2RQ6A

Solution structure of the epsilon subunit of the f1-atpase from thermosynechococcus elongatus bp-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
b'MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase epsilon chain
publication title Structural and functional analysis of the intrinsic inhibitor subunit epsilon of F1-ATPase from photosynthetic organisms.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Hydrolase
total genus 24
structure length 138
sequence length 138
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rq6A02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2rq6A01
4TQDA 2RQ7A 3FKSH 2E5YA 2RQ6A 2WSSH 2ZINA 2ZNIA 1FS0E 5K1XA 2YIBD 4CS3A 2Q7GA 2Q7EA 3OE7H 2XOKH 2Q7HA 3OEHH 4ASUH 3VQVA 2JVDA 3DSQA 4CH3A 4ZIBA 3BHPA 1H8EH 2R70A 2ZIOA 4CH4A 4BW9A 2HLDH 3OAAH 1BSHA 1O9GA 2YI8A 3QTCA 2V7QH 1O9HA 2YI9A 4CH6A 2QE7H 4BWAA 4Q6GA 2PUSA 3OFNH 2HEPA 2R72A 2ZCEA 5K1PA 1E79H 4TQFA 4YXWH 2XNDH 1BSNA 5FL7H 2E3CA 2YIAA 3VQXA 2RJZA 2ZIMA 1G6UA 3VQYA 2PGGA 4CH5A 2QJ1A 3VQWA 4CS4A 2ZNJA 4CS2A 5DN6I 2YIBA 3ZEDA 1AQTA
chains in the Genus database with same CATH superfamily
4PA3A 1I08A 1IZ3A 1H2KA 1PKXA 3WG7B 3JSLA 4UUJC 1YJNV 2X6CA 2Y69B 4JI4O 4DR4B 2KG7B 3C90A 1D5NA 3LSQA 5LL6Y 2XAJA 2IBZH 5BMVA 2X7RB 4H13B 2AHYA 2H94A 3E22A 3FYEB 3HPLC 3RGBA 3OUSA 4LF7O 4MSWC 3K5MA 1L0LH 1Q6IA 4O4LA 3QVNA 3T4DA 5J2UA 5JJJB 1M57C 1JMKC 4QIWF 5CBGA 4N23A 3AK3A 1OCZC 2P90A 4O4IB 5BR8O 2UXCB 1WP7A 3L73H 4ZHQB 2ITCC 2W6JG 4KFMA 3THOA 4O4JA 4J11A 1K8AW 2LFSA 2RJZA 4JTAB 4DV2B 1AJPA 2YEVB 4FZ1A 4G2KA 1T5EA 2P4VA 2Q5ZA 3DGEA 1XHXA 1BS3A 5FPRA 5B3SC 5A2QN 3CCQV 2YI9A 1COWG 3OEHG 3AG2B 4LFCO 1QR8A 1H8HG 4DV5B 1H2NA 2ZDIA 1G4YB 4WBNB 3ZMVA 5ITZA 1X4TA 5KA6A 4JI5O 5CB4B 4DR2B 4H33A 4NXNB 4LF9O 3U0ZA 3CYOA 2ZE5A 2P6JA 2QKAA 1HNWO 3ML0A 1K92A 2E3CA 2YC0A 1H38A 1J5EO 1WPXA 2VWJA 1VQLV 2RDCA 4LF6B 4KL1A 4X1KA 1W0JG 3OE7H 4HNAA 2QM8A 2YIDA 3SYOA 1S5HC 5KHKA 1KQSU 1OCOC 3P3NA 1VQ8V 2HJFC 2OTLV 2ZR2A 4I55B 1GTOA 1U96A 1I7FA 4I5SA 2DWDC 4PV1B 4FK5C 4GX0A 1VARA 5JJNB 3G6BA 4DR7O 4B3RO 4DV7O 5GONB 3FB6C 4QGPA 1HNXB 3FD9A 4JI1O 1FFTB 4I9WA 4MVRA 4R50A 1YI2V 1HR0B 4PELA 2LQTA 3ZHQA 4DR6O 4MTGA 1JJ2U 3TXSA 1D5AA 5B1BC 1GM9A 3ZS8C 1QHTA 3JD2A 4OX9O 2M6YA 5LP6B 1VF6A 3OFNH 1KP3A 4JI3O 2N05A 5KUKA 4PD4F 4FLUA 4U3JA 1ZWIC 1N0JA 3E8BA 2VRZA 2R9IA 3A0RA 2B1IA 3FYIB 2QEXV 3B09A 3IGAC 5EBWC 3J81N 4LF5B 3CC4V 3OMIB 4B3MB 2WLNA 1OCCC 2UU9O 2IW5A 4YXWH 3CRCA 2Q0OC 2WLKA 2DYRB 1RM1C 1MSDA 5LA6A 2XAGA 2OCCC 4UB6Z 1SKVA 1EN6A 3ZJZA 1BCCH 1SQPH 4JASA 3CRQA 1IVSA 1CPYA 4K0KB 4D7TA 1SERA 5JCOA 1WB7A 5C8YA 1YIJV 3OW2U 1AP6A 2WPDG 4FLTA 3TETA 1OCRC 2XOKH 5DEDA 5AG2A 5CA0A 1Y6XA 5EBLC 1EM1A 5JVDB 5EC1C 2K1EA 2Z0AA 3BEHA 3E22B 1PV0A 3EVKA 4CS2A 1GK9A 3L75H 4I4TA 2N04A 3OT7A 2ZDIC 1AI7A 2Q7GA 3DC6A 2YDEA 2PF4E 3RWRD 3SPHA 2QTSA 4DR1O 4O4JB 1N36B 3JARA 2PUSA 4LF4B 1KC8W 3ABKB 3T1HB 1DK1A 1XI1A 1IBMB 1GO3F 3LDDA 3AG7A 2Q4PA 1XEQA 4X64B 