4PA 3D9BA 3MAHA 2PE8A 4ZPAA 2MKJA 2IAJB 2WW4A 5THWA 2KG1A 5AT1B 3N01A 3MUMP 2MKCA 4LBPA 4QWCA 4LQ3A 3CCSS 3KHRA 5CYQB 3NCQA 4USIA 4EFAC 2YWKA 3POTB 2HAFA 2YNFA 1RWNB 3G6ES 3C15B 3D6HB 2KL8A 2YNIA 3BSCA 2LQ9A 1NKCA 2W7PA 4RW8B 1Q8IA 2NCKL 2FLLA 2FJAB 2DPJA 2ADBA 4DV7J 1YG0A 2KH9A 4GC7A 5KT7A 2Z57B 4ZP7A 3D68A 4B9MA 4DFJA 1FWLA 2X1AA 3W2WA 2OPPA 3R9LA 3SXLA 5GAEU 3MR3A 2FDNA 2W2PP 3FEXB 2ZH6A 4LSNB 4IFVA 3BJYA 5A0YA 3PHTA 1Y3KA 2FPHX 3CB4A 2ZBCA 1LWFA 2LEPA 3X1LB 3Q8QB 1CS4A 1QSYA 1HA1A 4NLPA 3DHXA 4HR2A 4F0KA 4HTIA 3DKDA 4U7UK 4ZVQB 4RO0A 2DJWA 3W5YA 4CLZA 1DQAA 1HBOA 1I94F 3I9ZA 3UPFA 2BJ1A 4NXMJ 4DV2F 3E01A 2G9OA 2J9DE 3W60A 4W98A 1RADB 3BGRA 3SCLE 2E9ZA 5ETMA 2CPYA 3MEDB 1EX8A 4Y6IA 2UZAA 2FC8A 1FE4A 3MM7B 1B99A 2A0FB 2EG1A 1M1GA 4M5DB 4ED1A 2B7BB 1JLAB 1A9NB 3AJ1A 2H3EB 4TVAB 3L7OA 1OYEA 1LWCB 2QMXA 2XM3A 1U2RA 4N76A 2OELA 3MTJA 1RKIA 1CC8A 3CIMA 4HI1A 4NXNF 2N4CA 3D4JA 2MQOA 1S1XB 4P73A 3KHGA 2OMOA 2JEFA 2VKRA 3H2LA 1R31A 1ZPVA 4ECYA 4R0JA 4Q2MA 4ECQA 3U1LA 4A4JA 1IR0A 3IBWA 4XIUA 4CZCA 3S1TA 1JJHA 1TL7A 2V6AA 2PDAA 1R7IA 2I9SA 2F1FA 1U02A 2HS3A 3AB4B 1RHMB 1QUPA 2N3LA 3CMQA 3FFIA 1WNEA 2BANB 4V1Ak 4F36A 5BR8F 1RISA 3M4XA 4CO0A 4C9DA 1YRUA 3TAMA 1AFJA 3C66A 5LSOA 3CMES 1U7LA 1NSAA 3SSRA 2CPDA 3ZFVA 1TKTA 3F41A 1T05A 3IR7B 3MECA 4UW2A 2HAIA 2V9KA 2E9TA 3PRDA 1OYDA 4QR1A 2DR6A 2FVQA 3EGVA 1WHXA 5F8JA 1U6BA 2OEJA 4HEA9 4PYAA 2XMKA 1SKRA 2ZH5A 4LVOP 1YZ6A 2VKZG 2KJWA 5L39A 2ILYA 3RJMB 2P9CA 4ZLNA 4NPOA 3NAIA 4ZIVA 5SZTA 3R5DA 3GIKA 2GQCA 4D3GA 2KVIA 1M5VC 2CQ2A 2K8GA 5CCLA 3OHAA 1NM2A 5KFYA 3WZ0A 2YKNA 2DNRA 2AV5A 4FYDA 4X4UA 1QD1A 3CC2S 3ILJA 1RTIA 3AODA 1FWPA 1D1UA 4MYTA 3V6DA 3NNCA 4X62F 4RNNA 3DOLB 1VRUB 4DUTA 4HL9A 1RWWB 5HP1B 1KONA 1MNEA 3ZZUA 4W90B 1NK6A 2VG5B 1ZOTA 1VQYA 2DGOA 2RKIB 1D9FA 3JAMU 1SL1A 3DMJA 1IR1A 7FD1A 2JEIA 2HGLA 2Q3PA 5CA5A 3QQCD 1G3OA 2NUHA 2F65A 4CLWA 3V6HA 1S76D 3RB6A 1XMQF 3GYXB 4JI6F 1RBOB 5F8NA 1VBXA 4B17A 3MEGB 3EYZA 2CAJA 4O0IA 4DXLA 4TQRA 1SV5A 1N33F 4J9UE 3OFHA 3EZUA 1Y5LB 2D69A 1WEYA 1QSLA 3MOJB 3ISND 4PXEA 1VGYA 3TEGA 4B3RJ 1OQ6A 2BW7A 8AT1B 5IQ6A 2AT1B 5H9FJ 2QTWA 3RR8A 2OLWA 4I4BA 4H4OA 3PIPQ 3UI3A 3N28A 2R42A 1KHVA 5LJ3Y 3GILA 2Z2YB 3SDEB 2FJXA 2Z8QA 4OIXA 2IIHA 3IAS9 3IA0A 4KB7A 5IXUA 1LKZA 5L1LA 2EBEA 1Q4RA 2DNLA 1BQNA 4F4XA 4ZN3A 5KT3A 1T9TA 2XC9A 1N6QA 4AT1B 4J5OA 4PG6A 2KT3A 2Y3YA 4NLTA 4JI7F 3NMAA 2W2NP 3OFGA 2GJIA 2DH8A 3UN2A 5K5MA 4AFFA 2VG6B 3PNIA 4MH8A 5BXIA 2HZAA 2OPRA 1UVIA 2BVZA 4CLYA 2E5HA 1OSCA 1FKAF 1FHTA 4Q0BA 2V8VA 4USUA 1WHYA 1LV5A 2F5GA 1FF2A 2B5JB 1RLCL 5KT4A 4ZLJA 3AXMA 4I7FB 3BPSP 2IM1A 2E1PA 1JB0C 4K0KJ 2YBVA 3PW7A 4JI5F 3B78A 4GO7X 1U1PA 1PG5B 4O4RA 1IWAA 3NOGA 1U8WA 3C16B 4TY9A 1HQEA 2E5LJ 1TKZB 3M32B 3OFEA 5KFJA 4P2SA 4JV5F 5AXKA 4LQ9A 2JDJA 2KYXA 1KVKA 3CDEA 4DSLA 2W2QP 2N7YA 2CQGA 5GAGI 4YUDA 3CCVS 2QEXS 4K2JA 4LF2A 2HHPA 2CYYA 3RBEA 2VG7B 2FVPA 1WWHA 3G8SA 1GT8A 4USVA 2FY8A 3OLAA 4RW7A 1UVNA 1QAJA 1FFSB 2I8EA 3K5OA 2Y8YA 4C98A 3G96A 1DLOA 1F5CA 3QSYB 4QZVB 2ZKTA 2OFHX 5B7WA 2ZM6F 1AZSA 3M6UA 2W4CA 3UN3A 1DQ8A 3RR7A 1KKHA 5J2QB 1I51B 3C6TA 3MPYA 5ITHA 1FNMA 2DHSA 2BW2A 3DDKA 3BH6B 3CCUS 4N47A 1SJFA 3Q2TC 2C3MA 2YKOA 2MXYA 5J2NA 3HHLD 4I68A 4WU3A 4L6V3 1VR6A 3I55S 5KG0A 2YNHB 2OO4A 3HPOA 4IO9Q 3O44A 4Y00A 3PKYA 3VALA 1VQ4S 2VBXA 2A6OA 2KDOA 1VK3A 2ZOGA 1DTTA 1UVMA 2HHHJ 3MMCB 3SQGB 1IBLJ 4WP3A 5HMXA 4NCGB 3CDUA 2VICA 2IJNA 3HSZA 4WCEQ 2FJVA 2OD4A 2ZBQA 4CWBA 1H0HB 1S7HA 4AL5A 2AJ1A 5C25A 3GG0A 5GMKa 3ENVA 1RT3B 2IRXA 4PG5A 3PYGA 3IR6B 3H5SA 1EP4B 1RHJB 1CULB 2HNZB 4DCJB 5DRKA 5HQMA 5GAEI 2RQMA 2O01C 3UNYA 3C19A 1FFWB 4WK1A 2CWXA 4Q7AA 4DR2J 5A8WA 1KR4A 3HXMA 1RTZA 1WTBA 2GW8A 2MHNA 3M9NB 3JB9k 2QYGA 5J1EA 1RWVB 2X1FA 3KMQA 2D7SA 1PJ7A 1YI2S 3IAM9 2JWNA 1L3UA 4J9RA 1Q0NA 5D0EA 3HVWA 2HWHA 2XLKA 3PW5A 1CJKB 4B3SF 2VODA 4ILMA 3MPUB 3TAQA 4I67A 1VQ5S 3UD3P 2OMLA 3Q8UA 3FMBA 2OPSA 3MR7A 4Q8FA 3LUYA 4OZLA 4DV5J 1HWIA 1WG4A 5KFVA 2RJZA 3H8YA 4OYOA 2BA9A 5F3ZA 1KOHA 3H59A 2R8KA 3VGTA 1B7FA 1SKWA 4PG8A 2DCLA 3HHLB 4X66F 2OTLS 3IWXA 1XWLA 5H1SV 4U96A 2L3MA 3PEHA 3T5HA 2YQ0A 4FNIA 3ZZRA 4DZ6A 1OWXA 2DNHA 3HP6A 2IM0A 3T1HF 2A2CA 1URRA 1FA0A 4C2MA 3VGUA 3QGIA 3IWNC 2HMIA 1JLQB 4JYAJ 2VPYB 1HMVA 5C42B 1T03A 1U48A 1SUQA 2QLWA 1WELA 2PEBA 4F4WA 3WDOA 4MYUA 3T5JA 4ID5A 2MY7A 3V81B 3FQKA 1N0UA 2BOAA 4M5GA 5KOXA 3H4BA 1JNRB 1F2GA 2EC2A 3LOUA 4USWA 4WZQA 2KXHA 2EFNA 3TYTA 2VA3A 4TYAA 5C24B 1VMBA 1OPZA 2HQGA 2R7VA 4RZRA 2RS8A 3MOZA 2R8JA 4KFBB 2I1RA 1FO1A 1NPRA 1RT1A 3W8GA 4P2FA 4X4RA 5LMNF 3T1YF 1XERA 5IC6B 2NLWA 1RTDB 4PPDA 4YB6A 2YNGB 2ASYA 2AU0A 4ANEA 1VLYA 2QN6B 4C8OA 3E2EA 2J9DA 1CVJA 1VK8A 1VCTA 4NZ6A 4Z37A 2JH3A 1H6KX 2KT5A 1SL2A 1RDRA 2DNYA 1FWKA 1IBKJ 4KHRA 2XSFA 4FZVA 2VUGA 1CLFA 2M4MA 