2RONA

The external thioesterase of the surfactin-synthetase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
242
structure length
242
Chain Sequence
MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAAEPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGIFPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSDYRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQTEEVAERIFAILNQHPIIQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the selectivity of the external thioesterase of the surfactin synthetase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Surfactin synthetase thioesterase subunit
total genus 42
structure length 242
sequence length 242
ec nomenclature ec 3.1.2.-:
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ronA00
2E3JA 1XZFA 4AO7A 5DTIA 4B80A 1EK2A 3I2GA 5LZ8A 3HXKA 4QDXA 4XJVA 4Q3KA 4H7JA 2CJPA 3S8YA 2DR0A 3W2TA 3KWFA 5A2GA 4ZXFA 5ALVA 4QEKA 3FVRA 4RGYA 3IUMA 4WY5A 3H04A 3YASA 4C4ZA 4WDRA 1E3QA 2VQ6A 4DNFA 2NW6A 3QMVA 1IUNA 4B9EA 2JIDA 4X7BA 2O2IA 5ALQA 3QPAA 5KWIA 1HPLA 3OPMA 2QOEA 3FYUA 4J7AA 1GT6A 4PNZA 2GBFA 3L1HA 4W1PA 3DOIA 1CEXA 1DINA 4DSZA 4GHWA 1XRRA 5AM4A 2JGFA 1CPYA 3O4HA 3WKEA 3M82A 1EI9A 4CCYA 2HA6A 2C5GA 4X95A 2PBLA 4X3CA 5D6OA 3WKCA 2QVBA 3I1IA 1N1MA 3M3DA 1VXOA 3N0TA 1EHYA 4BYMA 3HJUA 3JWEA 5CW2A 2VTVA 5ALZA 5FP0A 3IUJA 1ZOIA 1LZLA 1MNQA 2GYVA 4X6UA 2UZ0A 4OB6A 4G4IA 5LZ7A 2OAGA 4G8DA 3NGMA 3C87A 4TPKA 1XZAA 1L7QA 2CZQA 4BC0A 5IVKA 4N5IX 4EY4A 1B41A 1CUFA 4H7HA 1TAHA 1YA8A 5LKAA 1YB7A 4UHBA 4Y2JA 5SYNA 1XZJA 1QTIA 2AJCA 2CMFA 2OAEA 4X85A 4Y2XA 4AN1A 2VJCA 1ZD4A 3H2KA 2QT9A 2XQFA 1IVYA 3ESBA 3T4UA 5ALTA 5KWJA 2JGKA 2C58A 4UUQA 5LKRA 5JASA 4DGQA 3WWEA 3RM3A 2HRRA 3HRHA 1ZD5A 3EIOA 3BF7A 1Q84A 4G5XA 1QO9A 1W6RA 1H2YA 2Z3WA 4BE9A 1CUBA 1XQYA 3OM8A 1XRPA 1Y7HA 3EQ8A 1AZWA 4XX1A 1K6EA 3FCYA 1JI3A 3O0DA 5ALDA 2D5LA 5EHZA 3HSSA 2HA4A 1W1IA 1JMKC 2WG1A 4H7FA 4CFSA 1QFSA 5FDFA 4X6YA 5AICA 5HF9A 3DOHA 1UZAA 4RE6A 4DNPA 3VJKA 2OCGA 2QXTA 3C45A 3PF9A 1BEZA 3ANSA 4I4CA 4OB7A 5AH0A 2C7BA 3WL6A 1QIJA 4FKBA 5EI5A 3V1KA 3LP5A 4P92A 1Q83A 3AFIA 5DTJA 1MX9A 4GLBA 1A8QA 2YYSA 3GA7A 5BWBA 5JATA 2WUGA 3D0KA 1VOTA 4MQLA 3CXUA 3QVMA 2B4KA 4HS9A 1CUUA 4U2GA 4S0XA 4KE6A 4HAIA 3U0VA 5ALHA 2WJ3A 5ALKA 2G4LA 3W9BA 5CH5A 1JU4A 5AOBA 1R3DA 2WG0A 1VE6A 3SC2A 2BKLA 4CIAA 3CCBA 1LZKA 3M83A 3STVA 1J06A 5I9IA 3HZOA 4OU4A 5K3CA 2WU4A 3H17A 2WQZA 3SWWA 4PQEA 5A7FA 3FLBA 1AGYA 2ACKA 1LBSA 1BN7A 5ALWA 2H7XA 2C0QA 3R40A 3R3WA 2WKWA 3WL5A 2GBIA 4XWGA 5AKEA 1IMJA 1USWA 1SOMA 4FMPA 1FFBA 1N5RA 3QYJA 1ZI9A 3G9XA 2XUOA 1C7IA 1FJ2A 3H1AA 3EQ9A 4UFPA 5AOCA 1H23A 3KWJA 2QS9A 3OURA 2DHDA 3HEAA 3DDUA 1A8UA 2H7YA 3WWPA 4UBOA 4QA9A 3H2JA 4CCWA 4EHBA 4U2CA 2HA7A 5T4EA 1K4YA 2HL6A 3BL8A 4H7KA 4GW3A 4Y2PA 3E3AA 2XUJA 3A2NA 2H7CA 4E15A 2DSNA 1YB6A 1WPXA 5HQ3A 5EHNA 3KXPA 4NMWA 5AKXA 5K5EA 1EH5A 1QJ4A 4OYLA 5E4YA 1MU0A 3WMRA 1HL7A 1DQYA 5AIBA 4U2FA 4BE4A 5JYCA 1TK3A 3GZJA 1ISPA 3ZPXA 3FYUB 1ZJ4A 4ZWNA 5KBYA 3B5EA 1Z68A 1BN6A 2O2HA 2ZJ7A 4BZZA 2X76A 4U2DA 3D59A 4LYEA 3F9CA 1HBJA 3BIWA 1EXWA 2WFMA 3P2MA 4MWTA 4CCYB 3VJLA 2OGZA 2HHAA 2G5PA 3L1JA 1OILA 3PE6A 4Q82A 4IO0A 1JFRA 1P0QA 4EZIA 2GBGA 1ZGBA 1SFRA 4P93A 1LNSA 3D3NA 2G5TA 4GBGA 4BTLA 3WIBA 2J3QA 3CN9A 4H7DA 2CKMA 3B12A 1MT3A 1UOOA 3TRDA 5AKIA 2XUGA 2HU5A 5JADA 2VJAA 1HKHA 4DLNA 4QZVA 3ED1A 1E8MA 1XZCA 4Q05A 1B6GA 4X94A 4MXDA 2C4HA 2XMDA 4BZWA 5HF6A 1LPNA 1ZD3A 3G0DA 4FBLA 5JARA 4HRXA 1CIJA 4AX4A 2ZJ6A 4UHFA 5K3BA 2XQGA 5AI8A 2XUFA 5D3ZA 5ALFA 2XUQA 1VLQA 2WIKA 2QZPA 3O4GA 3W04A 1DWOA 4FFVA 5HKAA 3FLAA 3TJMA 4YASA 4N8SA 1I6WA 3O9VA 4XVCA 3IB3A 1WB6A 1LBTA 3WZLA 1RWQA 1ZD2P 4J0DA 1K8QA 1QTRA 1YSCA 1QIDA 3KDAA 5BWCA 1ETHA 1VA5A 1UK8A 1TIBA 1K5PA 5HK8A 1R1DA 1A7UA 1UKCA 2OLEA 4UHDA 4BAZA 3C5WP 3LLCA 2IIVA 3EF3A 1QZ3A 3H1BA 4B7ZA 1JU3A 3EBLA 1XLWA 1XZGA 4GWLA 1UK7A 5C81A 3NWOA 4ZI5A 5CXXA 3STYA 4AQDA 2HADA 5K3FB 4X90A 4ZV9A 2AJ8A 1CR6A 1EDEA 1CFJA 3H0CA 1R9NA 1DX6A 2I78A 3ESDA 3OOSA 3LIPA 1DT3A 1GQSA 2XE4A 1EB8A 5AOAA 5HF8A 1XZKA 3BXPA 4CIBA 4BAGA 3RKSA 1ZICA 5EIEA 1XLVA 4G8BA 4L3WA 4GEGA 5AKLA 1ACLA 1E66A 2OCKA 2RAUA 1XRQA 2FX5A 4KE9A 2QTBA 4LYDA 4X97A 1O6FA 2K2QB 4RE5A 5FOQA 4KAJA 5ALJA 4EY7A 1P0PA 2BGRA 1DX4A 4WDQA 2ZYRA 3RLIA 4I3FA 5AJHA 3FWHA 1P0IA 5EGNA 1CUVA 1H2WA 5AM1A 5IVIA 5AM5A 3VVLA 3W06A 5K3EA 1EVEA 5JD6A 2OXEA 4XIIA 2CBGA 2ORYA 1DWPA 2YXPX 4QDZA 2I3DA 2CUTA 3BF8A 1EK1A 4H0CA 3O4JA 1L7AA 5CTAA 1QLWA 4M0FA 2X5XA 3I2HA 5EHXA 5FPPA 2HA5A 3G7NA 3QMWA 2PL5A 2VEOA 4BDTA 3STWA 5H3HA 5AKYA 5I7UA 3ILSA 2R11A 3M81A 3IIIA 2BAGA 1J2EA 3DNMA 1QIHA 3FYTA 4FFWA 3WK9A 2WILA 1TKRA 5ALOA 3R0VA 5CURA 1VZ2A 3WYDA 1CUGA 4D9JA 4L0CA 4BCDA 1UK6A 2Z3ZA 3WIOA 3AZPA 4OYYA 4Q34A 5JANA 5ALIA 1AUOA 5K3DA 3WA6A 3WWCA 1LPOA 3FNBA 4HZGA 1GKKA 1MO2A 4INZA 4G9GA 1FFEA 3DCNA 1R50A 2Y1KA 1WPRA 3GFFA 5FKJA 3D4LA 4N5HX 2PU7A 2XB6A 1LPMA 4FDMA 1GQRA 4BDSA 3X3HA 3WWOA 2RHWA 1XZLA 2AJDA 4QDUA 3G9ZA 1G42A 4CG2A 1YS1X 4C01A 1VZ3A 5D7BA 3VJMA 2C5FA 3FAKA 5JD5A 5LP1A 5FPQA 2XUHA 2XT0A 3A2MA 2ZVDA 4FLEA 1G4HA 3D2BA 2ACEA 4Y2TA 3L1IA 4CG3A 3I6MA 