2ROPA

Solution structure of domains 3 and 4 of human atp7b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
142
Chain Sequence
b'VTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPAVISPEELRAAIEDMGFEASVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-transporting ATPase 2
publication title Metal binding domains 3 and 4 of the Wilson disease protein: solution structure and interaction with the copper(I) chaperone HAH1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 29
structure length 142
sequence length 171
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ropA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ropA01
1SQEA 2IFXA 4OJ1A 3HDSA 2OKQA 4HI2A 5B0AA 5T7LA 3HF5A 1AFJA 2W4DA 1ULRA 3K7RA 1SB6A 2QLWA 2QIFA 1JK9B 5B0GA 2KYZA 2XMKA 3GZ7A 2XMJA 1S6UA 5K9FA 1XBWA 3HFKA 3HHLA 5A6PA 4HI1A 5B0BA 1RJJA 2HLTA 3HHLC 4FNHA 5B08A 2KT2A 3FMBA 2QLXA 2XMMA 1TL5A 1S6OA 4A48A 1FVSA 1Q53A 2OFGX 2OD6A 5B0EA 3KG1A 3F44A 2LXFA 1MWZA 3VTIA 3CJKA 4DN9A 3KG0A 2XMWA 2AP6A 4YEAA 4OJGA 1VQSA 2BUNA 1Y3JA 1V3ZA 2GGPB 1KVIA 1Q8LA 4NPOA 5T7LB 2AJ0A 1R6YA 2K7KA 4YDXA 1TL4A 1TZ0A 2BJDA 1YJUA 3BDEA 1AFIA 3TRGA 2N4CA 2EW9A 3IWLA 4HH0A 2L3MA 2ROGA 2GO8A 4ZA1A 4EFAC 1OQ3A 1X7VA 4U9RA 1MWYA 4Q2MA 2GFFA 5IXUA 3HHLD 3HHLB 1TUVA 1IUJA 1JWWA 1QUPA 3FGVA 5B0DA 1CC7A 4Y2MA 1P8GA 1KQKA 1YJTA 1YRXA 2FTRA 2LDIA 4A47A 3MZIA 2FB0A 4F67A 2LQBA 2BYCA 2Q3PA 2BJEA 1P6TA 2GA7A 2G9OA 2RU9A 3BN7A 1Y0HA 3CJKB 1AW0A 1YJVA 1FE4A 3QMQA 2ROEA 2VV5A 4FNIA 4Q2LA 2CRLA 1TR0A 3QGPA 2ZDOA 3BR8A 5B0FA 1N5TA 2AW0A 1URRA 2HFNA 2PGCA 3DXSX 2QYCA 2OP5A 1X8DA 1FVQA 1KVJA 2W4PA 3MCSA 2ASYA 2XMTA 2FIUA 2KT3A 3LGNA 1GXUA 2HIQA 1SI9A 1Y9OA 4DPOA 1Y3KA 2HLUA 2HQIA 1OPZA 3KKFA 3LGMA 1K0VA 2N4DA 2RMLA 1FD8A 2HFOA 2JDJA 2RSQA 2RILA 1YG0A 3BF4A 4HH1A 4QOTA 2AJ1A 5A6WA 2BBEA 2OAUA 1WD6A 2KKHA 1LQ9A 3IWXA 2ROPA 2GV1A 1X0PA 2K1RA 2N7YA 3KNGA 1FE0A 1APSA 4ZOSA 1YJRA 3BM7A 2K2PA 4NL5A 4A46A 4A4JA 1U7LA 1W2IA 5F0UA 2ACYA 4OJHA 3T9NA 2OD4A 4HL9A 1CPZA 1N5VA 4OJ3A 2IYGA 3E8OA 4Y2KA 2PD1A 3TNVA 3I9ZA 2XMUA 3BGUA 3TOQA 4DL0C 5B0CA 5F0WA 2IYIA 1FESA 2OMOA 3WDOA 3DCAA 5B09A 1N5QA 3FRYA 1Q8BA 1FEEA 1Q4RA 2K7JA 2XMVA 4Y2IA 3UDCA 5KAKA 3BB5A 2OFHX 2FHMA 2W4CA 1N5SA 2K1RB 3HX9A 4OIXA 1CC8A 3LO3A 2ZDPA 2GCFA 1OQ6A 1GXTA 1OSDA 2LQ9A 2VH7A 1VQYA 2GGPA
chains in the Genus database with same CATH superfamily
3QYYA 1RWPB 5BXIA 2ZVSA 4FPIA 2DRBA 1SJ1A 3NLCA 2HFUA 2DCLA 3N79A 3NG8A 5A2QY 2G0IA 4LFAJ 2FHJD 1U25A 1OYEA 1S6OA 2RHSB 1GTEA 3JQKA 3QZ8A 1IN0A 3AB2B 2E66A 1PC5A 1NKEA 1YJUA 2WSCC 1WSVA 4QU7A 1VOMA 4ID5B 4CYUB 3T5KA 3AXMA 2KFZA 4ZVRB 2YPYA 4LSNB 4ZPAA 3JSMA 3V6KA 2KRBA 1HWJA 1WELA 1R8BA 2NXJA 2WSEC 4Y2CA 1RHKB 3OUYA 1FWKA 2XY7A 2FJBB 1QUVA 4P2MA 1VYAA 4O0NA 1F60B 4ILRA 4OI3A 3OJSA 4X4VA 4IO9Q 2BX6A 3MEEA 2BABA 3CCLS 3DLEA 3TANA 2B43A 3T9ZA 1YJ7A 2IVYA 3M8QB 1LK7A 1C0UB 3VVUA 2MXYA 1Q4RA 1XNQF 3TAMA 2H51B 4DX8H 4LIRA 1U1RA 4QYZK 3UVJA 2NSCA 4DV2J 3CVKA 4OHVA 3D3CJ 2JSXA 5C25A 3ZZYA 1LW2A 2IM2A 3WQPA 3OXLA 3KYLA 3OL8A 1QE1B 1AZSA 4ZKAA 3CCUS 4ALZA 3ILLA 4RNOA 1SV5A 3KJQB 3RRKA 3QAUA 4UW2A 2CJKA 2FYXA 3QGGA 1KQKA 3OVBA 1S1XB 3OL7A 5KFFA 4F4KA 2RS2A 3U02A 1FFSB 2GC8A 3M30A 2FLLA 4FYDA 3AQPA 3CJTA 5GADI 2HRTA 4F4YA 2RILA 3R1LA 5A6WA 4DR4F 1HNWJ 1CS4B 2DH7A 4USJC 3O1LA 3OBIA 4CDIA 5KFOA 3IS9B 2J9DA 3NCPA 3NXZA 5IC4B 5HK4A 5HQ8A 2BXJA 2WVEA 2DR8A 3HVTA 4ED8A 1P9QC 1RWVB 2V34A 1IBMJ 2YWWA 1FK9B 2CJBA 3UI3A 4P73A 4JI6J 2PMHA 4HACA 2ZJPQ 3QSIA 3KLGA 4WZQA 4DCJB 2LXFA 3K5LA 4DN9A 2GS8A 1F5CA 4RBVA 2EWHA 1XNRF 3MGJA 4LSLB 3H40A 3HM9A 4LBIA 4X62J 4NA2A 3QO9A 2FB0A 2XS5A 3H90A 3UNYA 2Z0GA 4DR2F 2I9SA 4FXVA 5ETRA 3N01A 4A8FA 1UWBB 2CYYA 2IAJB 1WC3A 4P52A 2W25A 4PPDA 2Z2LA 2OAUA 1VHIA 1EETA 4P6QA 1U1QA 4NXMF 1H3DA 2ZKTA 2K06A 4K4WA 3M8YA 2DGOA 1X4EA 1YTYA 4O3SA 4OL8A 1Y5LB 3OHBA 3MR6A 1WACA 3PV8A 3SSQA 1KOHA 4I2QB 1S0OA 4YS2A 4O3RA 2F9DA 2GJIA 2KN4A 1NCLA 3LH2S 3EVWA 3T6JA 1UP1A 4DQRA 2QLXA 4KC5A 1U1OA 2BZ2A 4HTJA 5J2MA 3MFIA 2QLJB 3M9NB 2F63A 2IM0A 2R7QA 2E1PA 2ZUAA 3ZZUA 2IDLA 5K8MA 1T94A 5ADZA 5KFZA 1QAJA 1PO6A 3LOUA 1RTIB 4FZVA 2ZOMA 5C24B 2OI2A 4DUZF 4J7CA 4LF1A 2XLKA 3RZAA 1VDHA 1HNVB 3GU0A 4LFAF 3G86A 5GAHI 1IQZA 1OY8A 3J7A1 4Z37A 4G1IA 4P7VA 5D3GB 2BRKA 2GVZA 3GIIA 3KLHA 4KKOA 1MN7A 1T9YA 1CJUB 2Y1IA 3EVOA 3W8GA 4ITSA 4CO2A 4B9VA 5CA5A 1P1LA 3BGOP 2XO6A 4TY9A 5B0GA 1JKHA 3P45B 2IRUA 1YDLA 4QCLA 2KRRA 2DD8S 1VRQC 2DR7A 5RUBA 1VMBA 1D8YA 3OW2R 3ET6B 2VASA 5D6GA 2ATCB 3GONA 1UWAA 2IIHA 3O3LA 5H1SV 1QUPA 4IYQA 3GIKA 1NMEB 3KHGA 4F2RA 2X3GA 4JI3F 1WHWA 2DPIA 3I82A 5KFXA 2B6AB 1U47A 2QA1A 2VPYB 2ROEA 2V2KA 5E33A 2XO7A 1JJ4A 1Q7LB 3QT6A 4C2MA 1LEOA 1DBDA 5HP1A 1S7IA 4NE9C 2J76E 3UQSA 4ICLA 1HBNA 4GKKJ 2KZMA 2ZEJA 5A8WB 3GB0A 4MKYA 4ZDNA 1CPZA 2Y8YA 3TUPA 1FA0A 2CPJA 4B9LA 4ECQA 3DCAA 3HLUA 2NLWA 4E2FB 5LXRA 4I67A 2Y1RI 1GMVA 2G1DA 3C2PA 2W2OP 4JI1J 2WVDA 2CQDA 3PX4A 2M88A 2H1YA 2XB2D 3MUVP 3W2VA 1B64A 3PRBA 4EYHB 3QLHB 4NWBA 2EFGA 2ZBQA 3DFEA 5F8LA 3GIMA 5DZ7A 1TL1B 2H54B 2Y0SD 3BDEA 3NEKA 2EW9A 4ZLPA 3KTQA 2RVJA 2P6TA 1RTJB 