2RQ6A

Solution structure of the epsilon subunit of the f1-atpase from thermosynechococcus elongatus bp-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the intrinsic inhibitor subunit epsilon of F1-ATPase from photosynthetic organisms.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Hydrolase
molecule keywords ATP synthase epsilon chain
total genus 24
structure length 138
sequence length 138
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rq6A02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2rq6A01
3BHPA 1BSNA 3DSQA 3OE7H 4ASUH 2YIAA 4BWAA 4CH5A 5K1PA 2YIBA 1G6UA 1E79H 2WSSH 3OEHH 2XOKH 2QJ1A 1O9HA 2RJZA 2YI8A 2ZINA 2ZNIA 1AQTA 2YIBD 4CH3A 2R70A 3OAAH 2Q7EA 2RQ7A 1H8EH 2ZCEA 2JVDA 2XNDH 3OFNH 5DN6I 4TQFA 4BW9A 2HEPA 4CH4A 2Q7GA 2E5YA 4Q6GA 3VQWA 3VQVA 4CS3A 2HLDH 2ZIOA 3QTCA 2E3CA 2QE7H 4ZIBA 2Q7HA 2R72A 2YI9A 3VQXA 2PGGA 2ZIMA 3ZEDA 3FKSH 2PUSA 5FL7H 4YXWH 3VQYA 4CS4A 1BSHA 4TQDA 2ZNJA 5K1XA 1FS0E 1O9GA 2V7QH 4CH6A 2RQ6A 4CS2A
chains in the Genus database with same CATH superfamily
1TA8A 4I4TB 4D7TA 1MMMA 2VRZA 2EX3A 4GT1A 2B1GA 3A0RA 3QO5A 5BY1A 4PA6A 1R3JC 1NVPB 4IT5A 3ZMSA 1SQFA 3UM7A 2PGGA 3RGBA 1AP5A 2XTAA 3Q4HB 3C90A 1TVKA 4N21A 4I0XB 3P30A 4FVMA 1DF4A 1I94B 4DV0O 1Y74B 3JD2A 5LGUA 3JD3A 2RCVA 2KB1A 3G67A 1K33A 3JAKA 4GUNA 2ODMA 3RYIA 1Q5OA 2HLDH 5B1AC 1WPXA 2IJIA 4LWSB 2IW5A 2LO1A 1YEWA 5KAFZ 3T1YO 5DN6I 1AVMA 4JI3B 2HHHB 4FIPC 5CB4B 4IIJA 5LMNO 1SERA 1R1BA 4DV2O 3G71V 5LXTB 3ZHQA 4JTAB 1GMGA 3QO8A 3WU2Z 4JI4B 4JASA 3SDLA 1BQ0A 2ZNIA 4X20A 4TV8B 2QWPB 4QE7A 4W4LA 2VQEO 4CH4A 4EEQA 4DR3B 3JARB 2ZR3A 4PD4F 5LOVB 1YIJV 1Y76B 1HNXO 3CC7V 2P7TC 1ORQC 1Z5WA 5KLVH 3J80N 1FS0G 3WFVA 1KP3A 3FYEB 1HNWB 4UCRA 2N04A 4I7ZB 3FB5C 2VQEB 3ETEA 1IXMA 1IBMB 1AJPA 2YDEA 2UXBB 4KXRA 1NT2B 1SZTA 2XAGA 3D3QA 2H8PC 2NNUA 1JVMA 1KP2A 1NR7A 4O2BA 4NVPA 1D5NA 2LW7A 2K1EA 1N33B 3WB1A 3ZN1A 4ICGA 1MSWD 1ZLZA 3NXSA 4K0KO 4J11A 1VQ5V 1OCRC 3TETA 1YDXA 3HKEA 2ZT9B 4E4EA 2R72A 4O2BB 2BTQA 4IHJB 3F7VC 3BY6A 1SESA 1JR9A 1FXKB 3N2GB 1OCOB 1BL8A 2P22C 3FAVB 1RFYA 3P3PA 4X89A 1OCZB 3BCCH 4JI8O 1XNRB 4YJ3A 4ZBMA 2XAJA 1AROP 4DUYB 3JAWB 4DXWA 1M56B 4X64O 1F23A 2ZIMA 5FL7H 5KA6A 4RUEA 5GONB 1YITV 1Y74A 1KD1W 1N36O 1TUEB 1O9GA 4QNHB 4X1IA 1NKDA 2H94A 4TT3G 4TV9A 3OEHH 1SQGA 1R3LC 2XOKH 1RM1B 1O9HA 4W4KA 3E8HA 4AQYB 5IJ9B 3DXRA 4GKKO 3QF7A 1YXBA 3OGIB 4JZ2A 2A9HA 4I55A 1NH2B 4LFBB 2FB5A 4YY3O 3J7AU 1QBZA 3ABKC 5B1OA 1OJHA 2YIBA 3HPLC 3OW2U 3WB0A 2KKWA 2EIMB 5ITZA 4NKGB 1OCCB 1EFRG 4BIZA 4TQFA 4DRXA 2UXNA 2LQTA 1XI1A 5L3FA 1WP7A 4D6TH 3SYAA 3MHSC 1JFFA 1K92A 3S3XA 5LGTA 1UJWB 1FPOA 3M7MX 1S5HC 4PELA 1SC5B 4QE9A 4DUZB 5KA5A 3QVNA 1OCOC 2BTOA 2Q0OC 4TUYB 2E5LB 2CTWA 1NZ6A 3A0BZ 1CPYA 2W6JG 2VQFB 3H1KH 4X62B 5FNVA 1P7GA 4DV6B 3AG1B 2F66C 3BAAA 3UKMA 2HG5C 5EZYB 2EIKB 5E1AC 3UO2A 4MW8A 1AILA 1KUQA 1FXKC 4CC5A 5CA1B 2V7QH 1NBMG 2ETNA 3F7YC 1PP9H 2XNDH 5B1BB 5H9CA 1TAEA 1BSMA 2DWDC 5CA3A 3OE7G 2GUZA 1GAXA 2AW9A 2GTAA 2GBOA 3L72H 3W7SA 1VP7A 4PA7A 4DV2B 1JJ2U 4IL6Z 2ZNJA 5BR8B 4FLYA 2X6BA 3TK1A 4UCVA 4MTXA 4UVCA 2BOBC 1FKAO 4KUMA 1UPGA 3JYCA 4WFFA 2F95B 1NR1A 2QEXV 3UT5B 3K57A 4JI0B 2PYJA 2YI9A 4CC6A 5B66Z 3K59A 1BHAA 3FX7A 4FK5C 2OCCC 3TJTA 2WLIA 3ZX6A 5L3EA 5L3BA 2HP8A 3OGCC 4PI2A 5IYZA 4K8ZA 2BSKB 4I9WA 3SPGA 5LYJA 2GTSA 2A0LA 1B06A 3K3WA 2AXTZ 1K5SA 3VQVA 1PPJH 1RM1C 4DR1O 3B09A 5LA6A 1BSHA 1K7DA 4J9ZB 4RO2A 5J2UA 5J2TA 2WA4A 2ZE5A 4CH5A 2X7RB 1WP8A 1TGOA 3OT7A 1FFTB 2HFEC 3L74H 1OV9A 2UUAO 3O65A 2KG7B 2JGDB 2VQFO 1N0JA 3ZEDA 1DK1A 5J2UB 2GSMB 1Y67A 5IWAB 2ILMA 3OM3B 1XMQB 3ZN0A 1KYOF 3EXAA 2JS3A 1LNQA 1MZFA 5IJ0B 3K06A 1FD9A 4KP4A 2V4DA 2IJHA 4BIOA 2XOKG 1EZVH 3D36C 1HNWO 3CXCU 3ZCCA 2R9RB 2QE7H 4GX1A 3ZMVA 1J5EB 3SPJA 2P06A 4TSFG 4JI5O 1V55B 2DW4A 4BAYA 4GLXA 1L1FA 3SJBC 4UV8A 2OYQA 3ABMB 3LDDA 2F1MA 1R6KA 2WLNA 4DR3O 4O4LA 5HFMA 3STLC 1XOUA 2YIBD 3KKYA 4LF4B 4JI3O 4BW9A 2GV9A 2Q8VA 2IJKA 4MVZA 4UVAA 3CJHB 1YJNV 1N4CA 1BS3A 1I5XA 2A7WA 2QWRB 4DR4B 1VF6A 4J7ZA 4JI2B 4X66O 5JH7A 3RBZA 3LUTB 1K4DC 4XDJA 1XMOB 2D3OW 1JOYA 2XNDG 3ZHSA 3HKCB 1Y66A 3FB6C 2UXCO 2FTKA 1RPOA 2JIZG 1QVFU 1L0LH 3JCUZ 4DRXB 1SA0A 1W59A 4EKWA 2JEUA 4I9QA 2V7QG 2BTQB 4I50A 4G27B 2YSUB 3DTUB 4B3MO 2F4VB 1SETA 4PDLA 1B3QA 4X65O 1ZX3A 3G6BA 2DYSB 1SQBH 4FM2A 1IBLO 2QWNB 4DV4O 2QR4A 3W7WA 4F6RA 4LF5O 1GM9A 1F4NA 2OTLV 4J41A 4CS4A 1R6NA 2UU9O 2F23A 1YCIA 1AJQA 4TWKA 1I5YA 3CC4V 2WSSH 5C8YB 2KSDA 4WCEV 3IJ4A 3R65A 5JVDA 2EILB 4ZHQB 1US6A 4Q20A 2DQ0A 2P6JA 4B3TB 4GX0A 5IYCO 1QU7A 4DR7O 4WFAV 5KX5A 4HAMA 2RNBA 1V55C 2WWWA 4HBNA 4HYOA 4MVQA 5GTHZ 4GKJB 4KHPB 2Q5ZA 3N2KA 1FAFA 1ZSPA 2JRIA 3JARA 4FM0A 3C3TA 1XNQB 2VWJA 4EB6B 2ITDC 3LSSA 5JJNB 1HP8A 5JCOC 1H2GA 2IBZH 3X2QC 4NTYA 4YY3B 2Z0AA 1N34B 4X1YA 1F51A 3WB2A 1GN3A 3OEHG 2WPDG 2UU9B 2CH7B 1S3JA 3K9AA 4HZ3A 4FZ0A 2X6CA 4YJ2B 4GKKB 1XEQA 3A0HZ 1AI5A 2HLDG 1Q43A 5K1PA 1N32B 2DJVA 1R6TA 1EN5A 3LSUA 1Q82W 2UUBB 