2ECFA 1DU4A 5AI9A 4B83A 3A2LA 3F97A 1IUOA 5ALXA 3E1GA 3KOOA 3WK7A 3DLTA 5ALSA 3WK4A 4E46A 4GDMA 1UWCA 1XZBA 2Q0XA 5AP9A 1EDDA 5JZSA 2DCMA 4B0PA 2OQIA 3G0CA 4A5SA 1DTEA 3WL7A 1AMNA 3PDCA 4AZ3A 1X2EA 1WB5A 4G8CA 5FXMA 3ZV7A 4BC1A 1CUZA 3DYVA 2JF0A 4UFOA 3I6ZA 1MX5A 2PSJA 5AM3A 4TVKA 5CXUA 5IH7A 2PSEA 1L7RA 5LZ5A 4F0JA 5EIHA 2ZYHA 4BB0A 4V2IA 1QIKA 3CCCA 4BBZA 3NOXA 2BGNA 5HCUA 2Y2VA 3G0BA 4W1QA 2XUDA 3WJ1A 5CH8A 4LXGA 4K6GA 4BP8A 2V97A 3R3ZA 1G66A 1MNAA 1K63A 4AZ0A 4B81A 1XQXA 4UFNA 1GPNA 3AIMA 3TGLA 5J3JA 1F6WA 4DIUA 2O7VA 4C4XA 2ZYSA 4X91A 3VISA 1S8OA 2RI6A 3DL4A 1TCCA 1UT6A 3ANTA 1BROA 1R4ZA 3BJMA 3G0GA 5AKHA 5C8ZA 5HKBA 4IH4A 4WY8A 3IVMA 1D07A 2ROQA 4YX9A 1LPAB 1EX9A 3EQ7A 4Q3OA 5CT4A 3ZLTA 3PFBA 5EIAA 1EDBA 1U8EA 2WUFA 4OUKX 2BUAA 2RGUA 1DQZA 4KRXA 1YR2A 2G63A 1ORWA 2WFLB 4LXIA 5A7HA 4JYMA 4W1SA 3ESCA 1F0PA 2PUHA 4J0HA 5AO9A 2OGTA 2QJRA 4HXEB 2EEPA 3A6ZA 1XZHA 1H22A 4HTAA 1R88A 2PSHA 3QBJA 1KEZA 3F8SA 4Y2VA 5IVHA 2D0DA 1W75A 3D2AA 5HF5A 2IX9A 2EDAA 3E0XA 4PW0A 2QJWA 3I28A 4ARBA 5JZBA 2GBCA 4AMYA 2PKYX 3AIOA 1E89A 2FUKA 3N2ZB 2HDWA 3C5VA 1M33A 3IUNA 2JEZA 3H2IA 1XZEA 1GZ7A 2Y6UA 1FFAA 1BCSA 1BCRA 1CUDA 1J1IA 4ROTA 1JJBA 5C8XA 4QWWA 5DLPA 4C89A 3WWDA 1UFOA 4FHZA 2WHQA 4OSEA 3QMMA 1MAAA 3C8HA 6YASA 3FBWA 4UBJA 4U2EA 2JEYA 5CT9A 5T4FA 1CUYA 3VVMA 1SCIA 3DS8A 2YASA 1CUHA 3RARA 3W05A 4MEAA 3STUA 5AKGA 5DYWA 4QDTA 5DWDA 4KYVA 4X93A 5ALYA 3FYUC 3UUEA 5JZ9A 2YH2A 4MJ3A 2OG1A 2J4FA 5AI0A 3AINA 4HXGA 3FLEA 5AIAA 5SYMA 1YAJA 4N8EA 3R3YA 1W76A 4FTWA 1F0NA 2WJ4A 1JT2A 4P08A 5C7YA 3TEJA 2XUPA 1U65A 4JYPA 3K2IA 5FUMA 1LPBB 1PFQA 5E2IA 1GGVA 3FSGD 1HDEA 1LLFA 5FLKA 5AI5A 5K3FA 3R3VA 2BFNA 4UHEA 1VA4A 2FJ0A 3WK8A 4J0KA 4LIPD 4F21A 2JGJA 5ALRA 3SK0A 4UBKA 1QO7A 1CUAA 1KU0A 3FSGA 4QLAA 3FOBA 5DYYA 1SC9A 1DWQA 5I8PA 1QIFA 4W63A 5A6VA 5LYYA 1VE7A 2PPLA 5HK9A 1EINA 4F60A 1MPXA 2PSFA 5LZ4A 2WIGA 4K6HA 1JJFA 4B6GA 4YK7A 1ZI8A 2HU7A 1RYYA 3DEAA 4JEIA 5T4BA 4AMZA 3BWXA 1CUEA 1CV2A 5JAUA 1W4LA 5D3KA 2XMGA 3Q0TA 3QZUA 4DNQA 4DMKA 4RNCA 1CUWA 3C6XA 5A71A 5CH3A 3WK6A 4UBMA 4ZRDA 3H18A 4BRZA 5JIBA 4JUIA 2J4CA 3R3XA 3OG9A 1EVQA 3MGAA 4G1FA 4IQ4A 3IA2A 3T52A 5FV4A 2XMRA 5F4ZA 1OXMA 1JJIA 3HACA 2GYUA 3BDVA 5HFNA 4BTVA 2XQJA 5JAPA 2QXUA 5AI4A 4C87A 1YS2X 3ZLUA 1O6GA 1XZMA 2X8BA 3UUFA 2XI4A 4ZGBA 2QMQA 1IUPA 1UKBA 1A88A 5AK4A 1BRTA 1ODTC 2WTMA 2XUIA 2JBWA 1THGA 2FJPA 2HM7A 5CRIA 3PF8A 1XROA 1LPPA 1FSSA 1QGED 2LIPA 2VAXA 2VF2A 4DM7A 2XQIA 4NVRA 1CUXA 1E5TA 4CI9A 1BU8A 2V9ZA 4HXFB 4X92A 5EHQA 2WU3A 2WHRA 4J0JA 3SX4A 3F67A 4EY8A 1CLEA 2WIJA 4IH1A 1XQVA 4KAFA 1PV1A 1ZJ5A 3WL8A 1HQDA 5DNUA 2CEKA 4FBMA 4BAUA 2AJBA 1PJAA 4Q3LA 5FRDA 3LIIA 4A16A 2HFKA 2ZSHA 5DYTA 1J07A 2HFJA 4X6XA 1TCBA 3HYSA 1QIEA 3C70A 4OU5A 5JALA 1LPSA 2Z8XA 2VA9A 4KR0A 1UK9A 5CMLA 5ISMA 3QM1A 3BIXA 1UXOA 2Z8ZA 1SCQA 4JH0A 3HABA 2JGLA 1XZIA 4ZV7A 1KU6A 5C8VA 4L9AA 3VXKA 4FWBA 1U2EA 4B84A 2DHCA 2WLSA 2B20A 2AJLI 2WFLA 2WHPA 4GECA 2XMCA 3DJYA 1MAHA 3PUHA 5DJ5A 2XLBA 3D5EA 4ITVA 3Q8WA 4OB8A 1QFMA 1MX1A 2WHPB 1VKHA 4BP9A 2PVSA 3DD5A 1E8NA 4H35A 2CB9A 3CN7A 3PFCA 2OPHA 1VJ5A 4FLFA 1BE0A 3K6KA 3HI4A 4UBIA 4OPMA 1WCYA 4QDOA 4B82A 2WM2A 4UBNA 4UHCA 4C88A 3H2HA 4KJXA 3MVEA 4J0IA 2H1IA 4BCBA 1FFDA 3B3QA 1ODCA 1UKAA 2BJHA 3I2IA 1UOPA 1XRLA 3V9AA 2HU8A 1ACJA 5AKKA 1CUJA 5LZ2A 3AILA 3AZQA 4X00A 4DMHA 1R9MA 1CRLA 5ALMA 1XRNA 3O9MA 3I1YA 5CT8A 3IULA 5CT6A 3C6BA 3ZLVA 4HVTA 1JKMA 5T4HA 3D2CA 4AO6A 4UHHA 5E4JA 3FVTA 2XMBA 4M0EA 2XUKA 1CUSA 4MYSA 1OCEA 4FNMA 5ALLA 5BOVA 2WTNA 3U1TA 2V98A 3DYIA 3MUOA 4I19A 2VT6A 1A8SA 2QR5A 1CUCA 4EB0A 5HQ3B 3W9UA 1NX9A 3VKFA 4B85A 3IURA 3AUKA 4MYDA 1YA4A 4WFIA 5ALNA 4LXHA 1ZIYA 2HA2A 3ZI7A 1GXSA 2JGEA 1P0MA 4PSUA 4KAAA 4ZREA 3QH4A 5LIPA 4PV7A 1TRHA 4H7EA 4O08A 1IZ8A 3OTQA 3DQZA 4Y2RA 2BCEA 4WCVA 1Q0RA 5AKJA 4YPVA 1MJ5A 4EY5A 1T2NA 3WKDA 1AQLA 1F8UA 1AURA 3I2FA 1ODSA 4KE7A 5LZ9A 3O4IA 4DYHA 1HLGA 1X2BA 4G4GA 5ALUA 3G9TA 1QIGA 1EB9A 3QPCA 1CQWA 3PICA 3S2ZA 4DSAA 5A7GA 4EBBA 1BEEA 1Y7IA 3JW8A 3MUNA 4AB1A 5DNVA 3GUUA 4UPDA 2XQKA 3BDIA 3ZWQA 3RK4A 4A23A 1RP1A 2WSLA 4F5ZA 4KEAA 1CVLA 3GELA 2JGIA 4PSCA 5IVDA 5HFAA 2B9VA 4J03A 1MN6A 1WOMA 2GZSA 4BVLA 3WI7A 5ALEA 4LHEA 4C6HA 5AHXA 2BUCA 2WUEA 2C0PA 1Q0ZA 1XKTA 3DL7A 1NU6A 2AXEA 3A70A 2VATA 2PSDA 4EUSA 2DQZA 4H7IA 2DQYA 3O95A 4FLMA 1XFDA 1MTZA 2RHTA 3WZMA 2XLCA 1CUIA 1G5FA 4AN0A 4J0CA 2W22A 4K5QA 1QONA 4EA6A 4KACA 4PO3X 3GROA 2O2GA 1N8SA 4GI1A 3G0IA 2HRQA 1GKLA 2VJBA 4J0GA 1BS9A 1XLUA 1QOZA 5E4TA 1E8DA 2XMQA 4L72A 2OCLA 3HLKA 3G9UA 3ICVA 4B0OA 4G4JA 4N8DA 4LKOA 4Y7DA 4ARAA 2B61A 2OGSA 4GXNA 3WYNA 4Y9SA 2PUJA 4MWSA 4DTCA 2XMZA 3AJAA 4CG1A 1W52X 1WB4A 4C4YA 2XDWA 2I3ZA 4DNOA 1YAHA 3JYHA 5AM0A 4H18A 3C43A 4M0MA 1WHTA 5KREA 3G02A 2W6CX 2BUBA 4OD0A 2R8BA 3F96A 2VAVA 4K6KA 3BE8A 2ONCA 4Y2YA 2GYWA 4BVKA 4ETWA 1DT5A 3R41A 4BCCA 3WA7A 3UMJA 1UOQA 1THTA 2I03A 3NUZA 4MQMA 3V1LA 2WUDA 3WKAA 1FFCA 2Y6VA 3WJ2A 3V1NA 1YASA 2P8SA 4QWMA 1VXRA 2V96A 2QM0A 5JD4A 4E11A 2H9YA 4WFJA 2VT7A 4AXBA 5JAHA 4U2BA 2HIHA 4J3JA 2PM8A 3DKRA 3OC0A 2OQVA 5K3AA 1CQZA 5IKXA 1TQHA 1IZ7A 3VDXA 2WFZA 4H77A 