1N0VC 1YWXA 2BBEA 2K7KA 5CYQA 3J7AN 1FTCA 4K50A 2MLZA 4BWJA 3CD7A 4ZK7M 1REVA 1RWOB 2CPIA 3C15A 2RRNA 5E2QA 4CDIA 4ANDA 2M2BA 4AUKA 3C6UB 1UL3A 2IVMA 1BWEA 3VQSA 4LUBA 4ZVFA 3UDLA 4F50A 2ACYA 1QE1B 4R0EA 2EEYA 5JVHQ 2H65B 3GV8B 3ITHA 3LPEA 4IG0A 3EZOA 1HBMA 2IRYA 5JJBA 2C2NA 2F63A 1Y00A 3GFYA 2WRMA 3OTOJ 3KLEB 4ICLA 3NBPB 3M1VA 3TW0A 2AYEA 4G1QA 1K0VA 3AD9C 4LSNA 1P27B 3MPVA 1HQUB 4X4NA 3MM5B 5U47A 2LECA 5F8HA 3H4DA 2U1AA 1HYSB 4ZPBA 1FXLA 1UVJA 5CZVA 2JRSA 3V4IB 4H4MA 1KQKA 2BE9B 1Q16B 1NK5A 2RAQA 3FBEA 4DMZA 2MQNA 4ZVPB 4PZVA 4UQGA 1TKDA 2VJUA 3V2UC 2QFJA 3DYAA 3MM8B 3KLGB 4ZP9A 2HWIA 5IWAJ 2KRBA 4M5DA 4NL5A 4NLQA 3NWRA 1ZAWA 1CJUA 1ZBTA 3K58A 5ETTA 2WVBA 3PYDA 1XR6A 3M6XA 4ZJQA 5A2QY 2NYIA 5H9EK 3KUGA 1V3RA 4W4MA 5EX0A 2VONA 4NYPA 3ET6A 3QLHB 5E5NA 3DRRB 2MZ1A 4O3OA 3ZNUA 2ASDA 3LAMA 2MJNA 4KH0B 4KHPJ 4PWWA 3EICA 1BQMA 2G2ZA 4DR4J 3ISZA 1HD1A 3R5AA 1S48A 2DXDA 4GC6A 2HZCA 3M7VA 4RNHA 3SIPB 1S6QA 5M2RA 1P8GA 2FD2A 1UEUA 2P2CB 2HVDA 2WONA 3M8WA 5KG7A 2GJFA 3DRPB 2JX2A 2BQ3A 1T8EA 1T7PA 2RHQB 3NCPA 4ZMMA 3N79A 3R97A 2CZ4A 3G2XA 4KH1B 2QV6A 1IKYB 1PO6A 5LXYA 3C14A 3T41A 1RT6A 2CJXB 5HLFA 3IFEA 2VQFJ 4Y2AA 1HQ2A 3FCWA 2KFZA 3TI0A 4NXMF 1B0TA 4OLPA 5KG2A 4NMXA 3TZYA 4LF1A 3PO5A 5DO2A 4ETZA 3VVUA 3IN5A 2ZH1A 1RYRA 3THVA 3SCJE 1S9GA 1WOSA 2HIYA 5I42B 3D1QA 2DIVA 3L09A 3Q83A 2RSQA 3PTWA 2E5IA 2HHTA 2NSCA 2MSSA 3DRSB 4FYYB 4LRFA 2B51A 1JLEA 5M2PA 1YBUA 4CM0A 2AJ0A 1JNZB 1WDDA 2CJ9A 2G2YA 2V8HA 1TMMA 2ZZMA 1XQIA 3NNAA 4PG7A 1GFWB 2DVIA 4ZJOA 4OJ1A 4BDPA 3PY8A 3FRYA 1FFGB 1C0UB 3MF5A 1Y10A 2YWHA 2AJFE 1E6VA 2C2RA 4DI6A 4NLVA 4CH0S 3TZXA 4NCBA 1RLDA 1TK8A 3DXSX 2R7TA 2W4PA 1C4AA 1RCOB 1M1KT 2YWGA 1A6LA 2ZHBA 4Z7CA 5DQGA 2QLJB 4XO0A 2UU9J 2A1BA 2GVZA 2MYFA 5GAHU 4KPCA 4IDKB 2IBOA 2HVEA 3HKZD 3M8RA 1EETB 2F4VJ 1GX5A 1NJYA 3DDIA 2XY5A 3DM2A 4PXCA 4CIOA 4P75A 2I38A 1NSKL 1HI1A 5F8LA 1ZM3A 1FK9B 3HHEA 3SV3A 5K20B 3QT7A 5KFTA 3DN9A 1RTJB 1QM9A 3MAAB 2XS5A 3N5FA 3N9UC 3ZNJ1 2QZ8A 2XYPB 4HI2A 2NZCA 4AL6A 2IMOA 1DHMA 3I5CA 4UOGA 3AY0A 5DQIA 4M94A 2KO1A 1KVJA 2OSQA 5EX3A 2VPZB 3R1HA 2IJRA 2ZKUA 2YTCA 3PJWA 5C2GA 2I5JA 4FS2A 4CO1A 3FGVA 1QVFR 3OT9A 4Y34A 5E0OA 2VG6A 1FRLA 4DR1F 2BOPA 2J0XA 4IQXA 5DETA 2XZTB 1U2CA 3ILIA 4DR5J 4C4WA 2BE2A 2XSJA 4DF8A 2O66A 2M0GB 2VL1A 3ZZYA 5J2PB 3UW1A 3PR5B 3MMAA 3GV5B 4O23A 4DQRA 3CE8A 2C3OA 4ZCIA 4Y28C 4NWBA 1RAJA 1WOOA 2LDYA 2RF2B 4QJVA 1X7VA 4G1PA 2NS1B 5L9XA 3QRQA 1EARA 1R6VA 4IFYB 2M88A 5ETKA 1UZDA 2AEMA 4ECSA 4QIEA 1Q79A 1AFIA 3PW0A 3PJ9A 4ECTA 2JLFA 4DPOA 1KS2A 1SC4B 3UD4P 4I64A 3GFHA 2ABYA 3J7ZT 3HVTB 3J80Y 1HBUB 2BXJA 4ZJLA 4OZ5A 5J2QA 3HDSA 1NEEA 1F2HA 4WTOB 4DOZA 4XDCA 2ROGA 3B8HA 3ETMA 4DQQA 3TVZA 1S9EA 1B7YB 1T9YA 3Q86A 4QIGA 2MZSA 4DFMA 3RB4A 3JSBA 1ACMB 1DY3A 4DHVA 4CLUA 4K7QA 1HW8A 3ZXWA 2R8GA 1KRPA 4CTAB 2W2MP 4MIAA 3BREA 3OUYB 4ECVA 3CJ2A 3SQGA 5JXSA 3HMJG 2OSRA 2DGWA 4NCGA 1VC6A 4MJKA 2ZE2A 2GHVC 4NI2A 4TXSA 4UTGA 1JWWA 5B0GA 4WFBQ 3SBMA 3KJNB 3QJPA 4O0NA 1NZ8A 1P6TA 3IG1B 2C3YA 1FNOA 1OMSA 3Q8SB 3U02A 2HURA 1V6HA 3TX8A 3JQMA 7FDRA 4CLSA 4H54A 2HNZA 1CJVB 4DX5A 2V8DA 3ADAC 3W62A 4QCLA 3THTA 1YKWA 2GMLA 2RILA 1FRHA 1Y5IB 4FXVA 3ZTRA 3HFZB 3FVYA 2HIQA 1RHRB 3PFOA 1K8AT 3M9OB 1Q86T 3OVSA 3IM9A 1RAGB 4DS5A 4B9TA 2A3JA 1TUVA 3K5LA 4H4KA 1LWXA 3QO9A 2DEJA 2V8PA 5EDWA 2NXJA 1CJKA 1TL3A 1BGXT 2J0SD 1H7WA 2JJ4D 1KLNA 2HFZA 4CT9A 1BC6A 1X9SA 3CMAS 3RU0A 2DO4A 2PD1A 3I0RA 3QRPA 2KB2A 1H7XA 2RNEA 1RWXB 1VQ6S 4JOUA 3TA0A 4DV4F 1BXNA 3OR1B 4DUZJ 4JV0A 2MTLA 3W2WB 2CIMA 1RWUA 2W1BA 1UW4A 2W7AA 5BR8J 1ZAVA 2N82B 2NQPA 1SKUB 1F9FA 5A0YB 3KWMA 3RAXA 5K8PA 2VBZA 2CQIA 1LWFB 2VPXB 1FJGJ 1JJ2R 1NHUA 3LANA 1CS4B 4DQIA 2ZBRA 4TN2A 2WSCC 5D0RA 2F9JA 1HBOB 5C42A 1RACB 5GMEA 1S1UA 3E01B 2XTJP 1NSQA 5E3CA 4X4VA 1X5SA 3D66A 4RUHA 3BGRB 3EUNA 1N34J 2AYBA 1VQKS 2AJ2A 4PR6A 5CD4A 4U8VA 2WSEC 2Y1RI 4EBDA 2OPQA 2PEHA 1CQMA 4L3NA 2GCFA 2GC8A 2VF3A 4I6WA 4QWEA 3HHKA 2B9XA 1VQOS 3H20A 3F56A 3HI9A 1RT2B 5HI7A 4MK8A 1VHFA 2X3GA 1FXRA 5C24A 4QW8A 1GMUA 2M52A 2E9RX 1IKVA 1NK9A 2F8MA 2VPWB 1VISA 4WE1A 2E66A 3BBCA 3O5TB 3J81U 2HHWA 4QIWD 2DNKA 4X62J 2HPUA 3OVAA 3IMQJ 1EZZB 3CNQP 4I2QA 5JMNA 4TLQA 1LW2A 1RTDA 1YBAA 4OJGA 1U1KA 2YNGA 1TL7B 3WX8A 3M9MB 2C28A 3KUHA 2D9PA 4BWMA 3HHNB 4I1TA 3BDPA 3KDOA 4U9RA 2M8DB 4RUBA 3FFIB 4X4TA 4JI2J 3CJSA 1ZA1B 3ZC4A 4JI6J 3H7HB 3JAMY 2BUNA 3FC9A 1R8AA 3DCAA 4UF4A 3TAMB 2VFUA 2H9ZA 2QA1A 4OI1A 5KFWA 1X9MA 2DKOB 2IHR1 3BV8A 4DDFA 2HSEB 3NY0A 3UD5A 1Q8BA 1TKTB 2DXFA 1T05B 4JYAF 1N33J 3MECB 4KBIA 5DLGA 2JL9A 1KSPA 3ZZ0A 4LR8A 1K0TA 2L48A 1D8ZA 4EZ6A 2WOMB 3F73A 3TVYA 5KT2A 3C6UA 1TTHB 2HQ3A 1QJHA 2QL7B 1NJZA 1YRXA 3HT0A 4M5HA 3MR2A 4YHHJ 1S1WB 2EFOA 5F0WA 4LSLA 5KG1A 5GAHI 3BPDA 2KXNB 5KT5A 2CXEA 3NWGA 1RGVA 2FHOB 2ZJQQ 2R7XA 