2ROHA

The dna binding domain of rtbp1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
122
structure length
122
Chain Sequence
GSPFADPNSLALANVPLSRSKRPDFGQRRIRRPFTVAEVELLVEAVEHLGTGRWRDVKFRAFENVHHRTYVDLKDKWKTLVHTASIAPQQRRGAPVPQELLDRVLAAQAYWSVDSSGRIVTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomere binding protein-1
publication title Solution structure of the DNA binding domain of rice telomere binding protein RTBP1
pubmed doi rcsb
source organism Oryza sativa
molecule tags Dna binding protein
total genus 20
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2008-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.220 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2rohA01
2ROHA 2AJEA 2QHBA 2CKXA 2JUHA
chains in the Genus database with same CATH superfamily
5IJ5A 4GG2A 5DBYA 2XVVA 5IFOA 4DHXB 1MM8A 4ZUXV 4WA6B 3B9MA 4K71A 2NQOA 3H3AA 2QHBA 3LU6A 3B9LA 4DM0A 5BPKA 2BXGA 2LOQA 1O9XA 2VUFA 4K2CA 1BJ5A 5HOZA 4N0FD 5IIHA 1GNJA 2BXQA 1N5UA 2BXFA 2I2ZA 2Z8KA 1BM0A 4PO0A 4MBEC 1HA2A 3G9KD 4S1YA 2EFDA 3NVIA 2GUTA 2QM6A 2BXAA 3FWCC 2BXIA 4FIPB 4OT2A 4JK4A 1VFIA 2DG5A 3GA9L 3UIVA 2XW0A 2EFCA 1J78A 3BPJA 3NMUA 2Z8JA 4FJCB 3LU8A 2AJEA 1AO6A 2XVUA 3NVKA 2XSIA 2YDFA 3LU7A 3TDLA 1IJGA 2DBWA 3A73A 1HK3A 2XVWA 2VDBA 1HK4A 4L8UA 2QMCA 3GQUA 4M70B 2BXDA 4ZBKA 3GQXA 4F5UA 2DBXA 4G03A 4BKEA 3H37A 3WHQA 3SIVB 2XW1A 4FK5B 1SB0A 2CKXA 2BXBA 1MA9A 4Z9OA 4W4UB 1VZSA 1GNIA 4L9KA 5D7GA 1MIWA 4GDLB 3W1SA 2OZBB 2BXEA 2LQIA 4TQ0A 3JRYA 4N0UD 4ZBRA 4LB2A 4OTTA 1E78A 3WHSA 3KJLA 3WHRA 3JQZA 1TF0A 1JNBA 3FWBC 3KIKA 1MUHA 1HK1A 2BXHA 4OTUA 1KDXA 2BXNA 3NVMA 4TQ1A 2XVQA 4F5VA 4F5TA 2BXPA 4Z69A 3VQIA 2AGHB 4GDKB 2XMOA 4OR0A 4I9OA 4C31B 3PLAA 5GHKA 5IIXA 4LA0A 2EFHA 3V08A 4BY9C 2NNWA 2LXTA 3ICXA 1HK2A 4IW1A 4HGKA 5IJEA 2BX8A 4G04A 2BXOA 1MIVA 2ROHA 2DBUA 2KBZA 1E7GA 1H5WA 3CX9A 1H9ZA 4D7XA 3SQJA 2LQHA 5ID7A 1LNSA 3MHHB 2I30A 5IJFA 2BXCA 2BXMA 4LUHA 2LXSA 2DYOA 1MUSA 4G01A 2E0YA 1J7EA 1E7HA 4NAWB 5DQFA 1FOUA 4EMXA 5IIUA 3V09A 1E7BA 1KXPD 1MIYA 2BXLA 2V36A 2VUEA 4GDXA 3FNMA 4IW2A 4F5SA 5GINA 1LOTA 1BKEA 3ECPA 2OT3A 4HGMB 3V03A 1E7FA 4E99A 1E7IA 1HK5A 1E7CA 2K0NA 2Z8IA 1TXUA 4N3ZA 2DYMA 2E0XA 5B5TA 3A75A 4LB9A 1UORA 2KWFA 3M99C 4L9QA 4ZC6A 4ZCGA 5GIPA 3SIUB 5FUOA 5ID9A 5GIOA 1KW2A 4J2VA 4LUFA 2EFEA 2BXKA 1E7EA 3MHSB 1NT2B 4ZBQA 2JUHA 1E7AA