5BV7A 4FOLA 4MEBA 3H19A 5ESRA 4PF1A 5A62A 2PU5A 3PUIA 3FCXA 1JMYA 2JGMA 5AK6A 1ORVA 3F98A 1T4MA 3IBTA 3R3UA 3WLAA 3I2JA 4QNNA 1XKLA 1N5MA 5DNWA 4BATA 2HA0A 2EDCA 3QPDA 4WJLA 4Y2QA 1GPKA 4KE8A 2RONA 1H2ZA 4IHAA 1AX9A 3LCRA 4X71A 2QUBA 4EY6A 1XRMA 1QIIA 3GBSA 4RPCA 4Z49A 2GZRA 4W9RA 2VSQA 4W1RA 2J3DA 2WG2A 5JAOA 3WKBA 4FNGA 4P9NA 4BVJA 4WFKA 5AI6A 3BJRA 3I6YA 3C6YA 2O7RA 1QE3A 2HA3A 2Z5GA 5AK5A 1U4NA 4DMFA 3STXA 2Y2UA 1XQWA 2ZYIA 5AKZA 2IITA 4E14A 3WK5A 4OCZA 5HZGA 3HC7A 1WHSA 1XZDA 2OCIA 1AC5A 1EA5A 3STTA 2WIDA 5EFZA 2XMSA 2ES4A 3KD2A 3V1MA 4IH9A 4HRYA 3K9BA 1YCDA 5CT5A 3H2GA 2QKYA 1TCAA 3ICWA 3WQHA 3DKKA 4K2AA 4UBLA 4NS4A 3G8YA 1GPLA 3AZOA 2WIFA 4G9EA 2XUAA 7YASA 3IDAA 3PI6A 4JNCA 4KRYA 4B9AA 4PSDA 3D7RA 3ESAA 2DHEA 4Y2UA 1AKNA 3KSRA 2ZSIA 4TGLA 3IUQA 2DFPA 2QRUA 3V48A 5ALGA 2WJ6A 4BRSA 1LGYA 5ALPA 4AO8A 2PX6A 5CBKA 5YASA 2ZJFA 2QUAA 3C8DA 1C7JA 3C6ZA 4Y2SA 5AM2A 4NZZA 1NU8A 1SCKA 1X70A 3AIKA 1ZI6A 2RIPA 1WM1A 3QITA 1H2XA 4QLOA 5AK3A 3I2KA 4Q1VA 4DMCA 3LS2A 2VJDA 1C4XA 5LLSA 1ZIXA 1ZGCA 3E4DA 4QE3A 1Y37A 1QIMA
chains in the Genus database with same CATH superfamily
2EFYA 2O1EA 1XZFA 3IAS1 3O0TA 4Q3BA 2QMZA 5DTIA 1G20A 1JDNA 4B80A 3BN3A 5LQUA 2VHEA 4GX5A 1OWNA 4JVOA 3KJNA 4RDCA 4HDRA 5F5XA 3UG7A 2GH1A 3EZ9A 5A3SA 2BP7A 2CXUA 3WP0A 4MDFA 3R6TA 3ML1A 5CLLA 3ZDDA 1KMHB 4O4IF 3JXEA 4GYKA 1ZN7A 2JLXA 2OHHA 3JZIA 1C7ZA 1ZN9A 3KJEA 4TMVA 2XNDD 3ADPA 1FJGB 1PG0A 2XGMA 3CFYA 2EL9A 2CJPA 1TDJA 3RWMB 1TYEB 1ZKDA 1Z34A 1UR5A 4U6NA 3THWA 1NBIA 1VYVA 4JT8A 1ADGA 1VG9B 1VJ0A 2GZHA 4LDAA 3DM9B 2FFAA 4Z3KA 3MILA 2J9XB 3R6GA 4ZKEA 1U8XX 2X3YA 1DAPA 1PX2A 1UBEA 4EGQA 1R4NB 1RW4A 3OECA 3ZVNA 2NV0A 4QHTA 2Q49A 2LCQA 5FWNA 4ZCSA 4V1CB 4G01B 3S2EA 2N9UA 3HYLA 4KLAA 3O3MB 4QJBA 2CFIA 2X41A 2IZ7A 1ORRA 3AB3A 3PKZA 4C4ZA 1HWYA 4HLDA 2JEOA 4ZDJA 1QG0A 4Q16A 1LW6E 3DMRA 4HYEA 4ZO8A 2FPGB 3K94A 3K92A 3A4TA 3RT9A 1WBBA 3AVVA 5EHGA 1YQDA 2VQ6A 1A8HA 5FI1B 1AIPA 2IQIA 3C0KA 2QHXA 3K1JA 4RAOA 3BA6A 1E6CA 4IFTA 4RVFA 5IN5A 4EFLA 2AEEA 1GQ2A 3LPMA 1KYTA 1Y42X 4HGNA 3QKRA 3VDRA 4BMOB 4F5DA 1N8NA 4ND7A 5JVDA 4WCFC 2OBYA 5ALQA 1CNFA 3PGXA 2NZ8A 1E2MA 1XEWY 3T54A 3EIUA 1V7CA 2DBZA 4KMMA 3ZUGA 2QOEA 3CW8X 4QVKA 3OEWA 4X9XA 4OIMA 2BM1A 3UT5B 4LOIA 5AXDA 1EVYA 4P7KA 4EECA 4RFVA 4KWCA 3K9NA 3EVBA 4L51A 3DOIA 1UBRS 2C9CA 2OESA 4J3NA 1S2LA 2POCA 4MHTA 3EVCA 2KLHA 5A4MS 4RA6B 4RMNA 1MJNA 2C8VA 2P77A 1SMKA 3FA2A 3PWZA 4B8ZA 5LNK6 5K2OA 3UK2A 2V5VA 3MMPA 5CHEA 3VKGA 1N9GA 3LOPA 4GHWA 3DAGA 4PFKA 5A6SB 4IOKA 1N2JA 3ZZMA 5AJTA 1V8ZA 1EJBA 5TMBA 3IDZA 4MVJD 3X2EA 1EI9A 2P9ZA 2TS1A 3T0IA 2M1XA 4UQOA 4BNKA 2I3GA 3MJCA 2PBLA 4J1TC 2IDKA 2ZIUB 3PEUA 1FVXA 4X3CA 4QUKA 3FCAA 2QVBA 3ONDA 4ZDKA 1BJKA 3HU1A 3IP3A 3WLNA 1AF4A 1Y63A 2FZGA 4JSYA 4KV7A 3MWGA 4PSKA 3M3DA 3T1OA 1CR2A 3CF2A 1B8VA 1HZZC 3GNSA 3IO5A 2NSJA 1R9JA 1FVOA 4TQUS 1UM9A 2Q3CA 1LI5A 1VXOA 4GR9A 1MJGM 3T8YA 2B8EA 2H00A 4YB8A 4YJGB 4UM8B 4E5PA 1Q7RA 1IFXA 4RD3A 3OQ1A 1GU0A 4XQCA 9LDTA 1JIXA 1M1NA 2YHUA 3KQVA 2VTVA 1Z4QA 2Q3DA 2VNJA 1A9ZA 1ZOIA 2J9ZB 1NVAA 3IUJA 1XVLA 4TSRA 2VDWA 5LOVF 4C4TA 1USKA 3FFBA 3P5SA 1WY7A 2E5WA 4YJDA 3GFTA 4OB6A 2OLKA 3VX4A 4BLWA 3BB4A 3K2QA 1KMNA 1TCVA 2OAGA 2XVMA 4IKOA 1FTNA 1Q0SA 3FJ1A 4DYVA 2KPOA 1L7PA 3NGMA 1OIWA 4XA8A 5JQGA 1A82A 1EIZA 2A4KA 5KMGB 4MVJE 1CRPA 1VHLA 3ZHCA 1JDUA 2CXQA 2FG5A 1HOXA 2BDTA 3FNGA 2IHNA 4P4LA 4M60A 3PPWA 4N5IX 2QBYB 3IKTA 4BNMA 1SBHA 2WSMA 3NKLA 3ZVLA 3L0OA 4FDTA 4H7HA 1TT7A 3LX4A 3JYLA 3L18A 4H6VA 3M5CA 5LKAA 2O05A 3QWBA 3ILYA 4FJ0A 1YB7A 3TXYA 4KYTA 4EDHA 1X9IA 2GBPA 4P86A 4Y2JA 3DDHA 4OA5A 4D92A 1TIPA 2JVJA 2ZYDA 3D7SA 3PNPA 3KT8A 5HJ5A 3A0UA 3RGWS 3EGCA 1KAEA 2ANBA 2IEAA 3EGDB 1PVDA 1AKQA 2K6GA 2VJCA 4X85A 3Q40A 4Y2XA 5DSXA 1WBDA 1NI4B 1M34B 2PKWA 1FP7A 4OKIA 4RS4A 1PQPA 1WO8A 2UYYA 3EIEA 3ESBA 3JQBA 2CLIB 2CFCA 4O4JA 1GYPA 4C3OB 2YIMA 5CTJA 4EKIA 3TZLA 1CD5A 2R6R1 4J7CA 4P7FA 3HNOA 2ON6A 5TQ0A 2C3OA 1X86B 3G2LA 4M49A 4BBPA 3WZ2A 4BNYA 2Z9BA 1NURA 2X1MA 3NEAA 3CX6A 3GGDA 1F60A 1Z2EA 2H1FA 2PZEA 3WWEA 3B20A 3RM3A 3CWCA 5E6RB 3O3CA 4DHEA 5F7OA 5F3WB 4QIHA 3A6GA 3JQQA 1EMDA 2CJXA 1EHCA 2H63A 3AHGA 2H4JA 3AMVA 4G5XA 1XDBA 1QHHA 1X39A 2VF5X 2YBEA 3BK7A 2Q27A 1IJEA 3H1GA 3VV2A 1JG6A 2YJGA 1N0UA 2Z3WA 3FDZA 5FT9A 1DTWA 3RASA 2ZRFA 4DMMA 3NMUF 4PHTA 1UKEA 4C04A 2BFDA 3KCQA 2DG2A 4DGSA 1UBNA 3OM8A 1WLYA 4PZZA 5D87A 3II6X 4RTOA 4MQFB 4EO4A 5AJUA 2DLCX 4PLCA 2XGGA 4FFLA 3RH0A 1WXQA 3FOFC 3DZ8A 1YVUA 3JD1A 3A1NA 1AZWA 3MBKA 2ZCJA 4DV7B 2O7QA 4DYDA 3FCYA 6GPBA 2EZ4A 3UK6A 5E3HA 2C59A 4IL5A 1KY3A 1JIIA 4JB8A 1RYBA 2AF4C 5ALDA 2ZRJA 4ENPA 2ATEA 4D2IA 2XZLA 2D5LA 4C14A 3WDKA 2A14A 2QLBA 3HSSA 3PD7A 4M9SA 3FKQA 3M6MD 4B09A 1PTJC 4EM6A 5EHZA 4M37A 3FVQA 1W2GA 4MRAA 1W1IA 4K0KB 3M9WA 2JJ8A 1PEKE 1A9TA 2PY6A 4PYNA 3ANMA 4W7SA 3FWNA 5G4KA 5JSYA 1YZTA 3IR6A 3CINA 4CIWA 3EODA 3IPRA 3DWGA 3L0CA 5TQ0B 1BHO1 5ENVA 1DKPA 2B2CA 5MGNA 1K8ZB 2AIRA 2V7GA 4ITUA 2AG0A 2GGSA 1AHNA 4BX3A 1UZAA 2BBOA 1MMFB 4KBYA 3VJKA 4F1JA 2QXTA 3QOYA 4WXEA 4A36A 3K0SA 2NYUA 3QVTA 2OR3A 1FDSA 4DREA 4TMZA 1SOUA 3IAEA 4IHQA 3DZJA 4D9BA 4F8YA 5PNTA 