4B3RO 5LMNB 1JPXA 1VQKV 1XUQA 1PM9A 4RQFA 3T1YB 1KMIZ 1UFIA 4DR6O 3RYCB 2FMLA 3T1HB 3E86A 2H3OA 1K9MW 5H5NA 1XNRO 1FJGO 3ML0A 1JQ0A 3CSXA 5KHKA 1FXVA 4YJ2A 1VQMV 4B3MB 2F4VO 3QO7A 1IBKB 3U0ZA 4XBFA 2ZCEA 3SJAC 2A3QA 3UO3A 4MVRA 1HR0O 1XL4A 3VQWA 1K5QA 3ABUA 4LH7A 1GK9A 3SYQA 3ASNC 3LDEA 3JCZA 2QKCA 1GH6A 1SQVH 3OUSA 2RJZA 4JGSA 1HW7A 3AG3B 4LF4O 1NTZH 5B3SB 1BT8A 5LXTA 2IM9A 3HKBA 2AGAA 1NS1A 4I4TA 1EBOA 2QTSA 5JQGB 2LP7A 2ZE6A 2RDCA 1K8AW 4JAUA 2AZ0A 5E79Z 4QIWF 2JS5A 4X1KB 3AG2B 1J5EO 2BOCC 2DN9A 3ZRWA 4OGQB 1QLEB 4JI1O 4J80A 2XT9A 5CA1A 2ARHA 3N27A 2PZSA 3RYFA 1PKXA 5IJ0A 5IY5B 2K9PA 1WNSA 2VWKA 2X6AA 4WF9V 3ZMUA 5A2QN 3T2MA 1DGSA 1Q8IA 1KECA 1TUBB 1BCCH 3K0GA 1ENVA 4YIPA 2CAZC 5AG2A 1OCRB 4I0XA 2KG7A 4UV9A 2P4KA 3AG2C 3CCRV 4LF9B 4EB6A 2RQ7A 3JSNA 1S77D 4WFHA 2QKAA 4UB8Z 3E89A 3PN1A 1B6QA 5IY5C 3F5TA 3M99B 2ZXWC 2PF4E 1XBLA 3Q4HA 4GYCB 1YHQV 4L87A 5EBLC 3JALB 3AK1A 1GTOA 3CRCA 1IBLB 1Y76A 4MTFA 4DV4B 1Y6XA 2DOSA 1S5JA 3BABA 4FM1A 1S72V 4O4JA 4FJCC 4X65B 4X1YB 4KL1A 2DMXA 2W0XA 1M57B 3I56V 1ZL8A 4DV0B 3K79A 4JI7B 1VIBA 3STZC 5L3DA 1V54C 1BZKA 3JAMN 1QQCA 3IFXA 4RAIA 2QSAA 4DR2B 4X66B 1U96A 1BHBA 1GM8A 1VQ9V 4DV1O 4FLUA 3I55V 1Z5VA 5KHIA 3FKSG 4PDMA 1YF2A 5A9GA 2IH3C 4P30A 1P49A 1L0NH 3FFQA 2M7WA 3MHHC 2IU0A 4DW1A 1FYJA 3CYOA 1XILA 1JA8A 1N32O 1CEZA 2UXDB 1ZL8B 2CH7A 2ZQMA 3K5MA 5B1NA 1FS0E 2IH1C 1VQ7V 4NXMB 4LF8B 1RSOB 3K5OA 4J7KA 3SGIA 1YVWA 4X62O 1AQTA 3H1JH 5LL6Y 3OFNG 2W6IG 2CTQA 2HKOA 1F7YA 2ZDIC 1I0HA 1K34A 4E2LA 2B5UA 3B8MA 2DE0X 4IYHA 1HDJA 1QLEC 5J2TB 2QM4A 3L9DA 2OT5A 5K1XA 1XHZA 5CB4A 2IJJA 3K08A 3O9OA 4J42A 2L6LA 1QHTA 2WLHA 2C2AA 4LNUB 3B2EE 3SR2C 1KU9A 5JVDB 5LYJB 1K73W 3KCYA 2MW2B 2Z3YA 3APQA 3DC5A 2Y0PA 1LUVA 3PJSK 5JQGA 3B40A 3E22B 1LUWA 5JJJB 3E8BA 4D7SA 1NI8A 4NXMO 4I55B 3ASNB 3CRAA 3ZRVA 4R50A 1AB3A 3OUFA 3D3IA 1SZXA 4DO2A 3UT5A 3VOUA 2XASA 4PDVA 1EN4A 1EN6A 3CRMA 3SPHA 2UXCB 5TISZ 5EZYA 4LCUC 1XMOO 3EFFK 3VQYA 4RQEA 1URFA 3FB7C 2N05A 2YXLA 3F5WC 4WFBV 4WBNA 4AQYO 4NB5A 2Z5UA 5BMVB 2CK3G 1P84F 2DYRB 3AK2A 4CBCA 4HNAB 3WG7B 1NTKH 1MABG 3TGUH 1XL6A 1MG1A 1Q6UA 1D2DA 4BW5A 1XREA 1X4TA 3FKSH 5ITZB 2E76B 5EIBC 4GZRB 4U3JB 3OAAG 1J95A 4JI8B 4JTDB 1SQPH 3E8FA 3CS5A 1AJNA 2ZD9A 1RPRA 5IT9N 5D5QA 5LMUB 4LH6A 2EZPA 2QDOA 1Q6IA 4O4IA 1BQZA 3CMEV 2ZDIA 4JI5B 5IYZB 2EIJC 2OIEA 3E83A 2IU3A 2QA4V 4UFZA 1OZ0A 2LGWA 1NH2D 2LGQA 4ZI7B 2GUZB 4CS3A 1M93A 3RVZA 3JD0A 2V1DA 4FLZA 1HNZO 4GX2A 2GHYA 1S5LZ 5LBQA 1WAZA 4DR5O 2PYLA 4JYAO 1WA8A 4JYCA 5FNVB 5IE9A 1Q81W 3HR0A 1G1XB 1CP9A 3ICXA 4JI6B 2ZE7A 2DYRC 1YJ9V 1VQLV 3JAWA 4QPJA 4X20B 3CD6V 2OWOA 4I5SA 4LF7O 2Q4PA 1PNLA 3U11A 3HKEB 5KHJA 4J10A 5H6RA 4LR3A 4G28B 4LFCO 3IC9A 4TUYA 4DK0A 4B7KA 1NVPD 4F6EA 1DLBA 2PI4A 4MVMA 5B1AB 5LP6C 4Z1MG 2HEPA 2W0FC 3CCVV 3ZRWB 1R3KC 4AI8A 3CCJV 4X64B 4DV5B 3SJCC 2NN4A 3CEIA 3I5DA 5CBFA 3ZHTA 2RN9A 2EIJB 2OCCB 3GB7C 5H2FZ 1DTOA 1H2MA 3BA9A 2HJFC 4TV9B 3K04A 3BEHA 1GN6A 3CJHA 1V9PA 1TVKB 5IJ9A 4FFKA 1DF5A 1PL4A 3RYFB 4HNAA 2EZOA 3AK3A 4GX5A 3CE2A 1SS3A 4X1IB 5KUMA 4OXSA 1KQSU 3ABLC 3N2KB 3JATA 1Q90D 2EINC 1SKVA 2Q69A 2QKSA 4R8CA 4IHJA 5KMGB 3JALA 3OMIB 4O4IB 1EM1A 2XAQA 4UXNA 4G2KA 3DSQA 2YIAA 4MTOA 5CA0B 4MTGA 1COWG 3K03A 3DC6A 2NR5A 1SQQH 4MT8A 4LWSA 3G4SV 4DV6O 3IC7A 4FMTA 5FPOA 3ZJZA 3G6EV 4ZI7A 1E79G 1XDCA 4TOIA 4U3JA 4X8AA 5DM6V 1K97A 1QLNA 4LFAB 4N23A 5LMUO 4KHPO 1Z2GA 4GKJO 2EBOA 1W0JG 3SJQC 4FLXA 3ABTA 2Q7EA 1JX9A 4B3SO 5CMUA 4PA3A 4NXNO 2JGUA 2P4VA 3FYIB 3JAKB 1YTFB 4UCUA 4JI4O 1H2NA 5FL7G 2Q6AA 4JV5O 2M6YA 1PNMA 3CWBH 4CH6A 4CS2A 4PDRA 1BSNA 5EC1C 4BWAA 1Q7YW 4DV3B 3DGEA 2HHHO 3T1CA 1QR8A 3HKBB 4UCSA 1F4MA 3T4ZA 3GWOA 1S0VA 4DUYO 4A5UB 3S3WA 3TCUA 3LNMB 2N74A 4ZHQA 2FKXA 2WSSG 1WLEA 4YIOA 3BFRA 4P9OA 4DV1B 1N36B 5D5PA 3E22A 4O2AA 4O4LB 3D36A 1AP6A 3CX5F 1H2LA 3K5NA 5B5EZ 2XAHA 3CCLV 4JYBA 2DQ3A 5C8YA 5BXZA 3GVMA 5EBMC 3B77A 3KZIZ 3H1HH 2BSKA 2EINB 1VF5B 4FFBA 2RMKB 3ETQA 1OCZC 3A2FA 3OMNB 1VF7A 1I08A 3EHBB 4J7JA 4NTXA 3GWKC 1CXZB 2ZM6O 4ABMA 3ZIAG 3CP1A 1YZBA 2FL4A 1H2SB 4IGGA 1AI7A 1IX9A 1VQOV 1HWYA 1ZTEA 2UXBO 1ZUQA 4QJFB 5BZBA 1M90W 3RYIB 2AHYA 2XHBA 3U10A 1R73A 2JJ2G 4FPPA 3AG7A 3AEIA 2L35A 1V54B 4LFAO 4JV5B 2UXXA 4PA4A 2VS0A 4OX9B 5DN6G 2PI5A 3ETGA 1H8EH 1SA0B 4JYAB 1SQXH 2A79B 1Q86W 2E5YA 3VBBA 4LF8O 1PL0A 3QTCA 2OTJV 5GW7A 3CRRA 3LNNA 2A06H 3HB3B 2X0LA 5KHGA 1AR1B 3B8NA 1VQ6V 4B3TO 2XAFA 5H6QA 1IVSA 1YTFD 4MVOA 2WAMA 2WA3A 1M57C 1VQPV 3H1LH 5IYBO 2Y0IA 3K5LA 2UUAB 1VMGA 5LP6B 1H38A 2P90A 3RYHB 2B9ZA 3MDSA 4UCOA 2ZM6B 3SYCA 2WLLA 1S76D 1P7BA 2ATKC 3L75H 5FLXN 4DR1B 2ZKOA 2CTPA 3TXQA 3H9VA 4K8XA 5KUKA 4JI7O 2F43G 4ZIBA 1W2BU 4YJ3B 1M4UA 1I94O 1HR0B 5EYPB 3T4DA 4X9QA 1JCHA 4ASUH 2CE4A 2YS8A 2Y69B 4DV5O 3X2QB 3N2GA 4YHHB 4UCTA 2JK5C 2DWEC 4Z2WA 2G38A 2YXYA 5J9PC 1FFXB 3OEEG 1RSOA 2Q7GA 4O4HB 2QM8A 2BE3A 1FXHA 3HKDA 4WFEA 1P4RA 3L71H 1GN2A 3ASOC 5GONA 5JCOA 3CCUV 4LFCB 5C93A 1WA8B 3OTFA 4R7CA 4FLVA 4H13B 