2RP4A

Solution structure of the oligomerization domain in dmp53
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
71
Chain Sequence
DDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGMIKEAAAEVLRNPNQENLRRHANKLLSLKKRAYELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor p53
publication title Structural evolution of C-terminal domains in the p53 family
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 20
structure length 71
sequence length 71
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11619 P53_C Transcription factor P53 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.680 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2rp4A00
2RP4A
chains in the Genus database with same CATH superfamily
2XZEA 4QHOA 4IE0A 4Q25A 2DNXA 4DR7T 4TV8E 4UV8B 1HG5A 2A72A 4AKRB 3ZMSB 4IGUA 4DV2T 2XUEA 5LG3A 2H3RA 1HCIA 4JYAT 2MTQA 1Z0PA 2C5JA 5JDNA 3ANWB 3Q5EA 4IHJE 5F3JA 4H63V 2W2UA 3R84B 1SHZC 5C2TA 1QLBA 5AQQB 4UR9A 5CA1E 3OYXA 3IF8B 3N2GE 3PU3A 3OKQA 4IDOA 2BS2A 5LGNB 2ES0A 3Q2MA 5HXCA 5EK2A 3VRBA 3LSVA 3CQXC 4OX9T 1BR4A 3EAMA 4OK0A 2X51A 5JRCB 2DCFA 1HG2A 2HN1A 4HWDA 4MHCA 3CIRA 5AQUB 3RYCE 1HNZT 5IUXA 4PW8A 2YDQA 2WS3A 2YEVC 3BQKA 4HKAA 3I0QA 4LF9T 4LF4T 4AXPA 2NW9A 4DR2T 1UX5A 3LK2B 2Y6XA 2Q9QA 4CI2B 4GK0E 3ZPOA 2ACXA 1UURA 1D0XA 4IREA 4P09A 3FBLA 5HXRA 4JI8T 4AKIA 5CJ5A 2CLYB 4HFIA 5JR9B 3AEEA 5J2TE 4B3TT 1T8BA 3UQ4A 4JV5T 4PFPA 1US7B 1LRZA 3K3OA 2X0LB 2IAKA 4EGWA 2UUCT 4LF7T 1ZOYA 3R6NA 4PNIA 4FJOA 2LEHA 2WWUA 2XJ7A 4U2YA 1HR0T 2XQ4A 1Z8UA 4ZZBA 3KVAA 3IEEA 2H88A 2ZMAA 4B6XA 1MMNA 5HCMA 4AQYT 1T7SA 4ZI3C 3OTOT 2CRBA 2JQQA 4YHHT 4X20E 3ZCIA 3BK9A 4NXMT 1E7PA 1SUMB 2X9HA 4TV9E 2WDQA 4TN7B 2LE8A 4EYUA 1W09A 3LBXB 4QX8B 3VU7H 3Q5XA 3AE9A 3JCFA 4PJNA 3QOFA 3JAFA 5EZYE 3UU5A 3AE5A 4ANJA 4U33A 3O1IA 1J5ET 1MNEA 3AEDA 3VRAA 2K3WA 1HNXT 2EHOA 2FBWA 2Y48B 2H7VC 3EDVA 4KI0F 2R6GF 5LYJE 1HNWT 3MK7C 1S35A 4UELA 1WLXA 1YW0A 3DP7A 5L4EA 3AA1B 2WDRA 4HWFA 4GIWA 2XQ3A 4J2CA 2NR4A 2OLTA 3AE6A 4ZS3A 5L3EB 1JNRA 2PTFA 2N9DA 5FY7A 1MNDA 2W61A 1T98A 3UQ7A 3FHNA 3CQCB 2JMKA 3ANWA 2BZBA 4XBFB 3H3MA 4XZCA 4U2ZA 2FJBA 3LG7A 3K3QC 3RGLA 3VHLA 3UU4A 2KWHA 2BKNA 3EI0A 3ZYKA 2MAWA 3QB5A 2CBJA 3KV4A 5ETWA 5AQLB 5FXXA 1U5PA 4JI6T 3PE0A 2V7LA 3C4WA 4CZZB 3Q5DA 3AAIA 3CX6B 5A1LA 1LKXA 2IMLA 4PFOA 2G0UA 2WP9A 4PJLA 5LBQB 2JRKA 5TAOA 4WYVA 4YT0A 3AEBA 4JI0T 5JRCA 2VL0A 4YJ2E 5BR8T 3ZMTB 5FYMA 2CXFA 2YKSA 2WB5A 3SFEA 1YQ4A 1WYCA 3VR8A 2PJQA 2Y8DA 3SFDA 4WW0A 4ZEYA 5HWYA 2I6HA 2JQHA 2YN6A 3HKCE 4AQFA 5KDMC 2XQAA 3JAEA 5JDGA 3L3PA 3FZLB 3ZSSA 4EYYR 3RIUC 2H89A 3EHZA 2BKOA 1W0AA 5JR9A 2D5UA 1WR6A 3Q5WA 5ABFA 3F57A 4H9OC 2E9XC 2NWBA 4COFA 2DLRA 4LF5T 3SWHA 4JEUB 2LOSA 1OWAA 1YD8G 4H9PC 2LSIA 3RQUA 5DQWA 5ABHA 2BDEA 2FJAA 4JI7T 3L39A 2ZM6T 4CN6A 2E9XD 2XPKA 1E2AA 1IJ5A 3M3ZB 3AB3B 5L2LA 2DHRA 2UUBT 4P0AA 3E08A 2HN2A 5AQJB 3SRZA 4BJMA 2KZ7B 3LBXA 3WAKA 2UUAT 2BVMA 2XTLA 2QRXA 1OEDC 2K5BB 3CX8B 5AQMB 2XM2A 1UK5A 3QC9A 4AQGA 3NWIA 4ZXLA 1MIYA 4UXNB 1QUUA 2C0SA 3PUGA 3AA0B 2OA5A 3OYZA 5HEUA 3N2OA 4ZS2A 4DV5T 4Z8XA 3HL6A 3CK6A 3PUVF 1LVKA 3P4WA 3ZC1A 5JDHA 1XNQT 2MYSA 2RA1A 3EUHA 4YY3T 4DV1T 5AQKB 4CI3B 5LGTB 2CHNA 3A8YC 1Y01A 3G06A 4X5TA 1WCRA 3ESLA 5AQOB 5FKYA 4DVDA 4JLEA 1MMGA 2D9DA 2A2FX 1M62A 5J0ZA 2WMOA 3PUXF 1HTJF 1XDPA 2BBJA 4ZHQE 3AXJA 5AQSB 4DV0T 4E7ZA 2K24A 4AKHA 5AQIB 4TWDA 3P7IA 5ADXL 2WMNA 3K1SA 4KMCA 3NVOA 1YQ3A 3ZC0A 3I1AA 3FB2A 4QXBB 5IWAT 4U72A 4HWIB 2IC9A 2K48A 2VQFT 5FVKA 1VRBA 5J1GA 3RYHE 3IHRA 1O3XA 2HHHT 4NUUA 3KBTA 4DBQA 3N9MA 2J1DG 3C64A 5L47A 1SE7A 4ISTA 4DO0A 4JBWF 4KP3C 1DU2A 2YINA 4EIWA 4G2AA 3UUNA 3N2KE 3GMIA 1HF8A 4O2AE 3BQIA 2WU2A 4IL4A 1KNRA 2JQKA 4TWFA 5FY0A 5CB4E 5LBMA 5CA0E 4L9IA 4UEMA 4EEBA 1FMVA 5EK4A 2F4VT 4TWHA 5JDMA 5HEOA 4F6RC 4X1KE 2LT3A 1D0YA 5LHGB 4KUMB 1I94T 3N9LA 3AEFA 1JNZA 2V1DB 4ILCA 3PU8A 3I9WA 2IC6A 3AAEB 2P9BA 3PUZF 4ISSA 1OEDE 1XNRT 3P4PA 4ASKA 4TNVA 4XAXB 3UTKA 3RKOA 2IUBA 1FIOA 3JC6C 3ETVA 2WM9A 4DR5T 4YTNA 3NRXA 2L3LA 2DI4A 4HWCA 4U31A 3ZN0B 4DR6T 3TLUA 4QH5A 3PUSA 2LSYA 3ZT5A 3K3NA 3JC6D 4U7IA 3T8OA 3ZYLA 1NEKA 3KV5A 2XQ5A 4MLKA 4DR4T 5ABFB 3NZPA 4UIGA 4QWNB 4H9RC 3J7Yq 1IZNB 4YTMA 3GWHA 3S4UA 5AQGB 5LGUB 3Q9DA 2LSJA 3X1DA 1XMOT 1NAFA 2V6YB 2MOZA 2CA5A 