3CCTA 3A13A 4QIVA 2CJAA 4DCPB 4DR6J 2OEJA 4WCEQ 2F40A 3AJ2A 1HQUA 4AD6A 3GFYA 4CWBA 4DEZA 1YJWS 4C0OC 3QIDA 1IKXA 1PYOB 1S79A 3D2WA 2NQPA 4PABA 1T02A 1FRJA 1G7CB 3JSBA 1J5OB 1LWCB 3B82A 1FERA 4H4MB 5HLFB 4ZCLA 3PO4A 5BJRA 3NP5A 4OYPA 2EFPA 2J7WA 1HHSA 2KXHA 3R5AA 3VHQA 3W60A 1REVA 5A8RA 1TQLA 4ZVFA 2RQCA 3V5RA 2OPSB 5FD1A 1R8CA 1L3VA 2OPQA 2RF2B 2HLTA 4N5SA 2GMHA 1IKVA 2ZJQQ 4DU7A 4KV8A 3TUZC 5F8JA 1W25A 5KFIA 1S1WA 1H2VZ 2MKYA 4MFBA 2AJ4A 3EZOA 1HW9A 1EJ7L 4USHA 3SI8A 2NSBA 4C11B 2CFXA 3CJKB 3FVYA 3Q86A 3OHAA 4L3KA 1IR0A 1EX8A 5KFNA 3KK2A 4QWBA 2C3PA 1RHQB 4A8KA 2UP1A 2FJEB 2KDOA 1CQMA 1HQ2A 1NZAA 4DMZA 1B7YB 2V8VA 1NDPA 4DV6F 2DPJA 2AYGA 1S49A 3OL9A 3CDEA 1HHQA 4CLYA 4B3TJ 5GMDA 1XTZA 3WIUA 4P2SA 4B3OA 4C0HA 3IP0A 3NAIA 4IG3A 1NHVA 1BC6A 1U02A 1E6YA 5K5MA 4OI0A 1H74A 1BWEA 1VRTA 1U1NA 1KTQA 1ZETA 3F0NA 3ISND 3W8PA 3BKUA 3BO3A 4USIA 3ZTPA 1IVZA 4J37A 3G6VA 3BO2A 3VAMA 1DLOA 4M5HA 4X64F 3GFZA 3LP1B 1YHQS 2BVZA 3W62A 2WVCA 1H6KX 4PEOA 2NXUA 1R8AA 4DS4A 2I38A 1XMOF 2PE8A 1BQNB 1IBLJ 3IR6B 1Q8IA 1D09B 3A4TA 2KVQE 4KGKA 5E3AA 3T5LA 4EO6A 1TKXB 4M5LA 3SXLA 4FKXA 5L39A 1UAWA 2XZWA 2IVFB 3D6TB 3CW2C 2AYMA 4UF4A 2MB0B 3BGUA 4PWDB 1BGXT 4DQQA 2ZJRQ 1X4HA 1S1TB 3TZYA 3VQTA 2J6UA 1P27B 2VH7A 3HO1A 3M8RA 4K4ZA 1YJNS 2BKOA 2DY9A 4QQBA 1L3UA 1GEHA 3BBCA 2X1BA 3TJ8A 3PEHA 1TL3B 4YDXA 1X4CA 2VUGA 1CVJA 3KK3B 1M5KC 1U09A 4ED3A 4M5DA 3PJ9A 3F41A 1N34F 2H5EA 2BQRA 2F1FA 4RL1A 2FPHX 2ERRA 3Q22A 4PWWA 3GTYX 2HZCA 1M1KT 4PPZA 2UUTA 1OYDA 4IRCA 4USUA 5JMNA 1UW9A 3BF4A 3EWGA 3M4XA 3VGSA 5K8NA 2VC1A 4GVBA 3RAMA 2CIMA 5A8KB 3BM7A 3OFFA 2HZVA 5M2UA 5KFSA 3RBEA 5E3QA 3BYPA 4TKTA 2ILYA 1NEEA 4X2BA 4B3RJ 1G1XA 3R5JB 4DG1A 3GJTB 3V2UC 1B99A 1KD1T 2QLWA 4URQU 1VQKS 5HVFA 4PQAA 2QMXA 5KT3A 2MGZA 3P5TL 2EK6A 4NX9A 5EUHA 5L46A 2CQ0A 3MMBB 1I94J 4Q44A 2RRAA 1VQ9S 4K7QA 5KG7A 4ZVEA 5HQMA 4DZDA 1KBRA 3T1YJ 3TO8A 3K2YA 5HBMA 1AT1B 2AD9A 4ZS6A 1S6QA 3DXBA 3M6WA 1RACB 2CNNB 1MU2B 2W4PA 3IC1A 2G2YA 1RAIB 4J9NA 1SI9A 5HL7Q 4JI5J 1F2HA 4TQSA 3JYTA 2B5JA 3SDEB 3Q8SB 2BE2B 5C2CA 2DR9A 2RJZA 2O66A 2HHPA 1S77D 2DGQA 3DOMA 1UW4A 2NUHA 3DDIA 2JWNA 3LTOA 4Y2KA 2DH9A 3W7BA 4MAKA 5F0WA 4K4VA 3E2EA 2UVRA 3RG6A 3BBBA 4JYAF 1KNZA 2DGUA 2M8HA 1UA1A 3UNGC 2ADCA 2ZNZA 2OKQA 4DX6A 4NI2B 3DGPA 3DHXA 3W3SA 1RJJA 4K0KJ 3IR5B 2CZVC 1QVGR 1HKAA 3FRZA 4D3GA 1T9VA 2C2OB 3LALA 4NPOA 4CTAA 1HD1A 2VONA 4B3TF 5ETTA 3GILA 4MTPA 2OMLA 2CPZA 2RAQA 3LUYA 2IVMA 1FI4A 1EKRA 2YY3A 1GT8A 1S7HA 1WOPA 5ETPA 2DNQA 5CYQB 1ZAVA 2E29A 3FQKA 1FRHA 4JV5F 3D0GE 3KOAA 2GV1A 1IM4A 2V8PA 2HNDA 3FBCA 2DNMA 2OMOA 3IG1B 1T3NA 3UD5A 4DZ6A 4N47A 4X84A 3R7BB 1FFWB 1TP7A 2XLIA 2WVBA 3C66A 5F8HA 2RDJA 5ETQA 3VVTA 4QR0A 3J81U 4NCGB 1DTTB 2GJ2A 4RWWA 2XMMA 4LVNP 4ZHRA 3MOJB 1JJHA 2GAGC 1MROB 2D69A 1X5SA 2XMWA 1PAUB 3MEDA 5KG6A 5SUHA 5IT9Y 1UJ4A 1UL3A 1VHFA 3HD2A 2HBRB 2L9DA 1TUVA 1JLBB 2A6MA 4LBPA 4LF9F 3L7PA 3J7ZT 1U0HB 4H4KA 2ZNYA 5LSOA 3NS5A 5HJXA 4FS1A 1KQGB 2VG5A 2HFOA 1BE4A 3CULA 2ROPA 1HNIA 5D15A 5SZTA 1WDDA 2RH3A 3TUJC 4ED5A 4B17A 1R89A 2LXIA 3EJMA 1LW0A 2JVOA 2POKA 3E01A 3QFWA 3ENWA 4R8UB 2IFXA 3FFIB 3DI6A 2PI5A 5AXKA 5E2QA 2VQEF 3HFKA 1D9AA 4LFBJ 4EZ9A 3V6DA 4QZVB 4IG0B 2OD6A 1CJVA 4EYIB 2AEJA 4BC9A 2VBWA 3G2XA 4L76A 5B7WA 1F6TA 1FWLA 4B3RF 2HHQA 3IRXB 1WG4A 3MMCB 2BYCA 3OFEA 2HWTA 2R9LA 3PW0A 1KONA 3R6LB 4DV3J 3QSYB 3V4IB 3EDRB 3RAXA 3BZQA 4AQYJ 1RWUA 2YVSA 4MYUA 1B0PA 1FJ7A 4LRDA 3RR8A 3DM2B 2AQ4A 1SC3B 4CH7A 5JJBA 4WZMA 4TLRA 1NJIT 2MZQA 1FRXA 2FC9A 4IDKB 4JUZA 1K73T 3K8VA 1RT2A 1CJTB 4DR1F 3QWPA 2AYEA 2ZBPA 1PG5B 5GAEU 1X5TA 2M70A 1VIXA 1WF2A 1YGYA 3GSDA 1S1VA 4ZIWA 5U47A 2Z2YB 2B7BB 2IRYA 3OSPA 2MYFA 2DEIA 2GIRA 3DYAA 4Y00A 4MIAA 4CLSA 2C2MB 4FF3A 1XQIA 4EFAC 1S6PA 1SPBP 1PGZA 3HHLD 4ZCIA 2HQDA 4ELUA 1HBOB 2KH9A 3O2IA 3PDNA 4JP8A 4ILMA 3CCSS 3HFVA 4Q8FA 1P9YA 4Q2LA 2QE5A 4A8YA 5KG4A 3BBFA 2MLXA 4DR5J 2QV6A 2HQIA 3MHYA 1NSKL 2R2UA 2QG9B 1VK8A 3BSNA 2WW8A 4TYAA 5D0RA 1Y5NB 2YPZA 1X4BA 5DDOC 4NLXA 3OSNA 4S0MA 5CABA 2NXCA 4ZVSB 3P5BP 3I4PA 4BHQA 4WE1B 5H9FK 2GGPA 3HF5A 3UO0A 5KFGA 3LAMA 2FHOB 2DTJA 3ISZA 1NK4A 2ZD1A 4PG5A 3HHNB 2AKWB 1U6FA 4AL7A 4HYKA 4OZJA 2B8QA 4LBHA 4R0JA 3H0PA 1VCTA 1WOOA 3T41A 1W7WA 4EEYA 1WWHA 5KFUA 2Q6BA 3FGVA 4G6VB 4DV7J 4IO1A 1JLGA 4G1QB 4NXNJ 2C22A 2BQUA 2CNLB 3KNAA 2J0WA 4O4GB 2HNYB 4L75A 2H3EB 1KQFB 2VFSA 2VG6B 2DRDA 5A2QU 4UY85 1GNKA 1U1KA 4CO1A 3HT0A 2ZH8A 5CZXA 3N9UC 4MKVA 1VQLS 2I2YA 4PYAA 1VRUA 2IYGA 2VC0A 4X4QA 3D28A 3UE2A 4H4OA 5ETLA 4K4TA 2L41A 2XYHB 3ZZRA 2W4CA 2YWEA 1RWXB 2K1RB 4RR5A 5T7LA 1ZTWA 2IM1A 2OGUA 3O6QA 4NYZA 1JXEA 2XZTB 1JLQA 3DRRB 2DGVA 1L3SA 3D54A 1LWEA 3IGVA 4DPXA 5CQGA 3UN2A 2NXEA 3GWCA 2NZCA 3BSAA 2BJDA 2E5LJ 4ZN1A 1NJZA 1WEYA 1HNZJ 3VZHA 3ILJA 3JS9A 1YBAA 4QWCA 3EE3A 1RKJA 3OTBA 3D3BJ 2CNKB 5KFBA 2C2KB 3A3NB 2ASYA 4RNFA 1IKYA 4HTIA 3O8WA 2WONA 4GO5X 2RSQA 4FXWA 2DR5A 2HWIA 3L7OA 1HYSB 1SL2A 2WBMA 3I56S 2RE1A 1FFGB 3OXFA 4HL9A 5J1EB 3WC2A 3MM6A 3ZZOA 4DL4A 2W2NP 2F4VJ 4YR0A 4KSEB 3HX9A 1WJ9A 4ECVA 3I9V9 3AHPA 3OXGA 4M5JA 1MN9A 1AFJA 9ATCB 3OPKA 3ZTSA 2MKKA 2APOA 3AA8A 1IBKF 2YKOA 