2BOCC 4R8CA 1HWYA 2JS5A 3HKCB 3W7WA 4YJ3A 4X62O 1N0NA 2D2CB 2EZPA 3AG3C 3N27A 4TV9A 3K9AA 1SQVH 3H1JH 4DW1A 4JYYA 3EHBB 3CX5F 4GYCB 4DR3O 3SPIA 4U3FH 2ZE8A 3ASOC 4YHHO 2WAMA 3CMEV 3ZHUA 4DV1O 4H37A 4JYAB 1QU7A 2QJ1A 3N2KB 5BY1A 1VMGA 1DF4A 1M4UA 2ZNIA 3MD0A 3LDEA 3A2FA 1H8EH 2PI5A 3ABLB 1VQPV 1YDXA 2ADQB 2GTSA 1JPXA 1I94B 1DGSA 3W7SA 3K08A 1XREA 1KB9F 2A9HA 1GH6A 4DR5B 2PYLA 2A06H 4QE7A 3LNMB 3CD6V 1GAXA 1VQ5V 1TVKA 4HAMA 1KMIZ 3ASNC 1H2LA 4TUYA 2QDOA 2V4DA 3SYCA 5LGTA 1CXZB 3OUFA 1VP7A 1VF6C 1NH2B 2EINC 3CCRV 2BSKA 1VQNV 2W0XA 4JI8B 2EBOA 4WFEA 1R3IC 3T1YB 1XNQO 3JD1A 5KMGA 2Q6AA 3K5NA 4ZOLB 1RSOB 4GKKB 4E4EA 1WAZA 3UCSC 3OR6C 1AROP 4N21A 1ZLZA 1JJOA 2F4VB 3SR2C 4WFBV 1BQZA 2NR5A 1Z5WA 5FNVB 4IHJB 1XNRO 3FB5C 3CP1A 2B9ZA 1V9PA 3CPWU 2EILC 3N2GA 3Q4HA 4FVMA 3GWOA 2YXYA 4X1YA 5LHHA 3JALA 5IY5B 3A0BZ 4JI7B 3K0DA 4PJ0Z 3ETGA 1LUWA 3JAKA 1NR1A 2ZCEA 3OTOB 3PN1A 5IDJA 3ABUA 3K3WA 1VQ4V 2HVJC 5IYZA 1RPRA 3ABTA 1RPOA 3JYCA 2QWNB 5EYPB 4MTFA 5B66Z 2IH3C 1FJGO 5EBMC 4F6RB 1D2DA 2Z3YA 4X1IB 4AQYB 4FLYA 2F95B 5DM6V 5IYCO 1AP5A 4FFKA 3S3WA 1NTMH 1S3JA 3K5LA 1NS1A 5LMUB 3CJHA 3AEIA 3TGUH 2UUAO 2UUBO 4RWUA 2Y48A 3D36A 2JGDA 3VQVA 4ZIBA 4LH6A 3JATA 2EIJB 2ZXWC 5IYDO 2YI8A 4H44B 2HG5C 1QLEC 4X8AA 1IBLO 1IDSA 5KAIZ 2DE0X 3H1KH 4JI0O 4EFBA 1VQKV 3ZHTA 1BZKA 1FXKA 2UXNA 4W4KA 4CBCA 4DK1A 2BE3A 1MG1A 1K9MW 3JASA 3ZRSA 1SQQH 3AG1B 1R3JC 4F6EA 4ZI7B 1MZEA 1MNGA 3QTCA 5L3FA 1IBKO 3RT3C 3K57A 3BA8A 5CA1B 1XMQB 2Y0IA 4NXMO 2DOSA 3G80A 1M56C 2QM4A 2RNBA 3JAWA 4X66O 4K8ZA 2ZNJA 3ZN0A 3B40A 5CMUA 5HFLA 4DV4O 1Y76A 4WFFA 1O9HA 5F2VO 5LXTA 2DW4A 2V7QG 5EIBC 2XNDH 4FM1A 4DRXB 3SJBC 3CRMA 4PA4A 2HR3A 2WWWA 4JI6B 3ZMZA 2RQ6A 4PA7A 2QR4A 1R73A 1YSCA 4CH3A 4IL6Z 3ZHSA 3UT5A 4FLXA 4O2AB 2UUCO 3SPJA 1DTOA 3T2MA 2EULA 2KB1A 4LNUB 3F7VC 4TV8A 4CH5A 2RCVA 4MS2A 4Z1MG 1THZA 4DR4O 2JEUA 4QPKA 1YVWA 3RYFB 1UPGA 1MOFA 3STZC 1K34A 1XMOB 2XUMA 5L3DA 3APQA 3F5WC 2ZM6B 1OV9A 4UVBA 1EBOA 4CC6A 1AR1B 4B3TO 4LFBB 3P32A 5KAFZ 4QNHB 1N32O 2EX3A 3DSQA 1TA8A 1V54C 2EIKC 1MSWD 3BAAA 2O57A 5JWPA 2E75B 4O2BA 4DV2O 1F4NA 2E76B 3E89A 1LR1A 4KXRA 2OIGA 2JEXA 3OD4A 2V1DA 3C3SA 2YIAA 4JI4B 3HKDB 1XOUA 4OPAA 3S3XA 3KG2A 1EN4A 1H2MA 1FS0E 2YIBD 2LFRA 3TK1A 1QLNA 3QO7A 4X20B 4DV5O 3HKBA 2FL4A 3ABMC 4CH6A 4AI8A 2A7WA 3H9VA 4GT1A 3G67A 4JI2B 1M57B 1E1QG 4RO2A 5DN6G 1FFXA 1QVFU 4UFZA 4B7KA 4TWKA 1Y67A 3WU2Z 5BR8B 4DR2O 2GSMB 1OCZB 1NJIW 3CRAA 3U10A 2P67A 2RQ7A 2UXXA 5GTIZ 3JCUZ 5JH7A 5K1XA 1YHQV 1N4CA 3OEHH 1NT2B 2ZIOA 2F23A 3D36C 4IGGA 4UV8A 3B2EE 2OTJV 1ENVA 2HLDG 4LF6O 5KLVH 4P30A 4UCSA 3CMAV 4KP4A 1EFRG 2P06A 5B3SB 3M99B 1BT8A 4CS4A 1B04A 2W0FC 5H9CA 2XAFA 1FXKC 5IJ9A 2ZR3A 3CWBH 4J41A 4DK0A 2G38A 2GTAA 5LGNA 4BW5A 2OIEA 3JD3A 1XBLA 1PNLA 1MA1A 1W0KG 4LF9B 4WFGA 2YUAA 1NR7A 4IIJB 4KHPO 5H5NA 1ZUQA 4DV6B 1JVMA 1KECA 2JJ2G 4D7SA 1ZL8A 2DN9A 1HR0O 4GX2A 1KP2A 1YJ9V 2EIMC 4BIZA 4PDMA 3M8AA 5JQGB 1H2GA 1JA8A 1S5JA 1QQCA 1OCOB 3AG4C 4B3SB 3IJ4A 4X9QA 