4KX6A 2V7JA 2VL8A 1BR2A 3RYFE 4JI2T 2UXDT 2BG9B 4YHJA 1Y64B 4ERRA 3CKDA 4PK4A 5LB7B 5AQNB 4H63H 4X65T 3PUWF 3CPZA 3AE7A 2VVSA 5LA6E 4ZI3D 2ZM0A 1N33T 3M65A 5CGMA 2XSBA 4CI1B 4AKGA 3RLFF 4BJNA 4YLHA 3ONLC 1BR0A 3QNUA 5JH7E 4YTPA 4NIQA 4DIDB 3RIFA 4C91A 2WDVA 3WAJA 5HXSA 1IBMT 1M7KA 5AQHB 4ZZCA 4HTEA 5E0OA 2YU1A 2QYWA 3KDSE 2WZHA 5JVDE 2ODVA 2JJ9A 2W66A 2KINB 3EDUA 2W0GA 4MBQA 3I9YA 2D0TA 3SOLA 4IDZA 1U4QA 5HXEA 4AI6A 2QGSA 1XMQT 2J62A 2MBGA 4IE4A 2IDOB 2E5LT 2NTYA 5JDLA 3AXJB 3TLTA 1GQEA 3LK42 5H6RB 2CWOA 2LSKA 1KF6A 3LDQB 1G73A 2BS4A 3PURA 3RHWA 3WI3A 2VKHA 4TX5A 2A9UA 2KNDA 2UXCT 1MIWA 4A97A 3N9NA 5IYZE 2WSSV 3TLVA 3PDYA 3KBUA 3T1HT 4LFAT 2J47A 5ABGA 3SS1A 1KFYA 2MPKA 3ZCJA 4MFRA 3HI2A 2V7IA 3QK6A 1EZ3A 2X66A 3CMLA 5JREA 5LG4A 2L9QA 2XAGB 4NUVA 3AE3A 4EZHA 4DNDA 4UV9B 2XM1A 4PAGA 4QKNA 3AAAB 2NOXA 5JTGA 3FBZA 1QSDA 3UULA 3ZMUB 1KNPA 4LFCT 2KLQA 2PBIA 4HE8A 2V8SV 4H9SE 4O4JE 5HEGA 2YK0A 3EABA 3EVYA 3AEAA 3GA8A 3N9PA 1WR0A 3V5UA 2N1GA 1J5WA 3QUJA 5L3FB 2ODUA 3IBPA 4QXCB 5CFBA 1D1AA 3C4XA 2KMFA 2XHEB 2WAUA 2ZLYA 5HEHA 2VKDA 5HYAA 3A5XA 3P50A 2V6YA 5LMUT 2VASA 2Q9QC 5FY1A 2FJEA 1VOMA 2JIWA 5LHHB 2LJLA 3H3AA 1R8IA 4KHPT 2K9AA 2RPAA 2BG9A 1FMWA 2CBIA 3ZJ2A 4LMLA 2Q9QD 4UF0B 3JADA 4I4TE 2C5KT 4HEAA 4X64T 2OV9A 3FZFB 2E9XB 2HPLA 2X9XA 3ZKRA 2ACZA 4B3MT 4EZ4A 1ZV4X 3NBXX 5KXJA 4I43B 2WQYA 3P8CD 2D2SA 3PUQA 2VVNA 5M4YA 2CPTA 1YXRA 3ZN1B 2L8KA 3FZMB 4CN4A 3N9QA 5AQRB 3T1YT 1SA0E 4HFEA 2LRKA 3KINB 3DJBA 3QB5K 2EHOC 4GKJT 5FXVA 4EV6A 1W9RA 3F31A 2FUPA 2XQYA 2UXNB 4PK6A 3FZKB 3PUYF 2RP4A 3RQWA 4WBNE 1KK7A 1HS7A 3L09A 3V5SA 5IHYA 3PJAJ 2LLYA 2XAFB 3ZEFB 4BAYB 2YDRA 3AVSA 3UUBA 4CXWA 2NW8A 3AE1A 3RRWA 1N34T 3FXDB 2XQ7A 3O4XE 2EHOD 1J1JA 2UXBT 1IJ6A 1CHUA 3H37A 4H9NC 4P0BA 4PJMA 5LOVE 3KVBA 4JI4T 4EOZB 5FMNA 4KHZF 3MACA 3RC8A 2M6IA 1V9DA 2IIUA 4K0KT 2XQ9A 3FXEB 4O4LE 2XAJB 3RIAA 1VCTA 4DBRA 5EK3A 3U3IA 3MA9A 3HA4A 4GYSA 4DUYT 5C3JA 5FXWA 5GONE 4CXXA 2CE7A 2JPFA 4H9QC 1NENA 2XAQB 1B7TA 1XZYA 4IDQA 2V5CA 4I50E 1T72A 5FNVE 3P4QA 3LJCA 3AA7B 4LMKA 5LMNT 1HX1B 2LRLA 3ZJ1A 5ABEA 1KNZA 2JQ9A 3D0TA 2WWVA 5LNKA 2X67A 1XWMA 4HFVA 1IBLT 4IDPA 2LHNA 2PFVA 2LHRA 2CM0A 5LXTE 3NZQA 3UFEA 4CXYA 2LSGA 4U74A 4AQFC 2W00A 5C8YE 5HWXA 2XASB 5L3CB 4JI3T 2LM2A 4WZXA 2B1EA 3B5MA 4ILAA 2CLYC 5JR9C 3GN5A 5L4HA 1UCUA 2IHR1 1S94A 4UVBB 5HCJA 4CN1A 4GK5E 4JI5T 2Z6EA 3RIUA 3MZKB 3PTRB 4UF0A 3FZHB 5H6QB 5HEJA 3MJXA 5AQFB 2UXXB 2E9XA 2XY8B 3MXZA 3HKDE 3O1HA 1D0ZA 4DMVA 2CEAA 2IW5B 2ZM2A 3K8PC 1X79A 4ADZA 2BG9C 4LMJA 4ILBA 1ZEEA 3AECA 2M67A 3KFWX 4YSYA 2E8IA 3ETUA 4PJJA 2FJDA 2WU5A 3KV6A 3J9X1 4DR3T 2W4XA 4TNWA 2BKPA 3NKZA 4O8SA 3OVUA 3ABVA 2WY2A 2W63A 3RF1A 4G63A 3DTOA 5FL0A 5FL1A 4ZI2C 2LM9A 4QX7B 1I6ZA 1ZKEA 2BBHA 3ZT6A 1OEDA 1W0BA 3I0OA 5JQGE 3UUMA 2WZIA 1N32T 4QH1A 2ZM8A 4YFSA 1CUNA 3ZT7A 1N36T 4OFZA 4GOUA 4X1IE 2XAHB 3P4SA 5HXHA 4JUYA 3W15B 2CHOA 2QA7A 4EEDA 4YXDA 2M6BA 4ZI2D 2KSRA 2DL1A 3UU3A 4IL9A 4X62T 2LOPA 3E22E 2X68A 3C50A 1YKEB 2VKJA 3C4ZA 2CXDA 3UU8A 4UVAB 2I0MA 3O9XA 2AXDS 4U7YA 3ZSTA 3PJAA 3RKGA 4IE5A 3HKEE 2YU2A 2I59A 4LFBT 2PG8A 3LFMA 5FVLA 3ZMVB 2QVAA 5FXZA 1X9BA 2W62A 3C98B 2BVLA 1G8XA 5DJQC 2H7OA 3L8RA 4I55E 4AIUA 4U3CA 4K0UA 1YKHB 2XQ8A 4E7SA 5LHIB 3UFGA 3ONXA 2VQET 4DMWA 2VK9A 2HPJA 2NP9A 1HFAA 2VURA 1VCSA 2E2AA 4O2BE 4V1Av 4A56A 3NRYA 5KX5E 3B57A 2VWAA 4WNKA 4TUYE 4B3RT 1L0VA 4FI5A 2X9YA 1OXZA 3TLWA 2DWKA 3HR0A 4KBMB 4O4HE 4A98A 4IIJE 4ZOLE 4DV4T 3CWZB 2BG9E 2X9WA 4Z91A 1LVFA 3RX6A 4C90A 2KWIB 3PUAA 3UUXB 4HFDA 1AJ3A 4HGAA 1XDOA 3A7MA 3LK3B 2LKHA 5AQTB 4TZ4C 5AFUL 5JDQA 3RC3A 1WRDA 4ZI7E 3MKDA 3B13A 2W67A 2V5DA 4UVCB 1UGOA 2A3DA 4B3ST 4F8HA 4NPPA 2AE9A 2V7KA 5F8PA 1ZHCA 2UU9T 1IBKT 5L3BB 3ONJA 4HN9A 4EAHA 1HX8A 2V26A 5LJMA 2VKOA 4EB6E 3U78A 2D0UA 4MALA 4I0UA 4Z90A 4DUZT 5L3GB 4LF8T 4HFHA 3ZLIA 4IT4A 4WBOA 4GKKT 4GYRA 3OJAA 4OYKA 1BR1A 1MMDA 2VB6A 3AEGA 4IDNA 3P4RA 3PV0F 3GN5B 2NTXA 4LF6T 3RYIE 5HAXA 2J4GA 3RI5A 2NW7A 3OBVE 3IA3A 3E0ZA 2KXPB 1MIVA 4X66T 3VKGA 5LCYA 3VKHA 5J2UE 2XQ6A 4NXNT 3AVRA 4A5XA 4OHFA 3N9OA 1WYBA 1ZP0A 3AA6B 2Q9QB 3AE2A 4DV3T 3RH3A 1WFDA 4N78D 3TLSA 4IE6A 4DV6T 1FJGT 4AISA 2YDSA 4X1YE 2CWYA 2BS3A 4OYJA 2X0HA 4JEHB 2B76A 5AQPB 3CVRA 1KEYA 3UU6A 3HKBE 2V6XA 1OEDB 5LJNA 4L0RA 2JMHA 3VR9A 3O1JA 1D1CA 2C5IT 3C51A 5F5WA 4ILUA 5AQVB 4AKLA 4P1NA 4YJ3E 2CCQA 4HFCA 3UT5E 2V7MA 1NWMX 3RRCA 1UUSA 3AE8A 5L3DB 2X0YA 3ZYMA 2CXLA 5FP3A 4HWHA 2LKGA 3RPUA 2XSAA 2CMRA 5DQVA 2WCAA 2DWGA 2E5VA 1FEWA 3N5LA 3OPCA 2YOEA 5DABA 5KMGP 4DV7T 4DR1T 4O4IE 5BMVE 4HFBA 4QXHB 2HH7A 2WBLA 3CQGB 1H7CA 3BQLA 4IE7A 1D1BA 3F2EA 4EXTA 2EHOB 4PK5A 3CX7B 4CQIA 4JI1T 4L5GA 3AE4A 2N2NA 5LP6E 1IAPA 1UX4A 4BA9A 4YSXA 2KT9A 1E1HB 4M1PA 3KV9A 1MMAA 4YSZA 4QH4A 3ZMZB 5JDFA 2SPCA 2GK9A 3TKLB