3IP0A 4KKOA 1RWKB 5DG8A 5J2MA 2CQHA 3NBPA 2UVVA 3K5MA 2YKNB 3VV2B 4PQUB 2QO3A 4K8RA 2MMYA 2DGUA 3DLKA 3TR5A 3GLJA 4HHUA 5KFEA 3V6DB 1HQUA 3MM5A 3NS6A 4C3MA 1NPKA 3TAPA 2MZRA 1L3KA 4DCPB 3I32A 2H48B 1WI6A 4FF3A 1T3OA 2FJBB 3RB3A 3DMJB 1IR2A 2KHDA 3GP9A 2YKMA 2G13A 3I6PA 3FEZA 3PX6A 3SV4A 3NGKA 4BS2A 5D4OA 3D28A 4M1KA 1AUDA 3LA0A 4QWAA 1ULRA 2ALYB 2VH7A 1OO0B 3UCGA 3MM8A 2Y9HA 1G1XA 2CPJA 3OTEA 2IFXA 2X1GA 1IBKF 1N56A 3Q24A 3A1YG 4X84A 3MGJA 1SJQA 2KT2A 3CJQA 3FBBA 3RTVA 1SV5B 1O51A 3KG1A 4E98A 5F9LA 1UPMB 2G0CA 2XWXA 3BO3A 1MMDA 2D3UA 4LFBF 5JUMA 3IR5B 1SQGA 4WP8A 4KRWA 5FIIA 2CJAA 1H74A 5ETSA 3R6GB 2ZDOA 1M90T 2NXNA 1HPZA 4HHHA 5KFFA 1VS3A 3NG8A 4F3OA 4DX8H 3D0HE 2RD5C 1UCNA 3CJKA 1Z4UA 4WFNQ 1W2IA 1XR7A 1SVDA 1XC9A 3VTIA 2GHPA 3I4PA 2NPFA 2CG4A 4ELTA 2X1BA 1BQNB 3BSOA 1N6QB 1RT4A 3M2UA 4K4TA 3ZZZA 4HT5A 4V19X 1SJ4P 4DR3F 3HD1A 1HI8A 3GFXA 1GXTA 3V6KA 1IKYA 4F4KA 2ZZTA 4F67A 4NLOA 1MWYA 5D4NA 3L4BC 4JI4F 2HK3A 3TJAA 4RW9A 3JSMA 4ECUA 2YKPA 3N6MA 1V3SA 4DSEA 2OPRB 1RXOB 4P10A 2RDIA 4C6AA 4Q0BB 3CEDA 3HSJA 4HH1A 2V5HG 1DZ5A 4ENOA 3CO9A 1KLMB 2JC1A 3IC1A 4KHMA 4QYZK 5I42A 3QJJA 3BSNA 4ZPDA 2QYCA 5IWAF 2UUWA 2RS2A 2W25A 4FS1A 2BX6A 3DC2A 4JUZA 4BLGA 5IV3A 2PGCA 1HQEB 4HACB 1LW0B 1HHQA 2CADA 5LSRA 1WEXA 4NX9A 1ZZFA 4ZPVR 4EZ9A 5LSLA 4K5SA 4LF5J 1KFDA 2R8IA 1B0VA 1JLFA 3DNCA 3L95X 3CJRA 3KLFB 4DR4F 3OXLA 4QU6A 4UOFA 1F1BB 2JLEA 4CLTA 2LMIA 3RGIA 1SI9A 3M8ZA 3SCKE 2XWYA 3JYTB 1Q8KA 1RKJA 3M30A 2E1RA 3B4DA 1VQMS 1DLOB 4YFUA 2ZH9A 3GR0A 5EWEA 2HBZB 4DSJA 4XDDA 5I4MA 2LXIA 2UUAF 5D8HB 2HNDB 4ZDNA 4ZCLA 4J90A 1O5JA 3FCVA 3NP5A 1U47A 1F3FA 1LWEB 4ITSA 1U49A 4YDDB 3Q8PB 5KFPA 2LA4A 2NREA 2BYCA 3V5RA 3BQ2A 3TUPA 1ZM4A 1MROA 1PYSB 4L73A 2NUUG 2RUSA 5J2NB 1L3SA 4D3HA 2PC6A 3GU0A 1RCXB 3W2VA 4QR0A 3CC7S 4NYOA 2B9WA 2QC3A 4ELVA 1N32F 1EETA 3OTDA 4FBUA 3KK1B 1IJEB 1VFJA 2LQ8A 1EB0A 5KFNA 1J5OA 3DLHA 1HNZJ 2QRRA 1KNZA 2V2VA 5B0BA 1ZH5A 2ATLA 3AFGA 3NRBA 4R5PA 2IYIA 3RBXA 3VAGA 1F5AA 3D1HA 3HO1A 1UKUA 3W9JA 4IOCQ 5IZHA 3T1HJ 1R0BG 4PCQA 2XGPA 4KGKA 5K8OA 5C25B 1LFWA 1IM4A 2EW9A 1YITS 3W65A 2MGZA 3BKTA 5K8MA 2FLNA 1URNA 2CFXA 2C2KB 5HATA 3KFWX 2W2OP 4P9SA 2V68A 4OYMA 3BM7A 4MKAA 1NDCA 3MPWA 3QMQA 2VBWA 5A8WB 3MEKA 2R9LA 3ILOA 1VQLS 4OHVA 2AF6A 2GFFA 4BBYA 6FDRA 1WF0A 5J1EB 1T9WA 2AZ3A 3CUNA 4KV8A 1ZAXA 1VRQC 3OL9A 1Q7LB 1YTYA 4ZN1A 1HBNB 2GMHA 1S57A 1L5UA 4C97A 4A8SA 2K3IA 1S79A 2D3O1 4J9VA 1ITPA 1U26A 4MTPA 5KFQA 4X64F 1I6JA 2BRKA 3JQJA 3EPIA 2UU9F 1U0SA 5DZ6A 2OPSB 4N5SA 3CULA 3KG0A 5B0FA 4PRFA 1J27A 1N54B 5LMNJ 4ES3A 3T1YJ 8ATCB 1RU2A 2F4VF 2RF2A 1Q78A 5CXTA 4B9SA 2QSWA 1LQ9A 4O3RA 2Z2LA 1WI8A 5L46A 3BS9A 5F8IA 2ZVSA 2GX8A 2UV8A 2HEKA 3O6QA 4UZCA 3OXFA 3R5GA 4LR9A 2XS7A 1FDDA 2GIQA 4AE5A 3R2CJ 2RVJA 4RW6A 1DARA 3ILLA 3GCWP 2FIUA 2GAHC 4I56A 2EKYA 2LU1A 1SC6A 1T03B 1SUQB 5I3UA 4OQJA 1MW7A 1JJCB 2XHCA 4ID5B 4ZVRB 1TQLA 4KO0B 5KFLA 3EGZA 1HWKA 2OTJS 2FLPA 3Q8YA 2C2DA 2FTRA 5G0RA 3AH6A 2Z30B 3NCRA 2MZTA 1DRZA 2CJBA 5IFMA 4RW4B 3OV7A 1FD8A 2W9CA 2V2QA 2ZEJA 1R8PA 3EZ5A 4O3NA 3ZZPA 3P96A 4CTAA 7AT1B 2P6SA 4ER8A 1XN9A 4LF4F 1F6TA 4FF1A 2DK2A 3OUYA 1PSDA 1FVSA 2RE1A 4C8KA 2RIJA 1D0EA 2VFSA 3CD5A 2ASLA 2W9BB 2DNPA 2DHAA 2DRDA 3OFFA 3THPA 4MK9A 1RT1B 4WP9A 2X3DA 2Q66A 3R3TA 4DV3J 2P8IA 4CLKA 4DR6F 3VZIA 3I31A 3PO4A 3DGPA 2BJ3A 4IH6A 5HQ8A 1X8DA 1IWGA 3AQPA 4Y2MA 5LMUF 1EKRA 2XZWA 3IBCB 4K5RA 4G3IA 3U7JA 4FDFA 4F25A 2HWTA 1NPPA 2R4FA 1NJXA 1R89A 2H54B 1TV6A 3KLIA 3SFUA 2MLYA 1UW9A 2GGPB 4ED3A 5IT0A 1WG1A 4PQAA 4O3SA 1HHTP 1YX2A 1REVB 2LCWA 2YX1A 3W8PA 3UFCX 4DFPA 1S1TA 2RDDA 3GR1A 1GTEA 3IS9A 4K4YA 1FJCA 4OX9F 2FVRA 2YY3A 4OJ3A 4WF9Q 2YKAA 4OI6A 1T9XA 1N5YA 2V9WA 2R2SA 2HFUA 1Q5YA 3H98A 1QUVA 3CCES 1Y11A 4FYXB 3ITHB 4IG0B 1HBMB 1LNQA 4G1IA 2H51B 5A8KA 1N4LA 3KLHA 1WUUA 3OR1A 3D3CJ 3SCIE 3QGHA 4ICLB 2XMUA 4RUCA 3M1VB 2CQPA 4G1QB 2LKZA 5FDLA 1S0VA 3KXDA 5SUHA 4J9PA 3O3LA 2OI2A 4FXWA 4Q5VA 2BE7D 5D15A 1M1HA 2VZ9A 3LO3A 1FJ7A 1U6ZA 4CLLA 4HHJA 3W5XA 1YHQS 4Q2LA 4Z7YA 2HNYA 2H1YA 3ZO7A 2EPIA 4PPZA 2BJ9A 4F7VA 1I1GA 3EDQB 3N6NA 2EWHA 4WKYA 4H4MB 3BGLA 1RAIB 4E2FB 3Q8RB 3A13A 3KJFB 3CPWR 4TU9A 1SCJB 4ATNA 4DV6J 3DYAB 4C11A 1TELA 2V2KA 1BUXA 1S59A 3CW2C 1FXDA 3FSYA 1NLKL 3DDNA 3LGNA 1CJUB 4J9NA 1U25A 3OJUA 4ZS6A 1FE0A 1W26A 4FN5A 1K1SA 3BKFA 2IBKA 3TRGA 1Y9OA 3GYGA 3SI8A 4WZMA 1RT2A 1QLNA 2G0IA 3AA8A 3ET6B 2UXBF 1BQMB 4X4QA 2GO9A 3T9NA 1WC1A 2XI3A 1JIHA 2XYGB 2P9EA 1NXIA 1KWMA 3HFVA 5B08A 3PYEA 4ZLLA 1C0TA 4RKUC 3GWCA 2MJUA 4A8KA 1S6QB 2FLOA 5HMZA 2KM8C 1B4SA 2E5JA 2WONB 5AXLA 4DUZF 1DQ9A 4DCOB 4A47A 3OJSA 3WIUA 3OBIA 1SH3A 3UDEA 3HVAA 2PMWA 2MKKA 4PXDA 2HFNA 3D6TB 4DLEA 2ACMA 1ZTTA 1FJGF 2R7UA 1NSPA 2IA6A 5KG4A 5DJBA 3C14B 1RT6B 5E3AA 5HLFB 2R7QA 1X4BA 2UUBF 3MEEB 1ZM2A 1ZS6A 3NGDA 