3ZRXA 1LR1A 4LP8A 1VQNV 1BE3H 2LJ2A 5FPRA 4CH3A 1OCCC 1H8EG 1N0NA 4LF7B 1JFFB 1VF6C 3OD4A 4NXNB 2Y69C 2CGNA 2CUGA 3E2EA 1NU1H 3H1IH 3ETDA 4FLTA 3IAYA 2LW1A 5IDJA 3OR6C 3OE7H 1G8MA 1QNMA 2YEVA 3RVYA 1MOFA 5CBGA 1M9NA 2HR3A 4JI6O 4DV7O 2YICA 5CBHA 2NLJC 2BCCH 3CCMV 3UQ8A 2ADQB 1KC8W 2YIDA 1HNZB 3QG5A 1NQTA 1IDSA 2YXHA 3KCXA 2QE7G 4QPKA 1FFXA 2QWQB 1VARA 4ZKIA 4MSWC 4LC1A 1U97A 1B04A 5LHGA 3P3NA 3FB8C 4IIJB 5EYPA 1GM7A 1OHHG 2JDIG 4OPAA 2CTRA 4IYIA 5LOVA 1THZA 4EFBA 2Q73A 3BPZA 2JEXA 5EBWC 5EIBD 3TXSA 1YJWV 3L73H 1MNGA 4J9YB 4DYLA 4MVUA 2O57A 2Q68A 5GTIZ 4WFGA 2KQXA 1IBKO 3CCQV 4K35A 3ABLB 1XHXA 2JJ1G 3ABMC 4FZ1A 2AHZA 2EJ7A 1RP3B 3VQXA 3ZMTA 2Y48A 4DR4O 1VEWA 3CCEV 2EILC 4ZOLB 4QGPA 2HJDA 3FD9A 3ZMZA 3OAAH 1QVGU 4MVSA 4FFBB 4UB6Z 2UUBO 1Q3EA 4B3RB 1M1KW 1Q6HA 4PHZA 4OPHA 2Q67A 3LSQA 5DEDA 3A8TA 2HVKC 4O2AB 1E79H 1MSDA 2XUMA 3G80A 1T5EA 2R70A 2UUCO 3WG7C 1PV0A 1JJOA 4JF3A 1XNQO 1GKFA 2E3CA 1SF9A 3THOA 2GDSA 3E8GA 3OR7C 1R3IC 3OMAB 4DR5B 1AI4A 5KAIZ 2QWOB 2EIMC 5DECA 2E5LO 4MW3A 3RT3C 2HVJC 2OCHA 1KBHA 1GN4A 4L8JA 1FXKA 4FLWA 1N8RW 5KX5B 3LDCA 5EK0A 2YC0A 3J81N 4DV7B 1H8HG 2Y4UA 3OTOO 3EVKA 4JAAA 4P2ZA 5L3GA 2YI8A 2UUCB 1SRYA 4LBEC 1IXBA 3ZHUA 5LGNA 1W0KG 3ASOB 3JASB 1ZWIC 2Q9LA 4Z1VA 1PNKA 1ROPA 3SPCA 5JWPA 4F6RB 4JZGA 3ZHVA 1BMFG 1KB9F 3QNEA 4RWUA 3CPWU 5LHIA 4PI0A 1QR9A 4GCZA 4NYKA 1TUBA 4H0LB 4JI0O 1D5AA 5CA0A 5B1BC 4F4LA 1WB8A 2MK3A 2QJ1A 2R9AA 3L70H 3DXRB 3CRQA 2OIGA 5LA6B 5KHHA 4DR2O 4H33A 4PV1B 3CCSV 3E35A 4JI2O 2PUSA 3JATB 1M5IA 1NTMH 3BHPA 4DK1A 5IYDO 3AG1C 4JYYA 2WLMA 3NR7A 2YEVB 2R9IA 2QGNA 2PTMA 4K3AA 3BVOA 2FYUH 4TV8A 1KKDA 2JVDA 3RYCA 4U7NA 4DW0A 2QTOA 4EFEA 4PJ0Z 2YUAA 5B3SC 1GO3F 3RWRD 3OTOB 4ASUG 4ZOLA 4H44B 4MS2A 5EC2C 4JPRA 4JTCB 1N33O 2AZ2A 3K58A 3RFRA 3CC2V 1L8DA 1WJZA 2ZE8A 2WLKA 2LFRA 3ZS8C 1PD3A 3AG3C 3JD4A 1XMQO 5IWAO 1IBMO 5BMVA 3CMAV 1N34O 3R66A 4U3FH 1WN7A 3HKCA 4H37A 1AR4A 3HKDB 3MD0A 1YI2V 2ADPA 3SYOA 5JH7B 4U7OA 1H2KA 4WBNB 2F93B 2ZR2A 2WLIB 4NR1A 2LFSA 4JI1B 2Q0AA 3KG2A 2D2CB 4LF6O 1NJIW 3ZBHA 2WLLB 2UXDO 3CB2A 5KMGA 3CHXA 2E75B 3SPIA 3JSLA 1AI6A 2EIKC 4KFMA 2QM7A 3CXHF 4YXWG 4XDLA 1X59A 4LF5B 1VQ8V 4I50B 5JJEB 1BGYH 1JMKC 1E1QG 2CGOA 3B4SA 1K3EA 2EULA 2CDYA 3BRCA 4YHHO 4BR6A 3C3SA 4BIUA 1A32A 4UUJC 1YSCA 4X88A 1XQ8A 5LHHA 2P67A 3W7UA 5BR8O 3UCSC 3M8AA 3RYHA 4B7EA 1I7FA 1IZ3A 3SYPA 4AILC 2WLJA 1FJGB 1GRJA 3W7XA 4K0KB 1AR5A 4O4JB 3ABKB 4P9PA 3W7TA 1VQ4V 4LNUA 2B1IA 4JAVA 5HFLA 3IGAC 1QCEA 4DV3O 1Y4MA 4O4HA 4Q6GA 2ZIOA 2EJRA 1G4YB 3JASA 4C7UA 1E1RG 1WB7A 4TQDA 3RN4A 3T1HO 3APOA 3H01A 3FAVA 3MAQA 1G6UA 3K0DA 4DR6B 1WPBA 3AG4C 3JD1A 1EZJA 2ZINA 4B3SB 3P32A 3RW0A 2P5OA 3BA8A 5CN0A 3OFNH 4B08A 1IURA 1MA1A 1M56C 2ITCC 4RUFA 1KKCA 1MZEA 2E74B 4LF9O 3D8CA 4UVBA 4YXWH 2DYSC 4DUZO 5F2VO 3ZRSA 2ZXWB 3ZHRA 4LF6B 3K9SA 5LP6A 2Y4TA 2PY5A 4NTWA 4PA9A 4CZZA 5L3CA 1HNXB 3AG4B 4XDKA 4DR7B 4OX9O 1K4CC 2JGDA 4R6ZA 2Q7HA 1ZAUA 4X1KA 4LFBO 4AHCA 2RQ6A
chains in the Genus database with same CATH topology
4JI8B 3OE7H 4JI2B 5JH7A 1XMOB 1TA8A 4I4TB 4D7TA 2EX3A 3HKCB 5D5QA 5LMUB 4LH6A 4DRXB 1SQFA 1SA0A 2PGGA 3UQ8A 4O4IA 4I9QA 3RGBA 1HNZB 3QG5A 4JI5B 2BTQB 5IYZB 1TVKA 4I50A 1FFXA 2F4VB 4FVMA 1I94B 4FM2A 4UFZA 1B04A 4F6RA 4ZI7B 3JAKA 3RYIA 1Q5OA 4IIJB 4CS3A 2HLDH 1M93A 5EYPA 4CS4A 4FLZA 5LOVA 4EFBA 2PYLA 3BPZA 5EIBD 2WSSH 5C8YB 5FNVB 5JVDA 1YEWA 4ZHQB 3ICXA 4JI6B 4B3TB 1XHXA 3JAWA 4X20B 5DN6I 4JI3B 2OWOA 2HHHB 5KX5A 3U11A 5CB4B 3HKEB 4IIJA 3VQXA 4HBNA 5LXTB 4GKJB 4KHPB 5KHJA 3N2KA 4LR3A 3JARA 4TUYA 4ZOLB 4FM0A 4JI4B 4DK0A 1XNQB 2VWJA 4EB6B 2ZNIA 4X20A 5JJNB 4TV8B 3OAAH 5JCOC 5LP6C 4FFBB 2HEPA 4YY3B 4CH4A 4X1YA 4EEQA 1N34B 4B3RB 1Q3EA 3WB2A 4DR3B 3JARB 4PHZA 2UU9B 5LOVB 4X64B 4DV5B 3SJCC 4YJ2B 4GKKB 1Z5WA 1N32B 1Q43A 4O2AB 5K1PA 1E79H 2UUBB 1HNWB 4UCRA 1T5EA 5LMNB 2R70A 2VQEB 1IBMB 3BA9A 4TV9B 1JJOA 3T1YB 2UXBB 1KMIZ 2E3CA 1V9PA 1NT2B 3THOA 3RYCB 1TVKB 3T1HB 5IJ9A 3RYFB 4HNAA 4O2BA 4NVPA 4DR5B 3CSXA 5KHKA 1N33B 3WB1A 4YJ2A 4X1IB 4B3MB 3N2KB 1IBKB 3JATA 3U0ZA 2ZCEA 3SJAC 4L8JA 3VQWA 4FLWA 5KX5B 3HKEA 4LH7A 1SKVA 2R72A 4O2BB 2BTQA 4IHJA 4IHJB 5KMGB 3JALA 4DV7B 4O4IB 3DSQA 2YIAA 5CA0B 3N2GB 2P22C 2RJZA 2YI8A 2UUCB 1HW7A 5LXTA 2IM9A 3HKBA 1XNRB 4I4TA 3JASB 4YJ3A 5JQGB 5FPOA 4DUYB 4F6RB 3JAWB 4ZI7A 4TOIA 2ZIMA 4U3JA 5FL7H 2JS5A 4X1KB 5GONB 4PI0A 1TUBA 1O9GA 4X1IA 4LFAB 1D5AA 5CA0A 4TV9A 3OEHH 1SQGA 5CA1A 2XOKH 2QJ1A 2R9AA 1O9HA 2PZSA 3RYFA 4FLXA 4AQYB 2Q7EA 5IJ0A 5IJ9B 5LA6B 5KHHA 1WNSA 3QF7A 2JGUA 2VWKA 3JAKB 4UCUA 1DGSA 1Q8IA 1TUBB 2PUSA 3JATB 4I55A 1M5IA 4LFBB 4CH6A 4CS2A 3BHPA 4DK1A 2CAZC 1BSNA 4BWAA 4DV3B 2YIBA 2PTMA 3HKBB 4UCSA 4TV8A 3WB0A 4LF9B 2KKWA 4EB6A 2RQ7A 3JSNA 4ZHQA 2JVDA 5ITZA 3RYCA 4TQFA 4DRXA 1XI1A 3PN1A 4EFEA 1JFFA 4DV1B 1N36B 3M7MX 5D5PA 3E22A 3RWRD 3OTOB 4DUZB 2BTOA 4GYCB 4O2AA 4O4LB 4TUYB 4ZOLA 2E5LB 3JALB 3K5NA 1IBLB 3K58A 2VQFB 4DV4B 4X62B 3RFRA 1S5JA 3BABA 1L8DA 5FNVA 4FM1A 4DV6B 4O4JA 