chains in the Genus database with same CATH topology
5IJ5A 4GG2A 5DBYA 2XVVA 5IFOA 4DHXB 4ZUXV 4WA6B 3B9MA 4K71A 2NQOA 3H3AA 2QHBA 3LU6A 3B9LA 5BPKA 2BXGA 2LOQA 1O9XA 2VUFA 4K2CA 1BJ5A 5HOZA 4N0FD 5IIHA 1GNJA 2BXQA 1N5UA 2BXFA 2I2ZA 2Z8KA 1BM0A 4PO0A 4MBEC 1HA2A 3G9KD 4S1YA 2EFDA 3NVIA 2QM6A 2BXAA 3FWCC 2BXIA 4FIPB 4OT2A 4JK4A 1VFIA 2DG5A 3GA9L 3UIVA 2XW0A 2EFCA 1J78A 3NMUA 2Z8JA 4FJCB 3LU8A 2AJEA 1AO6A 2XVUA 3NVKA 2XSIA 2YDFA 3LU7A 3TDLA 1IJGA 2DBWA 3A73A 1HK3A 2XVWA 2VDBA 1HK4A 4L8UA 2QMCA 3GQUA 4M70B 2BXDA 4ZBKA 3GQXA 4F5UA 2DBXA 4G03A 4BKEA 3H37A 3WHQA 3SIVB 2XW1A 4FK5B 2CKXA 2BXBA 1MA9A 4Z9OA 4W4UB 1VZSA 1GNIA 4L9KA 5D7GA 1MIWA 4GDLB 3W1SA 2OZBB 2BXEA 4TQ0A 3JRYA 4N0UD 4ZBRA 4LB2A 4OTTA 1E78A 3WHSA 3KJLA 3WHRA 3JQZA 1TF0A 1JNBA 3FWBC 3KIKA 1HK1A 2BXHA 4OTUA 2BXNA 3NVMA 4TQ1A 2XVQA 4F5VA 4F5TA 2BXPA 4Z69A 3VQIA 4GDKB 2XMOA 4OR0A 4C31B 3PLAA 5GHKA 5IIXA 4LA0A 2EFHA 3V08A 4BY9C 2NNWA 3ICXA 1HK2A 4IW1A 4HGKA 5IJEA 2BX8A 4G04A 2BXOA 1MIVA 2ROHA 2DBUA 2KBZA 1E7GA 1H5WA 3CX9A 1H9ZA 3SQJA 5ID7A 1LNSA 3MHHB 2I30A 5IJFA 2BXCA 2BXMA 4LUHA 2DYOA 4G01A 2E0YA 1J7EA 1E7HA 4NAWB 5DQFA 1FOUA 4EMXA 5IIUA 3V09A 1E7BA 1KXPD 1MIYA 2BXLA 2V36A 2VUEA 4GDXA 3FNMA 4IW2A 4F5SA 5GINA 1LOTA 1BKEA 2OT3A 4HGMB 3V03A 1E7FA 4E99A 1E7IA 1HK5A 1E7CA 2Z8IA 1TXUA 4N3ZA 2DYMA 2E0XA 5B5TA 3A75A 4LB9A 1UORA 3M99C 4L9QA 4ZC6A 4ZCGA 5GIPA 3SIUB 5FUOA 5ID9A 5GIOA 1KW2A 4J2VA 4LUFA 2EFEA 2BXKA 1E7EA 3MHSB 1NT2B 4ZBQA 2JUHA 1E7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROH A;  2AJE A;  2QHB A;  2CKX A;  2JUH A; 
#chains in the Genus database with same CATH topology