5IUKC 2ZRNA 1G6OA 5IC4A 2P4EA 3GWGA 1KWGA 2G76A 2DPMA 4L95C 5EI5A 5B12A 2YCBA 3V1KA 1PSWA 3EOBI 3Q3HA 5B4UA 2OAQ1 1KJ8A 4MA4A 3IIKA 1GG2A 1V5EA 4CMHA 1A8QA 3B48A 5JYBA 2YYSA 4PAOA 1CERA 1E9SA 1T8SA 2B7LA 2PZMA 3CH7A 1VI2A 5AVZA 2D3WA 5LOVA 3IXLA 4MQLA 4LI3X 4PBTA 2C9OA 3U17A 1PGJA 2VVTA 5B7NA 4Q9LA 5CFLA 3IL2A 2CV1A 3IMCA 4ARIA 4E88A 3AM3A 4AM8A 2JJ1A 4OFWA 3L9WA 4YRCA 3ZKWA 1XI2A 1S5PA 1P1RA 2N42A 2B4KA 2P27A 3KXIA 3QI2A 3EX7C 2G9RA 3K8OE 4MRMB 3V42A 3NIGB 3V7NA 1K92A 3EXIB 2AQHA 2VNHA 1UXHA 3DMFA 4HAIA 4XD7D 3UT5A 4DM4A 4CL3A 2P41A 3AM1A 1SXJA 4FU0A 4GYJA 1GIAA 1NTRA 2YMLA 2DUUA 2CLLB 3RUIA 3RS7A 4YCSA 2G4LA 3LY9A 2B4QA 1U1DA 3CE9A 4TL7A 3U19A 2YZMA 4KW7A 4FKMA 1U6JA 4PCAA 5CM2Z 3CIOA 5D3QA 2PL3A 3EG9A 3EPKA 1O95C 1UM9B 2EIXA 1S2OA 2WYIA 4GWGA 1R3DA 1SCUA 2A57A 4EGSA 4LRTB 3BERA 4J49A 3MTGA 3CGWA 4Y30A 4V39A 1LNZA 4E22A 2FWIA 3OESA 1RMQA 4LV5B 2JCSA 1KEEA 4KKXB 3QF4A 4ALLA 3UKJA 4CKBB 1RVDA 2D2FA 3QPWA 3HZOA 4Z0HO 3EPJA 1G8HA 2AK2A 2P2DA 1G63A 1P2VA 3KLNA 4L9WA 4OU4A 5BNFA 1QRSA 4DMLA 1DKUA 4G4SP 1RWPA 1Y1TA 2L82A 1Q95A 4IX1A 4K86A 3OE4A 2QMUA 4PQEA 1U7ZA 5A7FA 2IXAA 1N2BA 2Z5FA 4LJ8A 3H99A 2ACKA 2B7CA 3BJIC 4JHXA 4BGIA 1SC3A 2DERA 2VK8A 2Y1CA 4FX5A 4P54A 1ZIPA 2H7XA 3U49A 1GRVA 2C0QA 5B6JA 2ERCA 4DR7B 1MORA 1EZ1A 1IY1A 1VMDA 1YRAA 1NVXQ 4DL9A 3UENA 3R40A 2GM4A 2WKWA 4U0JA 3WL5A 3BTUA 1HV8A 3GH1A 1UBGA 1X1EA 2YVLA 4EY3A 5HBGA 2EWVA 3DGEC 1SOMA 3VI4B 5AVUA 4FMPA 5HKLA 4JC4A 3UAXA 2BFFB 3UC5A 4D74A 3SIRA 1Z28A 5HKKA 2F3QA 2I1WA 4P2GA 1T5HX 2ZBDA 4NY1A 2YCLA 2YOGA 4TKUA 5FPHA 2INGX 2R6HA 3C4VA 1K4MA 2HLDD 3LZCA 4LE0A 1DXHA 2Q6OA 5I5EA 4FOOA 2R1UA 4DA4A 3VNVA 1C7IA 2VH2A 4RELA 2HEIA 1YFJA 2HGSA 4ZC1A 3TLMA 3A9SA 1UXGA 1RQNA 1H8HA 3OHPA 3CKLA 3DDUA 1PKEA 4LXQA 4NXMB 1XFAA 4ALIA 1GAQA 2HK6A 3WWPA 4HN4B 2FFQA 4OQFA 5KKCA 3Q5GA 2FSPA 4YACA 2Q5LA 3ICPA 4ZQFA 1E1KA 4AZTA 2I33A 2E4UA 4F4FA 1K5GA 4OHYA 3OIGA 4U2CA 3ZW8A 3IB6A 1HGXA 3N2EA 1Z12A 1RKVA 2D3TA 2PMKA 4DG5A 1RXWA 5CVJA 3DW1X 4OBBA 4H7KA 3VU3A 1VG0B 4Y2PA 2V8OA 2CD9A 5GV8A 3WIDA 2XCUA 5GTDA 1H2BA 2D5BA 2H7CA 2W6MA 3A2NA 2I2DA 3TSAA 2DSNA 1DBIA 1RKXA 1DFHA 2C3PA 2ONJA 4EUHA 1Y98A 1YB6A 3AKZA 4NCAA 1KYWA 1N5OX 3KD3A 2H4HA 5EHNA 1NJ6A 2OO5A 1KDRA 4X3OA 4Q6BA 5BQOA 3U37A 3EA4A 2CYCA 1EDZA 1TXGA 4E2YA 1YOBA 2OV8A 2MOKA 4WBNF 4P3PA 2GCPA 5A3VA 3A1TA 1ONOA 5K8VA 1BHQ1 1XYYA 4KDEA 1SKUA 2C97A 4DWWA 4G41A 3QE2A 5KUTA 3RCBA 4PFQA 1SU6A 5I3CA 1QJ4A 1PL7A 1HTTA 2ALJA 5HFJA 3WVNA 1PQUA 4ENQA 4N0MA 1I6KA 4HYTA 4TXNA 3BMNA 2FMFA 3CZRA 3ZWYA 1TMKA 1AZLA 3OQHA 3TOZA 4EB6B 1E69A 2ENWA 3JATB 5AIBA 1RRVA 3JRXA 4MDYA 3I09A 2XIJA 3EAFA 4ZJPA 1RPNA 1OB5A 1V7QA 2C2ZA 2R1ZA 1PZFA 3GDGA 5ICCA 1VE9A 1C0LA 1PDVA 5BT9A 4AZSA 5K6TA 1MC5A 5IMSA 3F74A 4IR7A 1XQ1A 3JCZA 4B5KA 4UUBA 3KKEA 2VQ3A 2HZBA 2XF2A 1JLKA 3ILVA 5I47A 3CZ9A 1Z68A 1L7OA 3B2QA 1DO8A 1YZQA 3AP2A 2H1RA 1Z4JA 2MSNA 4PNHA 1OT3A 3EVFA 3GCGA 5LQRA 1F0KA 2QRLA 2Q1YA 2O7SA 4P3YA 4HX5A 4BZZA 1TYAE 4O25A 3L93A 4NPAA 1GCAA 1WXHA 2H52A 4LMRA 4RXTA 3A9TA 1V48A 1UDRA 1PJQA 2X4IA 1O97D 5KOJB 2CYAA 4OMDA 5EJFA 3C5HA 3F9CA 1KAMA 2WFMA 1H85A 3DGFC 2QA5A 3OE7A 3P2MA 3R6LA 5T8KA 3H05A 1DKOA 3U13A 1E96A 3L41A 4QPNA 3VJLA 1IYZA 1KJ9A 4DG8A 4EEKA 4HLUA 4WSOA 4EJMA 2G5PA 3L1JA 1KPIA 2J67A 1EFKA 5EUQB 5JRDS 1K7XB 2OWEA 5BNTA 1I3NA 1K68A 2YJ4A 1VL5A 1E98A 3EVTA 1YU9A 1V3QE 1ACMA 2G0TA 3BCHA 4L8WB 2WDPA 2PPVA 4DDTA 3AWDA 1ZOSA 4BMZA 4EZIA 2XEXA 2GBGA 2M98A 4N3AA 1TK9A 4I1RA 4MRVA 4DB2A 2V6IA 2GCEA 1I13A 1NC1A 3FKJA 2PMWB 3D3NA 3I45A 1KETA 3IRVA 3V1TC 4CKBA 1LVHA 1AXEA 3E05A 2SCUB 1BMTA 2ZJ1A 1N7GA 1YV9A 1GNTA 2G5TA 4G5SA 2A86A 3TCXB 2R87A 3LHIA 2Y93A 1DC5A 3QWIA 2PN1A 3K09A 1Q7EA 3JPYA 5J23A 1GKUB 1IC6A 1E79D 2L18A 3DEJA 3WIBA 3CLHA 4BTLA 5CCDA 4KXNA 1Y8QA 2XRFA 1ECPA 3ABOB 4P98A 2O2ZA 2Q5CA 1YJAA 2XX3A 1HMPA 2R4QA 4CKEB 3H8WA 2CJFA 5CPBA 4NEQA 3KQWA 1O1YA 1O6CA 4OHRA 3TRDA 4XSHA 4Y6OA 5AKIA 3TNJA 1S1MA 1IDN1 5CA1B 4BEBA 1P45A 1Y8AA 3GJZA 3M6VA 4OAPA 2RGDA 2NXJA 3DLAA 1M3SA 2JBHA 4QO7A 1C9NA 3S70A 3H3FA 3C1AA 2JIPA 2C88A 3DBHB 4R2HA 4D0NA 1WV0A 5L3VA 4YJ3F 5ECWA 1Y6ZA 3E22B 4E51A 3JSAA 5E9JA 5CX1B 3ZV4A 4EKGA 1B6GA 2QN3A 1ZMBA 5M04A 2QZZA 4NJOA 3PTZA 2K5UA 1VTKA 3GG2A 1XZQA 3QNMA 3HCDA 2XWJI 3SEQA 4NJMA 1D4FA 1TVKB 1ZM4A 1VPWA 3K6RA 1YZYA 1G21A 1X9GA 5EGSA 2EKBA 1SM4A 4B17A 4BFWA 5BN1A 4HUTA 2VDPB 3ABZA 4BZWA 3EDOA 4B48A 5CLFA 2J07A 1LPNA 1YVEI 3KUKA 4FT2A 4GZ5A 3JQ8B 2VP2A 3ZS9A 1U9IC 1J25A 5EP2A 1D2GA 2ORED 2VKQA 1PEAA 1PHPA 2C9MA 3CHYA 3IAM6 1E0DA 2J87A 1RYFA 4UHFA 5K3BA 3WLIA 2EBWA 2XQGA 2WWHA 1C4OA 3GJ8A 5AI8A 1KHHA 4F86A 1DRJA 3QP9A 5A4DA 3BSFA 3LCCA 5FUWA 1FSGA 1SUBA 4OI4A 1FRVA 2IEIA 1ABEA 1W34A 5DFAA 4M1MA 3PP8A 3ZTWA 1YU6A 3DF7A 4MI1A 3WGNA 5HKAA 3FLAA 2Q07A 4R3WA 5I5GA 3T7DA 2DJ5A 4N8SA 4BNIA 4PQGA 1IPEA 4H4EA 1J6UA 1ENYA 2HTEA 2ODNA 3WTBA 1SCAA 3HCNA 1ZCAA 2WPDA 2IPLA 3LXRA 4MQBA 3ZGLA 4BV3A 1I9GA 1L4FA 1ZD2P 2NTEA 1UBJS 3L06A 4GX0A 3LFTA 1QIDA 2QLMA 3KDAA 1HX7A 1IRIA 3FDJA 1TM7E 2IU3A 3M1AA 1FJXA 2REQA 4N47A 3I5XA 1TIBA 1ZM2A 1K5PA 3PC8A 2ONZA 4OL0A 2CMGA 1PSZA 1M1NB 4MTCA 1NE2A 