5GTHZ 1PD3A 4F4LA 1AI4A 3RW0A 5LHGA 1CP9A 5DECA 1L0NH 4O4HB 3LSSA 3CRRA 3HKEA 5KA5A 2HHHB 4DR7B 4B3RB 4DV7B 3CC2V 1HW7A 4LWSA 3VQXA 4JI1B 3B8NA 3ZMTA 1HNZB 3ZRWA 1Y74A 3R65A 1WA8A 4LF5O 4B3MO 1B3QA 3H1HH 2WLLB 4J7JA 3DXRA 3W7UA 3KCXA 3K0GA 4NR1A 3ZMSA 1NVPB 2EJ7A 4A5UB 4UB8Z 3CCSV 5B1BB 4YJ2B 2RN9A 4Q20A 4MTOA 4EB6A 1E79G 3SPGA 4PA9A 4JI3B 1AQTA 1B6QA 1S0VA 2ZD9A 4JF3A 2YICA 3OAAG 4WCEV 2PZSA 2WSSG 2BTQB 3E86A 5CA3A 1Q6HA 1TUBB 5KX5B 3BFRA 2B1GA 5E1AC 3P3PA 1G8MA 4J42A 2P5OA 1I5XA 2UU9B 4DUZB 4UCVA 1OCCB 2VQFO 4RQFA 4B08A 4BIOA 3SDLA 2NLJC 1RM1B 2OCCB 4IYHA 5CBHA 4GLXA 3IC7A 3K79A 4ASUG 1IX9A 4EFEA 4UXNA 1JFFA 5BMVB 5FPOA 3CSXA 4BR6A 3ZRXA 4O4LB 1SQXH 3AK1A 1YXBA 3IC9A 3OEEG 5J2UB 3TCUA 1GMGA 1K33A 5IJ0A 1N36O 4LF4O 5L3EA 3T1HO 1IBMO 2CTPA 5L3CA 1K4DC 1SESA 4LH7A 4X64O 1SF9A 3RYIA 2CH7A 1OCRB 4YY3B 4PDVA 2OCHA 1TAEA 1G6UA 2Q9LA 3SYQA 3UQ8A 4JYCA 5J2TA 2LO1A 5KHHA 4HYOA 1SA0A 4JPRA 3RYCA 3H1LH 1Q7YW 2WLIA 1N34B 2CTRA 3FKSG 4CZZA 2AHZA 4JYAO 1SZXA 1XQ8A 3D3QA 2GUZA 4I50A 2CUGA 1Q6UA 3CC7V 2E5LB 4GUNA 5ITZB 3VOUA 4DUYB 4LFAB 2ZE7A 4UCRA 3IAYA 1HP8A 1NH2D 1AJNA 2E74B 1I94O 4J7KA 1XUQA 4GX1A 2WLMA 4DW0A 1ZTEA 5LYJA 1E1RG 3AG3B 4DR5O 3FAVA 4MW3A 4TT3G 2UXDB 3ZHRA 3L72H 4X1KB 4HNAB 4YHHB 1N33B 2AGAA 1Q8IA 4DV1B 3ASOB 2XHBA 2QTOA 1P4RA 3STLC 5J9PC 2YSUB 1I5YA 2CAZC 5H2FZ 1UJWB 4X65O 2OT5A 1YF2A 2X6AA 2QGNA 2KG7A 1M1KW 2D3OW 4GKKO 2VQEB 2IJIA 3UKMA 1TGOA 3DTUB 4DO2A 1K73W 3CS5A 2Z5UA 1IURA 4NTXA 2Y0PA 2P7TC 5LMNB 2MW2B 2YXHA 1AI6A 2DYSC 1VF7A 2K9PA 4U7NA 1BSNA 1YTFB 4GX5A 4O4IA 4MW8A 4DYLA 3ASNB 4HBNA 4JI7O 2IJHA 4WF9V 1BL8A 2WLJA 3W7XA 2YEVA 4JV5B 3OTOO 2A79B 2EINB 3RYHA 2NN4A 1NQTA 4K8XA 3B4SA 3RBZA 2DQ0A 5IE9A 3K03A 4U3JB 4LR3A 1F4MA 4UCTA 1TUEB 4FFBA 5B1AB 5KHIA 3UO3A 1LNQA 4RUFA 1XL4A 4AQYO 3KKYA 2VS0A 4WBNA 3WB2A 3GVMA 2QWPB 4LC1A 3BA9A 5CB4A 1WN7A 1AR5A 5LMUO 2EILB 5LA6B 5LOVA 2LP7A 4LF8B 2IJKA 3C3TA 2YIBA 3MHSC 3X2QC 2B5UA 2E5YA 1HDJA 4R6ZA 1ZSPA 4FIPC 4JAVA 5EK0A 2JVDA 3RFRA 4MVQA 4BW9A 4GKJO 1S76D 4C7UA 1FXVA 1V55C 2Y4TA 3F7YC 5IWAO 2NNUA 4BIUA 1FJGB 1P49A 3OR7C 2AZ0A 5C8YB 3J7AU 2QE7G 3L74H 2Q69A 3MHHC 5IT9N 5CA0B 1M9NA 4JTCB 1SQBH 3SJQC 4AHCA 4LCUC 5JJEB 1XMQO 4MVZA 1Z2GA 3H01A 1J95A 2ZKOA 2UUAB 4P2ZA 3OGCC 3I55V 5HFMA 4WFAV 4FLVA 1BHAA 3MAQA 3CCJV 2QWOB 1NU1H 5GONA 3A0HZ 1H2SB 1IXMA 4I4TB 2ZXWB 3MDSA 1XILA 1KKDA 1QLEB 1EN5A 5FL7G 5B5EZ 1FS0G 5LGUA 3JARB 1SZTA 2CGNA 2UXBB 1R6KA 4NKGB 4OPHA 4JI6O 4RAIA 4W4LA 5B1OA 3EXAA 5LP6A 1SA0B 4YJ3B 1IBKB 2PGGA 4TV9B 1G1XB 4EEQA 3QF7A 4ABMA 4UCOA 2V7QH 3A8TA 4CH4A 2JS3A 1M56B 4QPJA 3ZHVA 4IT5A 1K3EA 4DV0B 3WG7C 2YXLA 4ZKIA 3VQYA 4YIPA 2Y69C 5BXZA 3T1CA 4PA6A 1PPJH 1MZFA 4DV3B 2MK3A 1K4CC 4J9YB 2EJRA 1XMOO 3GB7C 2AW9A 1KUQA 4RQEA 1VQMV 2PY5A 5CN0A 3FAVB 2ZM6O 1P7BA 5KHGA 4I0XA 3CB2A 3ZCCA 5D5PA 3H1IH 1NKDA 2CDYA 1VQ7V 4LFBO 3OMAB 1B06A 4JTDB 1L8DA 1TVKB 1YJWV 1JR9A 3ICXA 4G27B 3BRCA 1URFA 4JAAA 1VQOV 3QG5A 4TUYB 2UXCO 2BCCH 2OWOA 1RP3B 2JIZG 4UVCA 