 5IJ5 A;  4GG2 A;  5DBY A;  2XVV A;  5IFO A;  4DHX B;  1MM8 A;  4ZUX V;  4WA6 B;  3B9M A;  4K71 A;  2NQO A;  3H3A A;  2QHB A;  3LU6 A;  3B9L A;  4DM0 A;  5BPK A;  2BXG A;  2LOQ A;  1O9X A;  2VUF A;  4K2C A;  1BJ5 A;  5HOZ A;  4N0F D;  5IIH A;  1GNJ A;  2BXQ A;  1N5U A;  2BXF A;  2I2Z A;  2Z8K A;  1BM0 A;  4PO0 A;  4MBE C;  1HA2 A;  3G9K D;  4S1Y A;  2EFD A;  3NVI A;  2GUT A;  2QM6 A;  2BXA A;  3FWC C;  2BXI A;  4FIP B;  4OT2 A;  4JK4 A;  1VFI A;  2DG5 A;  3GA9 L;  3UIV A;  2XW0 A;  2EFC A;  1J78 A;  3BPJ A;  3NMU A;  2Z8J A;  4FJC B;  3LU8 A;  2AJE A;  1AO6 A;  2XVU A;  3NVK A;  2XSI A;  2YDF A;  3LU7 A;  3TDL A;  1IJG A;  2DBW A;  3A73 A;  1HK3 A;  2XVW A;  2VDB A;  1HK4 A;  4L8U A;  2QMC A;  3GQU A;  4M70 B;  2BXD A;  4ZBK A;  3GQX A;  4F5U A;  2DBX A;  4G03 A;  4BKE A;  3H37 A;  3WHQ A;  3SIV B;  2XW1 A;  4FK5 B;  1SB0 A;  2CKX A;  2BXB A;  1MA9 A;  4Z9O A;  4W4U B;  1VZS A;  1GNI A;  4L9K A;  5D7G A;  1MIW A;  4GDL B;  3W1S A;  2OZB B;  2BXE A;  2LQI A;  4TQ0 A;  3JRY A;  4N0U D;  4ZBR A;  4LB2 A;  4OTT A;  1E78 A;  3WHS A;  3KJL A;  3WHR A;  3JQZ A;  1TF0 A;  1JNB A;  3FWB C;  3KIK A;  1MUH A;  1HK1 A;  2BXH A;  4OTU A;  1KDX A;  2BXN A;  3NVM A;  4TQ1 A;  2XVQ A;  4F5V A;  4F5T A;  2BXP A;  4Z69 A;  3VQI A;  2AGH B;  4GDK B;  2XMO A;  4OR0 A;  4I9O A;  4C31 B;  3PLA A;  5GHK A;  5IIX A;  4LA0 A;  2EFH A;  3V08 A;  4BY9 C;  2NNW A;  2LXT A;  3ICX A;  1HK2 A;  4IW1 A;  4HGK A;  5IJE A;  2BX8 A;  4G04 A;  2BXO A;  1MIV A;  2ROH A;  2DBU A;  2KBZ A;  1E7G A;  1H5W A;  3CX9 A;  1H9Z A;  4D7X A;  3SQJ A;  2LQH A;  5ID7 A;  1LNS A;  3MHH B;  2I30 A;  5IJF A;  2BXC A;  2BXM A;  4LUH A;  2LXS A;  2DYO A;  1MUS A;  4G01 A;  2E0Y A;  1J7E A;  1E7H A;  4NAW B;  5DQF A;  1FOU A;  4EMX A;  5IIU A;  3V09 A;  1E7B A;  1KXP D;  1MIY A;  2BXL A;  2V36 A;  2VUE A;  4GDX A;  3FNM A;  4IW2 A;  4F5S A;  5GIN A;  1LOT A;  1BKE A;  3ECP A;  2OT3 A;  4HGM B;  3V03 A;  1E7F A;  4E99 A;  1E7I A;  1HK5 A;  1E7C A;  2K0N A;  2Z8I A;  1TXU A;  4N3Z A;  2DYM A;  2E0X A;  5B5T A;  3A75 A;  4LB9 A;  1UOR A;  2KWF A;  3M99 C;  4L9Q A;  4ZC6 A;  4ZCG A;  5GIP A;  3SIU B;  5FUO A;  5ID9 A;  5GIO A;  1KW2 A;  4J2V A;  4LUF A;  2EFE A;  2BXK A;  1E7E A;  3MHS B;  1NT2 B;  4ZBQ A;  2JUH A;  1E7A A; 
#chains in the Genus database with same CATH homology