chains in the Genus database with same CATH topology
3CX8B 2WSSV 3PDYA 3KBUA 4QHOA 4IE0A 4ZI2C 2DNXA 2LM9A 3QC9A 4QX7B 1ZKEA 4TV8E 4UV8B 1HG5A 3SS1A 4AQGA 2A72A 4AKRB 3I0OA 3ZCJA 3ZMSB 4IGUA 4MFRA 1MIYA 3HI2A 2V7IA 5JQGE 3UUMA 3QK6A 2XUEA 4UXNB 1QUUA 2C0SA 1EZ3A 1HCIA 2H3RA 2MTQA 3PUGA 3AA0B 2X66A 1Z0PA 2C5JA 2OA5A 2ZM8A 3ANWB 3CMLA 4YFSA 5JDNA 5LG4A 5JREA 1CUNA 3OYZA 4IHJE 2L9QA 4OFZA 4GOUA 4X1IE 5F3JA 2XAGB 2XAHB 3N2OA 4ZS2A 4NUVA 5HXHA 4H63V 4EZHA 4DNDA 4JUYA 4UV9B 4Z8XA 3W15B 2QA7A 4PAGA 4QKNA 3HL6A 3R84B 1SHZC 1LVKA 3AAAB 2NOXA 3ZC1A 5JDHA 3FBZA 4ZI2D 1QSDA 5CA1E 2MYSA 3UULA 3OYXA 3ZMUB 2RA1A 3EUHA 3IF8B 2LOPA 3E22E 3N2GE 3PU3A 4CI3B 5LGTB 2X68A 2KLQA 3ESLA 4DVDA 2PBIA 3OKQA 4JLEA 3C50A 1MMGA 5LGNB 2A2FX 2ES0A 4HE8A 1YKEB 2VKJA 3C4ZA 2CXDA 3Q2MA 4UVAB 4H9SE 2WMOA 4O4JE 3O9XA 2YK0A 5HXCA 1HTJF 5EK2A 3EVYA 3GA8A 4IE5A 4ZHQE 3HKEE 3N9PA 3V5UA 2N1GA 3CQXC 1BR4A 4E7ZA 3QUJA 4OK0A 2YU2A 2I59A 2K24A 2X51A 4AKHA 5L3FB 5JRCB 2PG8A 3LFMA 3ZMVB 3P7IA 5ADXL 2DCFA 2ODUA 2WMNA 3IBPA 4QXCB 1HG2A 1D1AA 3C4XA 4KMCA 5FXZA 2W62A 2KMFA 4MHCA 3ZC0A 3I1AA 3C98B 2XHEB 3FB2A 4QXBB 2WAUA 2BVLA 4U72A 3RYCE 1G8XA 5DJQC 2IC9A 2H7OA 2ZLYA 2K48A 4PW8A 4I55E 2VKDA 5HYAA 3A5XA 1VRBA 4K0UA 1YKHB 2YEVC 5J1GA 2VASA 3IHRA 1O3XA 2Q9QC 3BQKA 4HKAA 5FY1A 3RYHE 4E7SA 5LHIB 3ONXA 3I0QA 4NUUA 4AXPA 2NW9A 5LHHB 1UX5A 1VOMA 3KBTA 3LK2B 4DBQA 3N9MA 2LJLA 2J1DG 3C64A 2Y6XA 4DO0A 2Q9QA 4ISTA 3H3AA 4CI2B 2VK9A 4DMWA 4GK0E 3ZPOA 2ACXA 4KP3C 2K9AA 2HPJA 2YINA 2NP9A 1HFAA 1D0XA 1FMWA 4P09A 3FBLA 4EIWA 4G2AA 3UUNA 3N2KE 5HXRA 4O2BE 4AKIA 4V1Av 3ZJ2A 2CLYB 5JR9B 3GMIA 5J2TE 1HF8A 4O2AE 2Q9QD 4A56A 4PFPA 3BQIA 4UF0B 1US7B 1LRZA 3K3OA 2X0LB 3NRYA 4I4TE 2C5KT 2IAKA 4HEAA 5FY0A 5KX5E 3B57A 2VWAA 5CB4E 4WNKA 3R6NA 4PNIA 2E9XB 4FJOA 4TUYE 5LBMA 5CA0E 2LEHA 2HPLA 4L9IA 4UEMA 2WWUA 2X9XA 4FI5A 2X9YA 1OXZA 1FMVA 5EK4A 3KVAA 3IEEA 2DWKA 4EZ4A 1ZV4X 5JDMA 3NBXX 2ZMAA 4B6XA 1MMNA 3HR0A 4F6RC 4ZI3C 4X1KE 4I43B 4KBMB 2JQQA 2LT3A 1D0YA 4O4HE 4KUMB 5LHGB 4X20E 3ZCIA 3BK9A 4IIJE 4ZOLE 3N9LA 3P8CD 3CWZB 2X9WA 2D2SA 1LVFA 3PUQA 3RX6A 5M4YA 2X9HA 4C90A 4TV9E 2KWIB 2V1DB 3PUAA 3UUXB 3ZN1B 2L8KA 4TN7B 2LE8A 4EYUA 3LBXB 4QX8B 1AJ3A 3PU8A 3VU7H 3N9QA 3Q5XA 3I9WA 4HGAA 1SA0E 4PJNA 2IC6A 3AAEB 3KINB 3LK3B 5EZYE 3DJBA 4TZ4C 5AFUL 5JDQA 2P9BA 3RC3A 1WRDA 4ANJA 3MKDA 4ISSA 4ZI7E 2EHOC 3B13A 5FXVA 3O1IA 1MNEA 3F31A 4UVCB 2XQYA 2UXNB 4PK6A 4ASKA 2A3DA 4XAXB 2EHOA 3UTKA 2Y48B 2RP4A 2V7KA 3RKOA 1FIOA 3JC6C 3ETVA 5F8PA 2H7VC 3EDVA 4WBNE 1ZHCA 2WM9A 5L3BB 1KK7A 1HS7A 3L09A 4HN9A 4EAHA 5LYJE 1HX8A 2V26A 3V5SA 3NRXA 3MK7C 5IHYA 5LJMA 2VKOA 2XAFB 4EB6E 1S35A 2L3LA 3U78A 4UELA 4BAYB 3ZEFB 1WLXA 3AVSA 2D0UA 2DI4A 1YW0A 3DP7A 4MALA 4CXWA 2NW8A 3AA1B 3RRWA 5L3GB 3FXDB 3O4XE 2EHOD 4GIWA 3ZN0B 4J2CA 3ZLIA 4WBOA 1IJ6A 4GYRA 3OJAA 3H37A 3PUSA 2LSYA 4H9NC 4OYKA 4P0BA 4PJMA 1BR1A 4ZS3A 5LOVE 5L3EB 1MMDA 2VB6A 2N9DA 3KVBA 3K3NA 3JC6D 5FY7A 1MNDA 3GN5B 2W61A 2NTXA 3T8OA 3ZYLA 1T98A 3RYIE 5HAXA 3KV5A 4EOZB 3FHNA 3CQCB 2JMKA 3ANWA 4MLKA 5FMNA 2BZBA 4XBFB 2NW7A 3OBVE 3MACA 4XZCA 3RC8A 3NZPA 1V9DA 4UIGA 3E0ZA 3LG7A 4QWNB 4H9RC 3J7Yq 3FXEB 1IZNB 2KXPB 1MIVA 3GWHA 3K3QC 3VHLA 4O4LE 3S4UA 2XAJB 5LGUB 3Q9DA 2KWHA 4DBRA 2LSJA 3VKGA 5LCYA 3VKHA 3ZYKA 5J2UE 5EK3A 3U3IA 3MA9A 3HA4A 4GYSA 5FXWA 5GONE 4CXXA 3KV4A 5ETWA 1NAFA 2CE7A 2JPFA 4H9QC 3AVRA 2MOZA 4OHFA 2CA5A 2XAQB 3N9OA 5FXXA 1B7TA 1U5PA 2V7JA 2VL8A 1WYBA 3PE0A 2V7LA 3C4WA 4CZZB 4I50E 3AAIA 3CX6B 1BR2A 3RYFE 3AA6B 2Q9QB 5A1LA 1LKXA 5FNVE 4PFOA 3LJCA 3AA7B 2G0UA 3RH3A 4N78D 4PJLA 5LBQB 4YHJA 1Y64B 4IE6A 4ERRA 2JRKA 5TAOA 3ZJ1A 5JRCA 3CKDA 1KNZA 4PK4A 3D0TA 4YJ2E 4X1YE 2CWYA 3ZMTB 5FYMA 2CXFA 5LNKA 2X67A 4OYJA 4HFVA 4JEHB 2LHNA 4H63H 1WYCA 3CPZA 2PFVA 2LHRA 2PJQA 3CVRA 5LA6E 2CM0A 5LXTE 