5IYBO 4B7EA 3BABA 2BSKB 3LNNA 4TQFA 1PP9H 5JVDA 1YCIA 4ZBMA 1YZBA 5KMGB 2ADPA 4NB5A 1S77D 2QM7A 4OGQB 1FYJA 3NR7A 1JQ0A 2N74A 3AG2C 3FFQA 2Q7HA 3B8MA 4JI2O 3E83A 4LF7B 4J10A 4P9PA 4B3TB 2IU0A 4BWAA 1N32B 1SETA 1KBHA 2DQ3A 1DLBA 1NTKH 1FPOA 1WPBA 3JAMN 1GRJA 1V54B 2EIKB 3N2GB 3Q4HB 3NXSA 4X1YB 5L3GA 4NXNO 1DF5A 3JALB 3RYHB 5D5QA 2CK3G 4IYIA 2XAQA 3OM3B 1R3LC 3JAKB 3HKCA 2R9AA 4DXWA 2XAHA 4TOIA 1Q5OA 4FFBB 2ITDC 5IYZB 4U7OA 4NTYA 3EFFK 4AILC 3ZMUA 4LFCB 3ABMB 4Z2WA 2GHYA 1Q90D 2F66C 3OTFA 4MVUA 4CS3A 1QNMA 3N2KA 4MT8A 3BHPA 2HLDH 2W6IG 5LOVB 1OZ0A 3D3IA 3CCVV 1NI8A 4TSFG 3OE7G 1KYOF 2IU3A 4JI5B 2WA3A 2BTOA 5A9GA 2IJJA 3CJHB 1Y4MA 1PNKA 4DV6O 4FZ0A 3K06A 1HNWB 2JGDB 3JATB 2GV9A 1MMMA 1J5EB 1M5IA 1HNXO 1BSMA 3L70H 3QO5A 2GBOA 4QE9A 1FXKB 4H0LB 4B3SO 4JAUA 1K5SA 4LP8A 3FB7C 1BE3H 1M93A 3JASB 1QCEA 2CGOA 2FB5A 5LP6C 1NVPD 4D6TH 2HHHO 2Q68A 1Q86W 1QBZA 2L35A 1SQFA 4ZOLA 4KHPB 1RSOA 1XHZA 3G71V 1XL6A 1HNZO 4GZRB 3JAWB 1SRYA 3SYAA 3CEIA 2JGUA 1JCHA 2PI4A 1ORQC 4PI2A 3OFNG 5EZYA 2H8PC 1OJHA 5FNVA 4IHJA 2EIMB 1Y76B 3WB0A 4LBEC 2DYRC 5LXTB 4MVMA 4DR6B 1FKAO 3ETQA 3AG4B 3ZBHA 2HEPA 3TXQA 3JD0A 4OX9B 1AVMA 2A3QA 3E35A 5FLXN 4YXWG 2BOBC 1Q81W 2JJ1G 3UT5B 2X0LA 1PL4A 4NVPA 3O65A 5B1NA 3VBBA 4FM2A 4J80A 5EYPA 2QWQB 1GM7A 4K0KO 4MVSA 1IXBA 1E79H 4TV8B 4DUZO 4F6RA 1OHHG 2M7WA 1R3KC 1F51A 4X1IA 4BAYA 1R6NA 3JD4A 3OAAH 3HR0A 2A0LA 3KZIZ 2XASA 3T4ZA 4FLZA 1BQ0A 2WSSH 4RUEA 4I0XB 1JX9A 2R70A 1KD1W 1WLEA 1AJQA 2HKOA 2XOKG 1MABG 3CHXA 3M7MX 5E79Z 4UCUA 3ZX6A 4L8JA 3VQWA 5BZBA 1NZ6A 3ZEDA 3I5DA 2LW7A 1KKCA 3ABKC 2RMKB 2VWKA 3RN4A 4ASUH 4O2BB 3E8HA 3AK2A 4YY3O 2VQFB 4FPPA 3ZN1A 4JZGA 1L1FA 1P7GA 1GN6A 4ZI7A 2ODMA 2GDSA 4UVAA 2L6LA 4MVOA 5CA1A 1N34O 3K58A 5KUMA 1UFIA 3CXHF 4PDRA 1BHBA 3HKBB 3QO8A 1PM9A 3E2EA 3FB8C 2E5LO 3SJAC 1FFXB 4DUYO 4LFAO 2ILMA 1Z5VA 1N8RW 2LW1A 4DR1B 3LSUA 3ABLC 5JH7B 4FLWA 4I9QA 4DRXA 4TQDA 3FKSH 4JZ2A 3CCLV 3K04A 2F93B 1VIBA 3APOA 3L9DA 3PJSK 4X62B 2UXDO 1QVGU 1CEZA 3K9SA 3CXCU 1GKFA 5K1PA 1AR4A 1H8EG 1VF5B 4O2AA 5H6RA 1N33O 3ETDA 2QWRB 1WNSA 4DR3B 5IJ9B 1Q3EA 1X59A 2FYUH 2LGQA 1A32A 2ZE6A 4LNUA 2QA4V 5EC2C 2LJ2A 1W2BU 1YTFD 4HZ3A 1R6TA 4FM0A 3BPZA 1WP8A 2DWEC 2VQEO 3SGIA 4JI8O 2ETNA 3RYFA 4E2LA 3T1YO 3ZIAG 3ETEA 2ZQMA 3BVOA 3K5OA 4YIOA 1R1BA 2OYQA 2KSDA 4Z1VA 3WFVA 3IFXA 3CCEV 1Q43A 1I0HA 3G4SV 5LMNO 2Q7EA 1AB3A 1ZL8B 5TISZ 2F43G 2Q73A 5H6QA 1P84F 1M90W 2F4VO 1AI5A 2CTWA 4XDKA 1F23A 2PYJA 3K59A 1BGYH 3G6EV 1WB8A 4P9OA 3R66A 1VQ9V 5IY5C 2ZIMA 4JV5O 1Y66A 2H3OA 2Q67A 5DN6I 4ZHQA 4X65B 3HKDA 3E8GA 3HKEB 1W59A 3D8CA 1VQ6V 2JRIA 2P4KA 3LDCA 5B1AC 3U11A 1XNQB 3OGIB 2DJVA 3SPCA 4LWSB 4Q6GA 5EZYB 1ROPA 5GW7A 4X20A 4X89A 3ZRWB 1Y74B 1WA8B 2CTQA 1GN3A 4I7ZB 4EKWA 3J80N 2QSAA 2JK5C 1GM8A 3DXRB 2DYSB 2YS8A 1XNRB 3UM7A 3HB3B 4J7ZA 2JDIG 4OXSA 1YEWA 4GCZA 2ZT9B 4LF8O 2Q0AA 4EB6B 3DC5A 2C2AA 2IM9A 2PTMA 1GN2A 1KU9A 3RVYA 2WA4A 1WJZA 2EIJC 1JOYA 3E8FA 4R7CA 1GN4A 2Q8VA 2QKCA 4G28B 4X88A 4PI0A 2F1MA 2AXTZ 