5C7PA 2CQ3A 3BB5A 4K4VA 3QZ8A 4NRUA 2UXCJ 4P7TA 1HFEL 2WOMA 2LYVA 1N34F 2CG8A 4C0BA 1MMLA 3KUEA 1S9GB 1JLBA 1HR0J 3CCRS 2UXDF 5HO4A 3CCMS 2MKYA 3X3UA 1S1WA 3KK2A 3LWLA 4ZA1A 4OYWA 3PCOB 3FEYB 3MMBB 3G87A 3JS9A 4RBVA 5KFIA 1DBDA 4DEZA 2ASJA 2APOA 1TK5A 1JLEB 1M5OC 1TUGB 3RAQA 3F44A 4PQUA 1U0HA 3QJLA 1SC3B 1FESA 4Y2CA 2E1AA 2XMVA 2HGNA 4DUYF 4CP5A 4UOCA 2R2TA 1WOPA 1RBAA 1T94A 5CAAA 2DCUB 4NCAA 1TL4A 2CQCA 1FDNA 4DR1J 3WBZA 1E6VB 3IRWP 2ZH3A 4DV0J 3FBFA 3KMSA 3PYFA 4DPWA 4JI2F 2G1HA 3BBFA 3BO2A 2NSBA 1ZETA 3M8QA 1N5SA 1JLGA 1H2VZ 1WF1A 3GJQB 4EYHB 2GVDA 1KTVA 4XPCA 1NDPA 4CNYA 2GVZB 3A8JA 1GX6A 2F3JA 2O67A 3W66A 1H2TZ 1FI4A 3W3SA 5HMWA 4QWDA 4ZITA 1RAOA 1RQ0A 2QE5A 5IT4A 4LFCF 4RPFA 2DR8A 3I4HX 2HQIA 3GONA 5F3TA 4M5NA 3L7PA 3DM2B 3OR2A 1NBEB 4YDXA 4IOBA 1QVGR 1B70B 1U1RA 1H2UX 4OX8A 2B4VA 2DRBA 2PIIA 4WKRA 1HL6A 2CDRB 1NDKA 1Q95G 4YHHF 2DH7A 4GVLA 3RAMA 2CZVC 2MQMA 3D54A 5D3GA 3M8PA 4DL3A 3K59A 4OV6A 4F0HA 2V4QA 4CO2A 4R8UB 4M5JA 2HK2A 3CCTA 3GV7B 4OYBA 3KJQB 4A46A 2RB7A 3DLGA 2CKWA 4AXIA 1GXLA 4ZVEA 4TY8A 3OQ2A 2RQ4A 3LP2A 3I96A 2A2DA 3I0SB 2LQJA 1RHKB 2I5JB 5HSPA 2AD9A 2M70A 4YMEA 3HT3A 2NXEA 2XYHB 3Q23A 4ZVOB 3L7UA 2CNOB 3ZTQA 1JLCB 3HX9A 1RHQB 1J2VA 4QBUA 3T5KA 1VJQA 3FCHA 1PYTA 4A8XA 4FKXA 2BE2B 1XK8A 2XSJB 9ATCB 1KLMA 1XR5A 3EGNA 2V2ZA 4DN0A 4EBEA 5E7OB 2HBRB 1PILA 3CCJS 2X7IA 2DY1A 3P45B 1FJEB 3DLEB 1EQ0A 3MMAB 1R3NA 4IR1A 2XMWA 1K73T 4HACA 8RUCA 1LW0A 1AUSL 2FHJA 4KC5A 2VFRA 2QMWA 1UTAA 4DPUA 4EO8A 2YKQA 1BD6A 2VDIA 2WVDA 2AYMA 4AL7A 5IV4A 2EVZA 2BJEA 3KLFA 2HHSA 5KFOA 2DR7A 1IKXB 4Y0FA 3UN5A 1A0OB 4F3QA 4J9SA 3ZTOA 1QTMA 2C1EB 3JYTA 1GXUA 2C2EA 3OL8A 2R8HA 3W63A 3T9ZA 4OI2A 5A76A 5MLCV 5BYRA 3BN4A 1VQNS 2J8SA 5A2QU 2E7WA 2HNDA 3TX0A 2E1MC 1RZMA 2GV1A 4NYZA 2JVRA 2FJWA 2LEAA 1LWEA 2LQ5A 4M8LA 2UUCF 4PWDA 2HHQA 3GPAA 2HW3A 1S9EB 2YQ1A 3MPDA 2B9YA 3FNNA 3T3FA 3QFWA 1RABB 1JXVA 1VHIA 3N0VA 2AX1A 4L72B 1C1BA 4FVMA 1KFSA 3VAMA 2F8EX 1VBKA 5LJ5Y 2C3UA 4DV4J 4MKBA 2U2FA 3KK1A 3CCZA 4S0MA 3KJVA 4UOHA 5T14A 2V50A 2M9KA 2JFKA 2DB1A 3FKBA 3O1LA 3VCDA 4BHQA 2ZE2B 2C3PA 1NMEB 2Y0BB 3AHPA 3MUVP 4NI2B 4CT8A 4CH1A 4PKDB 2N7CA 1I3OB 3LAKA 5KFSA 4N41A 5E41A 4IKAA 4RWXA 3DHWC 4KJIA 3O2IA 4WFAQ 4JI0F 2OAUA 2MQQA 1SXLA 2OEMA 3U1NA 4LF5F 1S1VA 4DPTA 1RWMB 1TU0B 1U1NA 4OHZA 3C8YA 3D6MB 3UDVA 1PC4A 1RA6A 3U1MA 1FRXA 1FRMA 3Q0AA 3RUBL 3PG9A 3PR4A 2QA4S 1HNIB 3QGGA 4PEOA 4K4UA 4PXBA 3FJ2A 4Z2XA 4YR2A 2A10A 1YJ7A 4A8YA 2V8GA 1PC5A 4OZ0A 1O8BA 1HBNA 4U95A 2E44A 3G4SS 3QO9B 3EVMA 4BC9A 2VU5A 3DI6B 3TEHB 1TL3B 2KI2A 1VBZA 2DHXA 2WCXA 4N77A 3NL0A 1Q8LA 3NGUA 1IBMJ 3KDNA 2VOOA 1W7WA 4DU8A 4RX6A 4Q43A 1NKEA 5J1NA 1UPPA 3V4MA 1DTQA 3EVWA 3BBBA 3I0RB 2H4YB 2CQ4A 1S99A 2WB1D 2J0WA 2M8HA 1P1TA 4LRBA 5RUBA 1S0NA 1YJUA 1V3ZA 1S6PA 5FJ4A 4J9OA 1WHVA 1HNZF 2YPZA 4RJVA 2HFSA 2VV5A 5B0DA 1REGX 2R2RA 5C2CA 1Q53A 4JI3J 3QZ7A 2BKPA 1Q7YT 2WHOA 5ETNA 2MSTA 3SSSA 1FKPB 3R5BA 2RRAA 1V9OA 1S1UB 2PMZD 3CC4S 1HNVA 2FZKB 1VRTA 2ZC4A 2DGTA 2ZNYA 3BGFA 4KO0A 4LF7J 4YB5A 3LH2S 1LOUA 4B9LA 5DDPC 4NLUA 1Q81T 2OPQB 2GQ2A 3O8WA 4RW4A 1KHWA 1NH8A 2ZD1B 4GKJF 1BWVA 2IPOB 4QYRA 1FRKA 4J91A 2PFFB 4J9KA 2K1RA 2J76E 3FSXA 2QG9B 2W9BA 4AQYF 1IKVB 4HT7A 3US5A 4DJBA 1VQ8S 1XNRF 4WE1B 1PKUA 4A48A 1R8CA 3ZZTA 2L9NA 1NCLA 3S6EA 3NS5A 4I2QB 3D2WA 3VHQA 3DRYA 3R7NB 5CZXA 1LW2B 5DM7Q 2PA8D 2W4DA 3PXGa 1FEEA 3NNHA 3D0GE 3SMZA 4ZVSB 4DSIA 4F4AA 1XIQA 3GSDA 3PX0A 2DNOA 1FX2A 5AE2A 3RBDA 4EI2A 1WC5A 1U09A 1OS5A 1WC6A 2HHVA 3K57A 1TZ0A 4L3KA 3H90A 2GGPA 2P5VA 2UUTA 1VLOA 4X65J 2J9CA 1UJ6A 2QMUB 2Q43A 3AA9A 4KQZA 3EJMA 4AXJA 4OI3A 2GAGC 2M5YA 2XB2D 3BSAA 1ZYQA 4LFBJ 5CH7B 1Z1ZA 4EK2A 2XO6A 3BKUA 3M8YA 5D6GA 3CXCR 1BQXA 4PUOB 1SQFA 3QATA 3D3BJ 2KN4A 2EFQA 2VDHA 4EU0A 4LSLB 2I6WA 1T9UA 1HHSA 1JQGA 4CQ1A 4I69A 2KZZA 2O3DA 2CVIA 3GJTB 2YH1A 2WAQD 1PCAA 5HVHA 1TL1B 4KKOB 5FLXY 3AB2B 1IUJA 4LBIA 2J6TA 2G1DA 4QYZJ 3J80U 5J2MB 4CNZA 2D3ZA 3I82A 3D5MA 1SIZA 1CJTB 3D0IE 3DLKB 4YEAA 4USHA 4DR3J 5JVGQ 2JEJA 2CWKA 2V63A 3KHHA 1QY7A 3C2PA 4DN9A 4DV3F 1GTHA 1ELOA 3LTOA 2EK6A 1J5EF 1X0PA 1HD0A 2D3OR 4MAKA 1R43A 3QYYA 1YSJA 4JI4J 2QFIA 3H5YA 2YKMB 5EWFA 3R2DJ 3A4TA 1IXKA 4MIWA 1H72C 2AW0A 4Q8EA 3S8SA 4RNFA 4ZCKA 2CA9A 3LP1B 3NGSA 3B54A 2ZNZA 4N8OA 4B3TF 1WD6A 1VIXA 1YLXA 2AMCB 1HWJA 4DU7A 5CABA 4CCHA 3CT9A 3UVJB 1TVRA 2UV8G 1XMOJ 1XTZA 2EG2A 5DGAA 3ZZOA 3CDBA 1SH0A 5IM0A 1NO8A 3MR5A 2HLUA 2HLTA 2YH0A 4LR7A 2ADCA 1RT7A 4ZPCA 4NLXA 4DL7A 2Q79A 1HPZB 4C3KA 1FERA 1CG2A 2BM0A 3UDCA 4QW9A 4ILLA 4I6YA 4WYWA 4M63A 1UA0A 1HNXF 3CJKB 4N7TA 1ICEB 2PI5A 4C0HA 1SQEA 3UQSA 4GKKF 2UUAJ 4RU9A 2IC3A 4V19J 2VASA 4TLRA 1RT4B 2QSFA 3T6JA 1GEHA 3M2UB 5CQGA 3CSKA 1GMWA 4M5MA 4LREA 1C2PA 4KE5A 3P4UB 2CRLA 2SXLA 1EKSA 2ZDPA 3IGNA 1I5OB 2OP5A 1WC3A 4CO5A 4O3QA 