2Y8DA 3NZQA 3UFEA 4CXYA 2LSGA 4WW0A 4U74A 2ZM0A 5HWYA 4AQFC 2W00A 4ZI3D 5C8YE 3HKBE 5HWXA 2XASB 3M65A 5L3CB 4CI1B 4AKGA 4BJNA 5LJNA 4L0RA 3HKCE 4YLHA 4AQFA 5KDMC 1BR0A 2JMHA 5JH7E 2B1EA 5JDGA 3L3PA 3O1JA 2CLYC 5JR9C 4C91A 1D1CA 2C5IT 3C51A 4EYYR 3GN5A 4ILUA 1UCUA 3WAJA 5HXSA 1S94A 4UVBB 4AKLA 4GK5E 5JR9A 2D5UA 4HTEA 4YJ3E 2Z6EA 2CCQA 3MZKB 1WR6A 5E0OA 3Q5WA 3PTRB 3F57A 3UT5E 2V7MA 1NWMX 2YU1A 3KDSE 4H9OC 3RRCA 4UF0A 5JVDE 5L3DB 5H6QB 2ODVA 2JJ9A 2E9XC 3ZYMA 2NWBA 3MJXA 2CXLA 5FP3A 2KINB 3RPUA 2DLRA 3EDUA 2W0GA 2CMRA 5DQVA 2UXXB 4MBQA 2DWGA 2E9XA 3I9YA 3SWHA 1FEWA 3N5LA 4JEUB 3MXZA 3HKDE 3O1HA 2LOSA 2D0TA 3SOLA 1D0ZA 1U4QA 4IDZA 5HXEA 1OWAA 4DMVA 4AI6A 5DABA 1YD8G 5KMGP 2CEAA 4H9PC 2IW5B 2QGSA 4O4IE 2ZM2A 3K8PC 5BMVE 2MBGA 4IE4A 2LSIA 4QXHB 2HH7A 2NTYA 5JDLA 1X79A 4ADZA 5DQWA 3LK42 2WBLA 2BDEA 5H6RB 3CQGB 5IYZE 2CWOA 2LSKA 1H7CA 3BQLA 1ZEEA 2E9XD 4IE7A 1D1BA 2M67A 1G73A 3F2EA 4EXTA 3KFWX 1IJ5A 2EHOB 3AB3B 5L2LA 4PK5A 3CX7B 2E8IA 4CQIA 3PURA 2DHRA 3WI3A 3ETUA 4PJJA 4L5GA 4P0AA 2VKHA 3E08A 4TX5A 2KNDA 2N2NA 5LP6E 1IAPA 3KV6A 3J9X1 1UX4A 4BA9A 3SRZA 2KT9A 1E1HB 4BJMA 4O8SA 2KZ7B 4M1PA 3LBXA 3KV9A 1MMAA 3WAKA 3ZMZB 2BVMA 2W63A 2XTLA 5JDFA 1MIWA 2SPCA 2K5BB 3N9NA 2GK9A 3TKLB 4G63A 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RP4 A; 
#chains in the Genus database with same CATH topology
 2XZE A;  4QHO A;  4IE0 A;  4Q25 A;  2DNX A;  4DR7 T;  4TV8 E;  4UV8 B;  1HG5 A;  2A72 A;  4AKR B;  3ZMS B;  4IGU A;  4DV2 T;  2XUE A;  5LG3 A;  2H3R A;  1HCI A;  4JYA T;  2MTQ A;  1Z0P A;  2C5J A;  5JDN A;  3ANW B;  3Q5E A;  4IHJ E;  5F3J A;  4H63 V;  2W2U A;  3R84 B;  1SHZ C;  5C2T A;  1QLB A;  5AQQ B;  4UR9 A;  5CA1 E;  3OYX A;  3IF8 B;  3N2G E;  3PU3 A;  3OKQ A;  4IDO A;  2BS2 A;  5LGN B;  2ES0 A;  3Q2M A;  5HXC A;  5EK2 A;  3VRB A;  3LSV A;  3CQX C;  4OX9 T;  1BR4 A;  3EAM A;  4OK0 A;  2X51 A;  5JRC B;  2DCF A;  1HG2 A;  2HN1 A;  4HWD A;  4MHC A;  3CIR A;  5AQU B;  3RYC E;  1HNZ T;  5IUX A;  4PW8 A;  2YDQ A;  2WS3 A;  2YEV C;  3BQK A;  4HKA A;  3I0Q A;  4LF9 T;  4LF4 T;  4AXP A;  2NW9 A;  4DR2 T;  1UX5 A;  3LK2 B;  2Y6X A;  2Q9Q A;  4CI2 B;  4GK0 E;  3ZPO A;  2ACX A;  1UUR A;  1D0X A;  4IRE A;  4P09 A;  3FBL A;  5HXR A;  4JI8 T;  4AKI A;  5CJ5 A;  2CLY B;  4HFI A;  5JR9 B;  3AEE A;  5J2T E;  4B3T T;  1T8B A;  3UQ4 A;  4JV5 T;  4PFP A;  1US7 B;  1LRZ A;  3K3O A;  2X0L B;  2IAK A;  4EGW A;  2UUC T;  4LF7 T;  1ZOY A;  3R6N A;  4PNI A;  4FJO A;  2LEH A;  2WWU A;  2XJ7 A;  4U2Y A;  1HR0 T;  2XQ4 A;  1Z8U A;  4ZZB A;  3KVA A;  3IEE A;  2H88 A;  2ZMA A;  4B6X A;  1MMN A;  5HCM A;  4AQY T;  1T7S A;  4ZI3 C;  3OTO T;  2CRB A;  2JQQ A;  4YHH T;  4X20 E;  3ZCI A;  3BK9 A;  4NXM T;  1E7P A;  1SUM B;  2X9H A;  4TV9 E;  2WDQ A;  4TN7 B;  2LE8 A;  4EYU A;  1W09 A;  3LBX B;  4QX8 B;  3VU7 H;  3Q5X A;  3AE9 A;  3JCF A;  4PJN A;  3QOF A;  3JAF A;  5EZY E;  3UU5 A;  3AE5 A;  4ANJ A;  4U33 A;  3O1I A;  1J5E T;  1MNE A;  3AED A;  3VRA A;  2K3W A;  1HNX T;  2EHO A;  2FBW A;  2Y48 B;  2H7V C;  3EDV A;  4KI0 F;  2R6G F;  5LYJ E;  1HNW T;  3MK7 C;  1S35 A;  4UEL A;  1WLX A;  1YW0 A;  3DP7 A;  5L4E A;  3AA1 B;  2WDR A;  4HWF A;  4GIW A;  2XQ3 A;  4J2C A;  2NR4 A;  2OLT A;  3AE6 A;  4ZS3 A;  5L3E B;  1JNR A;  2PTF A;  2N9D A;  5FY7 A;  1MND A;  2W61 A;  1T98 A;  3UQ7 A;  3FHN A;  3CQC B;  2JMK A;  3ANW A;  2BZB A;  4XBF B;  3H3M A;  4XZC A;  4U2Z A;  2FJB A;  3LG7 A;  3K3Q C;  3RGL A;  3VHL A;  3UU4 A;  2KWH A;  2BKN A;  3EI0 A;  3ZYK A;  2MAW A;  3QB5 A;  2CBJ A;  3KV4 A;  5ETW A;  5AQL B;  5FXX A;  1U5P A;  4JI6 T;  3PE0 A;  2V7L A;  3C4W A;  4CZZ B;  3Q5D A;  3AAI A;  3CX6 B;  5A1L A;  1LKX A;  2IML A;  4PFO A;  2G0U A;  2WP9 A;  4PJL A;  5LBQ B;  2JRK A;  5TAO A;  4WYV A;  4YT0 A;  3AEB A;  4JI0 T;  5JRC A;  2VL0 A;  4YJ2 E;  5BR8 T;  3ZMT B;  5FYM A;  2CXF A;  2YKS A;  2WB5 A;  3SFE A;  1YQ4 A;  1WYC A;  3VR8 A;  2PJQ A;  2Y8D A;  3SFD A;  4WW0 A;  4ZEY A;  5HWY A;  2I6H A;  2JQH A;  2YN6 A;  3HKC E;  4AQF A;  5KDM C;  2XQA A;  3JAE A;  5JDG A;  3L3P A;  3FZL B;  3ZSS A;  4EYY R;  3RIU C;  2H89 A;  3EHZ A;  2BKO A;  1W0A A;  5JR9 A;  2D5U A;  1WR6 A;  3Q5W A;  5ABF A;  3F57 A;  4H9O C;  2E9X C;  2NWB A;  4COF A;  2DLR