2RP4A

Solution structure of the oligomerization domain in dmp53
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
71
structure length
71
Chain Sequence
DDSAAEWNVSRTPDGDYRLAITCPNKEWLLQSIEGMIKEAAAEVLRNPNQENLRRHANKLLSLKKRAYELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor p53
publication title Structural evolution of C-terminal domains in the p53 family
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 20
structure length 71
sequence length 71
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11619 P53_C Transcription factor P53 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.680 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2rp4A00
2RP4A
chains in the Genus database with same CATH superfamily
2UXXB 1MMNA 4DR7T 3FB2A 5AQJB 5L3FB 4UF0B 4AI6A 5FXWA 1HNWT 3AE8A 4MFRA 5LHGB 4AKRB 3ZT7A 2GK9A 5FNVE 4AKGA 2F4VT 4AKLA 1BR4A 5AQPB 2DWKA 5LXTE 4H9RC 3PUXF 1US7B 2XM1A 3AAEB 2OA5A 4UIGA 2CRBA 3AEDA 2HPJA 3I1AA 4PK4A 2XM2A 4JI6T 3U78A 1SHZC 2K9AA 2LRKA 5ETWA 2WS3A 1LKXA 4CI2B 4Z90A 3CKDA 5L4EA 4YHHT 3ZMVB 3AE6A 2H3RA 5FMNA 4PJLA 1GQEA 1ZEEA 3OYZA 2CLYC 3RKGA 3RC8A 2YEVC 1D1CA 3SWHA 4QKNA 4KMCA 3RQUA 1BR2A 5KX5E 4LFCT 3F57A 2Q9QB 2FBWA 2RP4A 3RHWA 4GK0E 1ZKEA 3TLUA 5DQVA 3EI0A 2BG9E 3ZJ2A 1IAPA 1T8BA 3AAIA 3LDQB 2RA1A 3RH3A 1ZOYA 1G8XA 2WCAA 2E9XD 5FKYA 5J0ZA 3QUJA 2NWBA 2CXLA 4A5XA 2X67A 1M7KA 4IE6A 3EDVA 2NW7A 1XDPA 4ZI3D 4ASKA 1UX5A 2RPAA 5J2TE 3UU8A 3L8RA 1X79A 3AE3A 4DV0T 4IDNA 1JNZA 2X9HA 2QYWA 3OKQA 1HTJF 4DNDA 2ZM0A 4HFEA 2W00A 4I43B 5AQUB 5J2UE 5HXRA 2WAUA 2LSYA 3V5SA 4ANJA 5LGTB 3MJXA 3KV9A 4L9IA 3IHRA 2IUBA 3A8YC 2JQQA 3JADA 4Z91A 3D0TA 1BR1A 4YJ2E 1IBMT 4ILUA 2ODVA 2D0TA 3TLWA 2E8IA 4XZCA 2LRLA 4ZS3A 2XPKA 3P7IA 4YY3T 2NR4A 4AQGA 3FZFB 2BKNA 5FY7A 3UQ4A 4O4IE 1OWAA 3C50A 1SUMB 3AE2A 1IZNB 1IJ6A 5AQIB 5JDQA 3CX6B 4J2CA 3CIRA 4JI8T 4HE8A 3FBZA 2LHNA 4LF7T 2JQHA 5ABGA 2XAHB 1YQ3A 1FEWA 5CA0E 4HFDA 3N9PA 2LM9A 3L3PA 2MOZA 1D0XA 3ONXA 3AECA 3AVSA 4TX5A 2WU2A 3ZCIA 5JREA 4H9SE 2Q9QC 3KV4A 2VL8A 2JQKA 3ZCJA 1U4QA 2XQAA 3L09A 5BMVE 1IBLT 1SE7A 5AQLB 1N32T 3QB5A 5L47A 5AQHB 3M3ZB 2JRKA 2CBIA 1LVKA 2WP9A 1XNQT 2WMOA 3FZHB 3NRYA 4JBWF 1R8IA 4ZI2C 1Y64B 3SS1A 2CBJA 1S94A 2XHEB 5JDMA 3P4QA 4C91A 5LBQB 4CXWA 3IF8B 5JR9A 4UVAB 3DTOA 3VHLA 3QNUA 1VCTA 4ILAA 1EZ3A 3O1IA 2QGSA 3RYIE 4NUUA 2NTYA 1XMOT 5AQGB 3UU6A 2E9XA 2NW9A 2NOXA 1FMVA 4JI5T 4MBQA 3I0OA 4CN1A 4UELA 4P0AA 1FIOA 3E22E 4GK5E 2Y6XA 3BQLA 5GONE 4DR6T 2B1EA 3S4UA 2FJDA 2CCQA 2VKJA 2FJAA 2ACXA 4LMJA 3MKDA 2AXDS 1VCSA 4B3ST 5JRCA 4BAYB 2V26A 5JDLA 3IEEA 1MMAA 2VURA 4E7ZA 5C8YE 2BKOA 1J5ET 4LF6T 3QC9A 4H63H 3ZMSB 2J4GA 2IC9A 2WBLA 3K3QC 5BR8T 1HNZT 4ISTA 2IDOB 4CQIA 5AQSB 3EAMA 5KXJA 1UUSA 2XQ5A 2VKHA 4KHPT 2WDRA 3F31A 4M1PA 2WY2A 2BDEA 3GWHA 3O9XA 3H37A 4X1KE 5HEJA 3CK6A 4JLEA 5CJ5A 2XQ6A 3AEAA 1W0AA 2LOSA 2M6BA 3AE7A 3PUSA 4HKAA 4LMLA 2W4XA 2ZLYA 5JDNA 4LFBT 3UUBA 5AQQB 5JR9B 1W09A 3B57A 3AEFA 4IE5A 1WR6A 4YXDA 5LP6E 3ZMUB 3SOLA 2C5KT 5KMGP 3KV6A 2CWOA 3F2EA 2LE8A 3PURA 5FP3A 5H6RB 3ZT5A 2Z6EA 2QRXA 4JUYA 1N36T 4ZXLA 4KHZF 5L3GB 1D1BA 2W66A 2K48A 1HFAA 2E9XB 4UR9A 2CEAA 3Q5XA 2C5IT 1HR0T 4PK5A 4IE7A 2WB5A 4TWHA 4NXNT 5CB4E 4U3CA 3SRZA 2YDSA 3EVYA 4U7YA 5JRCB 1OEDC 2XQ7A 3N2OA 5HEGA 1UK5A 4OX9T 2YINA 2V7MA 2E2AA 3C4ZA 4WBNE 1H7CA 2Y48B 4LMKA 3PU8A 1WCRA 2ES0A 2V7IA 5HXSA 2PTFA 2WDQA 3BQIA 1ZV4X 4U7IA 3LK3B 3CX7B 5LG3A 4UV9B 1KK7A 1KFYA 4EEBA 4GYSA 3PUWF 4DO0A 4L5GA 2KINB 5L3BB 1Z8UA 4ERRA 4B3TT 2IMLA 3HR0A 3RRWA 2HPLA 3UT5E 3NZPA 4O2AE 2LSJA 3RYHE 4PFOA 2LSGA 2WZIA 2G0UA 4EZHA 4QH1A 2CXDA 4YSZA 2V5CA 2WM9A 2LHRA 4UXNB 2NW8A 2IHR1 4EZ4A 2L9QA 4QH5A 3C64A 2FJEA 4DR2T 5FYMA 5FXXA 4ISSA 4GKKT 4EXTA 2CMRA 5HCMA 4EGWA 3J9X1 2V7KA 2VWAA 4EYUA 2V1DB 5HWXA 3FZLB 3PUYF 2W67A 3ZC1A 2V8SV 4X1YE 4DV4T 4EIWA 2DHRA 2L3LA 1QSDA 5JR9C 4O4LE 2DWGA 3ANWA 2P9BA 5IYZE 1FJGT 1NENA 2LLYA 4X65T 4NXMT 2VK9A 5LGNB 4LF5T 1YQ4A 3CMLA 3MZKB 1VOMA 4HEAA 4JYAT 2E5LT 2X0YA 4IGUA 4F6RC 2BKPA 4U2YA 2E9XC 1QUUA 3UUNA 5CGMA 3Q9DA 3LSVA 5L3DB 4O8SA 4ZI3C 4DV1T 5L3CB 3E0ZA 4TV8E 3N2KE 5C3JA 5AQMB 5LJMA 2IC6A 4PAGA 4DMWA 3ONLC 4DV6T 3AE1A 2V7LA 2BS4A 2XASB 5HWYA 1ZHCA 4IDPA 2ZM2A 3JCFA 2J1DG 2XJ7A 3AXJA 4DBRA 2CHNA 1Z0PA 5DJQC 2CXFA 2XZEA 3K8PC 1IBKT 3PJAJ 