3LOQA 2GHRA 3INGA 1BAPA 3DTNA 6LDHA 1RHUA 4LYFA 3TLKA 3ELBA 3M5WA 1PBTA 2OLEA 4RD2A 1HYEA 2CNWD 2W2XA 3F7TA 2AYXA 3N28A 3OZGA 4KDFA 4MYRA 4UHDA 4XUCA 5BQPA 4UAGA 4YFYA 1IBLB 2BTQA 1GRNA 2E5LB 1EESA 3MCWA 1BFUA 3Q3VA 2J08A 3C5WP 4FCWA 4NU5A 2XBUA 2A9OA 4NJEB 1QZ3A 3BC1A 1L1FA 4EHAA 3TQTA 4B7ZA 1TK2A 1VECA 3NW9A 4JR0A 3E9ZA 5GM1A 3WRYA 1JEEA 3EHDA 3M89A 1H8EA 3KKZA 2VUHB 5CXXA 3STYA 5IASA 2YIDA 4DEXA 3I6BA 3HBNA 4ZT5A 1V41E 3H8VA 3CNNA 2AJ8A 1CR6A 3UJBA 4YYEA 5IJ9A 1S8NA 221PA 3NHYA 5EIBD 3H0CA 1WWKA 1DX6A 4JXJA 1I3MA 1NW4A 1CRWG 1IAVA 1U7WA 1R0YA 4Q66C 1J0AA 1HQCA 4CPDA 2VBIA 2GO1A 3UANA 1C3LA 2H7VA 2A2ZA 3T3OA 1NA5A 3LK6A 2IS6A 1TW2A 1ZM9A 1ZZEA 5DCLA 4CN9A 4YCCA 5EG5A 1ZP6A 2QIPA 1JI0A 4GP7A 4TMKA 1MG0A 1ACLA 2EX1A 5T8KC 2PX5A 1D8TA 1JNXX 2VCHA 1P29A 5DBEX 2ZJBA 1H05A 1GTJ1 2RGEA 2OCKA 1AQYA 2X1LA 3DTVD 1OQAA 3MW8A 1T9AA 2CHUA 5IAEA 3RC1A 3DLHA 3F3SA 1HNXB 1R0CA 4ZHQF 2WSSA 1ZGHA 2I8AA 3A3OA 3PX3A 4X97A 2FZ5A 3V00A 1O94A 4FHEA 1OYVA 3FYDA 4NLLA 4P3XA 1I2AA 3CPEA 3LA6A 1CJTC 1X7WB 1KDYA 4EG6A 3IAUA 3OIUA 1PV2A 3G2OA 2ERXA 3KKQA 5JWHA 4LXXA 3A58B 2BD0A 3DBLB 3GAFA 1K3FA 1C7EA 4IXNA 3PGLA 4I3FA 1JAIA 2HCRA 1B26A 1ODJA 5AJHA 4RCVA 4LHXA 3SZ3A 5JU6A 2UXBB 5KJCA 5CFPA 1JG2A 3H42B 5U9CA 2QDXA 4QAQA 1SQSA 4X1YB 5EGNA 1O97C 4UQLA 2V54A 1R0WA 3HJAA 5AM5A 1UH5A 3EXG1 4GPTA 1E4EB 3W06A 3LSTA 1TTPB 1GEEA 3ANXA 1LI4A 5IKEA 3JAMA 3WB2A 2ZM6B 2W6OA 4OGFA 3SJCA 3QLUA 1BDBA 1OLXA 3FHTA 2YXPX 2DFTA 3I4FA 3GB9A 4Y67A 4ZAWA 1E6MA 5GONB 2RI0A 3MRXA 3UGJA 5EZYA 3ET5A 4NG4A 3O1IC 2QNRA 3NWBA 4H0CA 2G88A 3O4JA 2CXXA 4RWZA 1KBQA 3OH8A 3K1AB 4EKYA 3FOEC 3QXXA 7REQA 1JBEA 3KB2A 3DAOA 4K1LA 4D3SA 3M70A 3L1VA 2MWMA 3IQEA 4WKOA 2X5XA 3DV0A 4DA0A 3IEVA 3DZCA 4O2BB 4OMFG 1L3CA 4O59O 3PFNA 1JSXA 3D2LA 3KOYA 2W4QA 1BQ3A 4PRZA 1G4AE 5EQTA 2HBZA 2P2NA 3G7NA 3O74A 2DRIA 4N40A 4FWTA 4RFSB 2VK4A 4K88A 3EFOB 5E1OA 2DUMA 4EGCB 1AM4D 2E4WA 4I66A 4Z5XA 3W34A 1YZVA 1ONNA 2PH7A 3NVAA 4ZC8A 2HPAA 5H3HA 4EX6A 5JNLA 5L7TA 3P45A 3FJOA 3OLQA 1OXTA 4RACA 5JCOC 5DHRA 3BL5A 2YXNA 3WBJA 1SU7A 4PNPA 4QO8A 4G0XA 1TO6A 1G9SA 2DWQA 2QBYA 2RIRA 2YZ7A 1GGFA 3UB4A 3ZCPA 5LQJA 2NOAA 5I7OA 1OU4A 5IDQA 3J7AC 1WNTA 2WILA 2O8EA 3UO8B 3EIQA 2HY7A 1DELA 4R41A 1UAAA 1XPRA 3GBVA 3KUXA 5C2JB 5CURA 2ISCA 3AEUA 1PR4A 1V5IA 2WIAA 4RFLA 3LW8A 2WJZB 2UUAB 4BCDA 4NZPA 3WLEA 1CE8A 2I2BA 1OI2A 2Q1TA 2Z3ZA 1X77A 3LQYA 4RZQA 4D02A 4AXXA 5JANA 4LG1A 1FLAA 4QICA 3UT6A 1VRWA 2CVHA 2X23A 2EFEB 4YREA 1TZBA 3EG5A 5EZQA 4G5HA 3TTXA 4BNVA 5B1EA 5K3DA 2CVPA 3HFGA 3WWCA 5FA6A 3PUZA 2Y1XA 4RVHA 4RDHA 3FNBA 4B6EA 5K4HA 3OKPA 4Q1AA 1JG1A 4K9DA 4BXOB 3OPYB 3DV0B 4A1FA 3JWGA 3ONEA 1CJBA 2DULA 2JAOA 4M55A 1SUEA 4XVUA 3PVSA 4US2R 1Y6FA 5EUCA 3CISA 1SZPA 2HMTA 3COVA 3GAAA 1IOVA 2Z30A 3M4JA 3QFRA 1ZIDA 4DV0B 3NKVA 4MZXA 3QOWA 1HYBA 4E3WA 5LP6B 1H1LB 1MC1A 2XB6A 4KWIA 1RR6A 4Q4DA 4FDMA 4BIMA 1IXZA 3HUUA 3QVJA 1JHXA 3FNQA 5DN6A 3Q85A 2AFIE 3BWDD 1R4MB 4MRNA 4KQWA 1W9MA 3FWYA 3G9ZA 4XE5A 3SQMA 1R16A 1YDHA 4M88A 4OREX 3HE3A 1PZNA 4D56A 2QN7A 4CG2A 4E31A 3CRRA 3FM9A 2R4TA 1R6TA 2FP4A 3NTLA 1MZVA 4YJ2B 1AKMA 5LQNA 3O82A 4LECA 3TKYA 1VZ3A 3NHBA 5F2OA 4ZHQA 5KSOA 1L5MA 3CZCA 3CNEA 5DNYB 2VPQA 3C14C 2W48A 4MYTA 4UD2A 3PC7A 1ECJA 4K46A 2C5FA 3AUSA 3VJMA 3WHLA 2ZRBA 1SUSA 3GN2A 1C1DB 2B2NA 4QUGA 3IQZA 4CM6A 3AONB 3JQFC 4GOND 3WGZA 2YZKA 1OKKA 2GPYA 3FVVA 1XTIA 1RLOA 3IT3A 4RL4A 4FLEA 1S2GA 5T64A 3D2BA 5FWYB 2ZYTX 1T9GS 1SVLA 3BIOA 5K6AC 4FFOA 2ACEA 1IJBA 4YUAA 1TNDA 4KN5A 5BRNA 1KZGB 3GJ5A 4P0QB 1BX3A 1E32A 1GAEO 5C18A 1B42A 1A71A 2ECFA 4FGWA 3T99A 3P7MA 4C7JA 3IBYA 5B53A 2DWPA 4QQNA 4XWYA 1YZNA 2FF7A 3KVVA 3WYGA 1WZEA 2E37A 4JEHA 2B6NA 3IDOA 4B83A 5KJEA 1Z7YA 3NAQA 3E1GA 2BBTA 2NO4A 5FO1A 1ZL0A 2IYLD 4A03A 1XNGA 3LNCA 4HADA 4QUEA 1BDJA 3FNEA 2KJQA 1P19A 2OSVA 2R4UA 2ACWA 3WK4A 1N77A 1XZBA 2DPGA 1A9XB 2Q0XA 3UMGA 3KJZA 1GM5A 1ZK2A 3ZE8A 2YWEA 2OQIA 4J43A 4CMIB 3AL3A 1B76A 3G0CA 4YLYA 4A5SA 3UCEA 4TN5A 5TC4A 3PDCA 1G4UR 4C0WA 4AZ3A 3CRQA 1WB5A 2BKEA 2PUVA 4YQZA 4D7AA 4RTPA 2P79A 3Q2KA 1ZUIA 2W4MA 1E58A 4WLEA 3UNXA 1E3MA 3LBYA 4GLLA 1CUZA 2DLNA 1W19A 4NS1A 5AVXA 1T0JB 4ZOLB 5FBQB 3WL4A 2OFXA 5H4GA 2JF0A 3K0FA 4YR7A 4WKPA 5TJ9A 4LNUB 4FGSA 1PX0A 8AT1A 3ZK7A 3DQPA 4INPA 3A1DA 4LBYA 3CH6A 4FDAA 3RRFA 5AM3A 5IH7A 5JEEA 2A3RA 2OO3A 1KTVA 3D0QA 4OQNA 1DC3A 3FHOA 5A9RA 3HN2A 3HB7A 2A0YA 4B8YA 3LG2A 1DCMA 4DLYA 2YNMD 5EIHA 2EQAA 2ZYHA 1NTOA 2PT9A 4B7XA 4BB0A 4TKVA 1Y82A 2ZAIA 4V2IA 5AW5A 4CKEA 1VJDA 2QJOA 2D5CA 3CCCA 2FZLA 2AUTA 4KXLA 2ZQZA 5B1HA 1OSNA 4BBZA 4GYWA 3L79A 2CE2X 4HWPA 4DR5B 1P5JA 2JZNA 1BXGA 1EQ2A 2WKPA 3ZGOA 4C0SA 5HCUA 2IPNA 3DE0X 1OWOA 2BGJA 2F17A 3L6UA 3PSAA 3PYXA 2HDOA 1Y8RB 2TMKA 4YAKA 3RKRA 2EZ8A 3AR9A 4BP8A 5A3JA 2PZKA 4GKKB 4UUNA 4WKCA 4GRIA 3JWHA 3ETLA 2X8AA 2AH5A 4HDNA 1QH8A 3T5GA 1OX6A 2R5WA 4B45A 1T5IA 2AJTA 1XR3A 3R2JA 4WNYA 4GSLA 4PC7A 4DOMA 3GF4A 4AZ0A 4B81A 2P3SA 1CY8A 1UBLS 1JZTA 5DK6A 2E89A 4REQA 1UDCA 4DILA 1P9NA 4K7JA 2VDVE 5IM4A 3EXHC 4EJFA 1F6WA 4DIUA 1G3RA 1UBHS 4I9UA 5H0IA 1NY6A 5B64A 4OJNA 3AEKA 2HI0A 2BFCA 4IZIA 3UFBA 3PQFA 2QV7A 4X91A 