A;  4LF5 T;  3SWH A;  4JEU B;  2LOS A;  1OWA A;  1YD8 G;  4H9P C;  2LSI A;  3RQU A;  5DQW A;  5ABH A;  2BDE A;  2FJA A;  4JI7 T;  3L39 A;  2ZM6 T;  4CN6 A;  2E9X D;  2XPK A;  1E2A A;  1IJ5 A;  3M3Z B;  3AB3 B;  5L2L A;  2DHR A;  2UUB T;  4P0A A;  3E08 A;  2HN2 A;  5AQJ B;  3SRZ A;  4BJM A;  2KZ7 B;  3LBX A;  3WAK A;  2UUA T;  2BVM A;  2XTL A;  2QRX A;  1OED C;  2K5B B;  3CX8 B;  5AQM B;  2XM2 A;  1UK5 A;  3QC9 A;  4AQG A;  3NWI A;  4ZXL A;  1MIY A;  4UXN B;  1QUU A;  2C0S A;  3PUG A;  3AA0 B;  2OA5 A;  3OYZ A;  5HEU A;  3N2O A;  4ZS2 A;  4DV5 T;  4Z8X A;  3HL6 A;  3CK6 A;  3PUV F;  1LVK A;  3P4W A;  3ZC1 A;  5JDH A;  1XNQ T;  2MYS A;  2RA1 A;  3EUH A;  4YY3 T;  4DV1 T;  5AQK B;  4CI3 B;  5LGT B;  2CHN A;  3A8Y C;  1Y01 A;  3G06 A;  4X5T A;  1WCR A;  3ESL A;  5AQO B;  5FKY A;  4DVD A;  4JLE A;  1MMG A;  2D9D A;  2A2F X;  1M62 A;  5J0Z A;  2WMO A;  3PUX F;  1HTJ F;  1XDP A;  2BBJ A;  4ZHQ E;  3AXJ A;  5AQS B;  4DV0 T;  4E7Z A;  2K24 A;  4AKH A;  5AQI B;  4TWD A;  3P7I A;  5ADX L;  2WMN A;  3K1S A;  4KMC A;  3NVO A;  1YQ3 A;  3ZC0 A;  3I1A A;  3FB2 A;  4QXB B;  5IWA T;  4U72 A;  4HWI B;  2IC9 A;  2K48 A;  2VQF T;  5FVK A;  1VRB A;  5J1G A;  3RYH E;  3IHR A;  1O3X A;  2HHH T;  4NUU A;  3KBT A;  4DBQ A;  3N9M A;  2J1D G;  3C64 A;  5L47 A;  1SE7 A;  4IST A;  4DO0 A;  4JBW F;  4KP3 C;  1DU2 A;  2YIN A;  4EIW A;  4G2A A;  3UUN A;  3N2K E;  3GMI A;  1HF8 A;  4O2A E;  3BQI A;  2WU2 A;  4IL4 A;  1KNR A;  2JQK A;  4TWF A;  5FY0 A;  5CB4 E;  5LBM A;  5CA0 E;  4L9I A;  4UEM A;  4EEB A;  1FMV A;  5EK4 A;  2F4V T;  4TWH A;  5JDM A;  5HEO A;  4F6R C;  4X1K E;  2LT3 A;  1D0Y A;  5LHG B;  4KUM B;  1I94 T;  3N9L A;  3AEF A;  1JNZ A;  2V1D B;  4ILC A;  3PU8 A;  3I9W A;  2IC6 A;  3AAE B;  2P9B A;  3PUZ F;  4ISS A;  1OED E;  1XNR T;  3P4P A;  4ASK A;  4TNV A;  4XAX B;  3UTK A;  3RKO A;  2IUB A;  1FIO A;  3JC6 C;  3ETV A;  2WM9 A;  4DR5 T;  4YTN A;  3NRX A;  2L3L A;  2DI4 A;  4HWC A;  4U31 A;  3ZN0 B;  4DR6 T;  3TLU A;  4QH5 A;  3PUS A;  2LSY A;  3ZT5 A;  3K3N A;  3JC6 D;  4U7I A;  3T8O A;  3ZYL A;  1NEK A;  3KV5 A;  2XQ5 A;  4MLK A;  4DR4 T;  5ABF B;  3NZP A;  4UIG A;  4QWN B;  4H9R C;  3J7Y q;  1IZN B;  4YTM A;  3GWH A;  3S4U A;  5AQG B;  5LGU B;  3Q9D A;  2LSJ A;  3X1D A;  1XMO T;  1NAF A;  2V6Y B;  2MOZ A;  2CA5 A;  4KX6 A;  2V7J A;  2VL8 A;  1BR2 A;  3RYF E;  4JI2 T;  2UXD T;  2BG9 B;  4YHJ A;  1Y64 B;  4ERR A;  3CKD A;  4PK4 A;  5LB7 B;  5AQN B;  4H63 H;  4X65 T;  3PUW F;  3CPZ A;  3AE7 A;  2VVS A;  5LA6 E;  4ZI3 D;  2ZM0 A;  1N33 T;  3M65 A;  5CGM A;  2XSB A;  4CI1 B;  4AKG A;  3RLF F;  4BJN A;  4YLH A;  3ONL C;  1BR0 A;  3QNU A;  5JH7 E;  4YTP A;  4NIQ A;  4DID B;  3RIF A;  4C91 A;  2WDV A;  3WAJ A;  5HXS A;  1IBM T;  1M7K A;  5AQH B;  4ZZC A;  4HTE A;  5E0O A;  2YU1 A;  2QYW A;  3KDS E;  2WZH A;  5JVD E;  2ODV A;  2JJ9 A;  2W66 A;  2KIN B;  3EDU A;  2W0G A;  4MBQ A;  3I9Y A;  2D0T A;  3SOL A;  4IDZ A;  1U4Q A;  5HXE A;  4AI6 A;  2QGS A;  1XMQ T;  2J62 A;  2MBG A;  4IE4 A;  2IDO B;  2E5L T;  2NTY A;  5JDL A;  3AXJ B;  3TLT A;  1GQE A;  3LK4 2;  5H6R B;  2CWO A;  2LSK A;  1KF6 A;  3LDQ B;  1G73 A;  2BS4 A;  3PUR A;  3RHW A;  3WI3 A;  2VKH A;  4TX5 A;  2A9U A;  2KND A;  2UXC T;  1MIW A;  4A97 A;  3N9N A;  5IYZ E;  2WSS V;  3TLV A;  3PDY A;  3KBU A;  3T1H T;  4LFA T;  2J47 A;  5ABG A;  3SS1 A;  1KFY A;  2MPK A;  3ZCJ A;  4MFR A;  3HI2 A;  2V7I A;  3QK6 A;  1EZ3 A;  2X66 A;  3CML A;  5JRE A;  5LG4 A;  2L9Q A;  2XAG B;  4NUV A;  3AE3 A;  4EZH A;  4DND A;  4UV9 B;  2XM1 A;  4PAG A;  4QKN A;  3AAA B;  2NOX A;  5JTG A;  3FBZ A;  1QSD A;  3UUL A;  3ZMU B;  1KNP A;  4LFC T;  2KLQ A;  2PBI A;  4HE8 A;  2V8S V;  4H9S E;  4O4J E;  5HEG A;  2YK0 A;  3EAB A;  3EVY A;  3AEA A;  3GA8 A;  3N9P A;  1WR0 A;  3V5U A;  2N1G A;  1J5W A;  3QUJ A;  5L3F B;  2ODU A;  3IBP A;  4QXC B;  5CFB A;  1D1A A;  3C4X A;  2KMF A;  2XHE B;  2WAU A;  2ZLY A;  5HEH A;  2VKD A;  5HYA A;  3A5X A;  3P50 A;  2V6Y A;  5LMU T;  2VAS A;  2Q9Q C;  5FY1 A;  2FJE A;  1VOM A;  2JIW A;  5LHH B;  2LJL A;  3H3A A;  1R8I A;  4KHP T;  2K9A A;  2RPA A;  2BG9 A;  1FMW A;  2CBI A;  3ZJ2 A;  4LML A;  2Q9Q D;  4UF0 B;  3JAD A;  4I4T E;  2C5K T;  4HEA A;  4X64 