4HWFA 2CA5A 3KINB 2FUPA 3VKHA 3LJCA 4ZEYA 4JI3T 4HFHA 3WAKA 4PNIA 3AEBA 2N1GA 3A7MA 1HCIA 3AVRA 4CXYA 4LF4T 3ZPOA 3E08A 1MIYA 1MMDA 3ANWB 3UUMA 1D1AA 1NAFA 5HCJA 2XAGB 3RYFE 1QLBA 1LRZA 2DNXA 3FXDB 3RIFA 4I50E 4CN4A 3UTKA 4DR3T 5LG4A 2A9UA 4ILCA 2LEHA 4OFZA 1OEDA 4LF8T 4IIJE 2N2NA 3T1HT 4UVCB 4A56A 4O4HE 3HI2A 2PG8A 3ZJ1A 1D0YA 2WQYA 1N33T 4YTMA 3LG7A 4DV7T 1U5PA 2VQET 4PFPA 4ADZA 3PUGA 3QK6A 4AQFC 1WLXA 1B7TA 1UCUA 5LA6E 1YW0A 3VKGA 3EDUA 3OTOT 3VRAA 4X1IE 3P4PA 4BJNA 4K0KT 2XUEA 3IBPA 3P8CD 3AE9A 4B6XA 3R6NA 5EK2A 2CPTA 2XAQB 2VVSA 1WR0A 2W62A 1N34T 3AXJB 4CI1B 4IDOA 1S35A 2V5DA 2YU1A 1NWMX 1Y01A 3K3NA 4H63V 4HWCA 3ZKRA 4YTNA 5AQTB 4Z8XA 2X9WA 4XBFB 3N5LA 5L3EB 1XDOA 4QX8B 1MNEA 1I94T 3C98B 4IL9A 2HN2A 2H7VC 3JAEA 5HEHA 4AKIA 4HFCA 2W63A 2UUCT 2W61A 2K5BB 4MALA 1W0BA 3FHNA 5F8PA 5ABHA 3QOFA 3AB3B 5C2TA 3H3MA 4H9NC 1J5WA 1OEDB 4AKHA 4JI0T 2WMNA 3TKLB 4COFA 4HFVA 4ZZBA 3HKDE 2FJBA 2LSKA 2DCFA 3U3IA 2CM0A 1KNPA 4PK6A 4DV5T 4YSYA 2BS3A 2W0GA 4HWHA 4DIDB 2VASA 1KEYA 5AQNB 2VKOA 1J1JA 1WYCA 2KXPB 1E1HB 3PJAA 2PFVA 3DP7A 2X9YA 3ETUA 4ZHQE 4HTEA 4IDZA 2WSSV 3FBLA 1HX8A 2SPCA 3OPCA 2OLTA 1DU2A 5F5WA 2MPKA 2QA7A 4AIUA 2HN1A 4OYKA 2KWIB 3GMIA 3B5MA 2W2UA 3RIUC 2I59A 2BS2A 2VB6A 3IA3A 5CA1E 2KLQA 4DBQA 2DL1A 3KBTA 2UXCT 2N9DA 3NVOA 4E7SA 3N9LA 1YD8G 4HFIA 3ZT6A 3ZMTB 4DR4T 5DABA 4IE4A 4H9PC 4ZZCA 5M4YA 2MBGA 2MTQA 3C51A 5HEUA 2XQ8A 4IHJE 3P50A 4TNWA 1VRBA 2VQFT 4PW8A 2X0LB 2A2FX 4TWFA 2AE9A 3WI3A 3TLSA 3M65A 5ABFA 1D0ZA 3ETVA 3SFDA 4I55E 4JI7T 2UXBT 3MACA 5EK3A 4IE0A 3RI5A 2H89A 5FY0A 1UX4A 2BG9C 3J7Yq 2I6HA 3UFGA 4A98A 2J62A 4UVBB 3Q5EA 2X0HA 3O1JA 4OK0A 3I0QA 2LKHA 2M6IA 4PJMA 3ZYMA 3BK9A 3UU3A 4AQFA 3PTRB 1M62A 3PE0A 4G2AA 3ZN1B 3R84B 1XMQT 2JQ9A 5LHIB 5FXVA 4KI0F 5E0OA 4DUZT 2YKSA 4HGAA 4EB6E 1O3XA 5FVKA 3H3AA 4KP3C 1X9BA 3T8OA 1BR0A 1WRDA 3P4SA 4AXPA 4PJJA 5ADXL 3RGLA 1L0VA 4QXCB 3I9YA 3QB5K 1T7SA 4H9QC 4PJNA 3GN5A 3MA9A 4TZ4C 5HXCA 4CN6A 2EHOD 3HKCE 4YLHA 3ABVA 4XAXB 3JC6D 4F8HA 2C0SA 2YDQA 1MMGA 2ACZA 1AJ3A 4DVDA 3OYXA 4X20E 4JI4T 4NUVA 4UV8B 5FXZA 4JEUB 4TUYE 3ZC0A 3AA0B 5IWAT 5ABFB 2NTXA 5AQKB 3HKEE 5LMUT 5FY1A 3KV5A 5JDHA 2KZ7B 4DR1T 3EABA 5A1LA 4HWIB 2K24A 2A72A 3N2GE 3KBUA 2XAJB 2L8KA 2WWUA 3JAFA 5LGUB 3PU3A 3RX6A 3RF1A 3HL6A 5LB7B 3LBXA 4O4JE 1HG2A 3CPZA 4U74A 5AQRB 5LBMA 2BBJA 5IUXA 4GKJT 3LK42 2R6GF 5H6QB 3ZSTA 2X51A 3CWZB 5LCYA 2JMHA 2OV9A 3UQ7A 4BA9A 1I6ZA 3OVUA 3GN5B 3HA4A 2VVNA 3NBXX 2H7OA 5TAOA 5AQFB 3CX8B 4X66T 3RIAA 4LF9T 3P4RA 4U72A 2JJ9A 4EEDA 3RIUA 2XY8B 2XTLA 1E2AA 3ZYKA 5JH7E 2VKDA 5HAXA 1E7PA 4I0UA 2KSRA 3UU5A 3MK7C 3TLTA 4I4TE 3ZSSA 3PUVF 5HXEA 4DV3T 4O2BE 3UULA 5AQOB 3RPUA 3T1YT 3RC3A 4IL4A 5FL0A 2CHOA 4P0BA 4DUYT 5LYJE 5HEOA 1MIVA 1OEDE 3LBXB 1LVFA 4WYVA 4YSXA 2D9DA 3EHZA 5JDGA 4FJOA 2JPFA 4OYJA 2YU2A 2BG9A 4QXHB 2LSIA 5LMNT 3CQGB 5JTGA 2XQYA 4CI3B 5AFUL 3NZQA 4P09A 4JV5T 4JI1T 2ZM6T 4WZXA 1UURA 2PBIA 1HS7A 3KVAA 5JVDE 2D0UA 2EHOA 1W9RA 1WFDA 4WBOA 3PUAA 1MNDA 4V1Av 2YN6A 3FXEB 4X5TA 4H9OC 2CWYA 4QXBB 4EAHA 2WZHA 4WNKA 3PDYA 3VRBA 5ABEA 4U31A 4TN7B 2IW5B 2ZM8A 3N9OA 3BQKA 4BJMA 3PV0F 5JDFA 2DLRA 3FZKB 2LT3A 1UGOA 2YDRA 4P1NA 3UFEA 2Y8DA 3VU7H 2WDVA 1KF6A 2X68A 2E5VA 2JMKA 1IJ5A 2D5UA 4IDQA 3KFWX 1NEKA 2C5JA 3FZMB 3C4XA 4IREA 3RQWA 1V9DA 2KNDA 3LK2B 4EOZB 4YJ3E 2MYSA 2BG9B 1XNRT 3WAJA 4JI2T 4TWDA 4AISA 3TLVA 2J47A 4Q25A 3ZYLA 3PUQA 4KUMB 2KMFA 4GYRA 4DMVA 5EZYE 5LOVE 4U33A 2KWHA 5CFBA 2XQ9A 3O4XE 4OHFA 3L39A 1T98A 3A5XA 3ZEFB 4HFBA 2YOEA 2Q9QD 1ZP0A 2UUBT 3NRXA 2EHOB 3DJBA 5EK4A 2B76A 2KT9A 4ZS2A 2LKGA 1CUNA 5JQGE 1XWMA 4QX7B 4N78D 3VR8A 4QHOA 1HG5A 2ODUA 2BZBA 3HKBE 2VL0A 4WW0A 5AQVB 4DV2T 2DI4A 2LOPA 2UXNB 3AA1B 3ONJA 3X1DA 4ZI2D 4ZOLE 5LHHB 3N9MA 3NWIA 1JNRA 1T72A 5FL1A 2UXDT 4CXXA 2BBHA 4X64T 2H88A 2CE7A 2V6YA 4MLKA 4TV9E 2V7JA 3ESLA 3SFEA 4AQYT 3G06A 3I9WA 1G73A 2YK0A 1HF8A 2XQ4A 3AA6B 4EYYR 4YTPA 2XAFB 2XQ3A 3AEGA 2X9XA 2UU9T 3K3OA 4DR5T 5L4HA 3N9NA 5HYAA 3Q2MA 2A3DA 4B3RT 3CQXC 3UUXB 1YKHB 1KNZA 5KDMC 2WWVA 4ILBA 2HH7A 4NIQA 2NP9A 2ZMAA 4UEMA 1FMWA 2PJQA 3RRCA 3MXZA 3EUHA 4IT4A 4HN9A 2M67A 1CHUA 1XZYA 3LFMA 4L0RA 4KBMB 2UUAT 3O1HA 2XSBA 3OJAA 2X66A 4UF0A 4MHCA 3OBVE 3AEEA 5L2LA 2HHHT 4QH4A 3ZLIA 4G63A 2D2SA 3AE5A 5DQWA 3AAAB 3W15B 4YHJA 2MAWA 5F3JA 3AA7B 4HWDA 1HNXT 4GIWA 2CLYB 2IIUA 3PUZF 4B3MT 2WU5A 1SA0E 3AE4A 3C4WA 3CQCB 3NKZA 2V6YB 3CVRA 4X62T 4K0UA 2EHOC 3KDSE 3Q5WA 4LFAT 5FVLA 3JC6C 4KX6A 4C90A 5LNKA 4YT0A 3Q5DA 3RLFF 3K1SA 2QVAA 1WYBA 2BVMA 4JEHB 4U2ZA 1MIWA 4FI5A 5HXHA 4YFSA 3KVBA 3RYCE 2IAKA 3N9QA 3P4WA 3UU4A 3ZMZB 4TNVA 3B13A 3VR9A 2I0MA 2LM2A 5J1GA 3RKOA 4NPPA 2BVLA 2LJLA 3GA8A 1HX1B 4EV6A 2K3WA 2XSAA 1KNRA 3V5UA 5LJNA 4CZZB 1YXRA 5IHYA 1YKEB 1OXZA 4ZI7E 3ZN0B 4GOUA 4A97A 2JIWA 2Q9QA 2V6XA 4QWNB