2EZOA 5JCOC 3CCUV 2HVKC 2HFEC 2HJDA 3BCCH 1O9GA 1S72V 1ZAUA 3P30A 4PHZA 2R72A 1FXHA 2AZ2A 4NTWA 4CC5A 1QR9A 3AG1C 4K3AA 3JCZA 4ICGA 3FX7A 4I55A 1K5QA 2IH1C 2KKWA 1K97A 1EZVH 4UV9A 4MTXA 3BY6A 1JFFB 1VEWA 4IIJA 2HP8A 2UUBB 3X2QB 2QE7H 1EZJA 4GKJB 5KHJA 1F7YA 5C93A 3WB1A 5IJ0B 5IWAB 2LGWA 1IBLB 1Q82W 1V55B 2UXBO 4JI0B 5JQGA 4QJFB 3QNEA 3SYPA 3JSNA 4WFHA 2X6BA 2ATKC 2FMLA 3RYIB 2CH7B 1U97A 5EIBD 2Y4UA 4O4HA 1BMFG 1S5LZ 4J9ZB 5LHIA 5J2TB 5FL7H 2ARHA 5L3BA 1YITV 2FKXA 3RYCB 4XDJA 2XT9A 1PL0A 2WLIB 2XNDG 3B77A 3W7TA 2WLHA 4K35A 5LBQA 2QKSA 2ZINA 1ZX3A 2XTAA 4L87A 4NXMB 3LUTB 4X66B 4NYKA 4DV0O 3L71H 1PNMA 2GUZB 3F5TA 1LUVA 4I50B 2KQXA 3UO2A 2WLLA 3I56V 3GWKC 4DV4B 4XDLA 3RVZA 4DV3O 1XDCA 2CE4A 3OMNB 1SS3A 2P22C 4YJ2A 4FJCC 3KCYA 1US6A 3CCMV 1AILA 1RFYA 3O9OA 4JYBA 4FMTA 5CBFA 2FTKA 1SC5B 1BSHA 1FAFA 5LYJB 2DMXA 1K7DA 4PDLA 4XBFA 1NBMG 3CE2A 4JGSA 2BTQA 4KUMA 2R9RB 1TUBA 3SJCC 1FD9A 1NTZH 2UUCB 3ZRVA 5KX5A 3TJTA 1SQGA
chains in the Genus database with same CATH topology
3RYCA 5EYPB 1N34B 1SQFA 3JSLA 4F6RB 4ZOLA 4KHPB 1RSOA 4DR4B 1XHZA 4X1IB 4AQYB 1XQ8A 4FLYA 2F95B 3JAWB 4I50A 2JGUA 2E5LB 4PI2A 5EZYA 5ITZB 5BMVA 3K5LA 5LMUB 4DUYB 4LFAB 3E22A 3RGBA 5FNVA 3K5MA 4IHJA 4O4LA 3WB0A 4UCRA 3IAYA 5J2UA 5LXTB 3VQVA 5JJJB 4ZIBA 4LH6A 3JATA 4DR6B 1JMKC 2YI8A 3ETQA 4O4IB 2HEPA 2UXCB 5LYJA 4ZHQB 4EFBA 4OX9B 3THOA 4O4JA 2UXDB 2RJZA 4X1KB 4DV2B 4DK1A 4HNAB 1T5EA 4YHHB 1N33B 1Q8IA 3UT5B 3JASA 4DV1B 2XHBA 1XHXA 4NVPA 2CAZC 4ZI7B 4FM2A 5FPRA 5EYPA 3QTCA 2YI9A 3K57A 3BA8A 5CA1B 1E79H 1XMQB 4TV8B 4F6RA 4DV5B 4X1IA 2VQEB 2QM4A 3JAWA 4K8ZA 2ZNJA 1TGOA 3OAAH 4WBNB 4FLZA 2WSSH 5ITZA 1X4TA 5CB4B 2R70A 4DR2B 4NXNB 3U0ZA 1O9HA 5LXTA 5LMNB 5EIBC 3CHXA 3M7MX 1VF7A 2XNDH 1BSNA 4FM1A 4UCUA 2E3CA 4DRXB 4O4IA 3SJBC 4L8JA 4HBNA 3VQWA 2VWJA 4JI6B 3ZEDA 4LF6B 4KL1A 2RQ6A 4X1KA 2VWKA 4JV5B 4O2BB 4HNAA 3OE7H 4ASUH 4CH3A 3UT5A 4FLXA 4O2AB 2VQFB 5KHKA 3RYHA 4K8XA 4ZI7A 4U3JB 4LR3A 4I55B 4LNUB 1I7FA 4UCTA 5CA1A 4FFBA 4TV8A 4CH5A 3K58A 5KHIA 5JJNB 3HKBB 4WBNA 3WB2A 3RYFB 5GONB 3BA9A 3SJAC 5CB4A 1WN7A 1FFXB 1HNXB 5LA6B 1XMOB 1Z5VA 5LOVA 4DR1B 4LF8B 2ZM6B 1HR0B 5JH7B 4FLWA 2YIBA 4I9QA 4DRXA 2E5YA 4TQDA 3FKSH 4CC6A 1D5AA 4LFBB 2EX3A 2JVDA 3DSQA 2F93B 3RFRA 3ZS8C 1QHTA 4BW9A 1TA8A 3BAAA 5LP6B 4X62B 4O2BA 3OFNH 5K1PA 4O2AA 1FJGB 1P49A 2YIAA 5C8YB 1WNSA 4JI4B 3HKDB 4DR3B 5IJ9B 4FLUA 1Q3EA 4U3JA 4LNUA 5CA0B 4AHCA 1FS0E 2YIBD 5JJEB 2UUAB 4X20B 4FM0A 3HKBA 3BPZA 4LF5B 4B3MB 4CH6A 4FLVA 3MAQA 3SGIA 4YXWH 3RYFA 5GONA 4JI2B 1H2SB 4I4TB 1FFXA 4UFZA 3K5OA 5LA6A 5BR8B 1SKVA 2OYQA 3U10A 2RQ7A 1Q43A 5JH7A 5K1XA 2Q7EA 3OEHH 3JARB 1NT2B 2ZIOA 2UXBB 2PYJA 3K59A 3B2EE 5LP6A 1SA0B 4UCSA 4YJ3B 1IBKB 4K0KB 4D7TA 2ZIMA 2PGGA 4CS4A 1B04A 4TV9B 4ZHQA 5DN6I 5JCOA 4X65B 5C8YA 4EEQA 3HKDA 3QF7A 5IJ9A 4DK0A 4FLTA 3HKEB 2XOKH 4UCOA 2V7QH 5CA0A 4CH4A 3U11A 1XNQB 5JVDB 4Q6GA 5EZYB 4X20A 3E22B 4DV0B 4LF9B 2YXLA 3VQYA 4CS2A 4I4TA 4DV3B 4IIJB 1XNRB 2Q7GA 4DV6B 3RWRD 