1N0VC 4DWOA 1S8OA 3L1UA 1I6MA 2I9PA 1WXFA 2O3JA 2R85A 4OK5A 3W4IA 4EKDA 3AXSA 3FTDA 1TCCA 4YO8A 2R8ZA 1CX9B 2D00A 3BMCA 4ASUD 2SKCA 5B7GA 5K8LA 3VKHA 4JJZA 1R4ZA 1Q3TA 3BJMA 5BT8A 3INRA 1U0LA 2GLTA 1G8JA 3I9JA 4TN1A 5HKBA 2IE0A 4IH4A 3AUUA 5C4IA 4IIJB 1ZRHA 2EXXA 2OHIA 4I1PA 5B2EA 4OUDA 4YLEA 1TM1E 2ZI3A 4MS1B 2FVXA 5H81A 1YKSA 4QXPA 5HGJA 1NQTA 2VP3A 2FSUA 4YX9A 2D2VA 5FLXA 4W5RA 1LPAB 3C7KA 3EQ7A 2WF6A 1U8EA 5TV2A 3K0KA 1OAOA 5CFMA 5FQNA 2WUFA 5K0BA 3WTCA 2QGZA 3KPUA 3WIUA 1UKYA 2RGUA 1T3LA 4KRXA 4G4SO 1L9XA 4DJJA 1KI4A 2ISSD 2G63A 4BWGA 1IZ0A 1NMZA 5EUMA 3TINA 2WA1A 2XWSA 3UK7A 1XMOB 4CQMA 1JH9A 4R6XA 5FL7D 2JDID 3EXEA 3F5QA 3R1IA 4AAYA 1XD9A 3GI1A 5F23A 5KX5F 2DTXA 4V2UA 4QBHA 2AMJA 1LWOA 4MO9A 1XU9A 2PFGA 5C80A 3B89A 2OCBA 3D81A 4UXJA 4BUZA 5BVHB 4QUIA 3HKCA 4HUQA 3ESCA 4RJ2A 5C5CA 5GZ6A 1PGQA 3OAAA 3S2SA 1CS0A 2LKCA 4J0HA 4TTTS 4PAMA 2OGTA 2OVFA 2QJRA 2AMYA 1RKBA 2XDQA 3L8GA 4BU1A 2EEPA 4K1XA 3EW7A 1Y9AA 2D1RA 2RCYA 3A6ZA 3RIGA 2IWRA 3DB1A 4C4PA 3S27A 4XM0A 1QGOA 4KX5A 2VJMA 2VJLA 1DOZA 2WT8A 5EE1A 1IXKA 4CJXA 2A1IA 3ZN2A 1G1MA 2AW3A 5FEMA 2PV7A 4NBSA 2HF7A 2W2OA 2PSHA 2ZITA 2CSUA 3BFPA 3QBJA 5I7SA 4ZOAA 1PFWA 3UQYS 2ZSJA 2UVDA 2IXGA 1RJFA 4X1KB 4MUFA 2FSIA 4HBZA 3N53A 4G36A 3WBFA 4DRXB 3UUGA 1PK7A 4HDKA 4BQSA 3KQKA 4YXFA 2Q21A 2E82A 3X1WA 1STOA 4QBGB 4ZOBA 2VI5A 3TIXB 1KIMA 2DU8A 3AY7A 2ZI7A 3RF6A 2A0KA 2CXOA 2I67A 2JATA 4D5EA 4HWKA 1JX6A 4ARBA 1RS0A 2CNKA 1OD6A 2A59A 2Q1WA 3QWHA 4JI2B 5KOJA 1KXJA 2PKYX 3OX2A 2GM9A 3AIOA 4D43A 5CB6A 1ZNZA 2GK6A 3P9KA 1KA9H 3GYBA 2I4OA 4WJKB 3UPUA 1JFFA 1O0SA 3CKKA 1NQVA 1N2IA 4V0RA 3ZGNA 3HNPA 2BFAA 4BVHA 3LUAA 1VHWA 4D44A 3OQ6A 1DQRA 3L7JA 4G0NA 4LMAA 1TGYA 3WX0A 4B3FX 1BO6A 4BX2A 2WICA 1VBNA 2BMAA 1UPTA 2QPOA 2ZTVA 3DAYA 3D7KA 3KQQA 3OTGA 2OZEA 2WAAA 3ZE0B 1FUUA 2HSWA 4UVDA 3PHGA 3I04M 4YP7A 4DADA 1RMTA 4K9OA 5TARA 1CB0A 4E6PA 1NUHA 1QH8B 1BCSA 1BCRA 1FFXA 4HPJB 4N6GA 3O91A 3SG0A 2ZEJA 1O96B 3I8OA 4PGHA 2C42A 5DBFA 1IULA 2ETXA 3VKVA 2JLYA 4YAWA 2OY0A 4C4RA 2BEWB 2ILVA 1JEYA 1GA4A 1TVCA 2WR8A 1B00A 5E0KB 1VJTA 2VO1A 3OEED 4QU8A 1JKJA 1SC4A 1UFOA 3ZZ0A 2WHQA 1JR4A 5KYKA 1FU4A 5AFSA 2JFYA 4NF2A 3HB4X 3HJCA 4RBNA 3C74A 4DABA 3KU1A 1N2CA 2VRCA 2OV2A 4KXQA 1BOFA 2BYTA 4YDRA 2WT9A 3OFJA 3PHBE 3JQCA 1BGWA 4M0DA 3LGSA 1ZW1A 1XRJA 4G67A 3IEMA 3VAZA 4BKQA 4GUAA 1K8YB 2XCRB 1IOWA 3M2TA 5G1OA 1TEXA 1EE9A 4PX9A 2WRZA 4LS3A 2QRVB 4XYGA 4HTFA 4DV5B 4PN3A 1T8YA 3CPHA 3W05A 4OBXA 4MEAA 4POOA 1DKRA 1JTEA 3GIDA 3HXOA 4K40A 3ENWA 4CIYA 1W73A 2JJ2A 5CFRA 3U09A 5DWDA 4NE9A 2ZBGA 3LT2A 1B1CA 2Q4RA 2IP4A 2QYHA 3ZNQA 4HS4A 3WLQA 1S7CA 4O2BF 3K7EA 1KC3A 5CIYA 5IEBA 2VRBA 5J47A 3KHTA 2HYIC 3AESA 2Q29A 2QZJA 3HP7A 3TZBA 1OJLA 3N3BC 1QK5A 2G80A 3PL5A 4G0VA 1FZTA 1K98A 2GNOA 5HM8A 4LQCA 5EJGA 4HJXA 3DZFA 1UBMS 1IBKB 4KOAA 2W2VA 1PDWA 2HJRA 3JQ7B 5CA0A 4C7OB 3JAWA 2E85A 2C2GA 1LXCA 3RVSA 1YAJA 1A1VA 2OOKA 3QIAA 3MWJA 1XN1A 1ZOLA 4ZI3A 3RRZA 4N8EA 4HOYA 2JKZA 4OXIA 1KJYA 1W76A 3CMMA 3ORHA 4FTWA 1CEQA 4WVFA 3TYXA 3F8WA 3U7IA 1NF9A 3PQEA 3CLVA 5C1BA 1ONBA 4R7ZA 4REQB 3DXXA 1L9KA 2REOA 3HJGA 1JT2A 4P08A 4JOCA 4Q4AB 4XR4A 2ZRKA 3T7RA 3TEJA 4IJWA 4P33A 2FWMX 1Q16A 2EL7A 3QG5A 4DMGA 1OTHA 1PO7A 3DHVA 4F5EA 3WLLA 4RUKA 4HLQB 2PX2A 3HCWA 4YGXB 5DP2A 1GYRA 3R9KA 1I1QB 2PEYA 3CTMA 3W8NA 2DGDA 4AMUA 1E3WA 3NV7A 3EE6A 3GJXC 1PFQA 1KK2A 4QX6A 1VCHA 2I55A 4I50A 1DBQA 2HWXA 1KYQA 2P5SA 1HI9A 1HDEA 2BEVB 2MDTA 3OX4A 4OV6B 3ZNNA 8OHMA 3IEIA 5FLKA 5CCEA 3OY2A 4M1KA 5AI5A 5K3FA 4FYXA 4I2VA 5L3ZA 4QPZA 5C5DA 4W8HA 5HUQA 1QH0A 1E3WB 1L7BA 1ZUHA 2C3YA 1VA4A 1R8JA 1GZVA 2FJ0A 3HDQA 1WULS 2NNLD 3PDWA 4KBGA 2B36A 2KLBA 2YWFA 3BIFA 5DRYA 3GJTA 4HGRA 4LIPD 4UEWA 1UP7A 3L92A 4BNFA 2REXB 2ZYUX 4PRLA 4OQEA 2CF5A 4ZPJA 1CHDA 5CK5A 4ZP1A 2RHJA 3HB9A 2E4XA 3ICQB 4LJRA 2QN1A 1JFLA 1TJ3A 3DTVB 5DYYA 1DWQA 3QUSA 4A82A 3VYTB 4MV1A 4UNNA 2HWKA 1GU7A 4BVFA 1Z17A 5LYYA 4C03A 1TMGE 4TYMA 5A6VA 1ZGZA 2F3SA 2BIFA 2BTEA 2QTRA 4RVUA 4BO7A 1EINA 3LUFA 2CXSA 2QVGA 4RTLA 4MI6A 1MIOB 4B3BA 4F60A 4YJFA 5WRFA 1MH9A 4FINA 4QDKA 2Q5OA 1CS4C 2Z6AA 4F85A 3TH5A 7MHTA 2LCIA 1G60A 1JJFA 4QJ4A 3Q0EA 2V3CC 1KZ6A 1L4HA 2ZUFA 3GAZA 4KO1S 4LGYA 3E70C 1SWWA 1J9EA 5T4BA 3T38A 2EQ5A 4HK4A 3DAPA 1CV2A 3C3JA 1UKZA 4FYWA 4LBZA 2REBA 1AG9A 1WPGA 1KI1A 2H17A 3DO8A 3GK3A 2XMGA 3Q0TA 4R1SA 3ZQJA 1EAYA 4HNAB 1WVGA 3IKJA 4X1IA 3AG5A 3DD1A 2FNAA 2C57A 2J09A 2G6TA 4V0OA 5FOXA 2XA9A 4ZRDA 3USZA 3H18A 2OCDA 1XQ6A 1XCMA 2CK3A 2WVGA 4G37A 3T5BA 5IAGA 4D1YA 1YO6A 4BRZA 5JIBA 2J4CA 1KJQA 2VTKA 3CNLA 3EXAA 4TYWA 1FFSA 4X8LA 5CX4A 3PHIA 4E09A 3X43A 3OG9A 3M9LA 1M75A 4WOCA 2B21A 3RUCA 3H2YA 3G1WA 5MN4A 1EVQA 3AR7A 3MGKA 3ACBA 3PYLA 2E0IA 4WL0A 4DSNA 2QV0A 1M1YE 5K20A 2MYTA 3P9CA 4QKQA 4G1FA 3O73A 4X0EA 1X13A 3T52A 1KMIY 2GRAA 2XMRA 4DCNA 2R8PA 2O4CA 5IYZA 3MSCA 1OXMA 1TJ4A 3BBLA 3JQAB 1JJIA 5H82A 4A4DA 2J1LA 2LXNA 3GRFA 4G1MB 1VE3A 2ZB2A 3I9FA 3HBLA 4O1HA 1FOEB 4UOQA 3HY3A 4B5LA 5M5BA 3OF5A 3OAAD 1BXKA 1VL1A 2I5PO 5IKOA 4AY2A 4AJIA 2J9FA 3MD0A 3UJ3X 2O2SA 5DX8A 4IDOA 3KRTA 5GONA 3SX0A 1YS2X 2TECE 4DCJA 4DA9A 1AMUA 3ZLUA 2WWFA 3BB1A 