chains in the Genus database with same CATH topology
2UXXB 1MMNA 3F31A 4M1PA 4Z8XA 2X9WA 3FB2A 4XBFB 3N5LA 5L3EB 2BDEA 5L3FB 3GWHA 3O9XA 4P0BA 3H37A 4X1KE 4UF0B 4AI6A 5LYJE 5FXWA 4QX8B 1MIVA 4JLEA 1MNEA 3C98B 3LBXB 4MFRA 1LVFA 2LOSA 2H7VC 5LHGB 4AKRB 2GK9A 5FNVE 3PUSA 4AKIA 4AKGA 4HKAA 4AKLA 1BR4A 2ZLYA 2W63A 5JDGA 5JDNA 4FJOA 2DWKA 5LXTE 2W61A 4H9RC 2JPFA 4OYJA 1US7B 5JR9B 2K5BB 4MALA 3B57A 3FHNA 5F8PA 3AAEB 2YU2A 4IE5A 1WR6A 5LP6E 2OA5A 3ZMUB 3SOLA 3AB3B 4QXHB 2C5KT 5KMGP 3KV6A 4UIGA 2CWOA 2LSIA 3F2EA 3CQGB 2LE8A 4H9NC 3PURA 5FP3A 5H6RB 2XQYA 4AKHA 2Z6EA 4CI3B 2HPJA 3I1AA 5AFUL 4PK4A 2WMNA 3NZQA 4JUYA 4P09A 3TKLB 3U78A 4HFVA 1SHZC 5L3GB 1D1BA 2K9AA 3HKDE 2K48A 1HFAA 2LSKA 2E9XB 2PBIA 1HS7A 5ETWA 2CEAA 2DCFA 1LKXA 3KVAA 3U3IA 5JVDE 2D0UA 2CM0A 2EHOA 4CI2B 3Q5XA 3CKDA 2C5IT 3PUAA 4WBOA 4PK6A 2W0GA 1MNDA 4V1Av 4PK5A 4IE7A 2VASA 3FXEB 2VKOA 4H9OC 1WYCA 2CWYA 2KXPB 5CB4E 1E1HB 4QXBB 3SRZA 3ZMVB 2H3RA 3EVYA 5FMNA 4EAHA 4PJLA 5JRCB 2PFVA 3DP7A 2X9YA 3ETUA 4WNKA 1ZEEA 3PDYA 3OYZA 3N2OA 4ZHQE 2CLYC 4HTEA 4IDZA 2WSSV 4TN7B 3RC8A 2YEVC 2IW5B 3FBLA 1D1CA 1HX8A 2SPCA 3SWHA 2YINA 2ZM8A 4QKNA 3N9OA 2V7MA 3BQKA 4KMCA 3C4ZA 4BJMA 4WBNE 1BR2A 5KX5E 1H7CA 2Y48B 5JDFA 2DLRA 2LT3A 3F57A 3PU8A 2ES0A 2Q9QB 2V7IA 2QA7A 5HXSA 3UFEA 4OYKA 2Y8DA 3VU7H 2KWIB 3GMIA 2RP4A 3BQIA 4GK0E 2X68A 2JMKA 1ZKEA 1ZV4X 1IJ5A 2I59A 5DQVA 2D5UA 3ZJ2A 1IAPA 2VB6A 3LK3B 5CA1E 2KLQA 3AAIA 4DBQA 3CX7B 3KFWX 2RA1A 3RH3A 3KBTA 1G8XA 4UV9B 1KK7A 2N9DA 4GYSA 2E9XD 4DO0A 2C5JA 4L5GA 2KINB 5L3BB 3QUJA 2NWBA 2CXLA 4ERRA 4E7SA 2X67A 3N9LA 1YD8G 3C4XA 3HR0A 3ZMTB 3RRWA 4IE6A 3EDVA 2NW7A 5DABA 4IE4A 4H9PC 1V9DA 4ZI3D 5M4YA 2KNDA 3LK2B 2HPLA 4EOZB 3UT5E 2MBGA 3NZPA 4ASKA 1UX5A 4YJ3E 2MYSA 5J2TE 4O2AE 2LSJA 3RYHE 4PFOA 3WAJA 2MTQA 2LSGA 3C51A 1X79A 2G0UA 4EZHA 2CXDA 2WM9A 4IHJE 2LHRA 1VRBA 4PW8A 2X9HA 3ZYLA 2X0LB 2A2FX 3PUQA 4KUMB 2KMFA 3OKQA 4UXNB 4GYRA 2NW8A 4DMVA 5EZYE 3WI3A 1HTJF 4EZ4A 3M65A 1D0ZA 2L9QA 5LOVE 4DNDA 2KWHA 2ZM0A 3C64A 3ETVA 3O4XE 4OHFA 4I55E 1T98A 3A5XA 2W00A 4I43B 5FYMA 3ZEFB 5J2UE 5HXRA 2WAUA 5FXXA 2LSYA 4ISSA 2Q9QD 3MACA 3NRXA 2EHOB 3V5SA 3DJBA 2CMRA 5EK4A 4ANJA 4EXTA 5EK3A 5LGTB 2KT9A 4ZS2A 3MJXA 1CUNA 4IE0A 3J9X1 2V7KA 2VWAA 5FY0A 1UX4A 4EYUA 3KV9A 4L9IA 3J7Yq 2V1DB 5JQGE 5HWXA 3IHRA 4QX7B 3ZC1A 2JQQA 4N78D 4QHOA 4X1YE 4EIWA 1HG5A 2DHRA 2ODUA 2BZBA 2L3LA 3HKBE 4UVBB 3D0TA 1QSDA 1BR1A 5JR9C 4WW0A 3O1JA 4OK0A 3I0QA 4O4LE 2DWGA 4YJ2E 3ANWA 2DI4A 2P9BA 4PJMA 2LOPA 5IYZE 3BK9A 3ZYMA 2UXNB 3AA1B 4AQFA 3PTRB 3PE0A 2VK9A 4ILUA 4G2AA 5LGNB 2ODVA 3R84B 4ZOLE 3ZN1B 4ZI2D 2D0TA 5LHHB 3N9MA 3CMLA 5LHIB 2E8IA 5FXVA 3MZKB 5E0OA 4HGAA 1VOMA 4HEAA 4XZCA 4EB6E 4ZS3A 1O3XA 4CXXA 3H3AA 4KP3C 4IGUA 2CE7A 3P7IA 3T8OA 4F6RC 4MLKA 1WRDA 4TV9E 2V7JA 3ESLA 1BR0A 2E9XC 4AQGA 1QUUA 3UUNA 4AXPA 3Q9DA 4PJJA 3I9WA 5ADXL 5FY7A 5L3DB 4O4IE 1G73A 1OWAA 2YK0A 1HF8A 4O8SA 3I9YA 3AA6B 3C50A 4QXCB 4EYYR 4ZI3C 2XAFB 4H9QC 4PJNA 3GN5A 5L3CB 3E0ZA 1IZNB 1IJ6A 2X9XA 3MA9A 4TZ4C 5HXCA 4TV8E 3N2KE 2EHOD 5JDQA 3K3OA 3CX6B 3HKCE 4J2CA 4YLHA 5LJMA 2IC6A 4XAXB 3N9NA 4PAGA 5HYAA 4DMWA 3JC6D 2C0SA 3Q2MA 2A3DA 3FBZA 4HE8A 1MMGA 2LHNA 1AJ3A 3CQXC 3UUXB 4DVDA 1YKHB 2XAHB 2V7LA 1KNZA 3OYXA 4X20E 5KDMC 1FEWA 2XASB 5CA0E 3N9PA 2LM9A 5HWYA 3L3PA 2MOZA 1D0XA 1ZHCA 3ONXA 4NUVA 4UV8B 5FXZA 3AVSA 4TX5A 2ZM2A 4JEUB 3ZCIA 4TUYE 5JREA 2J1DG 4H9SE 2Q9QC 3ZC0A 3KV4A 2VL8A 3AA0B 3ZCJA 2NTXA 2HH7A 4DBRA 2NP9A 2ZMAA 1Z0PA 2CXFA 1FMWA 1U4QA 2PJQA 4UEMA 5DJQC 3RRCA 3MXZA 3EUHA 3HKEE 4HN9A 3K8PC 3L09A 5FY1A 5BMVE 2M67A 3KV5A 2CA5A 3KINB 5JDHA 2KZ7B 3LFMA 4L0RA 4KBMB 5A1LA 3VKHA 3LJCA 2K24A 2A72A 3O1HA 3OJAA 4PNIA 3N2GE 3WAKA 3KBUA 2XAJB 2L8KA 2JRKA 2N1GA 2WWUA 2X66A 1HCIA 3AVRA 4CXYA 1LVKA 4UF0A 4MHCA 5LGUB 3OBVE 2WMOA 3PU3A 3RX6A 5L2LA 