1YEWA 4D7SA 2PY5A 4O4JB 1N36B 3JARA 2Q0AA 2PUSA 5KHGA 4LF4B 4EB6B 3CB2A 3T1HB 2IM9A 2PTMA 5D5PA 1XI1A 1IBMB 1KU9A 5JQGB 4X64B 1S5JA 1QQCA 4B3SB 1L8DA 2JS5A 1TVKB 3HKCB 4PI0A 3ICXA 4YJ3A 3BRCA 2F1MA 5JCOC 3QG5A 4TV9A 4TUYB 4O4HB 2OWOA 1O9GA 4GYCB 3HKEA 1ZAUA 3BABA 4PHZA 2HHHB 2R72A 4DR7B 3LNNA 4TQFA 4B3RB 4DV7B 4CC5A 5JVDA 1HW7A 3VQXA 5KMGB 4JYAB 4JI1B 2QJ1A 4I55A 3N2KB 1HNZB 2KKWA 1M4UA 2ZNIA 3FFQA 2Q7HA 3A2FA 1H8EH 1JFFB 4IIJA 4LF7B 2UUBB 4B3TB 2QE7H 4BWAA 1N32B 4GKJB 1I94B 4YJ2B 1WPBA 5KHJA 4EB6A 3WB1A 5IJ0B 1DGSA 5IWAB 1IBLB 3N2GB 4JI3B 4X1YB 1AQTA 4JI0B 5JQGA 4DR5B 3JALB 3RYHB 2PYLA 5D5QA 3JSNA 3JAKB 1TVKA 3HKCA 2R9AA 1KMIZ 2PZSA 3RYIB 2BTQB 1TUBB 4TOIA 5EIBD 1Q5OA 4TUYA 4FFBB 4O4HA 5KX5B 5IYZB 2V4DA 5J2TB 5FL7H 4AILC 2P5OA 3RYCB 2UU9B 4JI8B 4LFCB 4DUZB 3T1YB 4UCVA 5KMGA 4B08A 3K5NA 2F66C 2ZINA 3OTFA 4CS3A 4ZOLB 4NXMB 4GKKB 3N2KA 4X66B 3BHPA 2HLDH 5LOVB 4I50B 4GLXA 4JI5B 4EFEA 2BTOA 1JFFA 1JJOA 2F4VB 5BMVB 5FPOA 4DV4B 3SR2C 3CSXA 1Z5WA 5FNVB 4IHJB 4O4LB 5J2UB 1V9PA 2P22C 4YJ2A 1HNWB 3JATB 2GV9A 5IJ0A 3N2GA 4FVMA 1J5EB 4X1YA 1M5IA 1BSHA 3JALA 4JI7B 5LYJB 4LH7A 3JAKA 2ZCEA 3OTOB 3PN1A 3RYIA 2BTQA 4YY3B 3SJCC 1M93A 1TUBA 2UUCB 5KX5A 1TAEA 1SQGA 5IYZA 3JASB 1G6UA 3UQ8A 5J2TA 5LP6C 5KHHA 1SA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQD A;  2RQ7 A;  3FKS H;  2E5Y A;  2RQ6 A;  2WSS H;  2ZIN A;  2ZNI A;  1FS0 E;  5K1X A;  2YIB D;  4CS3 A;  2Q7G A;  2Q7E A;  3OE7 H;  2XOK H;  2Q7H A;  3OEH H;  4ASU H;  3VQV A;  2JVD A;  3DSQ A;  4CH3 A;  4ZIB A;  3BHP A;  1H8E H;  2R70 A;  2ZIO A;  4CH4 A;  4BW9 A;  2HLD H;  3OAA H;  1BSH A;  1O9G A;  2YI8 A;  3QTC A;  2V7Q H;  1O9H A;  2YI9 A;  4CH6 A;  2QE7 H;  4BWA A;  4Q6G A;  2PUS A;  3OFN H;  2HEP A;  2R72 A;  2ZCE A;  5K1P A;  1E79 H;  4TQF A;  4YXW H;  2XND H;  1BSN A;  5FL7 H;  2E3C A;  2YIA A;  3VQX A;  2RJZ A;  2ZIM A;  1G6U A;  3VQY A;  2PGG A;  4CH5 A;  2QJ1 A;  3VQW A;  4CS4 A;  2ZNJ A;  4CS2 A;  5DN6 I;  2YIB A;  3ZED A;  1AQT A; 
#chains in the Genus database with same CATH topology
 4PA3 A;  1I08 A;  1IZ3 A;  1H2K A;  1PKX A;  3WG7 B;  3JSL A;  4UUJ C;  1YJN V;  2X6C A;  2Y69 B;  4JI4 O;  4DR4 B;  2KG7 B;  3C90 A;  1D5N A;  3LSQ A;  5LL6 Y;  2XAJ A;  2IBZ H;  5BMV A;  2X7R B;  4H13 B;  2AHY A;  2H94 A;  3E22 A;  3FYE B;  3HPL C;  3RGB A;  3OUS A;  4LF7 O;  4MSW C;  3K5M A;  1L0L H;  1Q6I A;  4O4L A;  3QVN A;  3T4D A;  5J2U A;  5JJJ B;  1M57 C;  1JMK C;  4QIW F;  5CBG A;  4N23 A;  3AK3 A;  1OCZ C;  2P90 A;  4O4I B;  5BR8 O;  2UXC B;  1WP7 A;  3L73 H;  4ZHQ B;  2ITC C;  2W6J G;  4KFM A;  3THO A;  4O4J A;  4J11 A;  1K8A W;  2LFS A;  2RJZ A;  4JTA B;  4DV2 B;  1AJP A;  2YEV B;  4FZ1 A;  4G2K A;  1T5E A;  2P4V A;  2Q5Z A;  3DGE A;  1XHX A;  1BS3 A;  5FPR A;  5B3S C;  5A2Q N;  3CCQ V;  2YI9 A;  1COW G;  3OEH G;  3AG2 B;  4LFC O;  1QR8 A;  1H8H G;  4DV5 B;  1H2N A;  2ZDI A;  1G4Y B;  4WBN B;  3ZMV A;  5ITZ A;  1X4T A;  5KA6 A;  4JI5 O;  5CB4 