5DQGA 3CJSA 3IGNA 1KQSR 2VPZB 3QT7A 2BANB 3H4DA 1Q8LA 3PFEA 2CG4A 2WK4A 2WCXA 3H2UB 1S59A 2EFVA 2RDIA 1X7VA 3RB0A 2JEFA 3DRSA 3KHRA 1GQEA 4Y2MA 1U45A 2HFVA 4ES3A 1N36J 3FSYA 4RW8A 2FHKA 2YNGB 4P2XA 4CLLA 4I69A 2LEAA 5ETVA 3MR5A 4ECWA 3D1QA 1N54B 2UUCF 1GXUA 3R5BA 4CLFA 4K4SA 3HCXA 3M2VA 5D77A 2DGTA 2BACA 4QR2A 4ZOSA 3AJ1A 4IOBA 5LMNF 2N3LA 1OY9A 1VK3A 4CM0A 4DV0F 1KN6A 2D3OR 3JSMB 4F0MA 1OQ6A 1HIYA 4OZ2A 2C3YA 4HI2A 4ETZA 2AMCB 3CCRS 1UEKA 3S8SA 5D8HB 3OUYB 4Z7YA 3M6XA 2KHDA 1FT8A 3ETMA 5IFMA 4B3MJ 5KFLA 1RDRA 3V6JA 3MMAA 3A3PB 3KJVA 3ULHA 2XS2A 2ADBA 2HBYB 3QAEA 4M5MA 4MYTA 3RW7A 3G6ES 1I5OB 3M2UA 5HMZA 3N5BA 1FDNA 2MZSA 2W9BA 4CLKA 4KHRA 5B0DA 1SKUB 4Y6IA 1H2TZ 1RTHA 2RHQB 2HGLA 3UVJB 1RU1A 1Q5VA 5DG7A 2I0XA 4YY3F 2UXBF 3CO0P 1X8DA 3M1VA 3T19A 3N6LA 3BGFA 2UVWA 3TEHB 2B0GA 3QZ7A 4TLQA 2PIIA 3NL0A 4K8RA 2NYIA 4F50A 3NGUA 3MM7A 3NWRA 2CXEA 4I2PA 2BV3A 3DKDA 2QLFB 2PFDA 3KNGA 1XMBA 1SV5B 5F0UA 1C2PA 2HQGA 4EMDA 3GMGA 3R1HA 1DY3A 3MDFA 2FY8A 3FSXA 4NXNF 4QBUA 3TUIC 2DHGA 3NGRA 3ENVA 2BW7A 4C3MA 4KH1B 3M30B 1KOOA 3FC9A 5I42A 1URNA 1TK8A 4OYZA 1DURA 1RT4B 4URSA 3DOKA 4LF7F 4DV4J 2W7PA 4P10A 3VQSA 1RAAB 1WF0A 2QC3A 4ZP9A 1JLCA 3K8WA 3Q2TC 4NLWA 4D3HA 4X65F 1J2VA 4B3SJ 1U49A 4UOGA 1QY7A 3QFHA 1RT1A 1WHVA 2D3O1 3SSSA 3A8IA 2V8DA 1RHRB 2AT1B 4ECZA 4ZVGA 2VQFF 2FDNA 3RR7A 1IKWA 3HVTB 2CRLA 2CQ2A 5B0FA 5HVGA 2X1AA 3BKFA 2Z4PA 3H2LA 3MR3A 4P74A 2R2SA 1RAOA 2CJXB 1FJGF 2XM3A 1K1QA 2YNHA 3H7HB 1AA1B 3RBDA 1N6QA 4OYMA 2WB1D 2W2QP 1J5EF 4F02A 2WBRA 2MHEA 2VODA 2GCFA 1YLXA 1SQEA 1RB0A 1LV5A 4KGMA 5LL6d 2MTLA 4LQ3A 2KVIA 4DFJA 1ZM9A 5B08A 4RO0A 2HEKA 2JFDA 1FRIA 4QYZJ 5F8IA 2CQGA 3GG1A 1EETB 4XPCA 5D0GA 1SL0A 2QL5B 3IWNC 4YP3A 2DEJA 2OPRB 3AODA 2YKNB 4A8XA 3DOLB 3CJ4A 4I6AA 2MQQA 1XMQJ 1WTBA 2AX0A 4RW9A 1IQTA 2CPIA 3IBCB 3TA2A 5HMYA 2V2ZA 3POTA 3AH6A 3OR1A 2ZDOA 2R7WA 4EBEA 4OHZA 1VC6A 4RBUA 1EP4A 3MPDA 2HLUA 1X0FA 2Z56B 1ZM4A 1M0SA 4IFVB 4OZ1A 1AUSL 2CNOB 1P1TA 5J2MB 3B6BA 2F8MA 2B9EA 3KWMA 2ZOFA 4BC7A 4OX9J 2DJWA 3SCIE 1HBUA 4MKAA 1JIHA 1SXLA 4CO5A 2AGQA 2GMLA 1T8EA 1S4EA 2ALYB 3NGDA 3MFHA 3IBWA 1W2BR 2V9WA 3AD8C 1KR4A 2V9KA 4WU3A 2L48A 4K50A 2VKRA 1MSWD 1IBCB 1J27A 1QTNB 3SQOP 3K5NA 4DV1F 3F73A 1Q16B 3C6TA 3M7VA 2IBOA 2MQ8A 2KJWA 1UVJA 1S57A 3KLHB 4HT5A 2EFNA 4KKOB 4NASA 3LP2A 3ELHA 8ATCB 1FXDA 2LCWA 3PRVA 3T1AA 1TK0A 5ETNA 3NBPA 2LQ8A 4U7UK 1HNXF 2RT3A 3OTEA 1WNEA 5CCLA 2DNLA 2XMTA 2DITA 4B3MF 1MLAA 3DLGA 3CC7S 4ZPTR 4X4OA 1UFWA 3KUGA 5GMEA 3M2RB 1LWFA 2EFOA 5DDPC 2VZ9A 3GJQB 4JI7J 1N52B 4YB7A 3D6HB 5GAHU 2ZHOA 3CIMA 3W5ZA 2DNZA 3HFZB 3TZXA 2LDYA 4GC7A 3R5DA 3GP9A 2MQMA 4FBUA 1UJ6A 3KDNA 4P7TA 3DHWC 2ZC4A 3TAQA 1XBWA 3BQ0A 4MK7A 5HP1B 1NK8A 3FMBA 2I6WA 4ZLNA 4LSNA 2NUUG 1N5YB 1HBNB 2CDQA 2QFJA 5AT1B 4LRCA 2FJDB 1I3OB 3K5OA 2GIQA 1BD6A 4LF2A 4O3PA 4PQUA 3H42A 1FJCA 4KHPJ 2VJUA 1YITS 1RSCA 1RTDA 4OZ0A 3Q83A 2DT9A 2W01A 2H48B 4DSKA 1BLUA 4J9KA 2XULA 3M8QA 3H5UA 1C0UA 5E5NA 4HH1A 4LF8F 3DC2A 4V1Ak 2GJFA 2J7KA 3TQEA 2J8SA 4N41A 4CT9A 4LRFA 4Y0FA 4E0DA 1FNMA 1HPZA 4DPUA 5ETOA 1FESA 3Q89A 2CQ4A 2OSRA 3NMAA 1FX2A 1KS2A 1QE1A 4XIUA 2WB4A 4FF1A 4HHHA 2AYBA 3NGSA 1WC0A 1HQUB 4UQGA 5KG2A 3NGTA 4U7CA 1Y7PA 1U6BA 4A8MP 5KG0A 4NLDA 4O0IA 3KDOA 2H5IB 5F9LA 4U9RA 1UVLA 4PXDA 2VKZG 3OTOF 1T95A 4ZJLA 4DX7A 1PC4A 1SKSA 4I7FB 1YSJA 5DQHA 1KLNA 2IRXA 3D1HA 4GO7X 3JB9k 3S6EA 2M0GB 3RBZA 4EI2A 3LP0A 2OPQB 3C14A 3QPIA 3QT5A 3DN9A 2H4YB 1WC6A 4F25A 4ENOA 3SMZA 4KV8B 3THVA 2VDIA 1KLMB 2IC3A 3FDSA 4LVOP 4RPFA 5CHCB 1DAXA 3ZZTA 3VR1A 1PILA 1GMUA 4MFBB 2BE7D 3OFGA 3MR2A 1U0SA 3RB6A 4L6V3 4NEZA 3FKBA 3VALA 3NS7B 3EICA 4DR7J 3KK2B 1ULRA 2FVQA 4Y2AA 2OPPB 3D5MA 3FQLA 4USVA 2CJYB 4K2JA 1FRMA 1I6JA 1R8PA 4P71A 4JI8J 2CPXA 2UXDF 3OTCA 3ZC4A 3JQJA 3RJMB 2UU9J 3IMQJ 2CWKA 2P9EA 3M9MB 2HS0A 4M8LA 2JVRA 2JLFA 4F2SA 3D1OA 4B3OB 4AUKA 4F67A 2A3JA 3OL6A 2A0FB 1E6YB 2BJ9A 2VL1A 1HBMB 3QIPA 1D8ZA 1VRTB 4IQMA 3GLJA 1HWKA 9RUBA 3TA1A 2MJUA 4YHHF 2C42A 3NKYA 4I2QA 2MJNA 4Y3CA 4A46A 1M1GA 3GR1A 4ED7A 2VDHA 2DNNA 3BGRA 2VBXA 3J80Y 2HIYA 3HD1A 3CUNA 1RCXB 2H65B 3TJ9A 4OV1A 3OVAA 3LO3A 4DPWA 2DNRA 2B7CB 1C0TA 4CM2A 2OSQA 4ED6A 1OPIA 3RRGA 1JXVA 3VAJA 1YZ7A 3KG1A 4HDHA 1XNQJ 4JI7F 3CSKA 3SBMA 4HLBA 4DI6A 3BPDA 1RE1B 4L3NA 1NZ8A 4OYXA 1HNVA 3H2VE 2E1AA 4HT7A 2D9OA 1WOSA 1SL1A 5D3GA 1F1BB 1HQEB 3G8TA 2UUBF 1HW8A 2HFNA 1T0TV 4ZVOB 1CJUA 1RT5B 2V4JB 3D67A 2E7VA 1C4AA 3MMJA 1ZA1B 4PG4A 1APSA 3G82B 1NDKA 4WXOA 6FDRA 3PEJA 2XI3A 4K59A 4M5DB 3C15B 4F36A 5DLGA 4QW8A 4X66F 2R2RA 2HFSA 3LQVA 3BB5A 4KHMA 4DR4J 2CZ9A 4ZJOA 1EKSA 4WIIA 1EARA 1GX6A 1GTHA 1PYTA 2YBVA 1T9TA 3R5GA 2R8KA 4FN5A 3SV3A 1SBRA 4GVBB 3HI9A 2B6AA 2KHCA 1HI0P 2WOMA 1ZA2B 3P4UB 3QNWB 5A0YA 2ROGA 4V19X 4F4XA 2HVZA 4X4RA 5I3PA 3HZEA 2BOPA 3CMES 3R9LA 2LMIA 2YKMB 1WF1A 2JH3A 4DG1B 1RHJB 1N56A 1ZM3A 4IOCQ 5A8WA 1KVJA 4F3MA 2MGZB 1XNRJ 2MKIA 4AYBD 2OJ3A 3TARA 1U1PA 1LQ9A 2FZGB 2DNGA 3CCWA 3RB3A 4AT1B 1HA1A 1NH7A 1AYEA 5D4PA 4DR2J 4CP5A 4ECSA 5HBMB 3I9ZA 2XG8A 5IT9U 4CH0S 4NLTA 1N5QA 3ZO7A 2MZJA 5LMUF 2A6OA 3PX6A 1S6QB 1KDNA 2V4QA 4FS2A 3GR0A 1TL1A 1JB0C 4NXMJ 