5C8YA 4X65B 4X1YB 2F66C 3BAAA 4FFBA 5EZYB 3ETQA 3ZS8C 4KL1A 3A2FA 1VF7A 2V7QH 4CC5A 5CA1B 5BMVA 4DV0B 4JI7B 1H2SB 1WN7A 3HKCA 3HKDB 1QQCA 2XNDH 1TAEA 4DR2B 4X66B 3RYIB 5JH7B 2XHBA 3U10A 4FLUA 1Z5VA 4WBNB 5KHIA 2F93B 4DV2B 2ZNJA 5BR8B 4JV5B 4JI1B 2Q0AA 4FLYA 4UCVA 4OX9B 1P49A 3FFQA 3CB2A 5KMGA 2F95B 1H8EH 3CHXA 3UT5B 1SA0B 3JSLA 3K57A 4JYAB 4JI0B 2E5YA 2PYJA 3QTCA 2YI9A 4CC6A 3K59A 3LNNA 2UXDB 5KHGA 3K5MA 1FS0E 4NXMB 4LF5B 4PI2A 5IYZA 4K8ZA 3K5OA 4I50B 4LF8B 3SGIA 1AQTA 5JJEB 1JMKC 5LYJA 3K5LA 3BRCA 2UUAB 5LP6B 3VQVA 1XQ8A 3RYHB 2QM4A 5J2TB 5LA6A 1BSHA 5K1XA 5J2UA 4UCOA 3RYHA 5J2TA 1I7FA 2ZM6B 4AILC 1XHZA 5CB4A 1FJGB 4CH5A 4K0KB 1TGOA 1QHTA 4O4JB 4DR1B 4LNUB 3B2EE 3SR2C 4LNUA 1KU9A 5JVDB 5LYJB 4K8XA 4O4HA 4Q6GA 2ZIOA 4ZIBA 3ZEDA 5J2UB 5JQGA 3JASA 4YJ3B 1M4UA 3E22B 5IWAB 1HR0B 4TQDA 4D7SA 5JJJB 5EYPB 1XMQB 4I55B 4ASUH 3MAQA 1G6UA 4DR6B 1WPBA 3N2GA 4YHHB 4UCTA 2ZINA 4B3SB 3UT5A 2P5OA 3BA8A 5IJ0B 2V4DA 3OFNH 1FFXB 4B08A 2UXCB 5EZYA 1RSOA 2Q7GA 4O4HB 2QE7H 1J5EB 4YXWH 3HKDA 3VQYA 5GONA 5JCOA 2YXLA 4LFCB 4GLXA 4LF6B 4WBNA 3SJBC 5LP6A 2OYQA 3OTFA 2F1MA 2PY5A 4FLVA 4O4LA 5BMVB 2YIBD 4CH3A 5FPRA 4LF4B 4HNAB 4LF7B 1JFFB 4BW9A 1HNXB 4DR7B 4NXNB 2GV9A 2Q7HA 4FLTA 3FKSH 1X4TA 1ZAUA 4DR4B 5ITZB 3IAYA 4X1KA 5EIBC 4U3JB 4AHCA 2RQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHP A;  1BSN A;  3DSQ A;  3OE7 H;  4ASU H;  2YIA A;  4BWA A;  4CH5 A;  5K1P A;  2YIB A;  1G6U A;  1E79 H;  2WSS H;  3OEH H;  2XOK H;  2QJ1 A;  1O9H A;  2RJZ A;  2YI8 A;  2ZIN A;  2ZNI A;  1AQT A;  2YIB D;  4CH3 A;  2R70 A;  3OAA H;  2Q7E A;  2RQ7 A;  1H8E H;  2ZCE A;  2JVD A;  2XND H;  3OFN H;  5DN6 I;  4TQF A;  4BW9 A;  2HEP A;  4CH4 A;  2Q7G A;  2E5Y A;  4Q6G A;  3VQW A;  3VQV A;  4CS3 A;  2HLD H;  2ZIO A;  3QTC A;  2E3C A;  2QE7 H;  4ZIB A;  2Q7H A;  2R72 A;  2YI9 A;  3VQX A;  2PGG A;  2ZIM A;  3ZED A;  3FKS H;  2PUS A;  5FL7 H;  4YXW H;  3VQY A;  4CS4 A;  1BSH A;  4TQD A;  2ZNJ A;  5K1X A;  1FS0 E;  1O9G A;  2V7Q H;  4CH6 A;  2RQ6 A;  4CS2 A; 
#chains in the Genus database with same CATH topology
 1TA8 A;  4I4T B;  4D7T A;  1MMM A;  2VRZ A;  2EX3 A;  4GT1 A;  2B1G A;  3A0R A;  3QO5 A;  5BY1 A;  4PA6 A;  1R3J C;  1NVP B;  4IT5 A;  3ZMS A;  1SQF A;  3UM7 A;  2PGG A;  3RGB A;  1AP5 A;  2XTA A;  3Q4H B;  3C90 A;  1TVK A;  4N21 A;  4I0X B;  3P30 A;  4FVM A;  1DF4 A;  1I94 B;  4DV0 O;  1Y74 B;  3JD2 A;  5LGU A;  3JD3 A;  2RCV A;  2KB1 A;  3G67 A;  1K33 A;  3JAK A;  4GUN A;  2ODM A;  3RYI A;  1Q5O A;  2HLD H;  5B1A C;  1WPX A;  2IJI A;  4LWS B;  2IW5 A;  2LO1 A;  1YEW A;  5KAF Z;  3T1Y O;  5DN6 I;  1AVM A;  4JI3 B;  2HHH B;  4FIP C;  5CB4 B;  4IIJ A;  5LMN O;  1SER A;  1R1B A;  4DV2 O;  3G71 V;  5LXT B;  3ZHQ A;  4JTA B;  1GMG A;  3QO8 A;  3WU2 Z;  4JI4 B;  4JAS A;  3SDL A;  1BQ0 A;  2ZNI A;  4X20 A;  4TV8 B;  2QWP B;  4QE7 A;  4W4L A;  2VQE O;  4CH4 A;  4EEQ A;  4DR3 B;  3JAR B;  2ZR3 A;  4PD4 F;  5LOV B;  1YIJ V;  1Y76 B;  1HNX O;  3CC7 V;  2P7T C;  1ORQ C;  1Z5W A;  5KLV H;  3J80 N;  1FS0 G;  3WFV A;  1KP3 A;  3FYE B;  1HNW B;  4UCR A;  2N04 A;  4I7Z B;  3FB5 C;  2VQE B;  3ETE A;  1IXM A;  1IBM B;  1AJP A;  2YDE A;  2UXB B;  4KXR A;  1NT2 B;  1SZT A;  2XAG A;  3D3Q A;  2H8P C;  2NNU A;  1JVM A;  1KP2 A;  1NR7 A;  4O2B A;  4NVP A;  1D5N A;  2LW7 A;  2K1E A;  1N33 B;  3WB1 A;  3ZN1 A;  4ICG A;  1MSW D;  1ZLZ A;  3NXS A;  4K0K O;  4J11 A;  1VQ5 V;  1OCR C;  3TET A;  1YDX A;  3HKE A;  2ZT9 B;  4E4E A;  2R72 A;  4O2B B;  2BTQ A;  4IHJ B;  3F7V C;  3BY6 A;  1SES A;  1JR9 A;  1FXK B;  3N2G B;  1OCO B;  1BL8 A;  2P22 C;  3FAV B;  1RFY A;  3P3P A;  4X89 A;  1OCZ B;  3BCC H;  4JI8 O;  1XNR B;  4YJ3 A;  4ZBM A;  2XAJ A;  1ARO P;  4DUY B;  3JAW B;  4DXW A;  1M56 B;  4X64 O;  1F23 A;  2ZIM A;  5FL7 H;  5KA6 A;  4RUE A;  5GON B;  1YIT V;  1Y74 A;  1KD1 W;  1N36 O;  1TUE B;  1O9G A;  4QNH B;  4X1I A;  1NKD A;  2H94 A;  4TT3 G;  4TV9 A;  3OEH H;  1SQG A;  1R3L C;  2XOK H;  1RM1 B;  1O9H A;  4W4K A;  3E8H A;  4AQY B;  5IJ9 B;  3DXR A;  4GKK O;  3QF7 A;  1YXB A;  3OGI B;  4JZ2 A;  2A9H A;  4I55 A;  1NH2 B;  4LFB B;  2FB5 A;  4YY3 O;  3J7A U;  1QBZ A;  3ABK C;  5B1O A;  1OJH A;  2YIB A;  3HPL C;  3OW2 U;  3WB0 A;  2KKW A;  2EIM B;  5ITZ A;  4NKG B;  1OCC B;  1EFR G;  4BIZ A;  4TQF A;  4DRX A;  2UXN A;  2LQT A;  1XI1 A;  5L3F A;  1WP7 A;  4D6T H;  3SYA A;  3MHS C;  1JFF A;  1K92 A;  3S3X A;  5LGT A;  1UJW B;  1FPO A;  3M7M X;  1S5H C;  4PEL A;  1SC5 B;  4QE9 A;  4DUZ B;  5KA5 A;  3QVN A;  1OCO C;  2BTO A;  2Q0O C;  4TUY B;  2E5L B;  2CTW A;  1NZ6 A;  3A0B Z;  1CPY A;  2W6J G;  2VQF B;  3H1K H;  4X62 B;  5FNV A;  1P7G A;  4DV6 B;  3AG1 B;  2F66 C;  3BAA A;  3UKM A;  2HG5 C;  5EZY B;  2EIK B;  5E1A C;  3UO2 A;  4MW8 A;  1AIL A;  1KUQ A;  1FXK C;  4CC5 A;  5CA1 B;  2V7Q H;  1NBM G;  2ETN A;  3F7Y C;  1PP9 H;  2XND H;  5B1B B;  5H9C A;  1TAE A;  1BSM A;  2DWD C;  5CA3 