B;  4DR2 B;  4H33 A;  4NXN B;  4LF9 O;  3U0Z A;  3CYO A;  2ZE5 A;  2P6J A;  2QKA A;  1HNW O;  3ML0 A;  1K92 A;  2E3C A;  2YC0 A;  1H38 A;  1J5E O;  1WPX A;  2VWJ A;  1VQL V;  2RDC A;  4LF6 B;  4KL1 A;  4X1K A;  1W0J G;  3OE7 H;  4HNA A;  2QM8 A;  2YID A;  3SYO A;  1S5H C;  5KHK A;  1KQS U;  1OCO C;  3P3N A;  1VQ8 V;  2HJF C;  2OTL V;  2ZR2 A;  4I55 B;  1GTO A;  1U96 A;  1I7F A;  4I5S A;  2DWD C;  4PV1 B;  4FK5 C;  4GX0 A;  1VAR A;  5JJN B;  3G6B A;  4DR7 O;  4B3R O;  4DV7 O;  5GON B;  3FB6 C;  4QGP A;  1HNX B;  3FD9 A;  4JI1 O;  1FFT B;  4I9W A;  4MVR A;  4R50 A;  1YI2 V;  1HR0 B;  4PEL A;  2LQT A;  3ZHQ A;  4DR6 O;  4MTG A;  1JJ2 U;  3TXS A;  1D5A A;  5B1B C;  1GM9 A;  3ZS8 C;  1QHT A;  3JD2 A;  4OX9 O;  2M6Y A;  5LP6 B;  1VF6 A;  3OFN H;  1KP3 A;  4JI3 O;  2N05 A;  5KUK A;  4PD4 F;  4FLU A;  4U3J A;  1ZWI C;  1N0J A;  3E8B A;  2VRZ A;  2R9I A;  3A0R A;  2B1I A;  3FYI B;  2QEX V;  3B09 A;  3IGA C;  5EBW C;  3J81 N;  4LF5 B;  3CC4 V;  3OMI B;  4B3M B;  2WLN A;  1OCC C;  2UU9 O;  2IW5 A;  4YXW H;  3CRC A;  2Q0O C;  2WLK A;  2DYR B;  1RM1 C;  1MSD A;  5LA6 A;  2XAG A;  2OCC C;  4UB6 Z;  1SKV A;  1EN6 A;  3ZJZ A;  1BCC H;  1SQP H;  4JAS A;  3CRQ A;  1IVS A;  1CPY A;  4K0K B;  4D7T A;  1SER A;  5JCO A;  1WB7 A;  5C8Y A;  1YIJ V;  3OW2 U;  1AP6 A;  2WPD G;  4FLT A;  3TET A;  1OCR C;  2XOK H;  5DED A;  5AG2 A;  5CA0 A;  1Y6X A;  5EBL C;  1EM1 A;  5JVD B;  5EC1 C;  2K1E A;  2Z0A A;  3BEH A;  3E22 B;  1PV0 A;  3EVK A;  4CS2 A;  1GK9 A;  3L75 H;  4I4T A;  2N04 A;  3OT7 A;  2ZDI C;  1AI7 A;  2Q7G A;  3DC6 A;  2YDE A;  2PF4 E;  3RWR D;  3SPH A;  2QTS A;  4DR1 O;  4O4J B;  1N36 B;  3JAR A;  2PUS A;  4LF4 B;  1KC8 W;  3ABK B;  3T1H B;  1DK1 A;  1XI1 A;  1IBM B;  1GO3 F;  3LDD A;  3AG7 A;  2Q4P A;  1XEQ A;  4X64 B;  2BOC C;  4R8C A;  1HWY A;  2JS5 A;  3HKC B;  3W7W A;  4YJ3 A;  4X62 O;  1N0N A;  2D2C B;  2EZP A;  3AG3 C;  3N27 A;  4TV9 A;  3K9A A;  1SQV H;  3H1J H;  4DW1 A;  4JYY A;  3EHB B;  3CX5 F;  4GYC B;  4DR3 O;  3SPI A;  4U3F H;  2ZE8 A;  3ASO C;  4YHH O;  2WAM A;  3CME V;  3ZHU A;  4DV1 O;  4H37 A;  4JYA B;  1QU7 A;  2QJ1 A;  3N2K B;  5BY1 A;  1VMG A;  1DF4 A;  1M4U A;  2ZNI A;  3MD0 A;  3LDE A;  3A2F A;  1H8E H;  2PI5 A;  3ABL B;  1VQP V;  1YDX A;  2ADQ B;  2GTS A;  1JPX A;  1I94 B;  1DGS A;  3W7S A;  3K08 A;  1XRE A;  1KB9 F;  2A9H A;  1GH6 A;  4DR5 B;  2PYL A;  2A06 H;  4QE7 A;  3LNM B;  3CD6 V;  1GAX A;  1VQ5 V;  1TVK A;  4HAM A;  1KMI Z;  3ASN C;  1H2L A;  4TUY A;  2QDO A;  2V4D A;  3SYC A;  5LGT A;  1CXZ B;  3OUF A;  1VP7 A;  1VF6 C;  1NH2 B;  2EIN C;  3CCR V;  2BSK A;  1VQN V;  2W0X A;  4JI8 B;  2EBO A;  4WFE A;  1R3I C;  3T1Y B;  1XNQ O;  3JD1 A;  5KMG A;  2Q6A A;  3K5N A;  4ZOL B;  1RSO B;  4GKK B;  4E4E A;  1WAZ A;  3UCS C;  3OR6 C;  1ARO P;  4N21 A;  1ZLZ A;  1JJO A;  2F4V B;  3SR2 C;  4WFB V;  1BQZ A;  2NR5 A;  1Z5W A;  5FNV B;  4IHJ B;  1XNR O;  3FB5 C;  3CP1 A;  2B9Z A;  1V9P