T;  2OV9 A;  3FZF B;  2E9X B;  2HPL A;  2X9X A;  3ZKR A;  2ACZ A;  4B3M T;  4EZ4 A;  1ZV4 X;  3NBX X;  5KXJ A;  4I43 B;  2WQY A;  3P8C D;  2D2S A;  3PUQ A;  2VVN A;  5M4Y A;  2CPT A;  1YXR A;  3ZN1 B;  2L8K A;  3FZM B;  4CN4 A;  3N9Q A;  5AQR B;  3T1Y T;  1SA0 E;  4HFE A;  2LRK A;  3KIN B;  3DJB A;  3QB5 K;  2EHO C;  4GKJ T;  5FXV A;  4EV6 A;  1W9R A;  3F31 A;  2FUP A;  2XQY A;  2UXN B;  4PK6 A;  3FZK B;  3PUY F;  2RP4 A;  3RQW A;  4WBN E;  1KK7 A;  1HS7 A;  3L09 A;  3V5S A;  5IHY A;  3PJA J;  2LLY A;  2XAF B;  3ZEF B;  4BAY B;  2YDR A;  3AVS A;  3UUB A;  4CXW A;  2NW8 A;  3AE1 A;  3RRW A;  1N34 T;  3FXD B;  2XQ7 A;  3O4X E;  2EHO D;  1J1J A;  2UXB T;  1IJ6 A;  1CHU A;  3H37 A;  4H9N C;  4P0B A;  4PJM A;  5LOV E;  3KVB A;  4JI4 T;  4EOZ B;  5FMN A;  4KHZ F;  3MAC A;  3RC8 A;  2M6I A;  1V9D A;  2IIU A;  4K0K T;  2XQ9 A;  3FXE B;  4O4L E;  2XAJ B;  3RIA A;  1VCT A;  4DBR A;  5EK3 A;  3U3I A;  3MA9 A;  3HA4 A;  4GYS A;  4DUY T;  5C3J A;  5FXW A;  5GON E;  4CXX A;  2CE7 A;  2JPF A;  4H9Q C;  1NEN A;  2XAQ B;  1B7T A;  1XZY A;  4IDQ A;  2V5C A;  4I50 E;  1T72 A;  5FNV E;  3P4Q A;  3LJC A;  3AA7 B;  4LMK A;  5LMN T;  1HX1 B;  2LRL A;  3ZJ1 A;  5ABE A;  1KNZ A;  2JQ9 A;  3D0T A;  2WWV A;  5LNK A;  2X67 A;  1XWM A;  4HFV A;  1IBL T;  4IDP A;  2LHN A;  2PFV A;  2LHR A;  2CM0 A;  5LXT E;  3NZQ A;  3UFE A;  4CXY A;  2LSG A;  4U74 A;  4AQF C;  2W00 A;  5C8Y E;  5HWX A;  2XAS B;  5L3C B;  4JI3 T;  2LM2 A;  4WZX A;  2B1E A;  3B5M A;  4ILA A;  2CLY C;  5JR9 C;  3GN5 A;  5L4H A;  1UCU A;  2IHR 1;  1S94 A;  4UVB B;  5HCJ A;  4CN1 A;  4GK5 E;  4JI5 T;  2Z6E A;  3RIU A;  3MZK B;  3PTR B;  4UF0 A;  3FZH B;  5H6Q B;  5HEJ A;  3MJX A;  5AQF B;  2UXX B;  2E9X A;  2XY8 B;  3MXZ A;  3HKD E;  3O1H A;  1D0Z A;  4DMV A;  2CEA A;  2IW5 B;  2ZM2 A;  3K8P C;  1X79 A;  4ADZ A;  2BG9 C;  4LMJ A;  4ILB A;  1ZEE A;  3AEC A;  2M67 A;  3KFW X;  4YSY A;  2E8I A;  3ETU A;  4PJJ A;  2FJD A;  2WU5 A;  3KV6 A;  3J9X 1;  4DR3 T;  2W4X A;  4TNW A;  2BKP A;  3NKZ A;  4O8S A;  3OVU A;  3ABV A;  2WY2 A;  2W63 A;  3RF1 A;  4G63 A;  3DTO A;  5FL0 A;  5FL1 A;  4ZI2 C;  2LM9 A;  4QX7 B;  1I6Z A;  1ZKE A;  2BBH A;  3ZT6 A;  1OED A;  1W0B A;  3I0O A;  5JQG E;  3UUM A;  2WZI A;  1N32 T;  4QH1 A;  2ZM8 A;  4YFS A;  1CUN A;  3ZT7 A;  1N36 T;  4OFZ A;  4GOU A;  4X1I E;  2XAH B;  3P4S A;  5HXH A;  4JUY A;  3W15 B;  2CHO A;  2QA7 A;  4EED A;  4YXD A;  2M6B A;  4ZI2 D;  2KSR A;  2DL1 A;  3UU3 A;  4IL9 A;  4X62 T;  2LOP A;  3E22 E;  2X68 A;  3C50 A;  1YKE B;  2VKJ A;  3C4Z A;  2CXD A;  3UU8 A;  4UVA B;  2I0M A;  3O9X A;  2AXD S;  4U7Y A;  3ZST A;  3PJA A;  3RKG A;  4IE5 A;  3HKE E;  2YU2 A;  2I59 A;  4LFB T;  2PG8 A;  3LFM A;  5FVL A;  3ZMV B;  2QVA A;  5FXZ A;  1X9B A;  2W62 A;  3C98 B;  2BVL A;  1G8X A;  5DJQ C;  2H7O A;  3L8R A;  4I55 E;  4AIU A;  4U3C A;  4K0U A;  1YKH B;  2XQ8 A;  4E7S A;  5LHI B;  3UFG A;  3ONX A;  2VQE T;  4DMW A;  2VK9 A;  2HPJ A;  2NP9 A;  1HFA A;  2VUR A;  1VCS A;  2E2A A;  4O2B E;  4V1A v;  4A56 A;  3NRY A;  5KX5 E;  3B57 A;  2VWA A;  4WNK A;  4TUY E;  4B3R T;  1L0V A;  4FI5 A;  2X9Y A;  1OXZ A;  3TLW A;  2DWK A;  3HR0 A;  4KBM B;  4O4H E;  4A98 A;  4IIJ E;  4ZOL E;  4DV4 T;  3CWZ B;  2BG9 E;  2X9W A;  4Z91 A;  1LVF A;  3RX6 A;  4C90 A;  2KWI B;  3PUA A;  3UUX B;  4HFD A;  1AJ3 A;  4HGA A;  1XDO A;  3A7M A;  3LK3 B;  2LKH A;  5AQT B;  4TZ4 C;  5AFU L;  5JDQ A;  3RC3 A;  1WRD A;  4ZI7 E;  3MKD A;  3B13 A;  2W67 A;  2V5D A;  4UVC B;  1UGO A;  2A3D A;  4B3S T;  4F8H A;  4NPP A;  2AE9 A;  2V7K A;  5F8P A;  1ZHC A;  2UU9 T;  1IBK T;  5L3B B;  3ONJ A;  4HN9 A;  4EAH A;  1HX8 A;  2V26 A;  5LJM A;  2VKO A;  4EB6 E;  3U78 A;  2D0U A;  4MAL A;  4I0U A;  4Z90 A;  4DUZ T;  5L3G B;  4LF8 T;  4HFH A;  3ZLI A;  4IT4 A;  4WBO A;  4GKK T;  4GYR A;  3OJA A;  4OYK A;  1BR1 A;  1MMD A;  2VB6 A;  3AEG A;  4IDN A;  3P4R A;  3PV0 F;  3GN5 B;  2NTX A;  4LF6 T;  3RYI E;  5HAX A;  2J4G A;  3RI5 A;  2NW7 A;  3OBV E;  3IA3 A;  3E0Z A;  2KXP B;  1MIV A;  4X66 T;  3VKG A;  5LCY A;  3VKH A;  5J2U E;  2XQ6 A;  4NXN T;  3AVR A;  4A5X A;  4OHF A;  3N9O A;  1WYB A;  1ZP0 A;  3AA6 B;  2Q9Q B;  3AE2 A;  4DV3 T;  3RH3 A;  1WFD A;  4N78 D;  3TLS A;  4IE6 A;  