3ZPOA 3HL6A 3NRYA 3E08A 3ZLIA 4ZI2C 1Y64B 3SS1A 3LBXA 1MIYA 1S94A 2XHEB 4G63A 4O4JE 1MMDA 1HG2A 2D2SA 3CPZA 4U74A 3ANWB 5JDMA 5DQWA 3AAAB 3W15B 3UUMA 4C91A 4YHJA 5LBQB 1D1AA 1NAFA 5F3JA 4CXWA 3AA7B 5LBMA 2XAGB 3IF8B 3RYFE 5JR9A 4GIWA 1LRZA 2DNXA 3LK42 2CLYB 3FXDB 4UVAB 3DTOA 5H6QB 3VHLA 4I50E 3UTKA 5LG4A 1SA0E 3C4WA 3CQCB 2LEHA 4OFZA 1EZ3A 3O1IA 2X51A 3CVRA 4IIJE 2N2NA 4UVCB 3CWZB 4K0UA 4A56A 2EHOC 3KDSE 4O4HE 3HI2A 2QGSA 3Q5WA 2PG8A 5LCYA 3RYIE 3ZJ1A 4NUUA 2JMHA 1D0YA 2NTYA 4BA9A 3JC6C 3LG7A 4C90A 5LNKA 1U5PA 3GN5B 3HA4A 4PFPA 2E9XA 2NW9A 4ADZA 2NOXA 1FMVA 3PUGA 3QK6A 4MBQA 3NBXX 4AQFC 1WYBA 1WLXA 2BVMA 4JEHB 1MIWA 4FI5A 2H7OA 3I0OA 4UELA 5TAOA 5HXHA 4YFSA 4P0AA 1FIOA 3CX8B 3KVBA 3E22E 4GK5E 2Y6XA 3RYCE 3BQLA 1B7TA 1UCUA 5GONE 2B1EA 3S4UA 5LA6E 1YW0A 2IAKA 4U72A 2JJ9A 3N9QA 3VKGA 3EDUA 2CCQA 2VKJA 2XTLA 2ACXA 3ZMZB 3MKDA 3ZYKA 4X1IE 4BJNA 5JRCA 4BAYB 2V26A 3B13A 5JDLA 5JH7E 2XUEA 3IBPA 3IEEA 1MMAA 3P8CD 5J1GA 3RKOA 4B6XA 3R6NA 4E7ZA 2VKDA 5HAXA 5C8YE 5EK2A 2XAQB 2W62A 3QC9A 4H63H 2BVLA 2LJLA 3GA8A 3ZMSB 3MK7C 2IC9A 4I4TE 4CI1B 2WBLA 5HXEA 3K3QC 4O2BE 4ISTA 1S35A 3UULA 3V5UA 4CQIA 5LJNA 4CZZB 5IHYA 2YU1A 1YKEB 3RPUA 1NWMX 1OXZA 3K3NA 3RC3A 4ZI7E 4H63V 3ZN0B 4GOUA 2Q9QA 2VKHA 4QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RP4 A; 
#chains in the Genus database with same CATH topology
 2UXX B;  1MMN A;  4DR7 T;  3FB2 A;  5AQJ B;  5L3F B;  4UF0 B;  4AI6 A;  5FXW A;  1HNW T;  3AE8 A;  4MFR A;  5LHG B;  4AKR B;  3ZT7 A;  2GK9 A;  5FNV E;  4AKG A;  2F4V T;  4AKL A;  1BR4 A;  5AQP B;  2DWK A;  5LXT E;  4H9R C;  3PUX F;  1US7 B;  2XM1 A;  3AAE B;  2OA5 A;  4UIG A;  2CRB A;  3AED A;  2HPJ A;  3I1A A;  4PK4 A;  2XM2 A;  4JI6 T;  3U78 A;  1SHZ C;  2K9A A;  2LRK A;  5ETW A;  2WS3 A;  1LKX A;  4CI2 B;  4Z90 A;  3CKD A;  5L4E A;  4YHH T;  3ZMV B;  3AE6 A;  2H3R A;  5FMN A;  4PJL A;  1GQE A;  1ZEE A;  3OYZ A;  2CLY C;  3RKG A;  3RC8 A;  2YEV C;  1D1C A;  3SWH A;  4QKN A;  4KMC A;  3RQU A;  1BR2 A;  5KX5 E;  4LFC T;  3F57 A;  2Q9Q B;  2FBW A;  2RP4 A;  3RHW A;  4GK0 E;  1ZKE A;  3TLU A;  5DQV A;  3EI0 A;  2BG9 E;  3ZJ2 A;  1IAP A;  1T8B A;  3AAI A;  3LDQ B;  2RA1 A;  3RH3 A;  1ZOY A;  1G8X A;  2WCA A;  2E9X D;  5FKY A;  5J0Z A;  3QUJ A;  2NWB A;  2CXL A;  4A5X A;  2X67 A;  1M7K A;  4IE6 A;  3EDV A;  2NW7 A;  1XDP A;  4ZI3 D;  4ASK A;  1UX5 A;  2RPA A;  5J2T E;  3UU8 A;  3L8R A;  1X79 A;  3AE3 A;  4DV0 T;  4IDN A;  1JNZ A;  2X9H A;  2QYW A;  3OKQ A;  1HTJ F;  4DND A;  2ZM0 A;  4HFE A;  2W00 A;  4I43 B;  5AQU B;  5J2U E;  5HXR A;  2WAU A;  2LSY A;  3V5S A;  4ANJ A;  5LGT B;  3MJX A;  3KV9 A;  4L9I A;  3IHR A;  2IUB A;  3A8Y C;  2JQQ A;  3JAD A;  4Z91 A;  3D0T A;  1BR1 A;  4YJ2 E;  1IBM T;  4ILU A;  2ODV A;  2D0T A;  3TLW A;  2E8I A;  4XZC A;  2LRL A;  4ZS3 A;  2XPK A;  3P7I A;  4YY3 T;  2NR4 A;  4AQG A;  3FZF B;  2BKN A;  5FY7 A;  3UQ4 A;  4O4I E;  1OWA A;  3C50 A;  1SUM B;  3AE2 A;  1IZN B;  1IJ6 A;  5AQI B;  5JDQ A;  3CX6 B;  4J2C A;  3CIR A;  4JI8 T;  4HE8 A;  3FBZ A;  2LHN A;  4LF7 T;  2JQH A;  5ABG A;  2XAH B;  1YQ3 A;  1FEW A;  5CA0 E;  4HFD A;  3N9P A;  2LM9 A;  3L3P A;  2MOZ A;  1D0X A;  3ONX A;  3AEC A;  3AVS A;  4TX5 A;  2WU2 A;  3ZCI A;  5JRE A;  4H9S E;  2Q9Q C;  3KV4 A;  2VL8 A;  2JQK A;  3ZCJ A;  1U4Q A;  2XQA A;  3L09 A;  5BMV E;  1IBL T;  1SE7 A;  5AQL B;  1N32 T;  3QB5 A;  5L47 A;  5AQH B;  3M3Z B;  2JRK A;  2CBI A;  1LVK A;  2WP9 A;  1XNQ T;  2WMO A;  3FZH B;  3NRY A;  4JBW F;  1R8I A;  4ZI2 C;  1Y64 B;  3SS1 A;  2CBJ A;  1S94 A;  2XHE B;  5JDM A;  3P4Q A;  4C91 A;  5LBQ B;  4CXW A;  3IF8 B;  5JR9 A;  4UVA B;  3DTO A;  3VHL A;  3QNU A;  1VCT A;  4ILA A;  1EZ3 A;  3O1I A;  2QGS A;  3RYI E;  4NUU A;  2NTY A;  1XMO T;  5AQG B;  3UU6 A;  2E9X A;  2NW9 A;  2NOX A;  1FMV A;  4JI5 T;  4MBQ A;  3I0O A;  4CN1 A;  4UEL A;  4P0A A;  1FIO A;  3E22 E;  4GK5 E;  2Y6X A;  3BQL A;  5GON E;  4DR6 T;  2B1E A;  3S4U A;  2FJD A;  2CCQ A;  2VKJ A;  2FJA A;  2ACX A;  4LMJ A;  3MKD A;  2AXD S;  1VCS A;  4B3S T;  5JRC A;  4BAY B;  2V26 A;  5JDL A;  3IEE A;  1MMA A;  2VUR A;  4E7Z A;  5C8Y E;  2BKO A;  1J5E T;  4LF6 T;  3QC9 A;  4H63 H;  3ZMS B;  2J4G A;  2IC9 A;  2WBL A;  3K3Q C;  5BR8 T;  1HNZ T;  4IST