3B6BA 4RW9B 3JSMB 3RG6A 3BF4A 3MEEA 2GA7A 4W92B 1N32J 2R2UA 3H0PA 2F4FA 4ZHRA 2CJQA 1FKOB 3PM9A 4IG3A 3TNVA 3TO8A 5L8RC 5IT9U 4DV6F 4DV1F 9RUBA 1Y4ZB 4JI8F 2AGQA 1F3VA 2CPXA 3PKMA 2X51A 1C1CA 2IA0A 3MMBA 1DJ0A 3OTCA 1K9MT 2ZBIA 3J7YU 3CD0A 1RAEB 3KK3B 1JLFB 2IM2A 4LF8F 3AJ2A 4HTJA 1DURA 1SPBP 3BR8A 5KFXA 1NHVA 1TFWA 1GNKA 2Y0SD 4IH7A 2PFDA 4DLGA 1IQTA 3M30B 2EK1A 2C2OB 2RU3A 2IJFA 3TQEA 2LXUA 1MSWD 2FHMA 5HJXA 3VAIA 2OKQA 4B3OA 5CYJA 1OJ4A 1X5TA 4A8OA 3GB0A 2CPHA 1RE1B 3ETOA 1FTRA 3EDRB 5D4PA 1SJRA 1N5TA 4A8WA 4X64J 5HL7Q 4XTTA 2AHOB 1MROB 4FPIA 4O4GA 1NK4A 3J7A1 3HZEA 5HJYA 4ZVTB 3GIJA 1X4EA 2KZMA 3K0JA 3W2VB 4LFAJ 4NA1A 2HS4A 3OW2R 3EM1A 1V5VA 3MUTP 4OI0A 2RMLA 1WG5A 1QAYA 2UXCF 1WTFA 4UZBA 1J5OB 3A8IA 1JK9B 5HVGA 1HR0F 1DFDA 4NZ7A 2XMAA 2XZDB 4R5PB 2LEBA 4PAAA 4OI4A 4EO6A 1IKWA 3R5CA 1LXNA 3SQOP 2HRYA 3HVRA 5KFUA 4RL1A 2MGZB 4R8UA 1PAUB 4NLSA 2KM8B 2IDEA 4UY85 2Z56B 1NRKA 3MD3A 1WKJA 1FDBA 1LEOA 3LW5C 3CD6S 3DOMA 1YJNS 3G6VA 3BR9A 3G6XA 3KNAA 4EMDA 3I0SA 1P9QC 4RR5A 3OXGA 3HFKA 5EHHA 3KNGA 3GTYX 2DNGA 4KV8B 1TFYA 2B6AA 1JLCA 4LF4J 4DX6A 1OY8A 4DV0F 2V4JB 1SL0A 2E1CA 1PIEA 4ED6A 4RNMA 3M2VA 1X4AA 1Y0HA 3OHBA 2MQLA 1UA1A 2COLA 1LXJA 4LJMA 3FZ2A 2KKHA 3CCWA 3QT5A 2V94A 3MM6A 3AD7C 4NA3A 3DFEA 2W9AA 1NK0A 1UJ4A 3OPKA 3DLEA 4M5IA 3VZHA 1VQPS 4I2PA 2WZ1A 5LXRA 3W9IA 5KFCA 4DR6J 4WU2A 4IQMA 2FJDB 3HZGA 3RRGA 4LBHA 3NXZA 5LMUJ 4WYLA 2DHHA 5LOQA 4A8QA 3I87A 2HRUA 3CF5Q 1IKXA 2KFYA 3G6YA 4YP3A 4I6AA 3BYPA 1R8BA 4ZPWR 2JHEA 4MIBA 1PBUA 4RW6B 2RRBA 1AW0A 4RUAA 3UE2A 4C8NA 5FD1A 3GE9A 1S4FA 1IVZA 2ZJRQ 3KTQA 4P52A 2MDAA 5K9FA 5I3UB 4UQTA 2ZUGA 4L75A 1NJWA 1EHWA 2IRUA 1YDLA 1ZA2B 2J5AA 4OX9J 4OHXA 3SEOA 3Q22A 3TARA 2XGQA 3PW2A 5G0RB 1KEKA 2W9CB 2BQRA 3R7SB 4ED4A 1G7CB 2PI4A 5ETOA 4MFBB 2L9DA 4Y2KA 1UFKA 3JQKA 2F9DA 4EGLA 3HJVA 5DM6Q 1HKAA 2Z2MA 4JI1F 4JBCA 2PSZA 1UZHA 4F02A 4ELUA 3LALA 4DR7F 4DL6A 2FJEB 2CUYA 2DGVA 4FF2A 2ZWPA 5KG3A 2FYXA 1YBTA 5K14B 1KOOA 1BHNA 4DG1A 1KQFB 2J6UA 4Y3CA 3DOKA 4YN3B 2GMJA 3WQPA 4LVNP 1X4CA 1Z2LA 1JKHA 3DGPB 3NOCA 2FC9A 3MCSA 4URQU 2VBYA 2VA2A 1RAAB 1RSCA 1MU2A 2WBRA 3MCNA 3A12A 4EBCA 2PA3A 3OD2A 1PYOB 5E3QA 2HQCA 1WF2A 3RZAA 4YY3F 2KYZA 3B4MA 4ETXA 1R0AA 2JC0A 2W24A 1HNIA 1TV6B 3TWZA 1HI0P 3AT1B 4FYWB 3KLIB 4GVBA 3KYLA 5F0UA 5E33A 2IMWP 4EWTA 4F26A 3CO0P 5D77A 4EUVA 1EAYC 4ES1A 1M5KC 5A6PA 5KTQA 4M95A 5F8MA 5F9NA 1RB0A 1S1TB 1RHUB 3TVKA 5D0HA 2ZH8A 3IS9B 2UXBJ 3DI6A 1M0SA 4KY3A 3BQ1A 1JXLA 2WVCA 2ZOFA 3ENAA 2HVIA 3TP2A 1TUWA 3JTOA 1N5YB 3IRXA 2V67A 3LP0B 2J7WA 2AWZA 2YWFA 1R0CB 4BCAA 1WSVA 2H5IB 4ECXA 5HVFA 2D74B 1G4CA 2HKEA 4HYKA 5A8KB 2IDLA 1CPZA 2CPZA 1R27B 2DITA 2R3VA 3KLHB 1BLUA 1N36F 2ALZA 2QX0A 5FDLB 2C22A 1RI7A 3E51A 1YJRA 5E3RA 2VHGA 4B9NA 2B0GA 4B3MJ 2KFNA 2AKWB 2BR0A 5HROA 4PYDA 3W1YC 3D6FB 2HNYB 1SKSA 2GO8A 3ONQA 3FDSA 1D9AA 1GQEA 3GQCA 3D7SB 3UO0A 4FVCA 2UUBJ 1FKPA 2HFOA 2XULA 4HVZA 3FRZA 3M2RA 3F0NA 4ZIWA 2J9EA 4IOAQ 1WKLA 4B9VA 4A8FA 1F9HA 4YB1P 3GSIA 5KAKA 1H38A 1M5PC 1TL5A 3RB0A 2MPUA 4P6QA 4UT4A 3AAWB 1AXQA 1CEZA 2UXDJ 2AGPA 4C11B 2R7SA 1N52B 4OX6A 3DRXA 2Z2ZA 2R7OA 1SJ3P 2CDQA 3TA1A 3FUYA 2ZD1A 3UCUP 1NHKL 3NS7B 1SJ1A 5ADZA 2RH3A 2A6MA 4EYIB 1X5PA 5GMDA 2G0JA 3PV8A 2BMBA 1B64A 4B08A 3K5PA 2NXCA 2ZHOA 1IBMF 2VQEJ 3DLJA 2ROPA 2CNKB 4DUYJ 4OHWA 1HWUA 2RT3A 4ED7A 3G8TA 5EN1A 2XG8A 2GIFA 4TNOA 2XNRA 3T6BA 2G4BA 1YGYA 3B82A 3A3PB 1C0TB 2MKSA 3DU5A 4OMFG 5DDOC 2XQCA 5D0GA 1NK7A 2WSFC 1UETA 2ZZNA 4DL0C 1HNWJ 1F5BA 2OUGA 4FKYA 3J7YI 3K8WA 4KGXB 4DWIA 5KOWA 2FB0A 1OIAA 3JTNA 3KG4A 3MM9A 1E6YA 1Z2ZA 4ZLPA 1RTHA 4NLRA 2ILZA 2CZ9A 2XCPA 2I0XA 4JI3F 2BEFA 2DNNA 2P6TA 2RQCA 2KHCA 4Y65A 5AJ3J 1BE4A 1UVKA 5C5JA 3K7RA 4DX7A 4IH5A 1VI7A 4LFCJ 3CJTA 2FZGB 3QIPA 2D9OA 3P5TL 1X4GA 4LF7F 4XAKA 4PWUA 2BDPA 1JLBB 4PUOA 2J8AA 4K4ZA 3HK2A 3ZTSA 3TUIC 5AXNA 1H3DA 3W5ZA 2QA2A 5IOLA 5G4DA 2KRRA 3KK2B 3AJDA 3VQTA 5KFHA 1TR0A 3VGSA 4ID8A 5T7LA 2DIUA 3GJRB 1X60A 3G86A 1TL1A 1UJ5A 1H98A 2J0QD 3BDEA 5KG5A 1F9EB 1CBKA 1Q5VA 2DXEA 2IAJA 4DQPA 1CJTA 1U0HB 4P7VA 1XEZA 2AQ4A 5J1PA 2HS0A 4DFKA 2OH2A 3POTA 1UFLA 2LFVA 1WJ9A 1S0MA 4B9UA 2HBQB 2KG0A 1U24A 3R5JB 3ICLA 2OEKA 3BN7A 1X0FA 3RW6A 4RW8A 1WACA 4NEZA 4UUWA 2K3KA 2NPIA 4OLOA 4ZKAA 5B0EA 2I2YA 3LP1A 3M8QB 1GK8A 2FHJD 5EWGA 1S0OA 1JLGB 4QQBA 2GHWA 2GVDB 3GZ7A 4F2RA 4U7CA 4CO3A 2HYIB 1X4HA 2B4UA 4X65F 3RRHA 1HW9A 3NEKA 3BEGB 3UVJA 3M6WA 1Y7PA 4CYUB 3QNWB 4ECRA 1HIYA 3LPYA 2L41A 3OR2B 4ES2A 5EGYA 1XNQF 2ZH2A 2AYGA 3VGVA 3PX4A 5DS7A 1XBWA 4Q44A 1T02A 3NLCA 1K47A 3CJ3A 1VOMA 5HQLA 3IXQA 3P49B 2CQDA 5AXMA 5D3GB 1MWQA 3M8PB 1M5HA 2AP6A 3H40A 4OYPA 3PW4A 2IVYA 4TYBA 2YQ3A 3MEDA 4KR0B 3NKYA 5MAOA 4ZVUB 3E8OA 3MM7A 3DLGB 2O1PA 3QWUA 4WK3A 2XMJA 4JV2A 2N3OA 1D3WA 2VFTA 1JLAA 2NR0A 4TY8B 4HDGA 2UUCJ 3LP2B 