A;  3OE7 G;  2GUZ A;  1GAX A;  2AW9 A;  2GTA A;  2GBO A;  3L72 H;  3W7S A;  1VP7 A;  4PA7 A;  4DV2 B;  1JJ2 U;  4IL6 Z;  2ZNJ A;  5BR8 B;  4FLY A;  2X6B A;  3TK1 A;  4UCV A;  4MTX A;  4UVC A;  2BOB C;  1FKA O;  4KUM A;  1UPG A;  3JYC A;  4WFF A;  2F95 B;  1NR1 A;  2QEX V;  3UT5 B;  3K57 A;  4JI0 B;  2PYJ A;  2YI9 A;  4CC6 A;  5B66 Z;  3K59 A;  1BHA A;  3FX7 A;  4FK5 C;  2OCC C;  3TJT A;  2WLI A;  3ZX6 A;  5L3E A;  5L3B A;  2HP8 A;  3OGC C;  4PI2 A;  5IYZ A;  4K8Z A;  2BSK B;  4I9W A;  3SPG A;  5LYJ A;  2GTS A;  2A0L A;  1B06 A;  3K3W A;  2AXT Z;  1K5S A;  3VQV A;  1PPJ H;  1RM1 C;  4DR1 O;  3B09 A;  5LA6 A;  1BSH A;  1K7D A;  4J9Z B;  4RO2 A;  5J2U A;  5J2T A;  2WA4 A;  2ZE5 A;  4CH5 A;  2X7R B;  1WP8 A;  1TGO A;  3OT7 A;  1FFT B;  2HFE C;  3L74 H;  1OV9 A;  2UUA O;  3O65 A;  2KG7 B;  2JGD B;  2VQF O;  1N0J A;  3ZED A;  1DK1 A;  5J2U B;  2GSM B;  1Y67 A;  5IWA B;  2ILM A;  3OM3 B;  1XMQ B;  3ZN0 A;  1KYO F;  3EXA A;  2JS3 A;  1LNQ A;  1MZF A;  5IJ0 B;  3K06 A;  1FD9 A;  4KP4 A;  2V4D A;  2IJH A;  4BIO A;  2XOK G;  1EZV H;  3D36 C;  1HNW O;  3CXC U;  3ZCC A;  2R9R B;  2QE7 H;  4GX1 A;  3ZMV A;  1J5E B;  3SPJ A;  2P06 A;  4TSF G;  4JI5 O;  1V55 B;  2DW4 A;  4BAY A;  4GLX A;  1L1F A;  3SJB C;  4UV8 A;  2OYQ A;  3ABM B;  3LDD A;  2F1M A;  1R6K A;  2WLN A;  4DR3 O;  4O4L A;  5HFM A;  3STL C;  1XOU A;  2YIB D;  3KKY A;  4LF4 B;  4JI3 O;  4BW9 A;  2GV9 A;  2Q8V A;  2IJK A;  4MVZ A;  4UVA A;  3CJH B;  1YJN V;  1N4C A;  1BS3 A;  1I5X A;  2A7W A;  2QWR B;  4DR4 B;  1VF6 A;  4J7Z A;  4JI2 B;  4X66 O;  5JH7 A;  3RBZ A;  3LUT B;  1K4D C;  4XDJ A;  1XMO B;  2D3O W;  1JOY A;  2XND G;  3ZHS A;  3HKC B;  1Y66 A;  3FB6 C;  2UXC O;  2FTK A;  1RPO A;  2JIZ G;  1QVF U;  1L0L H;  3JCU Z;  4DRX B;  1SA0 A;  1W59 A;  4EKW A;  2JEU A;  4I9Q A;  2V7Q G;  2BTQ B;  4I50 A;  4G27 B;  2YSU B;  3DTU B;  4B3M O;  2F4V B;  1SET A;  4PDL A;  1B3Q A;  4X65 O;  1ZX3 A;  3G6B A;  2DYS B;  1SQB H;  4FM2 A;  1IBL O;  2QWN B;  4DV4 O;  2QR4 A;  3W7W A;  4F6R A;  4LF5 O;  1GM9 A;  1F4N A;  2OTL V;  4J41 A;  4CS4 A;  1R6N A;  2UU9 O;  2F23 A;  1YCI A;  1AJQ A;  4TWK A;  1I5Y A;  3CC4 V;  2WSS H;  5C8Y B;  2KSD A;  4WCE V;  3IJ4 A;  3R65 A;  5JVD A;  2EIL B;  4ZHQ B;  1US6 A;  4Q20 A;  2DQ0 A;  2P6J A;  4B3T B;  4GX0 A;  5IYC O;  1QU7 A;  4DR7 O;  4WFA V;  5KX5 A;  4HAM A;  2RNB A;  1V55 C;  2WWW A;  4HBN A;  4HYO A;  4MVQ A;  5GTH Z;  4GKJ B;  4KHP B;  2Q5Z A;  3N2K A;  1FAF A;  1ZSP A;  2JRI A;  3JAR A;  4FM0 A;  3C3T A;  1XNQ B;  2VWJ A;  4EB6 B;  2ITD C;  3LSS A;  5JJN B;  1HP8 A;  5JCO C;  1H2G A;  2IBZ H;  3X2Q C;  4NTY A;  4YY3 B;  2Z0A A;  1N34 B;  4X1Y A;  1F51 A;  3WB2 A;  1GN3 A;  3OEH G;  2WPD G;  2UU9 B;  2CH7 B;  1S3J A;  3K9A A;  4HZ3 A;  4FZ0 A;  2X6C A;  4YJ2 B;  4GKK B;  1XEQ A;  3A0H Z;  1AI5 A;  2HLD G;  1Q43 A;  5K1P A;  1N32 B;  2DJV A;  1R6T A;  1EN5 A;  3LSU A;  1Q82 W;  2UUB B;  4B3R O;  5LMN B;  1JPX A;  1VQK V;  1XUQ A;  1PM9 A;  4RQF A;  3T1Y B;  1KMI Z;  1UFI A;  4DR6 O;  3RYC B;  2FML A;  3T1H B;  3E86 A;  2H3O A;  1K9M W;  5H5N A;  1XNR O;  1FJG O;  3ML0 A;  1JQ0 A;  3CSX A;  5KHK A;  1FXV A;  4YJ2 A;  1VQM V;  4B3M B;  2F4V O;  3QO7 A;  1IBK B;  3U0Z A;  4XBF A;  2ZCE A;  3SJA C;  2A3Q A;  3UO3 A;  4MVR A;  1HR0 O;  1XL4 A;  3VQW A;  1K5Q A;  3ABU A;  4LH7 A;  1GK9 A;  3SYQ A;  3ASN C;  3LDE A;  3JCZ A;  2QKC A;  1GH6 A;  1SQV H;  3OUS A;  2RJZ A;  4JGS A;  1HW7 A;  3AG3 B;  4LF4 O;  1NTZ H;  5B3S B;  1BT8 A;  5LXT A;  2IM9 A;  3HKB A;  2AGA A;  1NS1 A;  4I4T A;  1EBO A;  2QTS A;  5JQG B;  2LP7 A;  2ZE6 A;  2RDC A;  1K8A W;  4JAU A;  2AZ0 A;  5E79 Z;  4QIW F;  2JS5 A;  4X1K B;  3AG2 B;  1J5E O;  2BOC C;  2DN9 A;  3ZRW A;  4OGQ B;  1QLE B;  4JI1 O;  4J80 A;  2XT9 A;  5CA1 A;  2ARH A;  3N27 A;  2PZS A;  3RYF A;  1PKX A;  5IJ0 A;  5IY5 B;  2K9P A;  1WNS A;  2VWK A;  2X6A A;  4WF9 V;  3ZMU A;  5A2Q N;  3T2M A;  1DGS A;  1Q8I A;  1KEC A;  1TUB B;  1BCC H;  3K0G A;  1ENV A;  4YIP A;  2CAZ C;  5AG2 A;  1OCR B;  4I0X A;  2KG7 A;  4UV9 A;  2P4K A;  3AG2 C;  3CCR V;  4LF9 B;  4EB6 A;  2RQ7 A;  3JSN A;  1S77 D;  4WFH A;  2QKA A;  4UB8 Z;  3E89 A;  3PN1 A;  1B6Q A;  5IY5 C;  3F5T A;  3M99 B;  2ZXW C;  2PF4 E;  1XBL A;  3Q4H A;  4GYC B;  1YHQ V;  4L87 A;  5EBL C;  3JAL B;  3AK1 A;  1GTO A;  3CRC A;  1IBL B;  1Y76 A;  4MTF A;  4DV4 B;  1Y6X A;  2DOS A;  1S5J A;  3BAB A;  4FM1 A;  1S72 V;  4O4J A;  4FJC C;  4X65 B;  4X1Y B;  4KL1 A;  2DMX A;  2W0X A;  1M57 B;  3I56 V;  1ZL8 A;  4DV0 B;  3K79 A;  4JI7 B;  1VIB A;  3STZ C;  5L3D A;  1V54 C;  1BZK A;  3JAM N;  1QQC A;  3IFX A;  4RAI A;  2QSA A;  4DR2 B;  4X66 B;  1U96 A;  1BHB A;  1GM8 A;  1VQ9 V;  4DV1 O;  4FLU A;  3I55 V;  1Z5V A;  5KHI A;  3FKS G;  4PDM A;  1YF2 A;  5A9G A;  2IH3 C;  4P30 A;  1P49 A;  1L0N H;  3FFQ A;  2M7W A;  3MHH C;  2IU0 A;  4DW1 A;  1FYJ A;  3CYO A;  1XIL