4C98A 1XEZA 1YZ6A 1OSCA 2ZH7A 4NA1A 3JYTB 4NLGA 1RTJA 1FVSA 4JOUA 4TU9A 1A0OB 4TU7A 3I0SA 3JTOA 2Z58B 4EBCA 1V6HA 3M6VA 3I32A 3NY0A 4JV1A 4M5GA 5KFAA 5AXMA 1S5ZA 2Z57B 3QMQA 3BREA 4WP9A 1J5OA 3MURP 2C1EB 4O44A 2LEPA 4H4MA 4JI4F 1Q0NA 2WTFA 3DRPB 1T03A 2XZDB 4NMLA 2LA4A 3W66A 1C1BA 2KTQA 1DHMA 2YWFA 4NLQA 1VBXA 5EWGA 4CTAB 2AGPA 3TYTA 4DUZJ 3LA0A 4NLRA 2OPSA 2V6AA 3TNVA 1WC4A 3EUNA 4NCBA 2MKSA 3AOAA 2ASLA 2W8LA 1NJYA 4C8KA 1RWKB 2FJVA 1QSLA 4NEYA 3CWJA 1N4LA 1SB6A 5KT7A 2HS3A 2KI2A 1JLAB 4MIWA 3PYGA 2I1RA 2BR0A 4C11A 1JLEB 3CJKA 5D4NA 1GH8A 3HJFA 4USMA 2HNDB 1Y4ZB 4RZRA 2AU0A 4XTTA 4RUHA 4DXLA 2HHHF 3MM9B 4J9UE 1NO8A 2Y1JA 3PW4A 4FDFA 3MAAB 3D7SB 2E5JA 5J2QB 1VQ6S 2KM8C 4DX5A 4WK1A 3ZZZA 4F8RA 4YOEA 1RZMA 4JI3J 4WIQA 1RLDA 3MEDB 1XWLA 1SVDA 2L08A 3WX4A 2QA4S 4N8NA 3PY8A 2M4MA 4HKQA 1KKHA 4UUWA 2PDAA 5EWEA 5KTQA 2E9TA 3UR0A 1PIEA 5B0BA 1X5PA 2FGOA 3LP1A 3C46A 1TL5A 3KJNB 3C19A 4A48A 3FEXB 3CDUA 1HNIB 2BOAA 2G2OA 4TU8A 3PG9A 3R27A 3BDPA 2ZBIA 3QRRA 1LW0B 3E01B 4BCAA 1TKXA 2ZBRA 2HHVA 1Q78A 2BJ7A 2Q6CA 5K8PA 4FNIA 4NZ6A 1U2CA 4NLOA 5DS7A 3Q24A 3LPYA 2G2ZA 2EBGA 3A8EA 4PWDA 2XWYA 3V6DB 2JDJA 3LGHA 3UDLA 3CD7A 4OMFG 4IRDA 2P6SA 2R3VA 4G65A 2CA9A 1CJVB 1LWXA 3WZ0A 4B9TA 1SH2A 4B9MA 2B3TB 2W9CB 3GJSB 2HHSA 3ISNC 3KUHA 3D6MB 1FEEA 5LT5A 1FKPA 4DSJA 5DG8A 2YX7A 4PR6A 3FBEA 1QLNA 1TL3A 5K8OA 3SCLE 4KGXB 2IMOA 1SH3A 3KK3A 3TZZA 3TWZA 3DGVA 4FNHA 4OX8A 1FTCA 2CQ3A 2U1AA 1KVIA 2HQCA 1QAYA 1ICEB 1YK9A 2GO8A 1U8SA 2J9DE 1BY9A 1S12A 4ZITA 4UT4A 3G8SA 2W24A 5KFHA 2VICA 1ZAXA 2DXFA 5A8KA 3K58A 5HSPA 3Q2SC 3QGIA 1F2GA 4M95A 2IM3A 2OO4A 1B7FA 2P9GA 5L1LA 1X31C 4HVZA 2F7VA 4NCAA 3V81A 3DYAB 3S7RA 4NZ7A 3FEYB 2PI4A 1S6PB 2GAHC 4IH6A 5HQLA 2JOQA 4ZVQB 3MMBA 4PUOB 3EZUA 4DL5A 2XGPA 4AL5A 1GXTA 2HRYA 2GZOA 4DV6J 2XSFA 3M6UA 5EHHA 5F8NA 2XWXA 2W7OA 3OLAA 4OI4A 2IY5B 1SH0A 5KFEA 3MECA 1NLKL 1Y3JA 2Q1LA 1VLOA 2ZOGA 5KT6A 4OYAA 5F41A 4ZIVA 1MU2A 1TKZA 4V19J 2O01C 3IR7B 1GMWA 3CMQA 1M5SA 3CCES 2F3JA 2GHWA 2VBYA 2KT5A 3SDEA 4LF4F 1LNQA 4A8OA 2BE2A 4OHYA 2HHUA 3AXKA 3MCSA 4W92B 5E3RA 4X64J 2D1CA 4ES1A 2UXCF 4HR2A 3D68A 2VFVA 1N32F 3SQGB 4ZP7A 1M1HA 4CCHA 2CKWA 5J1NA 3V6HA 3C6UB 2BKNA 1TFWA 3GPAA 1DQ9A 1W2IA 1F0XA 2W7AA 1UKUA 4NI2A 1XMOJ 2YTCA 2DNYA 3M32B 1HWUA 3EGVA 5A76A 3FCVA 3E3XA 3TVZA 4WFZA 1H7XA 1LOUA 2QIFA 4Y34A 1RTZA 4EK2A 3NNCA 1MG7A 2JLGA 5IV4A 4JI2F 3HZGA 4BS2A 1WKJA 4DSEA 2WZ1A 2B8PA 1QAXA 2HGNA 1TELA 3QQCD 4ZPCA 1QSSA 2VF3A 5HAOA 1KFSA 2MY8A 3CNQP 4DL7A 1B0TA 4LF5F 2HNZA 2QX0A 1YQHA 3W2WA 4FKYA 4KAIA 1QDUB 1TL7A 1RYSA 2AGOA 1M5VC 4BLGA 1LKZA 2XS7A 1LWEB 3IG1A 2B9YA 3CJ0A 1Q95G 1N34J 1VBKA 4NCGA 3P3DA 3HSZA 3SSRA 2PD1A 2B4UA 2RUSA 1DTTA 5BR8F 3U7JA 4ED0A 4DFKA 2X7IA 3MPVA 4LR8A 3FBBA 3PHTA 4I1TA 2CAJA 1C1CB 4ZPDA 1SJRA 4RW4A 1JLBA 1TFYA 2RQMA 2KT2A 3W65A 4UOCA 1CJKB 5H9FJ 2AP6A 4OI1A 4GKJF 4RNHA 3GYGA 1U0HA 2OEKA 1TV6A 3MM6B 4ZPBA 4X4UA 3TVYA 3HHDA 2MLZA 2AJFE 1S72S 5L9NA 4LMZA 1EAYC 3IXQA 3KHHA 4MK9A 2KXNB 4FF2A 3GYXB 1KEKA 2KB2A 5C42A 2B9WA 1TVRB 2KU7A 3RGIA 5HROB 2DO0A 3GQCA 4O23A 1RI7A 1R3NA 2YKPA 4WP8A 2Q66A 2HMIB 1TTHB 3THPA 4QWAA 4WK3A 3MR7A 3VAFA 3BO4A 2P9CA 3EGZA 2EG1A 2PMZD 1OMSA 1RKIA 3SZ2A 2VA3A 2BM1A 4RW8B 1X9WA 4IG0A 3D9BA 2DHSA 4OLOA 2ZZNA 3QATA 2BA9A 2DB1A 3R3TA 1WKLA 2F8HA 5DO2A 2V2VA 2DXDA 2ZFHA 4DL6A 3MMCA 1RADB 3BEGB 3G87A 4JYAJ 1SC1B 1PCAA 1TKTA 1WC5A 3EYZA 3V4IA 3HHLB 4M5NA 2EPIA 1G4CA 2XMAA 2B4PA 3GFHA 1ZH5A 1RA6A 2HGMA 4OI6A 3G6XA 2NXNA 4C8NA 3BV8A 1RWWB 2F9JA 1JLFB 2BJ3A 4WFBQ 5L38A 5KG1A 2YNFB 4EGLA 7AT1B 1CJTA 4FVMA 2X51A 1WC1A 2J0QD 3MMAB 4Y28C 3J81Y 3KJVB 2XI2A 4C9DA 4GRSA 3QJPA 2A10A 2W9BB 2DHAA 1U2FA 3Q23A 2DYAA 2O5DA 2AEFA 2XSJB 4MKBA 1RTHB 4JV5J 3K89A 1CQNA 1EHWA 1PYSB 4OHXA 2CQ1A 3CJ5A 3LW5C 4P2FA 3PRDA 2JHEA 1HBOA 3BR9A 2JRSA 3MM7B 4I2PB 2CPHA 5I3QA 5DJBA 5DG9A 1N88A 5H9EJ 3MF5A 4OZ3A 4TN2A 4LR9A 2ZH3A 5KT2A 1T05B 3GJRB 4ECXA 4JBCA 5L9XA 4ANDA 1D9FA 2ZHAA 4C3KA 3T1HF 2C28A 3G9CA 4DQSA 1NKCA 1S9EA 2EC0A 1LXJA 3UD3P 5I42B 2M3DA 2AJ1A 3DOKB 4LF9J 3N5FA 3ENQA 4OQJA 3N6MA 2YKQA 2CADA 4WE1A 1JNRB 2HHXA 4FBTA 2ZZMA 4RNMA 1SKWA 2YXLA 2G1HA 2PEBA 2Q79A 3W9IA 2KG0A 1XERA 3TZWA 1IKWB 1FHTA 1FEHA 4P75A 2W4DA 2FLNA 3PZPA 2V8HA 3H20A 1V9OA 3HHLC 4CLWA 1DZ5A 4G1QA 1QSYA 1RT7A 4K4XA 2J5AA 1R6YA 3P49B 2L3MA 3NCRA 4O4GA 3RB4A 2RRNA 1O8BA 2DGWA 3PACA 5CZVA 2KJVA 4I64A 2VQEJ 1S9GA 1PKUA 2HAFA 2KO1A 3R97A 2HBQB 2VG6A 4LFCF 1X4DA 3EX7B 2ZM6J 2Y1LB 4DR3F 1XR5A 3UCUP 4KH0B 2Y8WA 3PR4A 4KB7A 1PJ5A 5C2GA 1YIJS 2FUG9 2KKHA 4DHVA 1X0PA 2K1RA 4KT0C 1RAHB 3CD6S 2P5VA 1VIOA 4DPYA 3PHEA 1HMVA 3CJ2A 2XMUA 3NNHA 1H7WA 1RAJA 4RW9B 5CD4A 3LWMA 4CIOA 1Y11A 1SIWB 2MMYA 5DM6Q 1R0AB 2N7CA 3PW2A 2EKYA 3PYFA 1JK9B 1LFWA 1EP4B 3MXHP 2PEHA 4DR1J 1SUQB 1T9XA 2FZKB 2BUNA 2F5GA 3ZTRA 2VFRA 2V4RA 1TZ0A 4WFAQ 3A12A 4LSZB 2BEFA 4WTYA 1OS5A 2ZHBA 1HBUB 4L72B 4H54A 3NOGA 1FDAA 1IWGA 2MY7A 1NPRA 3ZNUA 4IKAA 3MM8A 1KC8T 4M5IA 5J1EA 4ZJQA 2LLZA 3RU0A 2D3UA 2E9ZA 2BBEA 1HWLA 3AT1B 3MCOA 4NLVA 4R5PA 2ZWOA 3GIRA 4JB8B 3HKZD 4O3QA 2CVIA 3LP2B 1W26A 4DUYF 3FEZA 1YVFA 2GNKA 4GC6A 5B0CA 3Q8PB 