A;  2IDO B;  4CQI A;  5AQS B;  3EAM A;  5KXJ A;  1UUS A;  2XQ5 A;  2VKH A;  4KHP T;  2WDR A;  3F31 A;  4M1P A;  2WY2 A;  2BDE A;  3GWH A;  3O9X A;  3H37 A;  4X1K E;  5HEJ A;  3CK6 A;  4JLE A;  5CJ5 A;  2XQ6 A;  3AEA A;  1W0A A;  2LOS A;  2M6B A;  3AE7 A;  3PUS A;  4HKA A;  4LML A;  2W4X A;  2ZLY A;  5JDN A;  4LFB T;  3UUB A;  5AQQ B;  5JR9 B;  1W09 A;  3B57 A;  3AEF A;  4IE5 A;  1WR6 A;  4YXD A;  5LP6 E;  3ZMU B;  3SOL A;  2C5K T;  5KMG P;  3KV6 A;  2CWO A;  3F2E A;  2LE8 A;  3PUR A;  5FP3 A;  5H6R B;  3ZT5 A;  2Z6E A;  2QRX A;  4JUY A;  1N36 T;  4ZXL A;  4KHZ F;  5L3G B;  1D1B A;  2W66 A;  2K48 A;  1HFA A;  2E9X B;  4UR9 A;  2CEA A;  3Q5X A;  2C5I T;  1HR0 T;  4PK5 A;  4IE7 A;  2WB5 A;  4TWH A;  4NXN T;  5CB4 E;  4U3C A;  3SRZ A;  2YDS A;  3EVY A;  4U7Y A;  5JRC B;  1OED C;  2XQ7 A;  3N2O A;  5HEG A;  1UK5 A;  4OX9 T;  2YIN A;  2V7M A;  2E2A A;  3C4Z A;  4WBN E;  1H7C A;  2Y48 B;  4LMK A;  3PU8 A;  1WCR A;  2ES0 A;  2V7I A;  5HXS A;  2PTF A;  2WDQ A;  3BQI A;  1ZV4 X;  4U7I A;  3LK3 B;  3CX7 B;  5LG3 A;  4UV9 B;  1KK7 A;  1KFY A;  4EEB A;  4GYS A;  3PUW F;  4DO0 A;  4L5G A;  2KIN B;  5L3B B;  1Z8U A;  4ERR A;  4B3T T;  2IML A;  3HR0 A;  3RRW A;  2HPL A;  3UT5 E;  3NZP A;  4O2A E;  2LSJ A;  3RYH E;  4PFO A;  2LSG A;  2WZI A;  2G0U A;  4EZH A;  4QH1 A;  2CXD A;  4YSZ A;  2V5C A;  2WM9 A;  2LHR A;  4UXN B;  2NW8 A;  2IHR 1;  4EZ4 A;  2L9Q A;  4QH5 A;  3C64 A;  2FJE A;  4DR2 T;  5FYM A;  5FXX A;  4ISS A;  4GKK T;  4EXT A;  2CMR A;  5HCM A;  4EGW A;  3J9X 1;  2V7K A;  2VWA A;  4EYU A;  2V1D B;  5HWX A;  3FZL B;  3PUY F;  2W67 A;  3ZC1 A;  2V8S V;  4X1Y E;  4DV4 T;  4EIW A;  2DHR A;  2L3L A;  1QSD A;  5JR9 C;  4O4L E;  2DWG A;  3ANW A;  2P9B A;  5IYZ E;  1FJG T;  1NEN A;  2LLY A;  4X65 T;  4NXM T;  2VK9 A;  5LGN B;  4LF5 T;  1YQ4 A;  3CML A;  3MZK B;  1VOM A;  4HEA A;  4JYA T;  2E5L T;  2X0Y A;  4IGU A;  4F6R C;  2BKP A;  4U2Y A;  2E9X C;  1QUU A;  3UUN A;  5CGM A;  3Q9D A;  3LSV A;  5L3D B;  4O8S A;  4ZI3 C;  4DV1 T;  5L3C B;  3E0Z A;  4TV8 E;  3N2K E;  5C3J A;  5AQM B;  5LJM A;  2IC6 A;  4PAG A;  4DMW A;  3ONL C;  4DV6 T;  3AE1 A;  2V7L A;  2BS4 A;  2XAS B;  5HWY A;  1ZHC A;  4IDP A;  2ZM2 A;  3JCF A;  2J1D G;  2XJ7 A;  3AXJ A;  4DBR A;  2CHN A;  1Z0P A;  5DJQ C;  2CXF A;  2XZE A;  3K8P C;  1IBK T;  3PJA J;  4HWF A;  2CA5 A;  3KIN B;  2FUP A;  3VKH A;  3LJC A;  4ZEY A;  4JI3 T;  4HFH A;  3WAK A;  4PNI A;  3AEB A;  2N1G A;  3A7M A;  1HCI A;  3AVR A;  4CXY A;  4LF4 T;  3ZPO A;  3E08 A;  1MIY A;  1MMD A;  3ANW B;  3UUM A;  1D1A A;  1NAF A;  5HCJ A;  2XAG B;  3RYF E;  1QLB A;  1LRZ A;  2DNX A;  3FXD B;  3RIF A;  4I50 E;  4CN4 A;  3UTK A;  4DR3 T;  5LG4 A;  2A9U A;  4ILC A;  2LEH A;  4OFZ A;  1OED A;  4LF8 T;  4IIJ E;  2N2N A;  3T1H T;  4UVC B;  4A56 A;  4O4H E;  3HI2 A;  2PG8 A;  3ZJ1 A;  1D0Y A;  2WQY A;  1N33 T;  4YTM A;  3LG7 A;  4DV7 T;  1U5P A;  2VQE T;  4PFP A;  4ADZ A;  3PUG A;  3QK6 A;  4AQF C;  1WLX A;  1B7T A;  1UCU A;  5LA6 E;  1YW0 A;  3VKG A;  3EDU A;  3OTO T;  3VRA A;  4X1I E;  3P4P A;  4BJN A;  4K0K T;  2XUE A;  3IBP A;  3P8C D;  3AE9 A;  4B6X A;  3R6N A;  5EK2 A;  2CPT A;  2XAQ B;  2VVS A;  1WR0 A;  2W62 A;  1N34 T;  3AXJ B;  4CI1 B;  4IDO A;  1S35 A;  2V5D A;  2YU1 A;  1NWM X;  1Y01 A;  3K3N A;  4H63 V;  4HWC A;  3ZKR A;  4YTN A;  5AQT B;  4Z8X A;  2X9W A;  4XBF B;  3N5L A;  5L3E B;  1XDO A;  4QX8 B;  1MNE A;  1I94 T;  3C98 B;  4IL9 A;  2HN2 A;  2H7V C;  3JAE A;  5HEH A;  4AKI A;  4HFC A;  2W63 A;  2UUC T;  2W61 A;  2K5B B;  4MAL A;  1W0B A;  3FHN A;  5F8P A;  5ABH A;  3QOF A;  3AB3 B;  5C2T A;  3H3M A;  4H9N C;  1J5W A;  1OED B;  4AKH A;  4JI0 T;  2WMN A;  3TKL B;  4COF A;  4HFV A;  4ZZB A;  3HKD E;  2FJB A;  2LSK A;  2DCF A;  3U3I A;  2CM0 A;  1KNP A;  4PK6 A;  4DV5 T;  4YSY A;  2BS3 A;  2W0G A;  4HWH A;  4DID B;  2VAS A;  1KEY A;  5AQN B;  2VKO A;  1J1J A;  1WYC A;  2KXP B;  1E1H B;  3PJA A;  2PFV A;  3DP7 A;  2X9Y A;  3ETU A;  4ZHQ E;  4HTE A;  4IDZ A;  2WSS V;  3FBL A;  1HX8 A;  2SPC A;  3OPC A;  2OLT A;  1DU2 A;  5F5W A;  2MPK A;  2QA7 A;  4AIU A;  2HN1 A;  4OYK A;  2KWI B;  3GMI A;  3B5M A;  2W2U A;  3RIU C;  2I59 A;  2BS2 A;  2VB6 A;  3IA3 A;  5CA1 E;  2KLQ A;  4DBQ A;  