A;  1JA8 A;  1N32 O;  1CEZ A;  2UXD B;  1ZL8 B;  2CH7 A;  2ZQM A;  3K5M A;  5B1N A;  1FS0 E;  2IH1 C;  1VQ7 V;  4NXM B;  4LF8 B;  1RSO B;  3K5O A;  4J7K A;  3SGI A;  1YVW A;  4X62 O;  1AQT A;  3H1J H;  5LL6 Y;  3OFN G;  2W6I G;  2CTQ A;  2HKO A;  1F7Y A;  2ZDI C;  1I0H A;  1K34 A;  4E2L A;  2B5U A;  3B8M A;  2DE0 X;  4IYH A;  1HDJ A;  1QLE C;  5J2T B;  2QM4 A;  3L9D A;  2OT5 A;  5K1X A;  1XHZ A;  5CB4 A;  2IJJ A;  3K08 A;  3O9O A;  4J42 A;  2L6L A;  1QHT A;  2WLH A;  2C2A A;  4LNU B;  3B2E E;  3SR2 C;  1KU9 A;  5JVD B;  5LYJ B;  1K73 W;  3KCY A;  2MW2 B;  2Z3Y A;  3APQ A;  3DC5 A;  2Y0P A;  1LUV A;  3PJS K;  5JQG A;  3B40 A;  3E22 B;  1LUW A;  5JJJ B;  3E8B A;  4D7S A;  1NI8 A;  4NXM O;  4I55 B;  3ASN B;  3CRA A;  3ZRV A;  4R50 A;  1AB3 A;  3OUF A;  3D3I A;  1SZX A;  4DO2 A;  3UT5 A;  3VOU A;  2XAS A;  4PDV A;  1EN4 A;  1EN6 A;  3CRM A;  3SPH A;  2UXC B;  5TIS Z;  5EZY A;  4LCU C;  1XMO O;  3EFF K;  3VQY A;  4RQE A;  1URF A;  3FB7 C;  2N05 A;  2YXL A;  3F5W C;  4WFB V;  4WBN A;  4AQY O;  4NB5 A;  2Z5U A;  5BMV B;  2CK3 G;  1P84 F;  2DYR B;  3AK2 A;  4CBC A;  4HNA B;  3WG7 B;  1NTK H;  1MAB G;  3TGU H;  1XL6 A;  1MG1 A;  1Q6U A;  1D2D A;  4BW5 A;  1XRE A;  1X4T A;  3FKS H;  5ITZ B;  2E76 B;  5EIB C;  4GZR B;  4U3J B;  3OAA G;  1J95 A;  4JI8 B;  4JTD B;  1SQP H;  3E8F A;  3CS5 A;  1AJN A;  2ZD9 A;  1RPR A;  5IT9 N;  5D5Q A;  5LMU B;  4LH6 A;  2EZP A;  2QDO A;  1Q6I A;  4O4I A;  1BQZ A;  3CME V;  2ZDI A;  4JI5 B;  5IYZ B;  2EIJ C;  2OIE A;  3E83 A;  2IU3 A;  2QA4 V;  4UFZ A;  1OZ0 A;  2LGW A;  1NH2 D;  2LGQ A;  4ZI7 B;  2GUZ B;  4CS3 A;  1M93 A;  3RVZ A;  3JD0 A;  2V1D A;  4FLZ A;  1HNZ O;  4GX2 A;  2GHY A;  1S5L Z;  5LBQ A;  1WAZ A;  4DR5 O;  2PYL A;  4JYA O;  1WA8 A;  4JYC A;  5FNV B;  5IE9 A;  1Q81 W;  3HR0 A;  1G1X B;  1CP9 A;  3ICX A;  4JI6 B;  2ZE7 A;  2DYR C;  1YJ9 V;  1VQL V;  3JAW A;  4QPJ A;  4X20 B;  3CD6 V;  2OWO A;  4I5S A;  4LF7 O;  2Q4P A;  1PNL A;  3U11 A;  3HKE B;  5KHJ A;  4J10 A;  5H6R A;  4LR3 A;  4G28 B;  4LFC O;  3IC9 A;  4TUY A;  4DK0 A;  4B7K A;  1NVP D;  4F6E A;  1DLB A;  2PI4 A;  4MVM A;  5B1A B;  5LP6 C;  4Z1M G;  2HEP A;  2W0F C;  3CCV V;  3ZRW B;  1R3K C;  4AI8 A;  3CCJ V;  4X64 B;  4DV5 B;  3SJC C;  2NN4 A;  3CEI A;  3I5D A;  5CBF A;  3ZHT A;  2RN9 A;  2EIJ B;  2OCC B;  3GB7 C;  5H2F Z;  1DTO A;  1H2M A;  3BA9 A;  2HJF C;  4TV9 B;  3K04 A;  3BEH A;  1GN6 A;  3CJH A;  1V9P A;  1TVK B;  5IJ9 A;  4FFK A;  1DF5 A;  1PL4 A;  3RYF B;  4HNA A;  2EZO A;  3AK3 A;  4GX5 A;  3CE2 A;  1SS3 A;  4X1I B;  5KUM A;  4OXS A;  1KQS U;  3ABL C;  3N2K B;  3JAT A;  1Q90 D;  2EIN C;  1SKV A;  2Q69 A;  2QKS A;  4R8C A;  4IHJ A;  5KMG B;  3JAL A;  3OMI B;  4O4I B;  1EM1 A;  2XAQ A;  4UXN A;  4G2K A;  3DSQ A;  2YIA A;  4MTO A;  5CA0 B;  4MTG A;  1COW G;  3K03 A;  3DC6 A;  2NR5 A;  1SQQ H;  4MT8 A;  4LWS A;  3G4S V;  4DV6 O;  3IC7 A;  4FMT A;  5FPO A;  3ZJZ A;  3G6E V;  4ZI7 A;  1E79 G;  1XDC A;  4TOI A;  4U3J A;  4X8A A;  5DM6 V;  1K97 A;  1QLN A;  4LFA B;  4N23 A;  5LMU O;  4KHP O;  1Z2G A;  4GKJ O;  2EBO A;  1W0J G;  3SJQ C;  4FLX A;  3ABT A;  2Q7E A;  1JX9 A;  4B3S O;  5CMU A;  4PA3 A;  4NXN O;  2JGU A;  2P4V A;  3FYI B;  3JAK B;  1YTF B;  4UCU A;  4JI4 O;  1H2N A;  5FL7 G;  2Q6A A;  4JV5 O;  2M6Y A;  1PNM A;  3CWB H;  4CH6 A;  4CS2 A;  4PDR A;  1BSN A;  5EC1 C;  4BWA A;  1Q7Y W;  4DV3 B;  3DGE A;  2HHH O;  3T1C A;  1QR8 A;  3HKB B;  4UCS A;  1F4M A;  3T4Z A;  3GWO A;  1S0V A;  4DUY O;  4A5U B;  3S3W A;  3TCU A;  3LNM B;  2N74 A;  4ZHQ A;  2FKX A;  2WSS G;  1WLE A;  4YIO A;  3BFR A;  4P9O A;  4DV1 B;  1N36 B;  5D5P A;  3E22 A;  4O2A A;  4O4L B;  3D36 A;  1AP6 A;  3CX5 F;  1H2L A;  3K5N A;  5B5E Z;  2XAH A;  3CCL V;  4JYB A;  2DQ3 A;  5C8Y A;  5BXZ A;  3GVM A;  5EBM C;  3B77 A;  3KZI Z;  3H1H H;  2BSK A;  2EIN B;  1VF5 B;  4FFB A;  2RMK B;  3ETQ A;  1OCZ C;  3A2F A;  3OMN B;  1VF7 A;  1I08 A;  3EHB B;  4J7J A;  4NTX A;  3GWK C;  1CXZ B;  2ZM6 O;  4ABM A;  3ZIA G;  3CP1 A;  1YZB A;  2FL4 A;  1H2S B;  4IGG A;  1AI7 A;  1IX9 A;  1VQO V;  1HWY A;  1ZTE A;  2UXB O;  1ZUQ A;  4QJF B;  5BZB A;  1M90 W;  3RYI B;  2AHY A;  2XHB A;  3U10 A;  1R73 A;  2JJ2 G;  4FPP A;  3AG7 A;  3AEI A;  2L35 A;  1V54 B;  4LFA O;  4JV5 B;  2UXX A;  4PA4 A;  2VS0 A;  4OX9 B;  5DN6 G;  2PI5 A;  3ETG A;  1H8E H;  1SA0 B;  4JYA B;  1SQX H;  2A79 B;  1Q86 W;  2E5Y A;  3VBB A;  4LF8 O;  1PL0 A;  3QTC A;  2OTJ V;  5GW7 A;  3CRR A;  3LNN A;  2A06 H;  3HB3 B;  2X0L A;  5KHG A;  1AR1 B;  3B8N A;  1VQ6 V;  4B3T O;  2XAF A;  5H6Q A;  1IVS A;  1YTF D;  4MVO A;  2WAM A;  2WA3 A;  1M57 C;  1VQP V;  3H1L H;  5IYB O;  2Y0I A;  3K5L A;  2UUA B;  1VMG A;  5LP6 B;  1H38 A;  2P90 A;  3RYH B;  2B9Z A;  3MDS A;  4UCO A;  2ZM6 B;  3SYC A;  2WLL A;  1S76 D;  1P7B A;  2ATK C;  3L75 H;  5FLX N;  4DR1 B;  2ZKO A;  2CTP A;  3TXQ A;  3H9V A;  4K8X A;  5KUK