4K9KA 2FSHA 5AVOA 4YH1A 2G0NA 2H2WA 3PXUA 1SN7A 2MT9A 5CDHA 1NKVA 2CNWA 3ASYA 4ZGBA 1PFGA 1IUPA 2FOLA 2QMQA 1HYQA 3DBRA 3N2NA 5AQEA 1U7XA 3BUSA 5KS2A 1SG9A 3LYAA 2R48A 1ZNYA 4X62B 4TVSA 4KX3A 2P6OA 1NBEA 2RKWA 2O0MA 2WTMA 5BSFA 3R3SA 2BOVA 2JBWA 1D0SA 4BN5A 1WUYA 1U8UA 3LU1A 3PF8A 4ZA2A 1EXNA 4HAVA 2VSNA 4R05A 1Z82A 1DJPA 3NRJA 3DONA 1M72A 2BY4A 1LPPA 3KYJB 1XAIA 5CB0A 3OKFA 5FUYA 2VF2A 3HO6A 3SF0A 2XQIA 4D26A 1CUXA 1Y8CA 4XIJA 1V1JA 1BU8A 1VSUA 1U2TA 4RPKA 1MVLA 3H5OA 4WEQA 5HWSA 4XDHA 1UFVA 3NNNA 5DM0A 1BWSA 5FAKA 1V8FA 3HB5X 3M6FA 3MJSA 2V7XA 3I04A 3TGWA 2ZU0C 1A72A 3V2IA 4EY8A 4C7BA 1E9BA 3M4YA 2G5GX 1EFUA 4TS3A 5JDCC 5F73A 4DV4B 1D4AA 2BE7A 2BFPA 1PV1A 5BR8B 5CG1A 1HQDA 1D5CA 3F5SA 4JL8A 4ZAYA 4CF7A 4XI9A 3SS8A 4R16A 3MCTA 4DR6B 2XWQA 3QPVA 4PGAA 3JD0A 4LFCB 1R66A 1GTVA 4KNWA 5LP6C 1J2RA 1ZVMA 2IY9A 2QU8A 1J8YF 5B3LA 2JCVA 3L7MA 1NSFA 2CL0X 1NLZA 1QFZA 4L8LA 4U39A 2IU4A 4CM4B 5DYTA 1J07A 1O89A 1GUFA 4E94A 2N1MA 1F2TB 1E5LA 1L7VC 2R1VA 3M9XA 3OJOA 4YBZA 5HCIA 4TKVB 4OAQA 4OU5A 2C4TA 4UAVA 3W0LB 4J0FA 2FTKE 2OEPA 4E2XA 1AK2A 3KOWA 3E23A 5IBPA 3BCSA 2VA9A 3G0HA 2XB8A 1G5RA 5JUWA 2EKDA 3UKOA 2PUCA 3L49A 3V8QA 2XY4A 1Y4UA 3AERA 4IIBA 1QBKC 3LY8A 4L28A 4MUHA 2PS0A 5T5QA 3WRWA 3VZPA 2AR7A 3S0JA 3BIXA 1KO1A 4AJHA 2VFAA 1KI6A 1OLXB 1RM5A 4TLMB 5CD1A 5AW1A 3W90A 3FETA 3U31A 3L4BC 3JVVA 2BP7B 2I4RA 4U63A 1N0IA 1P81A 2G6BA 3HABA 2JGLA 1XZIA 2XUZA 3TL2A 3QSYA 2B8TA 2P4HX 4M9ZA 3THXA 2VH1A 4F9FA 2WU0A 3A3YA 5EWLA 3GP3A 1U02A 4NMHA 3WC4A 4XYEA 4ZEWA 1CRQA 3T4EA 4IIJA 1OXBB 2P35A 2IHBA 1Z83A 1CR4A 1CXZA 5L3QA 4TOIA 3VAAA 4TRMA 3AV3A 4XDYA 2WHPA 2Q4EA 4GECA 4PYQA 3W6NA 3LP8A 2ASEA 1Q14A 1LTKA 2NXWA 3DB2A 3DL2A 3D5EA 2OT3B 3BRWD 5EZ5A 2R6GA 2HF9A 1ZL2A 4ITVA 1F7UA 1IATA 2CY0A 2UVPA 1U90A 3MFQA 5LBUA 3H75A 1SO8A 5FFMA 2JRLA 4PHGA 1PSDA 1U1GA 2AB0A 3TAHA 4BP9A 3B1KA 3GRVA 2CLEB 3UHAA 4FONA 1D1SA 1DJLA 4H35A 5LJLA 1S01A 1I94B 4PHCA 3OZTA 1W8IA 2O8VA 2ZETA 1EWKA 3IUYA 5KNCH 4FLFA 4HGYA 2C2KA 1BE0A 1WZNA 1BH2A 1UMDA 3JTMA 3QV2A 3CLUD 3G5MA 3JQ8A 1G3QA 2AR0A 3ZDCA 2WT4A 1B3BA 1B73A 3VR6H 2OUKA 5BN5A 4Q02A 5DHFA 3UFXA 4E5KA 5LB4A 2BGWA 3V8BA 4PONA 2MYPA 2YYZA 1HT2E 4DXDA 2FR0A 5EJ2A 2HT1A 4ZGGA 5JCOA 2FSGA 3AVOA 3QW2A 1WCV1 3MHTA 1VI6A 1SQGA 1RQGA 4LY9A 1PJ4A 2QEQA 1I0ZA 4CM8A 5IJ9B 2CJWB 1TLTA 3K96A 1H69A 4IOJA 2JGDA 3KPWA 2R62A 4A0QA 3VPCA 2VN8A 3K70C 4MMXB 1VMEA 2NXEA 5FHRA 1FFDA 1ODCA 1UKAA 2BJHA 2GFIA 4J1QA 1IHDA 1XRLA 421PA 3ZR4B 1XAHA 1NLYA 1ACJA 5DXJA 4XR9A 5AKKA 2PRJA 1CUJA 3WGMA 3B60A 3CRVA 3HUTA 4WMLA 2A88A 4FX2A 4HRVA 5HIJA 3DW3X 4UKDA 3TF5A 1M7HA 1EVIA 2XVYA 1ESDA 1DQNA 1HOTA 5LJIA 2CDAA 3GA5A 4UCFA 5JNSA 3QHPA 3KPYA 3E61A 4PEVA 3AZQA 1KFJB 4BU0A 3W2HA 4EQ6A 1KRXA 3OZFA 4MUKA 4DG9A 1CRLA 1PL8A 2C00A 4WOJA 2FRXA 4PC6A 2FH5B 1QAMA 2EQBA 4F6CA 3D6TB 3SPXA 3CR7A 3I1YA 4RZXA 5CT8A 5FI0B 2B1GA 3KKLA 4G8JA 1PFVA 3C6BA 2OBXA 5DN6D 5ARBA 5AKZA 3KAPA 3KTAA 1GL3A 4YJHB 1YRYE 2ZKIA 5HUHA 4J9VA 1N2XA 3H83A 3E5HA 4OXXA 3VO1A 1SNYA 3QE0A 3ZW9A 4F45A 4ZDIA 4UHHA 2DPYA 3QOXA 4JCCA 4EI2A 3VGPA 3NDPA 4QECA 3T5MA 2XUKA 3AHEA 2X2EA 3L8ZA 1QTNA 5CP8A 4COKA 2O59A 3HYNA 1TOAA 3EGWA 1L4EA 4FNMA 4JL5A 4WA7A 4YP1A 3T7JA 2JHGA 2ZTSA 5ALLA 4KSBA 2WTNA 2ZR7A 3EWNA 2FEOA 4BN4A 1I36A 2OAP1 4R2WA 2IZ5A 3E35A 2VZ9A 4A8JA 3IP8A 2APJA 5AUPB 3RS5A 1JXOA 1RPAA 1UBCA 3NEYA 2F43B 1A8SA 4JJKA 5FWYA 5BQ3A 2VHYA 4KGVA 3KHUA 4QOSA 4EB0A 2EZ9A 4WE3A 3AGPA 4UTVA 1X1DA 3OOWA 4P4SA 2O8DB 1QC5B 2Q46A 4B76A 3QHQA 1M0WA 1M7GA 4QXRA 4AS2A 1BVRA 3QELB 1SRQA 1RQPA 4KVGA 1U1FA 3VR2D 3H2BA 4KUGA 4LZAA 3DDWA 3OFKA 3EOAI 3OLVA 5EP3A 4M7RA 5JWRA 1V3UA 4FC6A 2DY1A 4D80A 2AFVA 1XK6A 2HX1A 3WICA 2ZUDA 5BN4B 3ZYCA 4J3FA 4JBYA 1KNXA 2RARA 2VLBA 1E2QA 3OZVA 2ODEA 1XP8A 2C2XA 3LW7A 1ZIYA 4LXHA 1GXSA 2EJWA 2QNBA 1ZESA 1P0MA 1KP3A 3TPCA 4Q93A 4XJSA 1KXZA 3VPAA 3VR3A 2OCXA 1QYCA 2WM9B 2PUBA 4PSUA 1Z0SA 4ZREA 1KWKA 3NM4A 1F4PA 4U3JA 1VSQA 1O57A 2CBZA 1FRZA 2FAXA 4PV7A 4BZQA 2AFIA 4O08A 4Y2RA 4EQZA 3KKPA 5AVVA 1QH9A 3NHJA 1E4EA 3AQIA 3FX2A 2I76A 1QNFA 2PTHA 2DQ4A 4HH3C 4M9UA 4EKNB 4HV4A 5JY1A 3CX4A 2IHUA 2JFPA 1N0HA 4P3NA 2ZIGA 4G0YA 3U9TA 5LQKA 3WKDA 1RWNA 2HSEA 4X3PA 4BMCA 3PGMA 1WHTB 5EXTA 4GLJA 3SOZA 1ULHA 2PMDA 2R5FA 2RK4A 2YFKA 4WT7A 3OMWA 4CM4A 1JN0A 3SM3A 5DX0A 5IJZA 1NUSA 1HEIA 4YRTA 4RMHA 3VQTA 4NG5A 4DJTA 4F6RB 2AN9A 4AYWA 2DBYA 4QEDA 4EG0A 3N2KB 3F46A 3QPCA 1AE1A 1AQNA 1UPBA 4FZJA 3NUGA 5CNIA 1YQWA 3O4RA 4CKWA 5I51A 2I9KA 3DFUA 4RIEA 1G3IA 4EBBA 3LFUA 3JW8A 1T0PA 3MUNA 3VU1A 1VGRA 1NGSA 2XT9A 2ZDGA 5AJWA 5FORA 2ZI5A 4R4JA 2AG6A 3LHDA 4BQEA 1RVV1 4JLKA 2GEVA 5DMHA 5LD2C 2PEZA 1C80A 1R3UA 1U0OC 2EBUA 2ID8A 1FEZA 3BHMA 5E6SA 1ZAKA 1RADA 1P31A 1RP1A 2N3ZA 3ZHQA 4ETMA 5AVYA 4F5ZA 3FTEA 1OBCA 2PBZA 2JLBA 4FOTA 3AKYA 1L8AA 2JGIA 2Q2OA 3CGGA 1W5BA 3FDXA 4N5NA 4C22A 4V0KA 3A26A 2QRVA 1R9GA 3QVOA 4K3UA 4L74A 4V38A 1A96A 5HFAA 4OGWA 4CEHA 4AKTA 4W99A 1Q77A 3SP1A 4MB0A 4ZT2A 2H9IA 2VWGA 3IJEB 3RYIA 2V6BA 1T3SA 1Y4ZA 3N1UA 1G8KA 3N8DA 3AW8A 1Y3FE 3A1VA 2GZSA 4GX2A 4GPBA 4RIFA 1BW9A 1O7JA 3E9NA 5IBRA 3L7KA 1ZMTA 5JTTA 1HE8B 4BVLA 