2DL1 A;  3KBT A;  2UXC T;  2N9D A;  3NVO A;  4E7S A;  3N9L A;  1YD8 G;  4HFI A;  3ZT6 A;  3ZMT B;  4DR4 T;  5DAB A;  4IE4 A;  4H9P C;  4ZZC A;  5M4Y A;  2MBG A;  2MTQ A;  3C51 A;  5HEU A;  2XQ8 A;  4IHJ E;  3P50 A;  4TNW A;  1VRB A;  2VQF T;  4PW8 A;  2X0L B;  2A2F X;  4TWF A;  2AE9 A;  3WI3 A;  3TLS A;  3M65 A;  5ABF A;  1D0Z A;  3ETV A;  3SFD A;  4I55 E;  4JI7 T;  2UXB T;  3MAC A;  5EK3 A;  4IE0 A;  3RI5 A;  2H89 A;  5FY0 A;  1UX4 A;  2BG9 C;  3J7Y q;  2I6H A;  3UFG A;  4A98 A;  2J62 A;  4UVB B;  3Q5E A;  2X0H A;  3O1J A;  4OK0 A;  3I0Q A;  2LKH A;  2M6I A;  4PJM A;  3ZYM A;  3BK9 A;  3UU3 A;  4AQF A;  3PTR B;  1M62 A;  3PE0 A;  4G2A A;  3ZN1 B;  3R84 B;  1XMQ T;  2JQ9 A;  5LHI B;  5FXV A;  4KI0 F;  5E0O A;  4DUZ T;  2YKS A;  4HGA A;  4EB6 E;  1O3X A;  5FVK A;  3H3A A;  4KP3 C;  1X9B A;  3T8O A;  1BR0 A;  1WRD A;  3P4S A;  4AXP A;  4PJJ A;  5ADX L;  3RGL A;  1L0V A;  4QXC B;  3I9Y A;  3QB5 K;  1T7S A;  4H9Q C;  4PJN A;  3GN5 A;  3MA9 A;  4TZ4 C;  5HXC A;  4CN6 A;  2EHO D;  3HKC E;  4YLH A;  3ABV A;  4XAX B;  3JC6 D;  4F8H A;  2C0S A;  2YDQ A;  1MMG A;  2ACZ A;  1AJ3 A;  4DVD A;  3OYX A;  4X20 E;  4JI4 T;  4NUV A;  4UV8 B;  5FXZ A;  4JEU B;  4TUY E;  3ZC0 A;  3AA0 B;  5IWA T;  5ABF B;  2NTX A;  5AQK B;  3HKE E;  5LMU T;  5FY1 A;  3KV5 A;  5JDH A;  2KZ7 B;  4DR1 T;  3EAB A;  5A1L A;  4HWI B;  2K24 A;  2A72 A;  3N2G E;  3KBU A;  2XAJ B;  2L8K A;  2WWU A;  3JAF A;  5LGU B;  3PU3 A;  3RX6 A;  3RF1 A;  3HL6 A;  5LB7 B;  3LBX A;  4O4J E;  1HG2 A;  3CPZ A;  4U74 A;  5AQR B;  5LBM A;  2BBJ A;  5IUX A;  4GKJ T;  3LK4 2;  2R6G F;  5H6Q B;  3ZST A;  2X51 A;  3CWZ B;  5LCY A;  2JMH A;  2OV9 A;  3UQ7 A;  4BA9 A;  1I6Z A;  3OVU A;  3GN5 B;  3HA4 A;  2VVN A;  3NBX X;  2H7O A;  5TAO A;  5AQF B;  3CX8 B;  4X66 T;  3RIA A;  4LF9 T;  3P4R A;  4U72 A;  2JJ9 A;  4EED A;  3RIU A;  2XY8 B;  2XTL A;  1E2A A;  3ZYK A;  5JH7 E;  2VKD A;  5HAX A;  1E7P A;  4I0U A;  2KSR A;  3UU5 A;  3MK7 C;  3TLT A;  4I4T E;  3ZSS A;  3PUV F;  5HXE A;  4DV3 T;  4O2B E;  3UUL A;  5AQO B;  3RPU A;  3T1Y T;  3RC3 A;  4IL4 A;  5FL0 A;  2CHO A;  4P0B A;  4DUY T;  5LYJ E;  5HEO A;  1MIV A;  1OED E;  3LBX B;  1LVF A;  4WYV A;  4YSX A;  2D9D A;  3EHZ A;  5JDG A;  4FJO A;  2JPF A;  4OYJ A;  2YU2 A;  2BG9 A;  4QXH B;  2LSI A;  5LMN T;  3CQG B;  5JTG A;  2XQY A;  4CI3 B;  5AFU L;  3NZQ A;  4P09 A;  4JV5 T;  4JI1 T;  2ZM6 T;  4WZX A;  1UUR A;  2PBI A;  1HS7 A;  3KVA A;  5JVD E;  2D0U A;  2EHO A;  1W9R A;  1WFD A;  4WBO A;  3PUA A;  1MND A;  4V1A v;  2YN6 A;  3FXE B;  4X5T A;  4H9O C;  2CWY A;  4QXB B;  4EAH A;  2WZH A;  4WNK A;  3PDY A;  3VRB A;  5ABE A;  4U31 A;  4TN7 B;  2IW5 B;  2ZM8 A;  3N9O A;  3BQK A;  4BJM A;  3PV0 F;  5JDF A;  2DLR A;  3FZK B;  2LT3 A;  1UGO A;  2YDR A;  4P1N A;  3UFE A;  2Y8D A;  3VU7 H;  2WDV A;  1KF6 A;  2X68 A;  2E5V A;  2JMK A;  1IJ5 A;  2D5U A;  4IDQ A;  3KFW X;  1NEK A;  2C5J A;  3FZM B;  3C4X A;  4IRE A;  3RQW A;  1V9D A;  2KND A;  3LK2 B;  4EOZ B;  4YJ3 E;  2MYS A;  2BG9 B;  1XNR T;  3WAJ A;  4JI2 T;  4TWD A;  4AIS A;  3TLV A;  2J47 A;  4Q25 A;  3ZYL A;  3PUQ A;  4KUM B;  2KMF A;  4GYR A;  4DMV A;  5EZY E;  5LOV E;  4U33 A;  2KWH A;  5CFB A;  2XQ9 A;  3O4X E;  4OHF A;  3L39 A;  1T98 A;  3A5X A;  3ZEF B;  4HFB A;  2YOE A;  2Q9Q D;  1ZP0 A;  2UUB T;  3NRX A;  2EHO B;  3DJB A;  5EK4 A;  2B76 A;  2KT9 A;  4ZS2 A;  2LKG A;  1CUN A;  5JQG E;  1XWM A;  4QX7 B;  4N78 D;  3VR8 A;  4QHO A;  1HG5 A;  2ODU A;  2BZB A;  3HKB E;  2VL0 A;  4WW0 A;  5AQV B;  4DV2 T;  2DI4 A;  2LOP A;  2UXN B;  3AA1 B;  3ONJ A;  3X1D A;  4ZI2 D;  4ZOL E;  5LHH B;  3N9M A;  3NWI A;  1JNR A;  1T72 A;  5FL1 A;  2UXD T;  4CXX A;  2BBH A;  4X64 T;  2H88 A;  2CE7 A;  2V6Y A;  4MLK A;  4TV9 E;  2V7J A;  3ESL A;  3SFE A;  4AQY T;  3G06 A;  3I9W A;  1G73 A;  2YK0 A;  1HF8 A;  2XQ4 A;  3AA6 B;  4EYY R;  4YTP A;  2XAF B;  2XQ3 A;  3AEG A;  2X9X A;  2UU9 T;  3K3O A;  4DR5 T;  5L4H A;  3N9N A;  5HYA A;  3Q2M A;  2A3D A;  4B3R T;  3CQX C;  3UUX B;  1YKH B;  1KNZ A;  5KDM C;  2WWV A;  4ILB A;  2HH7 A;  4NIQ A;  2NP9 A;  2ZMA A;  4UEM A;  1FMW A;  2PJQ A;  3RRC A;  3MXZ A;  3EUH A;  4IT4 A;  4HN9 A;  2M67 A;  1CHU A;  1XZY A;  3LFM A;  4L0R A;  4KBM B;  