2I5JA 3H25A 1NUEA 2Q43A 2BANA 1RAFB 1R7IA 2IA6A 1T11A 1SJ3P 1WUUA 3ICLA 5JVGQ 3J81j 2QZ8A 5IOLA 4KPYA 2LYVA 5D0HA 1Z2ZA 2YNIB 4O4RA 2YNGA 5KG5A 1LWFB 2FD2A 1VQ5S 5F8GA 1RXOB 1QTMA 2XC9A 7FD1A 1CC7A 2M9KA 4GVLA 5HMXA 5EX3A 1S0NA 1D0EA 2QFIA 4RW6A 1FKAF 3FK4A 2JC0A 3GV5B 3KKFA 3DLBA 4MIBA 4DUTA 2E5IA 4L74A 2WW4A 3DLKA 2FJXA 2QMUB 2DHXA 5GAGI 2WAQD 4U8VA 4NL5A 3MM5B 3FCWA 1I51B 2D74B 1YKWA 1CLFA 4LF6F 4PQUB 4RUCA 5LJ5Y 2F8EX 3Q8RB 1WSRA 3CMAS 3QWUA 2HAIA 2ZUGA 3UW1A 2R4FA 1RTDB 1DTQA 3CJ3A 5HI7A 4KFBB 5IM0B 1NH8A 4CNYA 5FIIA 3EZ5A 2PFFB 2XGQA 2HS4A 5CD4H 2RB7A 3NWGA 3KLFA 1RGVA 2C2RA 1XR6A 3D0HE 4HH0A 5ITHA 2RKIA 1HPZB 2R42A 1HI1A 1P8GA 5I3UA 5E41A 2DNKA 2LDIA 4CRJA 3WX8A 3J80U 4NA3A 1GAOA 4JV2A 2MKJA 3MPWA 1HR0F 2WVFA 4LUBA 3NMRA 2OTLS 1Q8KA 3AQOA 3HVRA 3R8YA 4IR1A 5FDLB 3PO5A 3D66A 3BPSP 3CB4A 2RMLA 2E1RA 3KLEA 2V67A 4TY8B 4WYWA 3DMJB 2AJQA 1TU0B 4Q7AA 2JL9A 1HWIA 2XCAA 1RCOB 1HI8A 2EVZA 3HK2A 3AJDA 4NLSA 1ITPA 1Q86T 4C7QA 3FRYA 2DKOB 3NS6A 1RT4A 1TUWA 2ZM6F 2HW3A 3OR2A 4XPEA 1LXNA 3CDBA 3L95X 1NNDA 2XMJA 5C5JA 2IJNA 3M8PA 3LP0B 5JXSA 4FP9A 3C14B 2VG7A 2X1FA 2HYIB 3ETOA 4ZK7M 1SJFA 3CJ8A 1FRKA 1HD0A 1RLCL 1GFWB 2IC3B 2UVUA 2DHHA 3UDVA 1L5UA 1MWYA 3Q8YA 1IBKJ 4UY8T 3JTNA 1U4BA 2UUAF 4ANEA 3CIZA 2ZE2B 4BWJA 1H73A 4YN3B 2R7TA 1N5TA 3KMSA 2MQPA 2Z2MA 5G0RA 3J7YI 3PJWA 5MAOA 1RISA 1UCNA 4ZPVR 2RIJA 5DQIA 1AUDA 3PIPQ 3JXOA 2ZH2A 2UUCJ 2AX1A 5IWAJ 5ETMA 2OELA 1CULB 1HHTP 2K7JA 3QJLA 2OFHX 3KLIA 4IRKA 3QIPB 2LFVA 3PVXA 3L9ZA 3KK1B 2MQLA 5M2PA 2OPRA 2YKNA 5LMNJ 2HQFA 1ZPWX 3DOLA 1PBUA 4TVAB 4J9OA 4DV5F 4DV0J 4YQWA 2E1CA 3UN3A 3KG0A 1UETA 5DM7Q 5K14B 1RT3B 3PFOA 3BGRB 1WG1A 3D6FB 5C7PA 2Q3PA 1GX5A 4IFVA 4E8UA 4KRWA 3TEGA 4ECUA 1C0TB 2GIFA 1UVNA 3Q8UA 1NPKA 3HHKA 4DDFA 2MKCA 2H4WB 3W1YC 5IT0A 1NXIA 2CVEA 4DCOB 1JX4A 4MJKA 4C48A 3A3OB 3CCVS 1REGX 2B4VA 4YY3J 2UXBJ 2CZ4A 2XHWA 2E44A 4PAAA 1VBZA 2FHJA 1DFDA 2ZDPA 4Q0BA 3CDAA 4E98A 1UVMA 3TI0A 3A8JA 3D4JA 1S1UA 4PRFA 3M8SA 5EN1A 1FXLA 3GSIA 4N8OA 2GVDB 4F7VA 3HHEA 4NYOA 5CXTA 2VIHA 1H72C 5DZ6A 4K5SA 2AV5A 1OQ3A 1RT6B 3ITHB 2MEWA 1PJ6A 4KGVB 4F4WA 1MMNA 3M9OB 1E6VA 1FRLA 2CWXA 2EC2A 4LF7J 1FJEB 3M2RA 2C3MA 2RD5C 3KHLA 2YWGA 1WTFA 1HLWA 1X9SA 4X65J 5AXLA 1K0VA 1FD2A 5THWA 2BQ3A 1F9HA 4DV2F 2ZBCA 2WOMB 2VQFJ 2IHR1 4WJBA 5A0YB 2QO3A 5EDWA 3P6YC 1ZPVA 1UPMB 3H59A 2OTJS 1UTAA 3U1MA 3WDOA 1A6LA 3H98A 5CYMA 5F3ZA 1FJGJ 1N5YA 3HSGA 2CPDA 2YH0A 4DFPA 1OY6A 4ZMMA 5FLXY 3US5A 3R6GB 2W1BA 3L4BC 4YR2A 4NYPA 4WF9Q 4OYOA 1ZM2A 2HRUA 1J5EJ 1MWQA 1Q53A 1DQAA 3CXCR 4C6AA 4KTQA 5LOQA 4W4MA 2VB6A 5MLCV 2VHGA 2EFQA 1N0VC 3CCQS 4CLPA 4RW7B 1HNWF 4KGZB 2K3IA 1RYRA 2E1MC 1JMTA 4YB5A 2M8DB 3PIOQ 1XR7A 1O5JA 1XC9A 1BQMB 1NBEB 1R0BG 3S1TA 1KRPA 4U6PA 3B54A 3M8WA 4F4ZA 2XNRA 4PZVA 5J2NA 3I0SB 1IBMF 5H9EK 3U1NA 2FVCA 2J8AA 4LT6A 1IJEB 4JI6F 2LXUA 4DL0C 1B3TA 2QEXS 4YB6A 1N0UA 1RWNB 1NSPA 7FDRA 5KFDA 4X62F 4O44B 5K9FA 3ENAA 3AFGA 1T03B 3FSIA 2DISA 1IR2A 1C1BB 4I7FA 1ZZNA 4B9UA 3TVKA 4ED2A 3AD7C 4K4YA 2ZH9A 1Q5YA 4LJMA 5IWAF 2XEXA 3UWTA 4P9SA 4DV1J 1B70B 4KO0A 2JC1A 3PM9A 3S01A 3TX8A 2HKEA 5KG3A 4ZCMA 4QIEA 1KLMA 2JJ4D 2BE9B 2HBZB 3T5HA 3H4BA 4RBTA 3CO9A 3LGNA 3MEGA 1Y9OA 5J2PA 2IJFA 1S0VA 4PG8A 1YG0A 3RW6A 1WORA 3RAQA 2H5JB 1HNXJ 3Q8VA 2KYXA 2B56A 1GK8A 2OPPA 3O5TB 2A2CA 2ZC3A 2XYGB 4QPXA 5KT4A 4TYBA 3JQMA 4DL3A 3BQ2A 3PX0A 3MEEB 1WDTA 1HL6A 2XY6A 2ZKUA 3DLEB 4QIWD 4O3OA 5L1JA 5BYQA 1C4CA 3GZ7A 2MZ1A 3L3CA 1FO1A 1WI6A 3TJAA 3MCNA 1NKBA 2J6SA 1VISA 3SYZA 3TAMB 5HN0A 1VQSA 4NMXA 1HBMA 2AZ1A 4FPRA 3HT3A 2ZH4A 5C25B 3TW0A 1LW2B 2AZ3A 4Q8EA 3THTA 2V8GA 1WEXA 4DWIA 1AZSB 1K1SA 2AF6A 3NOCA 2G9OA 1NK6A 2R8IA 3QGPA 5KFMA 2QN6B 1A9NB 3CC2S 1YBUA 1R6VA 1K0TA 4PKDB 4ECRA 4CLTA 2RRBA 2C2EA 5KFQA 2CPFA 1NJWA 5KFWA 4R25A 3MWBA 3AOBA 2KFNA 1U26A 3G8QA 2EBEA 3I96A 4QJVA 2A18A 4LF8J 1V3RA 2VU5A 5DGBA 3IAS9 2EG2A 2IJRA 2W9AA 3EDQB 3DLHA 4IFYA 2RNEA 2UV8A 1S6UA 2RQ4A 4J9QA 1T9UA 4DSIA 1R31A 3ONQA 1EZZB 1WHXA 1HQEA 3VGVA 2EK1A 3MUMP 4ZLLA 1VFJA 2GFFA 1RT5A 4IH5A 4YR3A 2V4JA 1FWPA 4HACB 4GKKF 3KLGB 3O44A 1FKPB 3CEDA 2B51A 4O3NA 2ACMA 4FVCA 2Y0BB 4QIGA 3G82A 2BJ8A 3QO9B 5GADU 2ASJA 3T3FA 1NK5A 2Z30B 3C15A 3I0RA 3OTOJ 2R7VA 1B4SA 4NLYA 1SQGA 4OFZA 2EEYA 4KYZA 4JI1F 4RLEA 3FUYA 3N0VA 5E3CA 1U1MA 3GYNA 3CE8A 2JX2A 5LSRA 2UUWA 3RBXA 2VOOA 1KP6A 2WRMA 3JAMY 2NS1B 3C16A 3I31A 3SCJE 1MMDA 3HKWA 3HSDA 1NHUA 3P96A 1EB0A 2ZH6A 4OZ5A 4WBFA 3W9JA 2YWKA 3B8HA 2CG8A 3KUEA 2DCUB 3PKMA 1KTVA 4DR6F 3V81B 2YKMA 3K5MA 3IBFB 3CPWR 3KMQA 1ZZFA 4J9MA 3DDKA 1FKOA 2CQPA 1IUJA 3I6PA 3SV4A 1WKKA 3IM9A 2BDPA 4RUAA 2HWHA 1GXLA 1T9WA 4U67Q 2V50A 2UXDJ 4DF8A 4DJBA 2N82B 2FVPA 1FVQA 4NRUA 3QRPA 2GO9A 3K17A 5KOXA 4CZCA 2N3OA 4YUDA 4IQXA 3MECB 5AE3A 2EI5A 1SJ4P 2V69A 3BSCA 1TKZB 2KL8A 1Q79A 4WP3A 1UFKA 4PG6A 3FZ2A 1N5SA 2GVZB 2BM0A 1R8HA 4YHHJ 1OSDA 1VC0A 5B0AA 3PNIA 3K7RA 4ILLA 2VPXB 2MHNA 3LPEA 8RUCA 4M63A 3UN5A 4URGA 3KG4A 3F44A 3PYDA 4MT1A 2GMJA 1VQOS 2N4CA 1JKHB 4DOZA 3GV7B 3FBFA 3DRPA 4JV0A 4B9NA 5IS2A 3IA0A 4WPAA 3U1LA 5KFPA 2X1GA 3ZZ0A 5CCMA 2R7XA 4IR9A 4MK8A 4DF4A 3N4WA 2ILZA 1CEZA 4B02A 