4DV6 T;  1FJG T;  4AIS A;  2YDS A;  4X1Y E;  2CWY A;  2BS3 A;  4OYJ A;  2X0H A;  4JEH B;  2B76 A;  5AQP B;  3CVR A;  1KEY A;  3UU6 A;  3HKB E;  2V6X A;  1OED B;  5LJN A;  4L0R A;  2JMH A;  3VR9 A;  3O1J A;  1D1C A;  2C5I T;  3C51 A;  5F5W A;  4ILU A;  5AQV B;  4AKL A;  4P1N A;  4YJ3 E;  2CCQ A;  4HFC A;  3UT5 E;  2V7M A;  1NWM X;  3RRC A;  1UUS A;  3AE8 A;  5L3D B;  2X0Y A;  3ZYM A;  2CXL A;  5FP3 A;  4HWH A;  2LKG A;  3RPU A;  2XSA A;  2CMR A;  5DQV A;  2WCA A;  2DWG A;  2E5V A;  1FEW A;  3N5L A;  3OPC A;  2YOE A;  5DAB A;  5KMG P;  4DV7 T;  4DR1 T;  4O4I E;  5BMV E;  4HFB A;  4QXH B;  2HH7 A;  2WBL A;  3CQG B;  1H7C A;  3BQL A;  4IE7 A;  1D1B A;  3F2E A;  4EXT A;  2EHO B;  4PK5 A;  3CX7 B;  4CQI A;  4JI1 T;  4L5G A;  3AE4 A;  2N2N A;  5LP6 E;  1IAP A;  1UX4 A;  4BA9 A;  4YSX A;  2KT9 A;  1E1H B;  4M1P A;  3KV9 A;  1MMA A;  4YSZ A;  4QH4 A;  3ZMZ B;  5JDF A;  2SPC A;  2GK9 A;  3TKL B; 
#chains in the Genus database with same CATH homology
 3CX8 B;  2WSS V;  3PDY A;  3KBU A;  4QHO A;  4IE0 A;  4ZI2 C;  2DNX A;  2LM9 A;  3QC9 A;  4QX7 B;  1ZKE A;  4TV8 E;  4UV8 B;  1HG5 A;  3SS1 A;  4AQG A;  2A72 A;  4AKR B;  3I0O A;  3ZCJ A;  3ZMS B;  4IGU A;  4MFR A;  1MIY A;  3HI2 A;  2V7I A;  5JQG E;  3UUM A;  3QK6 A;  2XUE A;  4UXN B;  1QUU A;  2C0S A;  1EZ3 A;  1HCI A;  2H3R A;  2MTQ A;  3PUG A;  3AA0 B;  2X66 A;  1Z0P A;  2C5J A;  2OA5 A;  2ZM8 A;  3ANW B;  3CML A;  4YFS A;  5JDN A;  5LG4 A;  5JRE A;  1CUN A;  3OYZ A;  4IHJ E;  2L9Q A;  4OFZ A;  4GOU A;  4X1I E;  5F3J A;  2XAG B;  2XAH B;  3N2O A;  4ZS2 A;  4NUV A;  5HXH A;  4H63 V;  4EZH A;  4DND A;  4JUY A;  4UV9 B;  4Z8X A;  3W15 B;  2QA7 A;  4PAG A;  4QKN A;  3HL6 A;  3R84 B;  1SHZ C;  1LVK A;  3AAA B;  2NOX A;  3ZC1 A;  5JDH A;  3FBZ A;  4ZI2 D;  1QSD A;  5CA1 E;  2MYS A;  3UUL A;  3OYX A;  3ZMU B;  2RA1 A;  3EUH A;  3IF8 B;  2LOP A;  3E22 E;  3N2G E;  3PU3 A;  4CI3 B;  5LGT B;  2X68 A;  2KLQ A;  3ESL A;  4DVD A;  2PBI A;  3OKQ A;  4JLE A;  3C50 A;  1MMG A;  5LGN B;  2A2F X;  2ES0 A;  4HE8 A;  1YKE B;  2VKJ A;  3C4Z A;  2CXD A;  3Q2M A;  4UVA B;  4H9S E;  2WMO A;  4O4J E;  3O9X A;  2YK0 A;  5HXC A;  1HTJ F;  5EK2 A;  3EVY A;  3GA8 A;  4IE5 A;  4ZHQ E;  3HKE E;  3N9P A;  3V5U A;  2N1G A;  3CQX C;  1BR4 A;  4E7Z A;  3QUJ A;  4OK0 A;  2YU2 A;  2I59 A;  2K24 A;  2X51 A;  4AKH A;  5L3F B;  5JRC B;  2PG8 A;  3LFM A;  3ZMV B;  3P7I A;  5ADX L;  2DCF A;  2ODU A;  2WMN A;  3IBP A;  4QXC B;  1HG2 A;  1D1A A;  3C4X A;  4KMC A;  5FXZ A;  2W62 A;  2KMF A;  4MHC A;  3ZC0 A;  3I1A A;  3C98 B;  2XHE B;  3FB2 A;  4QXB B;  2WAU A;  2BVL A;  4U72 A;  3RYC E;  1G8X A;  5DJQ C;  2IC9 A;  2H7O A;  2ZLY A;  2K48 A;  4PW8 A;  4I55 E;  2VKD A;  5HYA A;  3A5X A;  1VRB A;  4K0U A;  1YKH B;  2YEV C;  5J1G A;  2VAS A;  3IHR A;  1O3X A;  2Q9Q C;  3BQK A;  4HKA A;  5FY1 A;  3RYH E;  4E7S A;  5LHI B;  3ONX A;  3I0Q A;  4NUU A;  4AXP A;  2NW9 A;  5LHH B;  1UX5 A;  1VOM A;  3KBT A;  3LK2 B;  4DBQ A;  3N9M A;  2LJL A;  2J1D G;  3C64 A;  2Y6X A;  4DO0 A;  2Q9Q A;  4IST A;  3H3A A;  4CI2 B;  2VK9 A;  4DMW A;  4GK0 E;  3ZPO A;  2ACX A;  4KP3 C;  2K9A A;  2HPJ A;  2YIN A;  2NP9 A;  1HFA A;  1D0X A;  1FMW A;  4P09 A;  3FBL A;  4EIW A;  4G2A A;  3UUN A;  3N2K E;  5HXR A;  4O2B E;  4AKI A;  4V1A v;  3ZJ2 A;  2CLY B;  5JR9 B;  3GMI A;  5J2T E;  1HF8 A;  4O2A E;  2Q9Q D;  4A56 A;  4PFP A;  3BQI A;  4UF0 B;  1US7 B;  1LRZ A;  3K3O A;  2X0L B;  3NRY A;  4I4T E;  2C5K T;  2IAK A;  4HEA A;  5FY0 A;  5KX5 E;  3B57 A;  2VWA A;  5CB4 E;  4WNK A;  3R6N A;  4PNI A;  2E9X B;  4FJO A;  4TUY E;  5LBM A;  5CA0 E;  2LEH A;  2HPL A;  4L9I A;  4UEM A;  2WWU A;  2X9X A;  4FI5 A;  2X9Y A;  1OXZ A;  1FMV A;  5EK4 A;  3KVA A;  3IEE A;  2DWK A;  4EZ4 A;  1ZV4 X;  5JDM A;  3NBX X;  2ZMA A;  4B6X A;  1MMN A;  3HR0 A;  4F6R C;  4ZI3 C;  4X1K E;  4I43 B;  4KBM B;  2JQQ A;  2LT3 A;  1D0Y A;  4O4H E;  4KUM B;  5LHG B;  4X20 E;  3ZCI A;  3BK9 A;  4IIJ E;  4ZOL E;  3N9L A;  3P8C D;  3CWZ B;  2X9W A;  2D2S A;  1LVF A;  3PUQ A;  3RX6 A;  5M4Y A;  2X9H A;  4C90 A;  4TV9 E;  2KWI B;  2V1D B;  3PUA A;  3UUX B;  3ZN1 B;  2L8K A;  4TN7 B;  2LE8 A;  4EYU A;  3LBX B;  4QX8 B;  1AJ3 A;  3PU8 A;  3VU7 H;  3N9Q A;  3Q5X A;  