A;  4JI7 O;  2F43 G;  4ZIB A;  1W2B U;  4YJ3 B;  1M4U A;  1I94 O;  1HR0 B;  5EYP B;  3T4D A;  4X9Q A;  1JCH A;  4ASU H;  2CE4 A;  2YS8 A;  2Y69 B;  4DV5 O;  3X2Q B;  3N2G A;  4YHH B;  4UCT A;  2JK5 C;  2DWE C;  4Z2W A;  2G38 A;  2YXY A;  5J9P C;  1FFX B;  3OEE G;  1RSO A;  2Q7G A;  4O4H B;  2QM8 A;  2BE3 A;  1FXH A;  3HKD A;  4WFE A;  1P4R A;  3L71 H;  1GN2 A;  3ASO C;  5GON A;  5JCO A;  3CCU V;  4LFC B;  5C93 A;  1WA8 B;  3OTF A;  4R7C A;  4FLV A;  4H13 B;  3ZRX A;  1LR1 A;  4LP8 A;  1VQN V;  1BE3 H;  2LJ2 A;  5FPR A;  4CH3 A;  1OCC C;  1H8E G;  1N0N A;  4LF7 B;  1JFF B;  1VF6 C;  3OD4 A;  4NXN B;  2Y69 C;  2CGN A;  2CUG A;  3E2E A;  1NU1 H;  3H1I H;  3ETD A;  4FLT A;  3IAY A;  2LW1 A;  5IDJ A;  3OR6 C;  3OE7 H;  1G8M A;  1QNM A;  2YEV A;  3RVY A;  1MOF A;  5CBG A;  1M9N A;  2HR3 A;  4JI6 O;  4DV7 O;  2YIC A;  5CBH A;  2NLJ C;  2BCC H;  3CCM V;  3UQ8 A;  2ADQ B;  1KC8 W;  2YID A;  1HNZ B;  3QG5 A;  1NQT A;  1IDS A;  2YXH A;  3KCX A;  2QE7 G;  4QPK A;  1FFX A;  2QWQ B;  1VAR A;  4ZKI A;  4MSW C;  4LC1 A;  1U97 A;  1B04 A;  5LHG A;  3P3N A;  3FB8 C;  4IIJ B;  5EYP A;  1GM7 A;  1OHH G;  2JDI G;  4OPA A;  2CTR A;  4IYI A;  5LOV A;  1THZ A;  4EFB A;  2Q73 A;  3BPZ A;  2JEX A;  5EBW C;  5EIB D;  3TXS A;  1YJW V;  3L73 H;  1MNG A;  4J9Y B;  4DYL A;  4MVU A;  2O57 A;  2Q68 A;  5GTI Z;  4WFG A;  2KQX A;  1IBK O;  3CCQ V;  4K35 A;  3ABL B;  1XHX A;  2JJ1 G;  3ABM C;  4FZ1 A;  2AHZ A;  2EJ7 A;  1RP3 B;  3VQX A;  3ZMT A;  2Y48 A;  4DR4 O;  1VEW A;  3CCE V;  2EIL C;  4ZOL B;  4QGP A;  2HJD A;  3FD9 A;  3ZMZ A;  3OAA H;  1QVG U;  4MVS A;  4FFB B;  4UB6 Z;  2UUB O;  1Q3E A;  4B3R B;  1M1K W;  1Q6H A;  4PHZ A;  4OPH A;  2Q67 A;  3LSQ A;  5DED A;  3A8T A;  2HVK C;  4O2A B;  1E79 H;  1MSD A;  2XUM A;  3G80 A;  1T5E A;  2R70 A;  2UUC O;  3WG7 C;  1PV0 A;  1JJO A;  4JF3 A;  1XNQ O;  1GKF A;  2E3C A;  1SF9 A;  3THO A;  2GDS A;  3E8G A;  3OR7 C;  1R3I C;  3OMA B;  4DR5 B;  1AI4 A;  5KAI Z;  2QWO B;  2EIM C;  5DEC A;  2E5L O;  4MW3 A;  3RT3 C;  2HVJ C;  2OCH A;  1KBH A;  1GN4 A;  4L8J A;  1FXK A;  4FLW A;  1N8R W;  5KX5 B;  3LDC A;  5EK0 A;  2YC0 A;  3J81 N;  4DV7 B;  1H8H G;  2Y4U A;  3OTO O;  3EVK A;  4JAA A;  4P2Z A;  5L3G A;  2YI8 A;  2UUC B;  1SRY A;  4LBE C;  1IXB A;  3ZHU A;  5LGN A;  1W0K G;  3ASO B;  3JAS B;  1ZWI C;  2Q9L A;  4Z1V A;  1PNK A;  1ROP A;  3SPC A;  5JWP A;  4F6R B;  4JZG A;  3ZHV A;  1BMF G;  1KB9 F;  3QNE A;  4RWU A;  3CPW U;  5LHI A;  4PI0 A;  1QR9 A;  4GCZ A;  4NYK A;  1TUB A;  4H0L B;  4JI0 O;  1D5A A;  5CA0 A;  5B1B C;  4F4L A;  1WB8 A;  2MK3 A;  2QJ1 A;  2R9A A;  3L70 H;  3DXR B;  3CRQ A;  2OIG A;  5LA6 B;  5KHH A;  4DR2 O;  4H33 A;  4PV1 B;  3CCS V;  3E35 A;  4JI2 O;  2PUS A;  3JAT B;  1M5I A;  1NTM H;  3BHP A;  4DK1 A;  5IYD O;  3AG1 C;  4JYY A;  2WLM A;  3NR7 A;  2YEV B;  2R9I A;  2QGN A;  2PTM A;  4K3A A;  3BVO A;  2FYU H;  4TV8 A;  1KKD A;  2JVD A;  3RYC A;  4U7N A;  4DW0 A;  2QTO A;  4EFE A;  4PJ0 Z;  2YUA A;  5B3S C;  1GO3 F;  3RWR D;  3OTO B;  4ASU G;  4ZOL A;  4H44 B;  4MS2 A;  5EC2 C;  4JPR A;  4JTC B;  1N33 O;  2AZ2 A;  3K58 A;  3RFR A;  3CC2 V;  1L8D A;  1WJZ A;  2ZE8 A;  2WLK A;  2LFR A;  3ZS8 C;  1PD3 A;  3AG3 C;  3JD4 A;  1XMQ O;  5IWA O;  1IBM O;  5BMV A;  3CMA V;  1N34 O;  3R66 A;  4U3F H;  1WN7 A;  3HKC A;  4H37 A;  1AR4 A;  3HKD B;  3MD0 A;  1YI2 V;  2ADP A;  3SYO A;  5JH7 B;  4U7O A;  1H2K A;  4WBN B;  2F93 B;  2ZR2 A;  2WLI B;  4NR1 A;  2LFS A;  4JI1 B;  2Q0A A;  3KG2 A;  2D2C B;  4LF6 O;  1NJI W;  3ZBH A;  2WLL B;  2UXD O;  3CB2 A;  5KMG A;  3CHX A;  2E75 B;  3SPI A;  3JSL A;  1AI6 A;  2EIK C;  4KFM A;  2QM7 A;  3CXH F;  4YXW G;  4XDL A;  1X59 A;  4LF5 B;  1VQ8 V;  4I50 B;  5JJE B;  1BGY H;  1JMK C;  1E1Q G;  2CGO A;  3B4S A;  1K3E A;  2EUL A;  2CDY A;  3BRC A;  4YHH O;  4BR6 A;  3C3S A;  4BIU A;  1A32 A;  4UUJ C;  1YSC A;  4X88 A;  1XQ8 A;  5LHH A;  2P67 A;  3W7U A;  5BR8 O;  3UCS C;  3M8A A;  3RYH A;  4B7E A;  1I7F A;  1IZ3 A;  3SYP A;  4AIL C;  2WLJ A;  1FJG B;  1GRJ A;  3W7X A;  4K0K B;  1AR5 A;  4O4J B;  3ABK B;  4P9P A;  3W7T A;  1VQ4 V;  4LNU A;  2B1I A;  4JAV A;  5HFL A;  3IGA C;  1QCE A;  4DV3 O;  1Y4M A;  4O4H A;  4Q6G A;  2ZIO A;  2EJR A;  1G4Y B;  3JAS A;  4C7U A;  1E1R G;  1WB7 A;  4TQD A;  3RN4 A;  3T1H O;  3APO A;  3H01 A;  3FAV A;  3MAQ A;  1G6U A;  3K0D A;  4DR6 B;  1WPB A;  3AG4 C;  3JD1 A;  1EZJ A;  2ZIN A;  4B3S B;  3P32 A;  3RW0 A;  2P5O A;  3BA8 A;  5CN0 A;  3OFN H;  4B08 A;  1IUR A;  1MA1 A;  1M56 C;  2ITC C;  4RUF A;  1KKC A;  1MZE A;  2E74 B;  4LF9 O;  3D8C A;  4UVB A;  4YXW H;  2DYS C;  4DUZ O;  5F2V O;  3ZRS A;  2ZXW B;  3ZHR A;  4LF6 B;  3K9S A;  5LP6 A;  2Y4T A;  2PY5 A;  4NTW A;  4PA9 A;  4CZZ A;  5L3C A;  1HNX B;  3AG4 B;  4XDK A;  4DR7 B;  4OX9 O;  1K4C C;  2JGD A;  4R6Z A;  2Q7H A;  1ZAU A;  4X1K A;  4LFB O;  4AHC A;  2RQ6 A; 