 5IJ5 A;  4GG2 A;  5DBY A;  2XVV A;  5IFO A;  4DHX B;  4ZUX V;  4WA6 B;  3B9M A;  4K71 A;  2NQO A;  3H3A A;  2QHB A;  3LU6 A;  3B9L A;  5BPK A;  2BXG A;  2LOQ A;  1O9X A;  2VUF A;  4K2C A;  1BJ5 A;  5HOZ A;  4N0F D;  5IIH A;  1GNJ A;  2BXQ A;  1N5U A;  2BXF A;  2I2Z A;  2Z8K A;  1BM0 A;  4PO0 A;  4MBE C;  1HA2 A;  3G9K D;  4S1Y A;  2EFD A;  3NVI A;  2QM6 A;  2BXA A;  3FWC C;  2BXI A;  4FIP B;  4OT2 A;  4JK4 A;  1VFI A;  2DG5 A;  3GA9 L;  3UIV A;  2XW0 A;  2EFC A;  1J78 A;  3NMU A;  2Z8J A;  4FJC B;  3LU8 A;  2AJE A;  1AO6 A;  2XVU A;  3NVK A;  2XSI A;  2YDF A;  3LU7 A;  3TDL A;  1IJG A;  2DBW A;  3A73 A;  1HK3 A;  2XVW A;  2VDB A;  1HK4 A;  4L8U A;  2QMC A;  3GQU A;  4M70 B;  2BXD A;  4ZBK A;  3GQX A;  4F5U A;  2DBX A;  4G03 A;  4BKE A;  3H37 A;  3WHQ A;  3SIV B;  2XW1 A;  4FK5 B;  2CKX A;  2BXB A;  1MA9 A;  4Z9O A;  4W4U B;  1VZS A;  1GNI A;  4L9K A;  5D7G A;  1MIW A;  4GDL B;  3W1S A;  2OZB B;  2BXE A;  4TQ0 A;  3JRY A;  4N0U D;  4ZBR A;  4LB2 A;  4OTT A;  1E78 A;  3WHS A;  3KJL A;  3WHR A;  3JQZ A;  1TF0 A;  1JNB A;  3FWB C;  3KIK A;  1HK1 A;  2BXH A;  4OTU A;  2BXN A;  3NVM A;  4TQ1 A;  2XVQ A;  4F5V A;  4F5T A;  2BXP A;  4Z69 A;  3VQI A;  4GDK B;  2XMO A;  4OR0 A;  4C31 B;  3PLA A;  5GHK A;  5IIX A;  4LA0 A;  2EFH A;  3V08 A;  4BY9 C;  2NNW A;  3ICX A;  1HK2 A;  4IW1 A;  4HGK A;  5IJE A;  2BX8 A;  4G04 A;  2BXO A;  1MIV A;  2ROH A;  2DBU A;  2KBZ A;  1E7G A;  1H5W A;  3CX9 A;  1H9Z A;  3SQJ A;  5ID7 A;  1LNS A;  3MHH B;  2I30 A;  5IJF A;  2BXC A;  2BXM A;  4LUH A;  2DYO A;  4G01 A;  2E0Y A;  1J7E A;  1E7H A;  4NAW B;  5DQF A;  1FOU A;  4EMX A;  5IIU A;  3V09 A;  1E7B A;  1KXP D;  1MIY A;  2BXL A;  2V36 A;  2VUE A;  4GDX A;  3FNM A;  4IW2 A;  4F5S A;  5GIN A;  1LOT A;  1BKE A;  2OT3 A;  4HGM B;  3V03 A;  1E7F A;  4E99 A;  1E7I A;  1HK5 A;  1E7C A;  2Z8I A;  1TXU A;  4N3Z A;  2DYM A;  2E0X A;  5B5T A;  3A75 A;  4LB9 A;  1UOR A;  3M99 C;  4L9Q A;  4ZC6 A;  4ZCG A;  5GIP A;  3SIU B;  5FUO A;  5ID9 A;  5GIO A;  1KW2 A;  4J2V A;  4LUF A;  2EFE A;  2BXK A;  1E7E A;  3MHS B;  1NT2 B;  4ZBQ A;  2JUH A;  1E7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...