3I9W A;  4HGA A;  1SA0 E;  4PJN A;  2IC6 A;  3AAE B;  3KIN B;  3LK3 B;  5EZY E;  3DJB A;  4TZ4 C;  5AFU L;  5JDQ A;  2P9B A;  3RC3 A;  1WRD A;  4ANJ A;  3MKD A;  4ISS A;  4ZI7 E;  2EHO C;  3B13 A;  5FXV A;  3O1I A;  1MNE A;  3F31 A;  4UVC B;  2XQY A;  2UXN B;  4PK6 A;  4ASK A;  2A3D A;  4XAX B;  2EHO A;  3UTK A;  2Y48 B;  2RP4 A;  2V7K A;  3RKO A;  1FIO A;  3JC6 C;  3ETV A;  5F8P A;  2H7V C;  3EDV A;  4WBN E;  1ZHC A;  2WM9 A;  5L3B B;  1KK7 A;  1HS7 A;  3L09 A;  4HN9 A;  4EAH A;  5LYJ E;  1HX8 A;  2V26 A;  3V5S A;  3NRX A;  3MK7 C;  5IHY A;  5LJM A;  2VKO A;  2XAF B;  4EB6 E;  1S35 A;  2L3L A;  3U78 A;  4UEL A;  4BAY B;  3ZEF B;  1WLX A;  3AVS A;  2D0U A;  2DI4 A;  1YW0 A;  3DP7 A;  4MAL A;  4CXW A;  2NW8 A;  3AA1 B;  3RRW A;  5L3G B;  3FXD B;  3O4X E;  2EHO D;  4GIW A;  3ZN0 B;  4J2C A;  3ZLI A;  4WBO A;  1IJ6 A;  4GYR A;  3OJA A;  3H37 A;  3PUS A;  2LSY A;  4H9N C;  4OYK A;  4P0B A;  4PJM A;  1BR1 A;  4ZS3 A;  5LOV E;  5L3E B;  1MMD A;  2VB6 A;  2N9D A;  3KVB A;  3K3N A;  3JC6 D;  5FY7 A;  1MND A;  3GN5 B;  2W61 A;  2NTX A;  3T8O A;  3ZYL A;  1T98 A;  3RYI E;  5HAX A;  3KV5 A;  4EOZ B;  3FHN A;  3CQC B;  2JMK A;  3ANW A;  4MLK A;  5FMN A;  2BZB A;  4XBF B;  2NW7 A;  3OBV E;  3MAC A;  4XZC A;  3RC8 A;  3NZP A;  1V9D A;  4UIG A;  3E0Z A;  3LG7 A;  4QWN B;  4H9R C;  3J7Y q;  3FXE B;  1IZN B;  2KXP B;  1MIV A;  3GWH A;  3K3Q C;  3VHL A;  4O4L E;  3S4U A;  2XAJ B;  5LGU B;  3Q9D A;  2KWH A;  4DBR A;  2LSJ A;  3VKG A;  5LCY A;  3VKH A;  3ZYK A;  5J2U E;  5EK3 A;  3U3I A;  3MA9 A;  3HA4 A;  4GYS A;  5FXW A;  5GON E;  4CXX A;  3KV4 A;  5ETW A;  1NAF A;  2CE7 A;  2JPF A;  4H9Q C;  3AVR A;  2MOZ A;  4OHF A;  2CA5 A;  2XAQ B;  3N9O A;  5FXX A;  1B7T A;  1U5P A;  2V7J A;  2VL8 A;  1WYB A;  3PE0 A;  2V7L A;  3C4W A;  4CZZ B;  4I50 E;  3AAI A;  3CX6 B;  1BR2 A;  3RYF E;  3AA6 B;  2Q9Q B;  5A1L A;  1LKX A;  5FNV E;  4PFO A;  3LJC A;  3AA7 B;  2G0U A;  3RH3 A;  4N78 D;  4PJL A;  5LBQ B;  4YHJ A;  1Y64 B;  4IE6 A;  4ERR A;  2JRK A;  5TAO A;  3ZJ1 A;  5JRC A;  3CKD A;  1KNZ A;  4PK4 A;  3D0T A;  4YJ2 E;  4X1Y E;  2CWY A;  3ZMT B;  5FYM A;  2CXF A;  5LNK A;  2X67 A;  4OYJ A;  4HFV A;  4JEH B;  2LHN A;  4H63 H;  1WYC A;  3CPZ A;  2PFV A;  2LHR A;  2PJQ A;  3CVR A;  5LA6 E;  2CM0 A;  5LXT E;  2Y8D A;  3NZQ A;  3UFE A;  4CXY A;  2LSG A;  4WW0 A;  4U74 A;  2ZM0 A;  5HWY A;  4AQF C;  2W00 A;  4ZI3 D;  5C8Y E;  3HKB E;  5HWX A;  2XAS B;  3M65 A;  5L3C B;  4CI1 B;  4AKG A;  4BJN A;  5LJN A;  4L0R A;  3HKC E;  4YLH A;  4AQF A;  5KDM C;  1BR0 A;  2JMH A;  5JH7 E;  2B1E A;  5JDG A;  3L3P A;  3O1J A;  2CLY C;  5JR9 C;  4C91 A;  1D1C A;  2C5I T;  3C51 A;  4EYY R;  3GN5 A;  4ILU A;  1UCU A;  3WAJ A;  5HXS A;  1S94 A;  4UVB B;  4AKL A;  4GK5 E;  5JR9 A;  2D5U A;  4HTE A;  4YJ3 E;  2Z6E A;  2CCQ A;  3MZK B;  1WR6 A;  5E0O A;  3Q5W A;  3PTR B;  3F57 A;  3UT5 E;  2V7M A;  1NWM X;  2YU1 A;  3KDS E;  4H9O C;  3RRC A;  4UF0 A;  5JVD E;  5L3D B;  5H6Q B;  2ODV A;  2JJ9 A;  2E9X C;  3ZYM A;  2NWB A;  3MJX A;  2CXL A;  5FP3 A;  2KIN B;  3RPU A;  2DLR A;  3EDU A;  2W0G A;  2CMR A;  5DQV A;  2UXX B;  4MBQ A;  2DWG A;  2E9X A;  3I9Y A;  3SWH A;  1FEW A;  3N5L A;  4JEU B;  3MXZ A;  3HKD E;  3O1H A;  2LOS A;  2D0T A;  3SOL A;  1D0Z A;  1U4Q A;  4IDZ A;  5HXE A;  1OWA A;  4DMV A;  4AI6 A;  5DAB A;  1YD8 G;  5KMG P;  2CEA A;  4H9P C;  2IW5 B;  2QGS A;  4O4I E;  2ZM2 A;  3K8P C;  5BMV E;  2MBG A;  4IE4 A;  2LSI A;  4QXH B;  2HH7 A;  2NTY A;  5JDL A;  1X79 A;  4ADZ A;  5DQW A;  3LK4 2;  2WBL A;  2BDE A;  5H6R B;  3CQG B;  5IYZ E;  2CWO A;  2LSK A;  1H7C A;  3BQL A;  1ZEE A;  2E9X D;  4IE7 A;  1D1B A;  2M67 A;  1G73 A;  3F2E A;  4EXT A;  3KFW X;  1IJ5 A;  2EHO B;  3AB3 B;  5L2L A;  4PK5 A;  3CX7 B;  2E8I A;  4CQI A;  3PUR A;  2DHR A;  3WI3 A;  3ETU A;  4PJJ A;  4L5G A;  4P0A A;  2VKH A;  3E08 A;  4TX5 A;  2KND A;  2N2N A;  5LP6 E;  1IAP A;  3KV6 A;  3J9X 1;  1UX4 A;  4BA9 A;  3SRZ A;  2KT9 A;  1E1H B;  4BJM A;  4O8S A;  2KZ7 B;  4M1P A;  3LBX A;  3KV9 A;  1MMA A;  3WAK A;  3ZMZ B;  2BVM A;  2W63 A;  2XTL A;  5JDF A;  1MIW A;  2SPC A;  2K5B B;  3N9N A;  2GK9 A;  3TKL B;  4G63 A;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...