#chains in the Genus database with same CATH homology
 4JI8 B;  3OE7 H;  4JI2 B;  5JH7 A;  1XMO B;  1TA8 A;  4I4T B;  4D7T A;  2EX3 A;  3HKC B;  5D5Q A;  5LMU B;  4LH6 A;  4DRX B;  1SQF A;  1SA0 A;  2PGG A;  3UQ8 A;  4O4I A;  4I9Q A;  3RGB A;  1HNZ B;  3QG5 A;  4JI5 B;  2BTQ B;  5IYZ B;  1TVK A;  4I50 A;  1FFX A;  2F4V B;  4FVM A;  1I94 B;  4FM2 A;  4UFZ A;  1B04 A;  4F6R A;  4ZI7 B;  3JAK A;  3RYI A;  1Q5O A;  4IIJ B;  4CS3 A;  2HLD H;  1M93 A;  5EYP A;  4CS4 A;  4FLZ A;  5LOV A;  4EFB A;  2PYL A;  3BPZ A;  5EIB D;  2WSS H;  5C8Y B;  5FNV B;  5JVD A;  1YEW A;  4ZHQ B;  3ICX A;  4JI6 B;  4B3T B;  1XHX A;  3JAW A;  4X20 B;  5DN6 I;  4JI3 B;  2OWO A;  2HHH B;  5KX5 A;  3U11 A;  5CB4 B;  3HKE B;  4IIJ A;  3VQX A;  4HBN A;  5LXT B;  4GKJ B;  4KHP B;  5KHJ A;  3N2K A;  4LR3 A;  3JAR A;  4TUY A;  4ZOL B;  4FM0 A;  4JI4 B;  4DK0 A;  1XNQ B;  2VWJ A;  4EB6 B;  2ZNI A;  4X20 A;  5JJN B;  4TV8 B;  3OAA H;  5JCO C;  5LP6 C;  4FFB B;  2HEP A;  4YY3 B;  4CH4 A;  4X1Y A;  4EEQ A;  1N34 B;  4B3R B;  1Q3E A;  3WB2 A;  4DR3 B;  3JAR B;  4PHZ A;  2UU9 B;  5LOV B;  4X64 B;  4DV5 B;  3SJC C;  4YJ2 B;  4GKK B;  1Z5W A;  1N32 B;  1Q43 A;  4O2A B;  5K1P A;  1E79 H;  2UUB B;  1HNW B;  4UCR A;  1T5E A;  5LMN B;  2R70 A;  2VQE B;  1IBM B;  3BA9 A;  4TV9 B;  1JJO A;  3T1Y B;  2UXB B;  1KMI Z;  2E3C A;  1V9P A;  1NT2 B;  3THO A;  3RYC B;  1TVK B;  3T1H B;  5IJ9 A;  3RYF B;  4HNA A;  4O2B A;  4NVP A;  4DR5 B;  3CSX A;  5KHK A;  1N33 B;  3WB1 A;  4YJ2 A;  4X1I B;  4B3M B;  3N2K B;  1IBK B;  3JAT A;  3U0Z A;  2ZCE A;  3SJA C;  4L8J A;  3VQW A;  4FLW A;  5KX5 B;  3HKE A;  4LH7 A;  1SKV A;  2R72 A;  4O2B B;  2BTQ A;  4IHJ A;  4IHJ B;  5KMG B;  3JAL A;  4DV7 B;  4O4I B;  3DSQ A;  2YIA A;  5CA0 B;  3N2G B;  2P22 C;  2RJZ A;  2YI8 A;  2UUC B;  1HW7 A;  5LXT A;  2IM9 A;  3HKB A;  1XNR B;  4I4T A;  3JAS B;  4YJ3 A;  5JQG B;  5FPO A;  4DUY B;  4F6R B;  3JAW B;  4ZI7 A;  4TOI A;  2ZIM A;  4U3J A;  5FL7 H;  2JS5 A;  4X1K B;  5GON B;  4PI0 A;  1TUB A;  1O9G A;  4X1I A;  4LFA B;  1D5A A;  5CA0 A;  4TV9 A;  3OEH H;  1SQG A;  5CA1 A;  2XOK H;  2QJ1 A;  2R9A A;  1O9H A;  2PZS A;  3RYF A;  4FLX A;  4AQY B;  2Q7E A;  5IJ0 A;  5IJ9 B;  5LA6 B;  5KHH A;  1WNS A;  3QF7 A;  2JGU A;  2VWK A;  3JAK B;  4UCU A;  1DGS A;  1Q8I A;  1TUB B;  2PUS A;  3JAT B;  4I55 A;  1M5I A;  4LFB B;  4CH6 A;  4CS2 A;  3BHP A;  4DK1 A;  2CAZ C;  1BSN A;  4BWA A;  4DV3 B;  2YIB A;  2PTM A;  3HKB B;  4UCS A;  4TV8 A;  3WB0 A;  4LF9 B;  2KKW A;  4EB6 A;  2RQ7 A;  3JSN A;  4ZHQ A;  2JVD A;  5ITZ A;  3RYC A;  4TQF A;  4DRX A;  1XI1 A;  3PN1 A;  4EFE A;  1JFF A;  4DV1 B;  1N36 B;  3M7M X;  5D5P A;  3E22 A;  3RWR D;  3OTO B;  4DUZ B;  2BTO A;  4GYC B;  4O2A A;  4O4L B;  4TUY B;  4ZOL A;  2E5L B;  3JAL B;  3K5N A;  1IBL B;  3K58 A;  2VQF B;  4DV4 B;  4X62 B;  3RFR A;  1S5J A;  3BAB A;  1L8D A;  5FNV A;  4FM1 A;  4DV6 B;  4O4J A;  5C8Y A;  4X65 B;  4X1Y B;  2F66 C;  3BAA A;  4FFB A;  5EZY B;  3ETQ A;  3ZS8 C;  4KL1 A;  3A2F A;  1VF7 A;  2V7Q H;  4CC5 A;  5CA1 B;  5BMV A;  4DV0 B;  4JI7 B;  1H2S B;  1WN7 A;  3HKC A;  3HKD B;  1QQC A;  2XND H;  1TAE A;  4DR2 B;  4X66 B;  3RYI B;  5JH7 B;  2XHB A;  3U10 A;  4FLU A;  1Z5V A;  4WBN B;  5KHI A;  2F93 B;  4DV2 B;  2ZNJ A;  5BR8 B;  4JV5 B;  4JI1 B;  2Q0A A;  4FLY A;  4UCV A;  4OX9 B;  1P49 A;  3FFQ A;  3CB2 A;  5KMG A;  2F95 B;  1H8E H;  3CHX A;  3UT5 B;  1SA0 B;  3JSL A;  3K57 A;  4JYA B;  4JI0 B;  2E5Y A;  2PYJ A;  3QTC A;  2YI9 A;  4CC6 A;  3K59 A;  3LNN A;  2UXD B;  5KHG A;  3K5M A;  1FS0 E;  4NXM B;  4LF5 B;  4PI2 A;  5IYZ A;  4K8Z A;  3K5O A;  4I50 B;  4LF8 B;  3SGI A;  1AQT A;  5JJE B;  1JMK C;  5LYJ A;  3K5L A;  3BRC A;  2UUA B;  5LP6 B;  3VQV A;  1XQ8 A;  3RYH B;  2QM4 A;  5J2T B;  5LA6 A;  1BSH A;  5K1X A;  5J2U A;  4UCO A;  3RYH A;  5J2T A;  1I7F A;  2ZM6 B;  4AIL C;  1XHZ A;  5CB4 A;  1FJG B;  4CH5 A;  4K0K B;  1TGO A;  1QHT A;  4O4J B;  4DR1 B;  4LNU B;  3B2E E;  3SR2 C;  4LNU A;  1KU9 A;  5JVD B;  5LYJ B;  4K8X A;  4O4H A;  4Q6G A;  2ZIO A;  4ZIB A;  3ZED A;  5J2U B;  5JQG A;  3JAS A;  4YJ3 B;  1M4U A;  3E22 B;  5IWA B;  1HR0 B;  4TQD A;  4D7S A;  5JJJ B;  5EYP B;  1XMQ B;  4I55 B;  4ASU H;  3MAQ A;  1G6U A;  4DR6 B;  1WPB A;  3N2G A;  4YHH B;  4UCT A;  2ZIN A;  4B3S B;  3UT5 A;  2P5O A;  3BA8 A;  5IJ0 B;  2V4D A;  3OFN H;  1FFX B;  4B08 A;  2UXC B;  5EZY A;  1RSO A;  2Q7G A;  4O4H B;  2QE7 H;  1J5E B;  4YXW H;  3HKD A;  3VQY A;  5GON A;  5JCO A;  2YXL A;  4LFC B;  4GLX A;  4LF6 B;  4WBN A;  3SJB C;  5LP6 A;  2OYQ A;  3OTF A;  2F1M A;  2PY5 A;  4FLV A;  4O4L A;  5BMV B;  2YIB D;  4CH3 A;  5FPR A;  4LF4 B;  4HNA B;  4LF7 B;  1JFF B;  4BW9 A;  1HNX B;  4DR7 B;  4NXN B;  2GV9 A;  2Q7H A;  4FLT A;  3FKS H;  1X4T A;  1ZAU A;  4DR4 B;  5ITZ B;  3IAY A;  4X1K A;  5EIB C;  4U3J B;  4AHC A;  2RQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...