1N8RT 3C3LA 2J0XA 3Q8QB 2K3KA 2PC6A 2RUGA 4UQTA 1T7PA 4EWTA 5LXYA 4MMOA 1V5VA 2ZH1A 2UUBJ 5DGAA 4ID5A 4CYUA 3V4MA 3X1LB 1JQGA 2R8JA 4C8OA 1JLAA 1UEVA 4ICLB 4LRBA 1RBAA 1JLEA 3VAGA 4J9PA 2HNZB 3W2WB 2VJVA 4CI0B 2QSFA 1TL7B 5E3PA 4QW9A 4XK8C 1T3OA 4PG7A 2FLOA 3KJFB 4I6YA 3WBZA 3H5XA 4X66J 3OTDA 1U2RA 3MM9A 5D78A 4WWSA 2ATLA 4USKA 1NJXA 1AFIA 1IBLF 3MAAA 5AJ3J 5J2QA 1X9MA 3UFCX 1YJTA 3RRHA 3W2VB 3DU6A 3SCKE 3VGTA 3UDEA 3UCZP 2QMWA 3WC0A 4C97A 1YJ9S 2ABYA 1FE4A 2J6TA 3I4HX 1DJ0A 5BYRA 3LANA 2J9CA 2E5GA 4RW4B 2FC8A 4ED1A 5G4DA 2A2DA 1JNZB 4C8MA 2PO4A 2ACYA 3T9NA 2QL9B 2UVVA 1TV6B 5E7OB 1Y00A 1BUXA 2GX8A 2E7WA 4G1PA 1IKXB 1S1XA 4C3LA 2GQ2A 1G6BA 3VAKA 1N48A 3VGUA 2MSSA 3W5YA 3HDSA 3HVWA 2CQCA 3NAHA 1QJHA 5C42B 4L73A 1RP5A 2NREA 1VJWA 1S9FA 2UV8G 1FNXH 3OFHA 4RKUC 4HEA9 5D0EA 1CS4A 1REVB 4X4PA 5A8RB 4OYWA 4KIAA 5LMUJ 3QJJA 5LSLA 3BGLA 4BBYA 3IS9A 3MZIA 4K4UA 1IKVB 2DIVA 2JLEA 3HULA 4KJIA 1AW0A 4ZCKA 1Z1ZA 4DQPA 4OYBA 1S1WB 2K8GA 2OP5A 3JTPA 1FK9A 1Q1KA 3BSOA 2HIQA 2W9CA 4OV6A 1JJCB 1AXQA 2HSEB 2AIRB 5F3TA 1UPPA 4BWMA 1UA0A 1NSQA 2LKZA 4B9SA 4ZN3A 4FYWB 1RA7A 2QTWA 1TMJA 4LSLA 1TKTB 3MI7X 3UPFA 4C0BA 3BKTA 4JI4J 4WKYA 1I94F 1M90T 1F5AA 1CC8A 1IWAA 3H5YA 2Y9HA 1V3SA 3T1YF 4OJ1A 3T6BA 4LIWA 1UWBA 4F04B 4ETXA 2IAJA 1X5OA 2NCKL 5A6PA 2HZAA 2VD3A 4IG3B 4DQIA 3B78A 3LAKA 3NNAA 1RBLA 2YH1A 2PSZA 4RX6A 1F3VA 2GQQA 2J9EA 3FNNA 4GMKA 5IQ6A 2DY1A 1LK5A 2YQ3A 2ALZA 4KQZA 3RUBL 4JI5F 2HVDA 4IOAQ 2CQBA 2LQBA 4YB1P 2HHTA 2W8KA 1NDCA 1G3OA 2AJ2A 3BN4A 1F9FA 2LP4A 3H5SA 3MD3A 3DXSX 1DLOB 2FQQB 5HMWA 3BQ1A 3DRXA 2OUGA 3LGMA 3W61A 5DLFA 3EMTA 2HHHJ 4UZCA 1DRZA 4PUOA 2X3DA 4I0WA 3PXGa 2R8GA 1YJRA 2R7SA 4QWEA 4F3OA 3KFWX 1EQ0A 3J7Z5 3FJ2A 4K0KF 3DNCA 1VLYA 1KHWA 2VPWB 2DRAA 3UDCA 2M5YA 3HVAA 5T14A 4OI2A 2DGSA 3CTRA 4OIXA 2V0NA 1RTIA 5C24A 1S9EB 3EPGA 1K9MT 2B9XA 2KYZA 4F3QA 2HG4A 3G96A 3MEKA 4AFFA 1VGYA 1M5HA 2LA6A 1JJ2R 1XK8A 2H9ZA 5I4MA 4NLUA 2YQ0A 5L1IA 1YRXA 1U6ZA 4ZLJA 3TA0A 2RU9A 3DU5A 3SQGA 5J1PA 2MLYA 2BMBA 3C6UA 2PGCA 2AW0A 2J7UA 3IAM9 2R7RA 4CT8A 3MTJA 3M32A 2DIUA 3CF5Q 2Y3YA 2FZCB 1L3KA 5EX0A 3K57A 3RYLA 1UJ5A 1RT7B 3ET6A 5AJ3F 1NU4A 4XDDA 2UZAA 2G4BA 2DGXA 4ZVHA 1K47A 2R8HA 2O67A 4DSFA 4FXDA 1VI7A 1X4GA 2ZH5A 1RAGB 4DL2A 2FVRA 5LJ3Y 1KFDA 1S9GB 2HVEA 6AT1B 4UTGA 1KWMA 1SKRA 5AXNA 5GMKa 3SIPB 4Q43A 3AB4B 1R0CB 2ASDA 4CQ1A 1UZDA 4Q5VA 1RUSA 4UZBA 3EXYA 1Q7YT 1ZS6A 1B0VA 2QSWA 1HFEL 1UVKA 4WFYA 4M94A 3MTKA 1HMVB 1WEZA 4ELTA 2FJWA 5D4LA 4A8QA 2NPFA 4KPCA 4X4NA 1MMLA 1R43A 1SIZA 3G71S 5K20B 5DETA 4HDGA 3ZZPA 2LU2A 4G3IA 2Z2ZA 2N4DA 2KFYA 3QLHA 1BXNA 3MD1A 1RHUB 1RHMB 2C3UA 5DDRC 2W2PP 2N7YA 3SEOA 1PAEX 4ES2A 1C1CA 3AAWB 4LFBF 4ECYA 3RTVA 2BKPA 3OVSA 1Q8BA 1L3TA 2B5JB 1QM9A 1CJKA 2FHMA 3UD4P 1Q82T 3L7UA 4C8ZA 4UOHA 3GV8B 3DOMB 5KT5A 2V63A 3IO1A 3TX0A 2P2CB 3MM8B 2DR6A 2F65A 4WFXA 1CSJA 3IM8A 4HHJA 4OYIA 2V68A 4C8YA 1WI8A 1RWOB 5DRKA 2OFGX 2MDAA 4YEAA 4R5PB 2AJ0A 1LWCA 2K7KA 2JEIA 1TL4A 4DV3F 2XCPA 2HHWA 4AL6A 3BH6B 3DGPB 3IWLA 4AQYF 5HLFA 2I5JB 1TVRA 1F5BA 1UZHA 5HROA 1PBAA 2ZITA 3BYRA 4ER8A 2NYHA 1D9DA 2KZZA 1X60A 5KFTA 4J9SA 2HMIA 4A8SA 1YBTA 4NOHA 3I5BA 4J91A 4KR0B 1U1LA 1GMWD 1RABB 1XJWB 1OPZA 1PJ7A 2RF2A 4F26A 4WU2A 3NRBA 2AWZA 4CLUA 1SJQA 3CCZA 4LF4J 2C3OA 4OJHA 4ZVUB 4BDPA 4J9LA 1OJ4A 4PXEA 3P8BB 1RAEB 4X4SA 2UXCJ 1O6XA 1N32J 2LQ9A 3C8YA 2V5HG 4FYXB 1UVIA 4RW6B 2A1BA 4XDCA 1AB8A 4QWDA 4DFMA 1H98A 2RQKA 3HHLA 1YI2S 5L8RC 4ZVTB 3OD2A 3DLKB 2R7OA 3MCMA 2XNQA 1PSDA 3OT9A 3TRGA 4DR5F 2IDEA 1JLFA 4FF4A 1FX4A 4HHUA 2YNFA 4ZHRB 1NK7A 3M8ZA 4JI2J 2BJEA 3BN7A 1TAQA 4J9RA 2CJ9A 1DTQB 4Z2XA 4IUFA 2OIHA 1Y5IB 1I1GA 3KLFB 1FTRA 4CNZA 2XSJA 3NCQA 2ZVIA 3AY0A 4LF5J 1NK0A 2P8IA 4ED4A 1N5VA 2MZRA 2RKIB 4ZP6A 4DLEA 3K0JA 5I3UB 2VG5B 3EPIA 4EUVA 4XO0A 4FYYB 3W9HA 2DVIA 5GAGU 3BH7B 2DXEA 1BHNA 5IT4A 3PW5A 4QPTA 2G0JA 4J9VA 3PJXA 2B4OA 1BQNA 4DV7F 4CO0A 1T05A 2IMWP 2JEGA 4N76A 1YWXA 4WKRA 5BR8J 3KLEB 3EM1A 4EBDA 3K59A 2FGCA 5IC6B 2LU1A 3AOCA 2D7SA 3DI6B 4EZ6A 4RNNA 3B4MA 1SC6A 1FF2A 4K2XA 4F0KA 3U27A 1NSAA 2LECA 5M2RA 2VFTA 1S1TA 2BJ1A 3KXDA 3OR2B 1RK8A 4QYRA 4N56A 4GKJJ 2QYCA 4U8YA 3Q0AA 3M8PB 2NZ4A 2XHCA 1Q81T 2VG7B 4QR1A 5IZHA 5F8MA 4QIFA 1ACMB 4ECTA 2DNPA 4A4JA 3SFUA 2MQOA 2ZZTA 1TUGB 4ZP8A 5AE2A 3CD0A 1YRUA 1FCAA 3R7SB 4P72A 3R2CJ 2E5LF 4NRTA 4RU9A 1U24A 2RS8A 2V2QA 3CDWA 1HNZF 3N28A 1RT2B 5LM7E 3TQ1A 2MZTA 5G0RB 2U2FA 5JUMA 5T41A 2D41A 3IFEA 2HK2A 4OLPA 3CC4S 3OJUA 4C4WA 1DARA 2HFZA 1S1VB 4OZLA 1X4FA 1JWWA 4F4AA 3AA9A 2O1PA 3KLIB 2PN6A 2YQ1A 4H4KC 2MPUA 2F4VF 4EU0A 2JEJA 3VZIA 3MUTP 5ETKA 5FLXU 2R7UA 2PA8D 4AE5A 3JSRA 2VOPA 4PXBA 2XTJP 3PW7A 1R0AA 3HMJG 2JNJA 4OJ3A 1OIAA 3J7YU 3I87A 3HP6A 2DBBA 2XMVA 1RBOB 4Y2IA 5KAKA 1FNOA 1O0PA 4ID8A 4RUBA 1SUQA 2WSFC 1M5PC 1NHKL 2D3ZA 4DBQA 3F56A 2CUYA 5KFVA 1ROFA 4UUXA 4DPTA 2QL7B 3VWSA 2XYPB 1N36F 4CO4A 1VQPS 1CBKA 1IR1A 4DU8A 1SC4B 3MOZA 3G4SS 4M1KA 1S4FA 2GGPB 5BYSA 2XY5A 3R7NB 4EO8A 4RJVA 2QA2A 2ZD1B 3CGIA 3MPYA 4U95A 4LQ9A 4WFNQ 4TXSA 1ZOTA 1NK9A 3OLBA 2VV5A 4Q0BB 3EGNA 4K5RA 5HJYA 1ZAWA 3BR8A 2LQ5A 4M5KA 1S1UB 2ZWPA 4J5OA 1JLGB 1FD8A 