2UUA T;  3O1H A;  2XSB A;  3OJA A;  2X66 A;  4UF0 A;  4MHC A;  3OBV E;  3AEE A;  5L2L A;  2HHH T;  4QH4 A;  3ZLI A;  4G63 A;  2D2S A;  3AE5 A;  5DQW A;  3AAA B;  3W15 B;  4YHJ A;  2MAW A;  5F3J A;  3AA7 B;  4HWD A;  1HNX T;  4GIW A;  2CLY B;  2IIU A;  3PUZ F;  4B3M T;  2WU5 A;  1SA0 E;  3AE4 A;  3C4W A;  3CQC B;  3NKZ A;  2V6Y B;  3CVR A;  4X62 T;  4K0U A;  2EHO C;  3KDS E;  3Q5W A;  4LFA T;  5FVL A;  3JC6 C;  4KX6 A;  4C90 A;  5LNK A;  4YT0 A;  3Q5D A;  3RLF F;  3K1S A;  2QVA A;  1WYB A;  2BVM A;  4JEH B;  4U2Z A;  1MIW A;  4FI5 A;  5HXH A;  4YFS A;  3KVB A;  3RYC E;  2IAK A;  3N9Q A;  3P4W A;  3UU4 A;  3ZMZ B;  4TNV A;  3B13 A;  3VR9 A;  2I0M A;  2LM2 A;  5J1G A;  3RKO A;  4NPP A;  2BVL A;  2LJL A;  3GA8 A;  1HX1 B;  4EV6 A;  2K3W A;  2XSA A;  1KNR A;  3V5U A;  5LJN A;  4CZZ B;  1YXR A;  5IHY A;  1YKE B;  1OXZ A;  4ZI7 E;  3ZN0 B;  4GOU A;  4A97 A;  2JIW A;  2Q9Q A;  2V6X A;  4QWN B; 
#chains in the Genus database with same CATH homology
 2UXX B;  1MMN A;  3F31 A;  4M1P A;  4Z8X A;  2X9W A;  3FB2 A;  4XBF B;  3N5L A;  5L3E B;  2BDE A;  5L3F B;  3GWH A;  3O9X A;  4P0B A;  3H37 A;  4X1K E;  4UF0 B;  4AI6 A;  5LYJ E;  5FXW A;  4QX8 B;  1MIV A;  4JLE A;  1MNE A;  3C98 B;  3LBX B;  4MFR A;  1LVF A;  2LOS A;  2H7V C;  5LHG B;  4AKR B;  2GK9 A;  5FNV E;  3PUS A;  4AKI A;  4AKG A;  4HKA A;  4AKL A;  1BR4 A;  2ZLY A;  2W63 A;  5JDG A;  5JDN A;  4FJO A;  2DWK A;  5LXT E;  2W61 A;  4H9R C;  2JPF A;  4OYJ A;  1US7 B;  5JR9 B;  2K5B B;  4MAL A;  3B57 A;  3FHN A;  5F8P A;  3AAE B;  2YU2 A;  4IE5 A;  1WR6 A;  5LP6 E;  2OA5 A;  3ZMU B;  3SOL A;  3AB3 B;  4QXH B;  2C5K T;  5KMG P;  3KV6 A;  4UIG A;  2CWO A;  2LSI A;  3F2E A;  3CQG B;  2LE8 A;  4H9N C;  3PUR A;  5FP3 A;  5H6R B;  2XQY A;  4AKH A;  2Z6E A;  4CI3 B;  2HPJ A;  3I1A A;  5AFU L;  4PK4 A;  2WMN A;  3NZQ A;  4JUY A;  4P09 A;  3TKL B;  3U78 A;  4HFV A;  1SHZ C;  5L3G B;  1D1B A;  2K9A A;  3HKD E;  2K48 A;  1HFA A;  2LSK A;  2E9X B;  2PBI A;  1HS7 A;  5ETW A;  2CEA A;  2DCF A;  1LKX A;  3KVA A;  3U3I A;  5JVD E;  2D0U A;  2CM0 A;  2EHO A;  4CI2 B;  3Q5X A;  3CKD A;  2C5I T;  3PUA A;  4WBO A;  4PK6 A;  2W0G A;  1MND A;  4V1A v;  4PK5 A;  4IE7 A;  2VAS A;  3FXE B;  2VKO A;  4H9O C;  1WYC A;  2CWY A;  2KXP B;  5CB4 E;  1E1H B;  4QXB B;  3SRZ A;  3ZMV B;  2H3R A;  3EVY A;  5FMN A;  4EAH A;  4PJL A;  5JRC B;  2PFV A;  3DP7 A;  2X9Y A;  3ETU A;  4WNK A;  1ZEE A;  3PDY A;  3OYZ A;  3N2O A;  4ZHQ E;  2CLY C;  4HTE A;  4IDZ A;  2WSS V;  4TN7 B;  3RC8 A;  2YEV C;  2IW5 B;  3FBL A;  1D1C A;  1HX8 A;  2SPC A;  3SWH A;  2YIN A;  2ZM8 A;  4QKN A;  3N9O A;  2V7M A;  3BQK A;  4KMC A;  3C4Z A;  4BJM A;  4WBN E;  1BR2 A;  5KX5 E;  1H7C A;  2Y48 B;  5JDF A;  2DLR A;  2LT3 A;  3F57 A;  3PU8 A;  2ES0 A;  2Q9Q B;  2V7I A;  2QA7 A;  5HXS A;  3UFE A;  4OYK A;  2Y8D A;  3VU7 H;  2KWI B;  3GMI A;  2RP4 A;  3BQI A;  4GK0 E;  2X68 A;  2JMK A;  1ZKE A;  1ZV4 X;  1IJ5 A;  2I59 A;  5DQV A;  2D5U A;  3ZJ2 A;  1IAP A;  2VB6 A;  3LK3 B;  5CA1 E;  2KLQ A;  3AAI A;  4DBQ A;  3CX7 B;  3KFW X;  2RA1 A;  3RH3 A;  3KBT A;  1G8X A;  4UV9 B;  1KK7 A;  2N9D A;  4GYS A;  2E9X D;  4DO0 A;  2C5J A;  4L5G A;  2KIN B;  5L3B B;  3QUJ A;  2NWB A;  2CXL A;  4ERR A;  4E7S A;  2X67 A;  3N9L A;  1YD8 G;  3C4X A;  3HR0 A;  3ZMT B;  3RRW A;  4IE6 A;  3EDV A;  2NW7 A;  5DAB A;  4IE4 A;  4H9P C;  1V9D A;  4ZI3 D;  5M4Y A;  2KND A;  3LK2 B;  2HPL A;  4EOZ B;  3UT5 E;  2MBG A;  3NZP A;  4ASK A;  1UX5 A;  4YJ3 E;  2MYS A;  5J2T E;  4O2A E;  2LSJ A;  3RYH E;  4PFO A;  3WAJ A;  2MTQ A;  2LSG A;  3C51 A;  1X79 A;  2G0U A;  4EZH A;  2CXD A;  2WM9 A;  4IHJ E;  2LHR A;  1VRB A;  4PW8 A;  2X9H A;  3ZYL A;  2X0L B;  2A2F X;  3PUQ A;  4KUM B;  2KMF A;  3OKQ A;  4UXN B;  4GYR A;  2NW8 A;  4DMV A;  5EZY E;  3WI3 A;  1HTJ F;  4EZ4 A;  3M65 A;  1D0Z A;  2L9Q A;  5LOV E;  4DND A;  2KWH A;  2ZM0 A;  3C64 A;  3ETV A;  3O4X E;  4OHF A;  4I55 E;  1T98 A;  3A5X A;  2W00 A;  4I43 B;  5FYM A;  3ZEF B;  5J2U E;  5HXR A;  2WAU A;  5FXX A;  2LSY A;  4ISS A;  2Q9Q D;  3MAC A;  3NRX A;  2EHO B;  3V5S A;  3DJB A;  2CMR A;  5EK4 A;  4ANJ A;  4EXT A;  5EK3 A;  5LGT B;  2KT9 A;  4ZS2 A;  3MJX A;  1CUN A;  4IE0 A;  3J9X 1;  2V7K A;  