1Y80A 5KNBA 2BI7A 3CU5A 4YUWA 1XF1A 3ETEA 4KQKA 3GEHA 3IPXA 1WU8A 2C0PA 4GS5A 1L1QA 1NR7A 1XZ8A 2WLTA 4I4IA 4KGDA 2AA3A 4OSOA 3V9PA 4B6OA 5HDQA 2OBBA 4B35A 2V58A 3GD7A 4FEAA 1NU6A 3C6KA 4A0FA 3A70A 5TGDA 2RHRA 1CEYA 2P0YA 4OFBA 4GFDA 1C30B 1GFWA 4G23A 2PSDA 4BTEA 2YN2A 3NBMA 2VDQB 4I99A 3GVIA 4IUYA 1FUYB 1DS6A 1G8FA 4WNAA 3SQDA 4E03A 2GJ4A 1NLUA 1X7XB 2GPTA 2KI5A 2XLCA 4ZT6A 2E5FA 1CJVC 2CMKA 3VR1A 3W3ZB 4AG3A 4CMEA 4IY1A 2O2CA 4JBHA 3BEOA 3NTOA 1GLGA 2BI8A 4IIVA 1R0RE 3M3HA 2FFJA 2H5EA 4QTUB 4EUSA 2I6SA 4ATNA 4ACAA 4KCGA 4HRAA 4EFKA 2W37A 1JBKA 3RQSA 1FVFA 4BY9E 3C1OA 4I50B 5AR1A 1I3CA 2XKJE 3FPEA 4JI4B 1LNQA 5C8YB 1XSEA 2B4RO 1L5VA 3V4OA 5J58A 1HDYA 2C5HA 2VJBA 5IT9A 4Q1EA 2DY0A 1BS9A 2W83A 2EFGA 3EZLA 2GD2A 3SHOA 2QE6A 2PL1A 1MQ8B 2J9GA 5IZCC 4JLWA 1PS0A 3GG9A 4KFTA 5TIIA 2Z56A 2CHFA 2ZAYA 3VI3B 3TSCA 3GAMA 1H93A 2J3IA 4INAA 4MX8A 1Z8FA 3E6AA 4OM7A 2OCLA 4EUFA 2Y66A 2AF3C 3HLKA 3NM6B 2VUIB 4MGKR 3AP1A 3G9UA 3ICVA 1ZMRA 2YJTD 1NATA 4TSKA 4ZEOA 1WABA 4IDPA 4LCEA 2JNWA 5EJMA 3UJ8A 1KQ3A 1NI5A 2OSBA 4LDZA 3N6VA 3OCWA 4CQLB 5KHOC 1JBQA 1HDGO 1NW8A 4JGIA 2GO7A 2VPPA 5IRCD 2XNCA 2IIPA 2XYPA 3E8XA 3IBFA 4ARAA 1T4DA 1SBCA 4FN4A 3RYFB 4C7OA 1PNOA 3TE7A 4W9MC 4FFMA 1RBMA 1WCXA 3NVDA 2WV7A 4MWSA 4DTCA 1SR8A 3I2YX 1HTWA 1W52X 4RQAA 2ZBRA 4REOA 5EAIA 4XGIA 2GJ8A 3LNTA 3Q9NA 1CVRA 1XDZA 1SB8A 1Z5OA 2I3ZA 4LY0A 1QFJA 4RY0A 4QPJC 4YJFB 4EB6A 3LF1A 2IF0A 1RRCA 2QD5A 1ZCZA 5DM60 3AKEA 3O83A 1GNPA 2G1AA 5MHTA 1THZA 5GZ1A 5FA5A 4O0MA 5A5VA 4F2GA 2X3FA 2JIZA 1CZNA 1WHTA 1W35A 1RZRD 2UV8A 3GNLA 1E1LA 1EGQA 5JJ5A 2GAJA 2O8FB 2ZKLA 2Q5IA 2QJFA 3L7YA 1NBMA 1IN1A 3F47A 2ZUVA 2RJ3A 3LGXA 3DG9A 4GBED 4LF8B 1MLDA 3CJTA 3SZMA 3JRNA 1OWMA 2HWWA 3V32A 3ICEA 4GQBA 2GWHA 1V6SA 1X1TA 4KU4A 5JAMA 1F9AA 2R8BA 4YRGA 2XA2A 2FVYA 3UB3A 5JT1A 2XITA 2VAVA 3W5IA 5ERYA 2FEKA 3HUEA 1VKRA 3O21A 5ICEA 2HCBA 1KK0A 4N6OA 1MB3A 3ZEIA 4C78A 1GQQA 2BEUB 3UMJA 4QBIA 5LD2B 4QRDA 1ZFNA 3L4SO 5JAIA 2CF6A 3F8TA 4LGCA 2I2WA 5T57A 2QTWB 721PA 2I03A 1HRDA 3TX2A 3AK4A 2PS3A 3S8EA 4GAEA 4JLVA 3ZJ5A 2JRCA 4UZEA 4AG6A 1JYFA 5IFLA 2WUDA 4ZU1X 3UA3A 1NPTO 2BHRA 1F12A 1NQAO 2Y6VA 1W8DA 5BN4A 1HDRA 3H65A 3MTDA 3V1NA 3MSXA 4PTLA 4WNAB 1YASA 4XLTA 3DH0A 3HVKA 4XX0B 4YGYA 3GP5A 3HVUA 3CF4G 2N0SA 2JD2A 1OFUX 3I12A 4QWMA 4RD4A 5E95A 2BGTA 2BMFA 2QM0A 3KSBC 1YJ5A 5DIZA 5JD4A 4MW9A 2H1CA 1GCOA 4IHJB 5FEUA 3QRWA 1HH4A 4WW0A 3GLFB 2I8LA 2IUYA 1T26A 2VWHA 4LHSA 5LXTF 1M6WA 1FMFA 4IJVA 1CULC 2R7KA 3KQYA 1G5TA 4YYZA 2PIDA 4QFBA 1NQUA 1T3ZA 4EPVA 2Y1EA 2I6FA 4U2BA 2PVPA 3IQGX 4I4NA 4TM7A 5JDCA 4G24A 2F48A 5CLIA 1MENA 2ZRMA 3MIIA 4LZZA 3ABSB 2Q3LA 3OC0A 1K6XA 2OQVA 4IDAA 5K3AA 2IS1A 3VDXA 4MJ7A 3W7AA 3I9MA 4CUKA 5BV7A 3H9QA 1WD7A 4LY6A 3FXAA 4QU9A 1WDTA 3EZGA 1XEXA 2HLDA 3NS7A 3CUVA 3P0IA 4FOLA 4PC1A 2GCNA 4LZLA 2QD1A 3H19A 2OO5C 2ZXEA 1SD1A 2JA2A 2XTAA 3FSRA 1SURA 2GOYA 2PU5A 3E58A 3C6QA 3IO3A 3D7NA 3FZNA 3OFSA 3ROTA 2OYSA 2JGMA 5E6RA 3L7BA 1ORVA 1T9GR 1XHFA 3KYCA 1D4OA 3ZQKA 5IJWA 1DNPA 3GFRA 1XTZA 1XD2A 1ZSVA 5SY9A 1E2IA 4QNNA 3PXCX 3TDMA 1EFTA 3D4BA 3PQ2A 3BZBA 4O2AB 3RLFA 4FB5A 2BR4A 4KXVA 1M73E 4C5BA 4E1AA 3ILHA 2BMWA 4UVGA 1GPKA 1Y4DE 4JQZA 2GPSA 3B78A 3EEBA 3JWJA 4KE8A 4ZARA 1NNLA 5D5HA 3MTQA 3VR3D 2BFEB 2ANCA 4L9RA 1QQ6A 4NU8X 5KTRA 4US0R 1L5NA 1KAQA 5FCDA 3RC7A 2R2AA 1WMBA 4X8OA 4BVGA 1AKRA 3RYTC 1X7ZA 3ZDAA 2FP3A 4RPCA 3JZDA 3IQFA 3L7IA 1QGDA 3ROKA 1VRCA 5HGXA 3T06B 3AKCA 5FBLB 3SMQA 2VOEA 1ZGJA 3HKCB 4HUQB 4D6YA 1ZCBA 2QTVB 2GN1A 1E1QD 3BWBA 5JAOA 3UWKA 4B3DA 1SBQA 1A9YA 3WL3A 4CMJA 1Z3CA 3MWDB 4MR8A 4MLZA 1WUJS 2LZ0A 1UDXA 1SXHA 3C8ZA 3KXLA 4WFKA 4Z8XA 5EPOA 1YBMA 2HPZA 3VU9A 3R5FA 4YR9A 1DFGA 2JFNA 3RS9A 2HRCA 5TQ2B 3C6YA 3K73O 4CQMB 4OHXA 2O7RA 2P62A 4I6EA 2CD7A 2GN6A 4NMLA 2IOFK 1Z0FA 1KJZA 3OJXA 5GGYA 2G28A 5DHTA 2WJAA 4ZVTA 2FEPA 5KMGA 4RY9A 4F4UA 2DFKB 1U6KA 2OXRA 3PPXA 3HJRA 5KB3A 2MINB 3GR6A 4DMFA 1JGTA 1EFCA 4HQNA 5GV7A 1Z4MA 2Z1DA 1C30A 3V7FA 3STXA 3ZWOA 2Y2UA 1XQWA 2GXQA 3TLAA 4F56A 2IITA 3P2YA 4B3GA 5REQA 3BCUA 4GOLD 1RRGA 4IOMA 1RBYA 4NPCA 3ETNA 1N32B 4TKMA 3TNDA 1A97A 1W46A 1XJ0A 1YWGO 2GTPA 2H5JA 3PHJA 1XZDA 4PLZA 3VNAA 2OCIA 1KY4A 1M6NA 2GYYA 4JA0A 1EA5A 3BREA 4WLVA 4LF6B 3L4BA 5DN9A 4YJ3A 1T24A 3RAPR 1I4WA 4DIDA 4GLOA 4KXUA 3FROA 4TZKA 2F3UA 5EFZA 3IIJA 2B8JA 3T15A 4YXWD 1HFJA 2I62A 1JVSA 7ADHA 2JI4A 1P6QA 2ICAA 4I46A 3HU3A 3IPAA 3G5AA 3K9BA 1YCDA 5EJEA 4MK4A 4UCWA 3EPLA 3H2GA 1JF8A 3HA2A 1JDBB 2QKYA 1RI1A 1ZA1A 3KR0A 4C2TA 1QVRA 2YHSA 1X9HA 3GZ4A 1IVNA 4H17A 2GUGA 2ZRLA 3P2IA 4GI7A 2X77A 3BXOA 4LHWA 3WQHA 4RTMA 1WZUA 1G7CA 2ZRGA 3DKKA 2CLSA 3IT1A 1PT7A 3KC2A 5J1SB 1A2KC 4UM5A 1GV0A 2EG9A 4LRQA 4MPRA 3TMYA 5JW6A 4JB0A 5JPCA 4UTXA 3AZOA 3GPIA 3L3BA 4DDHA 4QARA 4KQ6A 2WK1A 3DEHA 4I9HA 3RI3A 4FYKA 3WGTA 1DEHA 4Q9IA 3LDAA 1AF7A 3BRSA 1X8XA 3TNFA 1II8B 3V2GA 4PWZA 5KYUB 1AB5A 3IDAA 1AGPA 1U1IA 1TF5A 2O2EA 3OCCA 3IEPA 3EZXA 4M2LA 3SAJA 3W1VA 1IIBA 3GJQA 5L8VA 2Z6UA 4GRAA 5J5AA 4WLFA 5CVCA 3MJDA 1FF9A 3H9EO 3OETA 1Z7GA 4NENB 2P9FA 3AFOA 2CLMB 4TQ9A 2XTNA 3BRQA 2BR3A 5BYAA 2IHVA 1IY2A 1LJUA 2GJAA 3MK31 5IAOA 4LISA <