3OV7A 4I4BA 2MKHA 2FVSA 3CJQA 4ERDA 3QGHA 2WHOA 3X3UA 3GCXP 3T1HJ 1VC5A 2C2DA 3E51A 1QAIA 1RQ0A 2CJQA 2HQ3A 6FD1A 2OD4A 3QT8A 1NRKA 3HSJA 2IYIA 3GE9A 5B09A 2GW8A 1LFPA 4N7TA 1E6VB 2YNIA 2IPOB 4USTA 3UCGA 2DNOA 2DNHA 5E0OA 1O51A 1VRUB 5CYQA 3R5CA 3A8KA 1ZTTA 1D1UA 4WXWA 4H4OB 1N33J 1G2EA 5KFCA 1UFLA 4LR7A 4OHWA 2QRRA 1UEUA 2FY1A 4JI0J 1MWZA 5KOWA 3AD9C 4FYVB 1EIYB 5T7LB 2YX1A 3EXCX 1KSPA 1IM6A 1TK5A 3CT9A 1YX2A 1IXKA 2MSTA 5AE1A 1JLQB 4PXCA 4A47A 3BJYA 4XAKA 5CYMB 1UMJA 5KFJA 2G0CA 5GVQA 1KHVA 4WTOB 2KT3A 4ZPWR 3ZNJ1 3MM5A 4LRAA 1ELOA 2NPIA 4ATNA 1VJQA 1MROA 2XQCA 3IWXA 5IQQA 4CLZA 2QJ3A 4UOFA 4LFCJ 3TR5A 1VQMS 4YDDB 4KFBA 4DR3J 3GG0A 5IM0A 1IKYB 3E8OA 1S48A 3CCJS 2WONB 4DV4F 2HVHA 2DH8A 1FXRA 1D3WA 2OLWA 1VQ8S 1TAUA 4USWA 2BRLA 3VAIA 1OO0B 3IN5A 2KG1A 4YFUA 4J90A 4B3SF 5JVHQ 2NR0A 4W98A 4R0EA 3TP2A 5FJ4A 1HARA 2XBPA 2YKAA 4KE5A 2HVIA 1AROP 4C8LA 2HK3A 1V3ZA 5J2NB 1S0MA 3FMWA 4ZA1A 2JFKA 4Y65A 1IJFB 1X4AA 3I5AA 4KY3A 1H38A 5FDLA 1M5OC 1VQ4S 4U96A 4TY8A 5HATA 3IRWP 3DMJA 4R8UA 2LEBA 2C2ZB 3CJRA 3FFIA 3WIVA 3DRSB 4N77A 2FIUA 1NM2A 1DQ8A 1A7GE 2IA0A 1TMMA 2PA3A 2O3DA 3BS9A 1WHYA 2Z8QA 2LQJA 1FE0A 3PTWA 3SFGA 5GAEI 3MAQA 3N6NA 4B08A 3DLJA 3TOQA 2LVWA 2VBZA 3IRXA 3T5JA 4KO0B 3M2VB 4TQRA 2MQNA 4NZ0A 1U8WA 3QRQA 5DDQC 2KXFA 2DO4A 5HO4A 3MEGB 4DUYJ 1XMQF 5J2PB 2GQCA 3DM2A 2ZE2A 2QT7A 2SXLA 2OEMA 1NAQA 4CO3A 2E9RX 1S76D 1K8AT 4CH1A 2CPYA 4IDKA 5IXUA 1NPPA 2C2NA 4AXJA 2HURA 2AEMA 3H8YA 3GIJA 3EGWB 3ZXWA 1TR0A 4OX9F 2F4FA 3M2UB 3JAMU 4OX6A 4KBIA 4IH7A 4DS5A 3VCDA 1CULA 3W63A 3M1VB 1RU2A 3W5XA 4AXIA 3KK1A 3J7AN 1Y10A 4DN0A 3ADAC 1MNEA 3B4DA 2FLPA 1YRTA 3I5CA 5K14A 3NGKA 2CDRB 2M52A 1RT3A 3WHIA 2R2TA 3VAHA 3I55S 2XMKA 1NB7A 3ZTOA 4LREA 2QLBB 3HPOA 1V5IB 4Z7CA 4LF6J 3KLVA 2OHDA 5D4OA 3ZTQA 8AT1B 4Q45A 1VS3A 2D9PA 3JSYA 2FTRA 1WG5A 1H0HB 2GA7A 5HVHA 4A8WA 1BWVA 1JLCB 3K5PA 2FJAB 4IFYB 3UR3C 3LF0A 1N33F 1RT1B 4OZNA 3R2DJ 4JI0F 1Z4UA 1WD6A 5KFRA 4NLPA 2PT0A 4PCQA 1FDDA 1NB2A 4YMEA 1QVFR 1HR0J 2K2PA 3L09A 1R27B 3FZBA 2HPUA 2GVDA 2YX4A 3PKYA 4DLGA 2EKNA 2YNHB 3OQ2A 1S99A 4ELVA 1OWXA 1N6QB 2HNYA 1RT6A 4PWUA 3ITHA 5F9NA 4HI1A 2V94A 3I0RB 4KHPF 1MW7A 2YWHA 2CPEA 3VTIA 4OJGA 3G6YA 4MH8A 2QA4G 1BQXA 1JXLA 1U48A 1ZYQA 3ILIA 1QD1A 1F9EB 2OH2A 3EVMA 1RWMB 1Y0HA 4TNOA 3C16B 4PYDA 1URRA 5CYJA 3QBCA 3VF0B 2DK2A 1Z2LA 3DRYA 4DPOA 3PYEA 1Y3KA 1VQNS 3DRRA 4RWXA 2M7SA 3HJVA 1VQ7S 1S10A 3M05A 2QGFB 4I56A 2UUAJ 3LWLA 1VBYA 3POTB 3OR1B 2E7XA 2JZ5A 3A1YG 2QYGA 3GFXA 1EQMA 3HXMA 5ETSA 1FKOB 2VFUA 4I68A 4F0HA 5EWFA 2L9NA 3MAHA 4ZVPB 3CD5A 2M2BA 4DSLA 1VR6A 5KFYA 3FCHA 2EXUA 2IBKA 1K44A 2COLA 2KM8B 1S97A 1BMQB 5KFKA 4X4TA 3VV2B 3CCMS 2E5HA 4RW7A 1XIQA 2L9WA 3W64A 1HYSA 2XLJA 5B0EA 3ZFVA 4QU6A 5EGYA 3D0IE 3TAPA 2CQIA 1H2UX 4U7UD 4Q2MA 1KVKA 3C6TB 1BQMA 1ZBTA 2GHVC 2RU3A 3DDNA 1P6TA 3PCOB 3DLLQ 1YJVA 1NDLA 4DV5J 2CQHA 3GCWP 2PMWA 4WYLA 4ANCA 5CAAA 5L1KA 2G13A 1SCJB 2AHOB 3ILOA 2RDDA 3NBPB 4OX7A 4QOTA 2W2MP 1CG2A 4I6WA 1FDBA 2GHPA 4W90B 1XN9A 4DR7F 3MPUB 1U7LA 2VA2A 2J0SD 5HANA 3PR5B 4RU2A 2BW2A 2I8EA 1F3FA 3DLGB 5CH7B 4JI8F 1SQFA 1TKDA 5IV3A 2UU9F 1VQYA
chains in the Genus database with same CATH topology
2HNZB 4I1TA 3W2WB 1AFJA 1C1CB 3QYYA 3OPKA 4CI0B 2QSFA 2ZVSA 2DRBA 4ZPDA 2MKKA 1SJ1A 2APOA 5E3PA 3AA8A 1IBKF 3NLCA 1SJRA 4QW9A 4XK8C 4RW4A 2YKOA 5DQGA 1T3OA 4PG7A 2DCLA 3N79A 1JLBA 3NG8A 2FLOA 1TFYA 2RQMA 3IGNA 2KT2A 5A2QY 1KQSR 2FHJD 4I6YA 1U25A 2VPZB 3WBZA 3H5XA 3OTDA 1S6OA 1U2RA 3MM9A 2BANB 4UOCA 5D78A 3H4DA 1GTEA 5H9FJ 2AP6A 2ATLA 3QZ8A 1IN0A 4OI1A 1Q8LA 4GKJF 3AB2B 4RNHA 3PFEA 2E66A 1PC5A 2CG4A 2WCXA 1YJUA 2WK4A 3H2UB 1NKEA 1NJXA 1IBLF 1AFIA 2WSCC 2EFVA 2RDIA 1X7VA 5J2QA 1X9MA 3RB0A 3UFCX 2JEFA 1TV6A 3DRSA 3MM6B 4ZPBA 3KHRA 4QU7A 4X4UA 3TVYA 3HHDA 1GQEA 1VOMA 4ID5B 4Y2MA 1U45A 1YJTA 3RRHA 3W2VB 3T5KA 2AJFE 3DU6A 2KFZA 4ES3A 1S72S 3SCKE 4LSNB 5L9NA 3FSYA 4LMZA 4RW8A 3UCZP 2QMWA 4ZPAA 3IXQA 3WC0A 4C97A 3KHHA 1YJ9S 2ABYA 3JSMA 3V6KA 1FE4A 4MK9A 2FHKA 2KRBA 2YNGB 2J6TA 1HWJA 2KXNB 1WELA 4I69A 2LEAA 1R8BA 3MR5A 4ECWA 3I4HX 4FF2A 3GYXB 2WSEC 3D1QA 4Y2CA 1N54B 2UUCF 1DJ0A 1KEKA 3OUYA 5BYRA 2KB2A 3LANA 2J9CA 2E5GA 5C42A 2XY7A 1GXUA 2B9WA 1TVRB 2FJBB 2KU7A 4RW4B 5HROB 2DO0A 1QUVA 2FC8A 4ED1A 3R5BA 4O23A 1RI7A 3GQCA 5G4DA 1R3NA 4K4SA 1F60B 4ILRA 2YKPA 4OI3A 2A2DA 3OJSA 1JNZB 3M2VA 2Q66A 4C8MA 4X4VA 5D77A 2DGTA 2BACA 4IO9Q 2HMIB 3MEEA 4QR2A 3THPA 2BABA 3CCLS 4QWAA 4WK3A 3DLEA 3TANA 4ZOSA 3BO4A 3VAFA 2PO4A 3AJ1A 2P9CA 2B43A 3EGZA 2ACYA 3T9ZA 3T9NA 4IOBA 5LMNF 2EG1A 2UVVA 1TV6B 2IVYA 2PMZD 5E7OB 1Y00A 2N3LA 2GX8A 3M8QB 1RKIA 1LK7A 1VK3A 2E7WA 1C0UB 4G1PA 1IKXB 4DV0F 2MXYA 3SZ2A 1Q4RA 1S1XA 4C3LA 2BM1A 2VA3A 4RW8B 2GQ2A 1XNQF 1KN6A 3TAMA 2D3OR 1G6BA 3VAKA 1X9WA 1N48A 4DX8H 4IG0A 4LIRA 3JSMB 1U1RA 2DHSA 4OLOA 2ZZNA 1OQ6A 2MSSA 2NSCA 2C3YA 3HDSA 3HVWA 4HI2A 2CQCA 3CVKA 4OHVA 4ETZA 3CCRS 3NAHA 2JSXA 5C25A 3S8SA 5D8HB 3ZZYA 1LW2A 1QJHA 2IM2A 3OUYB 2BA9A 2DB1A 3R3TA 5C42B 3M6XA 2KHDA 1FT8A 1RP5A 2F8HA 1VJWA 5DO2A 1S9FA 2NREA 3OXLA 2UV8G 3KYLA 1FNXH 3OFHA 2ZFHA 5IFMA 3OL8A 4RKUC 4HEA9 4DL6A 3MMCA 1QE1B 