2VWA A;  5FY0 A;  1UX4 A;  4EYU A;  3KV9 A;  4L9I A;  3J7Y q;  2V1D B;  5JQG E;  5HWX A;  3IHR A;  4QX7 B;  3ZC1 A;  2JQQ A;  4N78 D;  4QHO A;  4X1Y E;  4EIW A;  1HG5 A;  2DHR A;  2ODU A;  2BZB A;  2L3L A;  3HKB E;  4UVB B;  3D0T A;  1QSD A;  1BR1 A;  5JR9 C;  4WW0 A;  3O1J A;  4OK0 A;  3I0Q A;  4O4L E;  2DWG A;  4YJ2 E;  3ANW A;  2DI4 A;  2P9B A;  4PJM A;  2LOP A;  5IYZ E;  3BK9 A;  3ZYM A;  2UXN B;  3AA1 B;  4AQF A;  3PTR B;  3PE0 A;  2VK9 A;  4ILU A;  4G2A A;  5LGN B;  2ODV A;  3R84 B;  4ZOL E;  3ZN1 B;  4ZI2 D;  2D0T A;  5LHH B;  3N9M A;  3CML A;  5LHI B;  2E8I A;  5FXV A;  3MZK B;  5E0O A;  4HGA A;  1VOM A;  4HEA A;  4XZC A;  4EB6 E;  4ZS3 A;  1O3X A;  4CXX A;  3H3A A;  4KP3 C;  4IGU A;  2CE7 A;  3P7I A;  3T8O A;  4F6R C;  4MLK A;  1WRD A;  4TV9 E;  2V7J A;  3ESL A;  1BR0 A;  2E9X C;  4AQG A;  1QUU A;  3UUN A;  4AXP A;  3Q9D A;  4PJJ A;  3I9W A;  5ADX L;  5FY7 A;  5L3D B;  4O4I E;  1G73 A;  1OWA A;  2YK0 A;  1HF8 A;  4O8S A;  3I9Y A;  3AA6 B;  3C50 A;  4QXC B;  4EYY R;  4ZI3 C;  2XAF B;  4H9Q C;  4PJN A;  3GN5 A;  5L3C B;  3E0Z A;  1IZN B;  1IJ6 A;  2X9X A;  3MA9 A;  4TZ4 C;  5HXC A;  4TV8 E;  3N2K E;  2EHO D;  5JDQ A;  3K3O A;  3CX6 B;  3HKC E;  4J2C A;  4YLH A;  5LJM A;  2IC6 A;  4XAX B;  3N9N A;  4PAG A;  5HYA A;  4DMW A;  3JC6 D;  2C0S A;  3Q2M A;  2A3D A;  3FBZ A;  4HE8 A;  1MMG A;  2LHN A;  1AJ3 A;  3CQX C;  3UUX B;  4DVD A;  1YKH B;  2XAH B;  2V7L A;  1KNZ A;  3OYX A;  4X20 E;  5KDM C;  1FEW A;  2XAS B;  5CA0 E;  3N9P A;  2LM9 A;  5HWY A;  3L3P A;  2MOZ A;  1D0X A;  1ZHC A;  3ONX A;  4NUV A;  4UV8 B;  5FXZ A;  3AVS A;  4TX5 A;  2ZM2 A;  4JEU B;  3ZCI A;  4TUY E;  5JRE A;  2J1D G;  4H9S E;  2Q9Q C;  3ZC0 A;  3KV4 A;  2VL8 A;  3AA0 B;  3ZCJ A;  2NTX A;  2HH7 A;  4DBR A;  2NP9 A;  2ZMA A;  1Z0P A;  2CXF A;  1FMW A;  1U4Q A;  2PJQ A;  4UEM A;  5DJQ C;  3RRC A;  3MXZ A;  3EUH A;  3HKE E;  4HN9 A;  3K8P C;  3L09 A;  5FY1 A;  5BMV E;  2M67 A;  3KV5 A;  2CA5 A;  3KIN B;  5JDH A;  2KZ7 B;  3LFM A;  4L0R A;  4KBM B;  5A1L A;  3VKH A;  3LJC A;  2K24 A;  2A72 A;  3O1H A;  3OJA A;  4PNI A;  3N2G E;  3WAK A;  3KBU A;  2XAJ B;  2L8K A;  2JRK A;  2N1G A;  2WWU A;  2X66 A;  1HCI A;  3AVR A;  4CXY A;  1LVK A;  4UF0 A;  4MHC A;  5LGU B;  3OBV E;  2WMO A;  3PU3 A;  3RX6 A;  5L2L A;  3ZPO A;  3HL6 A;  3NRY A;  3E08 A;  3ZLI A;  4ZI2 C;  1Y64 B;  3SS1 A;  3LBX A;  1MIY A;  1S94 A;  2XHE B;  4G63 A;  4O4J E;  1MMD A;  1HG2 A;  2D2S A;  3CPZ A;  4U74 A;  3ANW B;  5JDM A;  5DQW A;  3AAA B;  3W15 B;  3UUM A;  4C91 A;  4YHJ A;  5LBQ B;  1D1A A;  1NAF A;  5F3J A;  4CXW A;  3AA7 B;  5LBM A;  2XAG B;  3IF8 B;  3RYF E;  5JR9 A;  4GIW A;  1LRZ A;  2DNX A;  3LK4 2;  2CLY B;  3FXD B;  4UVA B;  3DTO A;  5H6Q B;  3VHL A;  4I50 E;  3UTK A;  5LG4 A;  1SA0 E;  3C4W A;  3CQC B;  2LEH A;  4OFZ A;  1EZ3 A;  3O1I A;  2X51 A;  3CVR A;  4IIJ E;  2N2N A;  4UVC B;  3CWZ B;  4K0U A;  4A56 A;  2EHO C;  3KDS E;  4O4H E;  3HI2 A;  2QGS A;  3Q5W A;  2PG8 A;  5LCY A;  3RYI E;  3ZJ1 A;  4NUU A;  2JMH A;  1D0Y A;  2NTY A;  4BA9 A;  3JC6 C;  3LG7 A;  4C90 A;  5LNK A;  1U5P A;  3GN5 B;  3HA4 A;  4PFP A;  2E9X A;  2NW9 A;  4ADZ A;  2NOX A;  1FMV A;  3PUG A;  3QK6 A;  4MBQ A;  3NBX X;  4AQF C;  1WYB A;  1WLX A;  2BVM A;  4JEH B;  1MIW A;  4FI5 A;  2H7O A;  3I0O A;  4UEL A;  5TAO A;  5HXH A;  4YFS A;  4P0A A;  1FIO A;  3CX8 B;  3KVB A;  3E22 E;  4GK5 E;  2Y6X A;  3RYC E;  3BQL A;  1B7T A;  1UCU A;  5GON E;  2B1E A;  3S4U A;  5LA6 E;  1YW0 A;  2IAK A;  4U72 A;  2JJ9 A;  3N9Q A;  3VKG A;  3EDU A;  2CCQ A;  2VKJ A;  2XTL A;  2ACX A;  3ZMZ B;  3MKD A;  3ZYK A;  4X1I E;  4BJN A;  5JRC A;  4BAY B;  2V26 A;  3B13 A;  5JDL A;  5JH7 E;  2XUE A;  3IBP A;  3IEE A;  1MMA A;  3P8C D;  5J1G A;  3RKO A;  4B6X A;  3R6N A;  4E7Z A;  2VKD A;  5HAX A;  5C8Y E;  5EK2 A;  2XAQ B;  2W62 A;  3QC9 A;  4H63 H;  2BVL A;  2LJL A;  3GA8 A;  3ZMS B;  3MK7 C;  2IC9 A;  4I4T E;  4CI1 B;  2WBL A;  5HXE A;  3K3Q C;  4O2B E;  4IST A;  1S35 A;  3UUL A;  3V5U A;  4CQI A;  5LJN A;  4CZZ B;  5IHY A;  2YU1 A;  1YKE B;  3RPU A;  1NWM X;  1OXZ A;  3K3N A;  3RC3 A;  4ZI7 E;  4H63 V;  3ZN0 B;  4GOU A;  2Q9Q A;  2VKH A;  4QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...