4O44B 3GIRA 1LWCA 3V6JA 3CDWA 1V5IB 4OZ2A 4IYQA 1GMVA 1Y5NB 3H5UA 4X2BA 3K2YA 4JV1A 4U67Q 3A3OB 4JP8A 1FEHA 1S1XA 1D8YA 5DQHA 1CSJA 3T5LA 5CHCB 2DR5A 4FF4A 1FKOA 3DXBA 2QA4G 4DV7F 2Q6CA 2H4WB 4G65A 2BACA 4OJHA 4JI0J 2BANA 4F2SA 1XMOF 3Q89A 4NA2A 3GIMA 1CQNA 3RBZA 3KK3A 2HQFA 4N56A 3MXHP 1S6OA 1D09B 2MLXA 4LF9J 1CC7A 1MMNA 2BKOA 5HMYA 4URGA 2FGOA 1RBLA 3PJXA 3OLBA 3SYZA 1KQGB 3D1OA 1PAEX 4U6PA 1PGZA 2XMTA 1X5OA 4J9LA 4RWWA 1IQZA 4QR2A 1NKBA 2B7CB 4QOTA 5CCMA 3DU6A 2WW8A 5KFMA 4QIFA 1YJVA 2JNJA 1AT1B 2E29A 2XEXA 1U1OA 4DL4A 4NLGA 3NMRA 1JX4A 2Q1LA 2HGMA 2PMHA 2W8LA 3K17A 2OFGX 1EIYB 1PJ6A 1NNDA 4BC7A 1RK8A 4PWDB 4IR9A 4NLDA 3L9ZA 3ELHA 3A3NB 4DPXA 5IC4B 5I3QA 3MCMA 1RJJA 3QBCA 4K2XA 2BJ7A 3OL6A 1W2BR 2XMMA 1C1BB 5CYMB 1VC5A 1N5QA 2B56A 4TU8A 1NH7A 1YQHA 2GJ2A 1YVFA 1T3NA 4ED5A 3Q2SC 3R1LA 2CQBA 3CGIA 4MT1A 4OYZA 1SB6A 4OYIA 3DOLA 1VRUA 3KJVB 3HLUA 5HP1A 2BZ2A 4FNHA 2VG5A 1MN7A 2RKIA 1ZM9A 1RU1A 1S9FA 5KFKA 5A8RB 1S72S 1RYSA 4DF4A 3P5BP 1PJ5A 2HVZA 2ZVIA 4J9QA 3VAHA 2W7OA 2IM3A 4LF6J 1P9YA 2D41A 4WFZA 2CJYB 1S1VB 3K89A 3VAKA 5HAOA 5DDQC 3BGOP 5IS2A 3MEGA 3DGVA 2B4OA 3QFHA 5DDRC 2AGOA 2YPYA 3ENWA 1JJ4A 2C2MB 4IRKA 1RT5B 1OSDA 2CPEA 2K06A 5HANA 1IBCB 3CWJA 3AOCA 4GKJJ 4KSEB 3VAJA 5BYQA 1PBAA 2OHDA 2OJ3A 2V4JA 1SH2A 4IRCA 3M6VA 4K4WA 3TANA 1YZ7A 5AE1A 3SDEA 4AQYJ 4USTA 2EBGA 4OV1A 2N4DA 1XNRJ 3CJ5A 1DTQB 1S77D 1T0TV 2DEIA 5KFAA 1GH8A 3UWTA 4ERDA 4KGMA 2NXUA 2LU2A 4LFAF 2CNNB 2ZH7A 2B43A 3UR3C 4MK7A 1WC4A 4CLFA 2BV3A 2EKNA 1S6PB 2W01A 4R25A 3AOBA 2ZOMA 2BM1A 5BJRA 2FQQB 4J7CA 1UAWA 3N6LA 3H5XA 2CNLB 2ATCB 5DLFA 2DGXA 3NGTA 1AB8A 4NMLA 1UEKA 5ETPA 3I56S 1OY6A 4GMKA 3L3CA 4LRCA 2B9EA 2B5JA 3AD8C 4USJC 4I7FA 5B0CA 5GVQA 2CQ0A 3WC0A 3MAQA 2HHXA 3WC2A 3P8BB 3NGRA 4ZPTR 1HNVB 4URSA 1VRTB 5L1KA 5DG9A 1HLWA 4CH7A 1S49A 1UWBB 3TJ9A 4WIIA 3C16A 4WPAA 4RU2A 5EUHA 1TKZA 4X4PA 3M32A 4P71A 5IQQA 4FXDA 4WWSA 2AX0A 2IYGA 3A8KA 1ZTWA 4B3RF 2VG7A 4F04B 3K5NA 4MFBA 3TJ8A 2XCAA 4ED0A 3MCOA 5HBMB 2L9WA 4WFXA 2K1RB 1D9DA 1U2FA 1MG7A 2M7SA 3QGPA 3PZPA 4HH0A 3T19A 1OY9A 2WBMA 1NK8A 1SC1B 3HHDA 3MDFA 1X9WA 3OSPA 2EFGA 5K14A 4GRSA 1JMTA 3Q8VA 3FBCA 1BMQB 3CJ8A 4WJBA 5H9EJ 2JEGA 1J5EJ 3EWGA 2LVWA 4QPXA 1FRIA 1YIJS 2FZCB 2DBBA 2HG4A 3G82B 2XS2A 4DSKA 3AOAA 2L08A 1NAQA 2RHSB 4LT6A 3JSYA 1IM6A 4ECWA 5H9FK 2R7WA 4FPRA 4J37A 1FDAA 2KVQE 3IGVA 2YNHA 4B3TJ 5D78A 3TQ1A 1TKXB 3MMCA 4XPEA 1FT8A 1QSSA 3LGMA 3EXYA 1NDLA 1EQMA 4TQSA 4WIQA 1A7GE 3I5BA 2ZJPQ 2UVWA 2FVSA 2VFVA 4K0KF 4DL2A 2F40A 2XHWA 2D1CA 3RW7A 3TUZC 4OX7A 2MKIA 3HULA 2ZUAA 2J7KA 1QDUB 2E5LF 4DSFA 3HJFA 1RT3A 4ALZA 3LP0A 1NU4A 4CRJA 1H73A 1EP4A 1I94J 2LXFA 1GMWD 4DV2J 3QRRA 1CULA 3QPIA 1HNXJ 3IBFB 2LDIA 4LRDA 3GMGA 4Y2IA 4GKKJ 1KP6A 2QL9B 1ROFA 3KHLA 1AYEA 4NRTA 1QAXA 2NYHA 3H2VE 2PT0A 2AJ4A 2ZHAA 3PIOQ 2Y1JA 3UNGC 4DZDA 3C3LA 2YNFB 2IVFB 3GCXP 3MFIA 4I0WA 1FNXH 3MTKA 2MQ8A 1Q82T 4KAIA 4FP9A 4NXNJ 2YNIB 3CTRA 2CVEA 2QJ3A 2BRLA 1UWAA 1NZAA 4TKTA 2GZOA 1YK9A 2WK4A 2WB4A 4NLWA 3UCZP 1R6YA 2DNMA 4LRAA 2ZC3A 4AYBD 4C7QA 3N4WA 4DV1J 1VC0A 4L74A 4JI8J 1RP5A 3PHEA 3OL7A 2HHHF 4C48A 1IBLF 3ZTPA 2B8QA 2ZFHA 2C42A 4X4SA 1TVRB 3JXOA 4KIAA 3M05A 4ANCA 2OPPB 2QL5B 4M5LA 1WC0A 3HHLA 1S7IA 2DD8S 4DBQA 1EJ7L 4OZNA 5IT9Y 4IFVB 4F8RA 3C46A 1X4DA 5IM0B 4QU7A 3BGUA 4LF8J 2BKNA 4F0MA 1IN0A 1RT7B 4Q45A 3QT6A 1B3TA 3QT8A 1JLQA 2VOPA 3TOQA 4LMZA 2RU9A 1K1QA 4JB8B 3EPGA 1UP1A 4K4SA 1KTQA 3R27A 4ZVHA 2V0NA 1TK0A 2KXFA 5HN0A 4PG4A 1AA1B 3KOAA 1QTNB 2WVFA 2IC3B 2XI2A 3HD2A 4L76A 4DR2F 1NJIT 2RQKA 1NUEA 3V81A 4FYVB 1S5ZA 3CVKA 3BYRA 3GJSB 1T95A 1VDHA 4B3MF 2MQPA 2DHGA 2AEFA 3CCLS 4QWBA 3VVTA 5KG6A 3EXCX 1F60B 3CJ0A 1KVIA 2P9GA 2BJ8A 2DNQA 2V4RA 2DTJA 2LP4A 4F4YA 1YJ9S 1YRTA 3FK4A 4KFBA 4ZHRB 4C8MA 1APSA 2YXLA 2HQDA 3I9V9 4IG3B 4CLPA 4DV5F 3P3DA 4IRDA 2JSXA 1BY9A 4CI0B 3JTPA 3T1AA 2FVCA 1MLAA 1C1CB 3CCQS 4X4OA 4P2XA 2B3TB 4E8UA 2LA6A 1XMQJ 4OZJA 1FCAA 2AJQA 1U1MA 1S97A 1S4EA 4OL8A 2VB6A 4CM2A 5F41A 3QIDA 3PRBA 2VQEF 2F7VA 3MFHA 4KTQA 3EE3A 4MKYA 4J9MA 2DRAA 4K4XA 3IWLA 3I5AA 4WFYA 1WHWA 2HVHA 1N88A 2YX4A 2ZITA 4KYZA 2BQUA 1HARA 3S7RA 1HNWF 4B3OB 3WIVA 2HFVA 1LK5A 2XO7A 2H5EA 2XY6A 1QE1A 3W7BA 5ETQA 1O6XA 4DPYA 1S6UA 4QIVA 4C3LA 3G71S 2XLJA 5BYSA 2BJDA 1KDNA 4O4GB 4MMOA 2XNQA 5GADU 4OYXA 4NZ0A 2XLIA 4ZOSA 2EI5A 3UR0A 3TZWA 3KLEA 1WSRA 2QGFB 2B4PA 2UVUA 1MN9A 1U8SA 2VJVA 4CYUA 5AJ3F 1HWLA 3H25A 5B0AA 2WVEA 1RTIB 2CJKA 4JI7J 3LF0A 3ISNC 3TA2A 2G2OA 4MKVA 4KGZB 5LT5A 1HYSA 1UMJA 2ZBPA 2HHUA 3HKWA 2PN6A 1RAFB 1WEZA 1XJWB 2YWEA 2GIRA 3V4IA 2CPFA 4QPTA 2Y1LB 1IKWB 2RDJA 3G8QA 2DISA 2EC0A 3HSDA 3LWMA 4YS2A 2DGSA 3AXKA 2VIHA 3GFZA 4USKA 2GNKA 3OTBA 4YQWA 1WORA 2DY9A 3KLGA 4P2MA 1FD2A 4EEYA 3DOMB 1U1LA 3VR1A 4P72A 4JI5J 2V69A 3W64A 4O44A 4B02A 2KU7A 4U8YA 1X31C 2DGQA 