5KFLA 3BEGB 1REVB 1RDRA 4X4PA 5A8RB 3V6JA 3MMAA 3KJVA 4KIAA 3ULHA 4ZKAA 2XS2A 3CCUS 3QAEA 3RW7A 4ALZA 4MYTA 2ADBA 3G6ES 3M2UA 3QJJA 5LSLA 4RNOA 1SV5A 5HMZA 3N5BA 1TKTA 1FDNA 2MZSA 3RRKA 3QAUA 3EYZA 4UW2A 2CJKA 3V4IA 3BGLA 3HHLB 2W9BA 4BBYA 2EPIA 4KHRA 5B0DA 2B4PA 3QGGA 1KQKA 3IS9A 3GFHA 1ZH5A 3MZIA 4Y6IA 1H2TZ 4K4UA 1RA6A 1IKVB 3OVBA 1S1XB 2DIVA 3OL7A 1RTHA 2HGMA 2JLEA 5KFFA 4OI6A 4KJIA 4F4KA 1AW0A 4ZCKA 3G6XA 2HGLA 2RS2A 3U02A 5DG7A 1Z1ZA 4DQPA 2I0XA 4YY3F 1S1WB 4C8NA 2UXBF 2K8GA 2OP5A 1X8DA 3M1VA 2F9JA 3T19A 3JTPA 2GC8A 3BGFA 3M30A 1JLFB 1FK9A 1Q1KA 2B0GA 3N6LA 3QZ7A 3BSOA 2FLLA 4WFBQ 2HIQA 4FYDA 3AQPA 5L38A 4TLQA 2PIIA 5KG1A 5GADI 2YNFB 4EGLA 2W9CA 3NL0A 4FVMA 1AXQA 2NYIA 4F4YA 2X51A 2RILA 3R1LA 2J0QD 5A6WA 4F50A 4DR4F 5F3TA 3MM7A 2DH7A 3MMAB 4Y28C 4I2PA 3J81Y 4BWMA 2BV3A 3KJVB 1UA0A 2LKZA 2XI2A 4USJC 3KNGA 4B9SA 1XMBA 4C9DA 1RA7A 3QJPA 2A10A 1SV5B 5F0UA 1C2PA 4LSLA 1TKTB 3GMGA 3MI7X 3O1LA 3R1HA 3MDFA 2W9BB 2DHAA 3OBIA 3UPFA 1U2FA 3Q23A 4C0BA 5KFOA 3IS9B 3FSXA 4NXNF 2J9DA 2O5DA 3NCPA 4WKYA 1I94F 4QBUA 2XSJB 4MKBA 1RTHB 3TUIC 1CQNA 1M90T 1F5AA 1CC8A 3H5YA 5HQ8A 2BXJA 2DHGA 2DR8A 1V3SA 3HVTA 3T1YF 4OHXA 4OJ1A 3ENVA 3T6BA 2CQ1A 4ED8A 4LIWA 3CJ5A 1P9QC 4C3MA 3LW5C 1UWBA 4ETXA 3M30B 1KOOA 2IAJA 1FK9B 2CJBA 1X5OA 3UI3A 5A6PA 5I42A 3PRDA 2VD3A 2JHEA 4IG3B 1HBOA 1URNA 4DQIA 1TK8A 3B78A 1DURA 3LAKA 1RT4B 2PMHA 4URSA 3NNAA 3DOKA 2ZJPQ 4LF7F 2YH1A 3BR9A 2JRSA 3MM7B 2PSZA 3KLGA 4RX6A 4WZQA 2W7PA 2GQQA 4I2PB 2LXFA 3VQSA 3K5LA 4DN9A 2CPHA 2J9EA 1WF0A 3FNNA 1F5CA 4GMKA 5I3QA 5IQ6A 5DJBA 5DG9A 4RBVA 1JLCA 1LK5A 2EWHA 3K8WA 4ZP9A 1N88A 4NLWA 3Q2TC 2YQ3A 3MF5A 5H9EJ 1XNRF 2ALZA 3MGJA 4KQZA 4LSLB 4TN2A 3H40A 2ZH3A 5KT2A 4D3HA 3HM9A 1T05B 4NA2A 3QO9A 4X65F 4JI5F 1J2VA 4ECXA 1U49A 1QY7A 4IOAQ 1RT1A 1WHVA 2CQBA 2FB0A 4JBCA 2XS5A 2LQBA 3SSSA 5L9XA 1D9FA 2ZHAA 4C3KA 3T1HF 2V8DA 2C28A 4YB1P 3G9CA 2HHTA 4DQSA 2W8KA 4ECZA 4ZVGA 2VQFF 1G3OA 2FDNA 3RR7A 1NKCA 1IKWA 3BN4A 3HVTB 2CRLA 1F9FA 1S9EA 2EC0A 2Z0GA 4DR2F 1LXJA 2CQ2A 2I9SA 3UD3P 5B0FA 4FXVA 3H5SA 2X1AA 3MD3A 3DXSX 3N01A 4A8FA 1DLOB 1UWBB 2CYYA 5HMWA 2IAJB 2Z4PA 3BQ1A 3DRXA 3H2LA 3MR3A 2R2SA 5I42B 2M3DA 2W25A 3LGMA 1FJGF 4PPDA 2Z2LA 1K1QA 2AJ1A 3DOKB 2OAUA 5DLFA 3N5FA 3ENQA 4OQJA 1DRZA 3N6MA 4PUOA 4I0WA 2YKQA 3PXGa 1EETA 1JNRB 4P6QA 4WE1A 1U1QA 2YNHA 2R8GA 4NXMF 2HHXA 1H3DA 4FBTA 1YJRA 2ZZMA 4RNMA 2R7SA 1SKWA 2ZKTA 4QWEA 3RBDA 3KFWX 4F3OA 4K4WA 1N6QA 3J7Z5 2DGOA 3FJ2A 4K0KF 2WB1D 3DNCA 2Q79A 1VLYA 1X4EA 1KHWA 1J5EF 1YTYA 2VPWB 4F02A 2WBRA 2KG0A 2DRAA 4O3SA 4OL8A 3UDCA 1Y5LB 2M5YA 2MHEA 1XERA 2VODA 3OHBA 3HVAA 3MR6A 5T14A 4OI2A 1WACA 2DGSA 3CTRA 2V0NA 1RTIA 4OIXA 1KOHA 4I2QB 3SSQA 3PV8A 1IKWB 2GCFA 5C24A 1FHTA 1FEHA 1S0OA 4O3RA 1S9EB 1SQEA 2F9DA 2GJIA 2KN4A 3EPGA 1LV5A 2W4DA 1K9MT 3LH2S 4KGMA 3T6JA 1UP1A 2B9XA 2FLNA 2KYZA 3PZPA 2V8HA 4DQRA 5LL6d 4F3QA 3H20A 4LQ3A 2KVIA 4DFJA 1V9OA 2HG4A 3G96A 1ZM9A 3HHLC 3MEKA 5B08A 2QLXA 4KC5A 4AFFA 1U1OA 1VGYA 1DZ5A 4G1QA 1M5HA 1QSYA 2BZ2A 2JFDA 1FRIA 4HTJA 4QYZJ 5J2MA 5F8IA 3MFIA 1RT7A 2CQGA 2LA6A 3GG1A 1JJ2R 1EETB 1XK8A 2H9ZA 4K4XA 5I4MA 4XPCA 2J5AA 3M9NB 1R6YA 2IM0A 3P49B 1SL0A 3IWNC 2L3MA 3NCRA 4O4GA 4YP3A 3RB4A 2R7QA 4NLUA 2RRNA 2OPRB 1O8BA 2DGWA 3PACA 2YKNB 5CZVA 3ZZUA 5L1IA 2KJVA 4A8XA 5K8MA 1YRXA 3DOLB 4I64A 1T94A 3CJ4A 1S9GA 1U6ZA 4I6AA 2MQQA 1WTBA 5ADZA 2AX0A 5KFZA 2KO1A 3TA0A 2RU9A 4RW9A 3DU5A 1QAJA 1IQTA 2VG6A 1PO6A 3LOUA 2CPIA 3SQGA 3TA2A 5J1PA 5HMYA 4LFCF 1RTIB 4FZVA 1X4DA 2ZOMA 3POTA 5C24B 3EX7B 4DR3F 3AH6A 3OR1A 1XR5A 2ZDOA 4DUZF 3C6UA 2PGCA 2AW0A 2J7UA 2XLKA 2R7WA 4EBEA 4OHZA 3IAM9 3UCUP 1VC6A 2R7RA 3RZAA 4RBUA 4CT8A 3PR4A 1HNVB 1EP4A 4LFAF 3G86A 5GAHI 2HLUA 1IQZA 3MTJA 3M32A 2DIUA 4KB7A 1X0FA 3CF5Q 1ZM4A 1M0SA 4IFVB 1YIJS 1L3KA 4OZ1A 3J7A1 4Z37A 2FUG9 2KKHA 4G1IA 4P7VA 5D3GB 5EX0A 1P1TA 2BRKA 3K57A 4DHVA 3RYLA 1X0PA 5J2MB 1UJ5A 1RT7B 2K1RA 4KT0C 3GIIA 2F8MA 5AJ3F 1NU4A 3KLHA 3KWMA 4XDDA 2UZAA 2G4BA 2DGXA 2ZOFA 4ZVHA 4BC7A 3CD6S 4KKOA 2R8HA 2P5VA 2O67A 4DSFA 2DJWA 4FXDA 3SCIE 1VIOA 1VI7A 1HBUA 3PHEA 1HMVA 1X4GA 2ZH5A 3CJ2A 4MKAA 2XMUA 1JIHA 1SXLA 4CO5A 4DL2A 2Y1IA 2GMLA 2AGQA 1T8EA 2FVRA 5LJ3Y 1KFDA 4ITSA 1S9GB 3NNHA 1H7WA 4CO2A 1RAJA 3NGDA 4B9VA 4RW9B 5CA5A 3MFHA 3LWMA 1SKRA 1P1LA 3IBWA 1W2BR 5AXNA 4CIOA 5GMKa 2V9WA 1KR4A 2V9KA 1SIWB 4WU3A 4Q43A 3AB4B 2L48A 4K50A 2VKRA 1MSWD 2MMYA 5DM6Q 1R0AB 2N7CA 3PW2A 2EKYA 4TY9A 2ASDA 1JK9B 5B0GA 4CQ1A 1JKHA 1LFWA 4Q5VA 3K5NA 2IRUA 1EP4B 4QCLA 3MXHP 4DV1F 1Q7YT 3EXYA 3F73A 1B0VA 2KRRA 1Q16B 3C6TA 2DD8S 2PEHA 2DR7A 2IBOA 2QSWA 1HFEL 1SUQB 2KJWA 1VMBA 1UVKA 1D8YA 1UVJA 3OW2R 4WFYA 4M94A 2BUNA 2VASA 3KLHB 2VFRA 5D6GA 2V4RA 4HT5A 1TZ0A 4WFAQ 3MTKA 2EFNA 4KKOB 3LP2A 3O3LA 4WTYA 1OS5A 2ZHBA 1HBUB 1HMVB 1WEZA 5H1SV 1FXDA 4ELTA 2LCWA 3T1AA 1QUPA 4IYQA 1TK0A 3GIKA 2FJWA 4F2RA 3KHGA 2X3GA 4JI3F 3NBPA 1WHWA 5D4LA 4A8QA 4U7UK 4L72B 2DPIA 4H54A 3I82A 1HNXF 5KFXA 1FDAA 2B6AB 2NPFA 1U47A 2RT3A 2QA1A 2VPYB 2ROEA 4X4NA 1MMLA 2MY7A 1R43A 1SIZA 2V2KA 5E33A 2XO7A 3G71S 3OTEA 5DETA 1JJ4A 1WNEA 1Q7LB 5CCLA 4HDGA 4C2MA 4IKAA 2DNLA 3MM8A 1KC8T 1DBDA