2EXUA 3D67A 2EFVA 4JV5J 1GAOA 1JXEA 3SSQA 2IY5B 2OD6A 1KC8T 1X4FA 4GO5X 3IM8A 3BH7B 4TU7A 2OIHA 3QLHA 4ED2A 3MI7X 3DRRA 2B6AB 3PEJA 5FLXU 2YVSA 3MD1A 4H4OB 2VD3A 4UY8T 5A6WA 3M2VB 5M2UA 4JI1J 3OVBA 1VBYA 4DS4A 4DR7J 3MM6B 5L38A 4ZCMA 2DO0A 3OSNA 2ZM6J 3VWSA 2NZ4A 3OTOF 3MURP 4I2PB 3HM9A 1NB7A 4HLBA 3DRPA 3QAUA 1N48A 5D4LA 4USMA 1W25A 2YX7A 4OZ1A 2ZWOA 2JFDA 4ILRA 1P1LA 2R7RA 2EFPA 3IO1A 3EVOA 3HF5A 3G9CA 2V34A 3ULHA 4RBTA 1G2EA 5LL6d 4YY3J 3PDNA 3GYNA 3WHIA 4WTYA 2MZQA 5L1IA 4HKQA 4C8YA 3R6LB 1SBRA 2AIRB 4H4KC 4YOEA 3EGWB 4UUXA 3CIZA 3M8SA 5KT6A 2JVOA 2YWWA 1ZPWX 2JOQA 1RWPB 1K44A 3MWBA 3LGHA 3GG1A 2XBPA 3J81j 1YJWS 4N8NA 5L1JA 3DRSA 3RYLA 2FHKA 1RUSA 1AROP 2QT7A 2XY7A 4ECZA 1KD1T 5DZ7A 2BABA 3HHLC 4K59A 1SIWB 2JZ5A 3FMWA 1OQ3A 1T9VA 2GS8A 5CYMA 3CDAA 4P74A 4KHPF 2JLGA 3QSIA 2HRTA 4RW7B 4YB7A 4OYAA 1N36J 1DAXA 3TUJC 1UFWA 4C8ZA 5KFZA 1VJWA 1S10A 5ETVA 2Y8WA 5A8RA 1C0UA 1AZSB 3A8EA 4F4ZA 4DG1B 1L3VA 5KFRA 1C4CA 3DOKB 1YJTA 2WTFA 3BO4A 3C6TB 3NAHA 1JKHB 4B3SJ 3CJ4A 1KQSR 2C2ZB 3SZ2A 3FZBA 3P6YC 4LF9F 3FSIA 1MU2B 1U4BA 3QAEA 2FY1A 3BQ0A 5LM7E 1U6FA 1M5SA 1N8RT 2KTQA 1R0AB 4IDKA 1RT5A 2VQFF 3KKFA 4OHYA 4XK8C 2KJVA 3AQOA 3U27A 2E7XA 4KGVB 3JSRA 4GVBB 4RLEA 1DTTB 2Z58B 1KBRA 2QLFB 1LFPA 4RBUA 3EX7B 2PO4A 5ETRA 4X66J 1VQ7S 1FK9A 1VQSA 2UVRA 3DLBA 1N5VA 2A18A 3MZIA 4E0DA 4OZ3A 4M5KA 4PABA 2LLZA 1RTJA 4NLYA 4ZP8A 2M3DA 3HSGA 3MAAA 3GIIA 3R8YA 5DG7A 2DPIA 1KN6A 1WDTA 3IRXB 3DLLQ 1QAIA 3R7BB 1OPIA 3H42A 5B09A 2O5DA 4O3PA 5KFGA 3EMTA 1RAHB 1FVQA 2HZVA 2E7VA 2W8KA 3J81Y 2F8HA 4ZP6A 3S01A 3PFEA 2VC1A 4HDHA 4WXOA 4KT0C 4ZVGA 5HROB 1VIOA 4OFZA 2B8PA 1O0PA 4LSZB 2J7UA 1S12A 4LF6F 2J6SA 2K2PA 2FGCA 4KPYA 3M2RB 3H2UB 2AZ1A 4G6VB 2LQBA 5CD4H 5J2PA 4NASA 3ENQA 1UWBA 2MB0B 5HK4A 3J7Z5 5E3PA 3MMJA 2DT9A 4CO4A 2DNZA 1LK7A 1TMJA 1IJFB 3FQLA 5KFBA 1Q1KA 1F0XA 5I3PA 4C8LA 4YR3A 2POKA 3MHYA 2MHEA 4WXWA 3WX4A 2Q6BA 5T41A 4IFYA 5HBMA 1WKKA 3RRKA 2AEJA 4RNOA 6AT1B 4LIWA 4AD6A 5ETLA 1UEVA 1FRJA 2DH9A 4DQSA 3N5BA 2ERRA 3HCXA 2MEWA 2HMIB 2E5GA 1HMVB 2DR9A 3TZZA 4ED8A 4A8MP 3HVTA 2OGUA 1HBUA 1TAQA 4NEYA 3K8VA 2UP1A 1G6BA 1XMBA 2VC0A 3G82A 3QWPA 5DGBA 4NE9C 1U45A 2RUGA 2Y1IA 5K8NA 1T11A 2ZH4A 2FUG9 3PVXA 2K7JA 3PACA 1TP7A 3E3XA 4IUFA 4YR0A 3MM9B 1E6YB 1RTHB 3MR6A 5F8GA 5GAGU 2CQ1A 4WBFA 1B0PA 5L9NA 1TKXA 3W61A 4DR5F 4U7UD 2QLXA 6FD1A 4IO1A 4FBTA 1R8HA 2MY8A 2MKHA 1NB2A 1U1QA 3QIPB 1L3TA 2GQQA 1MWZA 1XNQJ 2MZJA
chains in the Genus database with same CATH topology
4U7CA 3BZQA 4CO3A 2Z0GA 2HYIB 2JLFA 4DPOA 1X4HA 4DL5A 4NOHA 1KS2A 2I5JB 3IG1A 2B4UA 3UD4P 2AD9A 4I64A 3GFHA 3LQVA 4F3MA 2M70A 1VQ9S 4YMEA 3HT3A 1UVLA 5AE3A 4X65F 3RRHA 1HW9A 1TAUA 2ABYA 3Q23A 4C0OC 3J7ZT 1RA7A 3VF0B 5GADI 3BEGB 3M6WA 1Y7PA 3HVTB 1ZZNA 3J80Y 1HBUB 1JLCB 2BXJA 3VAFA 5T7LB 5KFDA 3HX9A 1J2VA 4OZ5A 4QBUA 5J2QA 4ECRA 3SFGA 3T5KA 3HDSA 4LIRA 1NEEA 3FCHA 2QIFA 3KLVA 1Y3JA 2ROEA 2Z4PA 4A8XA 4DOZA 3MAHA 2PE8A 2BE2B 3LPYA 3OR2B 4ES2A 2L41A 1XK8A 2XSJB 4XDCA 1KLMA 4ZPAA 5EGYA 2ROGA 3B8HA 4DQQA 1XNQF 2MKJA 3TVZA 2IAJB 2ZH2A 2AYGA 5THWA 1XR5A 1S9EA 3EGNA 3PX4A 2KG1A 4QIGA 5DS7A 4DN0A 1XBWA 2MZSA 4EBEA 5E7OB 3N01A 4DFMA 3RB4A 1PILA 3JSBA 4Q44A 1T02A 3CCJS 4DHVA 3MUMP 2MKCA 4QWCA 1FJEB 3NLCA 4LQ3A 3DLEB 3CJ3A 1HW8A 1VOMA 3KHRA 3MMAB 5CYQB 3IXQA 3CCSS 1R3NA 3NCQA 4IR1A 3P49B 2XMWA 4USIA 2CQDA 2YWKA 4CTAB 3POTB 5AXMA 4EFAC 1K73T 1KRPA 1LW0A 5D3GB 2FHJA 2YNFA 3M8PB 4KC5A 1M5HA 2AP6A 2VFRA 2QMWA 4MIAA 3H40A 3BREA 3G6ES 3OUYB 4EO8A 4ECVA 2YKQA 3CJ2A 3PW4A 1BD6A 3SQGA 2IVYA 4TYBA 5JXSA 3HMJG 2AYMA 2OSRA 2YQ3A 2YNIA 4AL7A 3BSCA 3MEDA 2DGWA 4KR0B 2LQ9A 4NCGA 1VC6A 3NKYA 5MAOA 1NKCA 2EVZA 3E8OA 3MM7A 2BJEA 2O1PA 3DLGB 3QWUA 2W7PA 4WK3A 4MJKA 3KLFA 2ZE2A 4RW8B 2XMJA 1Q8IA 4JV2A 2HHSA 2N3OA 1D3WA 5KFOA 2GHVC 2DR7A 2FLLA 1IKXB 4JI1F 2FJAB 2VFTA 1JLAA 2NR0A 2DPJA 4Y0FA 2ADBA 4TY8B 4HDGA 4TXSA 1JWWA 4F3QA 3LP2B 4O44B 1YG0A 4J9SA 5B0GA 1LWCA 4WFBQ 3V6JA 1QTMA 3JYTA 2KH9A 4GC7A 3QJPA 1GXUA 3CDWA 1P6TA 5KT7A 2C2EA 3OL8A 3IG1B 4IYQA 4ZP7A 1Y5NB 3H5UA 4B9MA 2C3YA 2R8HA 4DFJA 4X2BA 3K2YA 3T9ZA 4JV1A 1FNOA 4OI2A 3Q8SB 3U02A 4U67Q 5MLCV 5BYRA 1V6HA 2X1AA 3BN4A 1FEHA 3TX8A 1VQNS 7FDRA 1S1XA 2E7WA 2HNDA 3W2WA 4H54A 1D8YA 2E1MC 2HNZA 2OPPA 3SXLA 5GAEU 3MR3A 2FDNA 5DQHA 2GV1A 1CSJA 3T5LA 4NYZA 3FEXB 2ZH6A 4LSNB 5CHCB 2DR5A 2JVRA 4IFVA 2V8DA 2FJWA 2LEAA 3BJYA 1LWEA 4FF4A 1FKOA 3DXBA 5A0YA 2LQ5A 1SKSA 2QA4G 4M8LA 1Y3KA 2UUCF 2FPHX 3CB4A 4DV7F 4PWDA 2ZBCA 1LWFA 2LEPA 2HHQA 4QCLA 3X1LB 2Q6CA 2HW3A 3THTA 2GMLA 1S9EB 3Q8QB 2RILA 1FRHA 1QSYA 1HA1A 1Y5IB 4FXVA 2B9YA 3FNNA 3T3FA 4NLPA 3DHXA 4HTIA 3FVYA 2BACA 3N0VA 2HIQA 4U7UK 2DJWA 3PFOA 2AX1A 1DQAA 1HBOA 1K8AT 1I94F 4L72B 1C1BA 4FVMA 3I9ZA 4OJHA 3UPFA 3OVSA 3M9OB 1Q86T 1KFSA 3VAMA 2F8EX 4DV2F 3E01A 2G9OA 2BANA 4F2SA 2J9DE 5LJ5Y 2C3UA 1XMOF 4DS5A 4MKBA 4B9TA 4NA2A 2A3JA 2U2FA 1CQNA 3GIMA 1TUVA 3BGRA 4H4KA 3KK1A 3K5LA 3QO9A 3SCLE 3CCZA 5EDWA 2E9ZA 3KK3A 2CPYA 2J0SD 1TL3A 1BGXT 1H7WA 3MEDB 4N56A 3KJVA 3MXHP 1S6OA 5T14A 4Y6IA 2JJ4D 2UZAA 2FC8A 1FE4A 2M9KA 3MM7B 2JFKA 2DB1A 1CC7A 1MMNA 3O1LA 5HMYA 1KLNA 2EG1A 2HFZA 4CT9A 3VCDA 4BHQA 4URGA 2ZE2B 1BC6A 1X9SA 2C3PA 4M5DB 3CMAS 3MUVP 3AHPA 3RU0A 4ED1A 2DO4A 2B7BB 2FGOA 1JLAB 4CT8A 2PD1A 4CH1A 1A9NB 4PKDB 3AJ1A 3I0RA 2N7CA 3PJXA 3OLBA 3LAKA 5KFSA 3SYZA 5E41A 4N41A 3L7OA 1KQGB 4IKAA 4RWXA 2KB2A 1H7XA 1LWCB 3D1OA 2QMXA 3DHWC 4KJIA 2RNEA 1U2RA 4U6PA 1PGZA 2XMTA 3O2IA 4WFAQ 4N76A 1X5OA 1VQ6S 4JI0F 4J9LA 2OAUA 4JOUA 4RWWA 2MQQA 1IQZA 4QR2A 1NKBA 2B7CB 4QOTA 5CCMA 3TA0A 3DU6A 3MTJA 2WW8A 1RKIA 4DV4F 1SXLA 5KFMA 4QIFA 1CC8A 3CIMA 3OR1B 1YJVA 4HI1A 4NXNF 4JV0A 2N4CA 3U1NA 4LF5F 1S1VA 2E29A 2XEXA 2MQOA 1U1OA 1S1XB 1U1NA 3W2WB 2CIMA 4DL4A 4NLGA 4OHZA 3C8YA 3NMRA 1JX4A 2Q1LA 3KHGA 1RWUA 2HGMA 2OMOA 2JEFA 2PMHA 2VKRA 1PC4A 1UW4A 2W7AA 2W8LA 1ZAVA 2N82B 2NQPA 3H2LA 1R31A 1ZPVA 1RA6A 4ECYA 2OFGX 3U1MA 1FRXA 1F9FA 4R0JA 5A0YB 1NNDA 1FRMA 3KWMA 3Q0AA 4Q2MA 3RAXA 4BC7A 1RK8A 4ECQA 5K8PA 2VBZA 4PWDB 2CQIA 3PR4A 1LWFB 2QA4S 4IR9A 2VPXB 4NLDA 1HNIB 1JJ2R 3QGGA 3U1LA 1NHUA 3LANA 4A4JA 4DQIA 4K4UA 1IR0A 4PXBA 3FJ2A 3IBWA 4XIUA 4Z2XA 4CZCA 5I3QA 3S1TA 1JJHA 2PDAA 1RJJA 4K2XA 4TN2A 2WSCC 3OL6A 4YR2A 1R7IA 2F9JA 2A10A 1W2BR 1HBOB 2I9SA 2F1FA 2XMMA 2HS3A 3AB4B 5C42A 1C1BB 5CYMB 4A8YA 1VC5A 1N5QA 2B56A 2N3LA 1QUPA 1NH7A 1S1UA 2V8GA 4TU8A 1YQHA 3E01B 3FFIA 2GJ2A 1PC5A 1YVFA 2BANB 4OZ0A 1O8BA 1WNEA 1T3NA 1HBNA 5E3CA 4ED5A 1X5SA 4X4VA 3Q2SC 5BR8F 2E44A 3R1LA 2CQBA 3CGIA 4RUHA 3BGRB 3G4SS 1RISA 3M4XA 3QO9B 4BC9A 4CO0A 4C9DA 3EUNA 3DI6B 2AYBA 1VQKS 1SB6A 1TL3B 2KI2A 3DOLA 1VRUA 3KJVB 1VBZA 2DHXA 1YRUA 2WCXA 3HLUA 4N77A 4PR6A 1Q8LA 5HP1A 3TAMA 3NL0A 1AFJA 2BZ2A 2WSEC 4FNHA 2VOOA 2VG5A 3C66A 2Y1RI 5LSOA 3CMES 1U7LA 4RX6A 4Q43A 3SSRA 4EBDA 2CPDA 2RKIA 1ZM9A 5J1NA 1NKEA 3ZFVA 2OPQA 1S9FA 3V4MA 2PEHA 1CQMA 5KFKA 1DTQA 5A8RB 1S72S 4L3NA 1RYSA 3I0RB 4DF4A 2GCFA 2GC8A 1TKTA 3F41A 4I6WA 1T05A 3IR7B 2HVZA 3MECA 4UW2A 4QWEA 2CQ4A 2HAIA 2V9KA 2E9TA 4J9QA 1S99A 3PRDA 3VAHA 3HHKA 2W7OA 2IM3A 2B9XA 1VQOS 3H20A 3F56A 2WB1D 3HI9A 1RT2B 2J0WA 2M8HA 4QR1A 5HI7A 1P1TA 2D41A 4WFZA 4MK8A 1VHFA 2FVQA 2X3GA 1FXRA 1WHXA 1S1VB 3VAKA 5F8JA 5C24A 4QW8A 1U6BA 1S0NA 1YJUA 1V3ZA 1S6PA 2M52A 5DDQC 2E9RX 5FJ4A 5IS2A 1IKVA 4J9OA 3MEGA 4HEA9 1WHVA 1HNZF 2XMKA 1NK9A 2F8MA 2VPWB 2B4OA 1SKRA 2ZH5A 4WE1A 2E66A 3O5TB 2HHWA 4LVOP 4QIWD 2DNKA 5DDRC 2VV5A 2AGOA 2HPUA 5B0DA 3OVAA 3ENWA 2VKZG 1JJ4A 4IRKA 2KJWA 2R2RA 1RT5B 5L39A 2ILYA 2P9CA 1Q53A 4I2QA 1OSDA 3QZ7A 2CPEA 4TLQA 4NPOA 1LW2A 3NAIA 1YBAA 1Q7YT 1RTDA 5SZTA 4OJGA 1U1KA 2YNGA 2WHOA 3R5DA 3GIKA 2GQCA 3CWJA 3M9MB 2C28A 4D3GA 2D9PA 2MSTA 3SSSA 2KVIA 1M5VC 2CQ2A 4BWMA 2K8GA 1FKPB 5CCLA 3OHAA 3HHNB 4I1TA 5KFYA 3WZ0A 2YKNA 4KSEB 3BDPA 3R5BA 2DNRA 2AV5A 4U9RA 2M8DB 4FYDA 2RRAA 3VAJA 1V9OA 1S1UB 5BYQA 4X4UA 3FFIB 4X4TA 2OJ3A 3CC2S 2V4JA 2PMZD 1SH2A 1RTIA 4IRCA 3ZC4A 3M6VA 3CC4S 1HNVA 1D1UA 1VRTA 4MYTA 2ZC4A 3V6DA 4K4WA 2DGTA 2ZNYA 3TANA 3JAMY 2BUNA 3NNCA 5AE1A 1R8AA 3BGFA 4X62F 4RNNA 3DOLB 4KO0A 1VRUB 3DCAA 4YB5A 4HL9A 3SDEA 3LH2S 5HP1B 1KONA 1MNEA 3ZZUA 4W90B 3TAMB 1LOUA 3U27A 2EBGA 4B9LA 5DDPC 4OV1A 1NK6A 2VG5B 1ZOTA 4NLUA 1VQYA 2VFUA 2H9ZA 2DGOA 2N4DA 2QA1A 4OI1A 2RKIB 5KFWA 1X9MA 2IHR1 2OPQB 2GQ2A 3O8WA 1Q81T 1D9FA 1SL1A 4DDFA 3DMJA 3CJ5A 1DTQB 4RW4A 1S77D 1KHWA 5KFAA 1NH8A 1GH8A 7FD1A 1Q8BA 1TKTB 3UWTA 2HGLA 2JEIA 2Q3PA 4ERDA 1T05B 4JYAF 3MECB 4KBIA 5DLGA 2ZD1B 4KGMA 5CA5A 2JL9A 1G3OA 2NUHA 4GKJF 2NXUA 4QYRA 2LU2A 1KSPA 4LFAF 1FRKA 3ZZ0A 2ZH7A 2B43A 3UR3C 3V6HA 4MK7A 1S76D 3RB6A 1K0TA 1XMQF 3GYXB 4JI6F 2L48A 1D8ZA 4EZ6A 2WOMB 3F73A 2BV3A 3TVYA 5KT2A 3C6UA 2PFFB 4J9KA 2K1RA 2HQ3A 2J76E 3FSXA 5F8NA 1QJHA 1VBXA 4B17A 2W9BA 1S6PB 4AQYF 1NJZA 1YRXA 1IKVB 3MEGB 3EYZA 4HT7A 4R25A 3US5A 2ZOMA 4DJBA 4O0IA 2BM1A 3MR2A 1VQ8S 1XNRF 1S1WB 4WE1B 2EFOA 5F0WA 5BJRA 4LSLA 4A48A 5KG1A 1R8CA 4TQRA 3ZZTA 2L9NA 5GAHI 3S6EA 1SV5A 1N33F 3OFHA 3EZUA 1UAWA 3N6LA 2KXNB 5KT5A 3H5XA 3NS5A 1Y5LB 3NWGA 4I2QB 1RGVA 1WEYA 2DGXA 2FHOB 3D2WA 5DLFA 3DRYA 2ZJQQ 2R7XA 5CZXA 1LW2B 5DM7Q 4NMLA 1QSLA 3MOJB 2PA8D 4KKOA 2W4DA 3I56S 3PXGa 3ISND 4PXEA 1FEEA 4GMKA 3NNHA 3L3CA 5DG8A 1VGYA 3D0GE 3SMZA 4DSIA 5J2MA 2CQHA 3NBPA 2UVVA 2B5JA 1OQ6A 4USJC 3K5MA 2YKNB 3GSDA 5IQ6A 3PX0A 4I7FA 5B0CA 5GVQA 5H9FJ 2CQ0A 4PQUB 3WC0A 2QO3A 3RR8A 3MAQA 2HHXA 2MMYA 2OLWA 4I4BA 2DGUA 3WC2A 2DNOA 3DLKA 3TR5A 4ZPTR 1HNVB 4H4OA 4URSA 1VRTB 5AE2A 5KFEA 3PIPQ 5L1KA 3V6DB 3RBDA 3UI3A 1HQUA 3N28A 5DG9A 1KHVA 3MM5A 3NS6A 4CH7A 5LJ3Y 1S49A 4C3MA 1U09A 1UWBB 3GILA 2MZRA 3TAPA 4WIIA 3SDEB 1OS5A 1L3KA