A;  3CPW U;  2EIL C;  3N2G A;  3Q4H A;  4FVM A;  3GWO A;  2YXY A;  4X1Y A;  5LHH A;  3JAL A;  5IY5 B;  3A0B Z;  4JI7 B;  3K0D A;  4PJ0 Z;  3ETG A;  1LUW A;  3JAK A;  1NR1 A;  2ZCE A;  3OTO B;  3PN1 A;  5IDJ A;  3ABU A;  3K3W A;  1VQ4 V;  2HVJ C;  5IYZ A;  1RPR A;  3ABT A;  1RPO A;  3JYC A;  2QWN B;  5EYP B;  4MTF A;  5B66 Z;  2IH3 C;  1FJG O;  5EBM C;  4F6R B;  1D2D A;  2Z3Y A;  4X1I B;  4AQY B;  4FLY A;  2F95 B;  5DM6 V;  5IYC O;  1AP5 A;  4FFK A;  3S3W A;  1NTM H;  1S3J A;  3K5L A;  1NS1 A;  5LMU B;  3CJH A;  3AEI A;  3TGU H;  2UUA O;  2UUB O;  4RWU A;  2Y48 A;  3D36 A;  2JGD A;  3VQV A;  4ZIB A;  4LH6 A;  3JAT A;  2EIJ B;  2ZXW C;  5IYD O;  2YI8 A;  4H44 B;  2HG5 C;  1QLE C;  4X8A A;  1IBL O;  1IDS A;  5KAI Z;  2DE0 X;  3H1K H;  4JI0 O;  4EFB A;  1VQK V;  3ZHT A;  1BZK A;  1FXK A;  2UXN A;  4W4K A;  4CBC A;  4DK1 A;  2BE3 A;  1MG1 A;  1K9M W;  3JAS A;  3ZRS A;  1SQQ H;  3AG1 B;  1R3J C;  4F6E A;  4ZI7 B;  1MZE A;  1MNG A;  3QTC A;  5L3F A;  1IBK O;  3RT3 C;  3K57 A;  3BA8 A;  5CA1 B;  1XMQ B;  2Y0I A;  4NXM O;  2DOS A;  3G80 A;  1M56 C;  2QM4 A;  2RNB A;  3JAW A;  4X66 O;  4K8Z A;  2ZNJ A;  3ZN0 A;  3B40 A;  5CMU A;  5HFL A;  4DV4 O;  1Y76 A;  4WFF A;  1O9H A;  5F2V O;  5LXT A;  2DW4 A;  2V7Q G;  5EIB C;  2XND H;  4FM1 A;  4DRX B;  3SJB C;  3CRM A;  4PA4 A;  2HR3 A;  2WWW A;  4JI6 B;  3ZMZ A;  2RQ6 A;  4PA7 A;  2QR4 A;  1R73 A;  1YSC A;  4CH3 A;  4IL6 Z;  3ZHS A;  3UT5 A;  4FLX A;  4O2A B;  2UUC O;  3SPJ A;  1DTO A;  3T2M A;  2EUL A;  2KB1 A;  4LNU B;  3F7V C;  4TV8 A;  4CH5 A;  2RCV A;  4MS2 A;  4Z1M G;  1THZ A;  4DR4 O;  2JEU A;  4QPK A;  1YVW A;  3RYF B;  1UPG A;  1MOF A;  3STZ C;  1K34 A;  1XMO B;  2XUM A;  5L3D A;  3APQ A;  3F5W C;  2ZM6 B;  1OV9 A;  4UVB A;  1EBO A;  4CC6 A;  1AR1 B;  4B3T O;  4LFB B;  3P32 A;  5KAF Z;  4QNH B;  1N32 O;  2EX3 A;  3DSQ A;  1TA8 A;  1V54 C;  2EIK C;  1MSW D;  3BAA A;  2O57 A;  5JWP A;  2E75 B;  4O2B A;  4DV2 O;  1F4N A;  2E76 B;  3E89 A;  1LR1 A;  4KXR A;  2OIG A;  2JEX A;  3OD4 A;  2V1D A;  3C3S A;  2YIA A;  4JI4 B;  3HKD B;  1XOU A;  4OPA A;  3S3X A;  3KG2 A;  1EN4 A;  1H2M A;  1FS0 E;  2YIB D;  2LFR A;  3TK1 A;  1QLN A;  3QO7 A;  4X20 B;  4DV5 O;  3HKB A;  2FL4 A;  3ABM C;  4CH6 A;  4AI8 A;  2A7W A;  3H9V A;  4GT1 A;  3G67 A;  4JI2 B;  1M57 B;  1E1Q G;  4RO2 A;  5DN6 G;  1FFX A;  1QVF U;  4UFZ A;  4B7K A;  4TWK A;  1Y67 A;  3WU2 Z;  5BR8 B;  4DR2 O;  2GSM B;  1OCZ B;  1NJI W;  3CRA A;  3U10 A;  2P67 A;  2RQ7 A;  2UXX A;  5GTI Z;  3JCU Z;  5JH7 A;  5K1X A;  1YHQ V;  1N4C A;  3OEH H;  1NT2 B;  2ZIO A;  2F23 A;  3D36 C;  4IGG A;  4UV8 A;  3B2E E;  2OTJ V;  1ENV A;  2HLD G;  4LF6 O;  5KLV H;  4P30 A;  4UCS A;  3CMA V;  4KP4 A;  1EFR G;  2P06 A;  5B3S B;  3M99 B;  1BT8 A;  4CS4 A;  1B04 A;  2W0F C;  5H9C A;  2XAF A;  1FXK C;  5IJ9 A;  2ZR3 A;  3CWB H;  4J41 A;  4DK0 A;  2G38 A;  2GTA A;  5LGN A;  4BW5 A;  2OIE A;  3JD3 A;  1XBL A;  1PNL A;  1MA1 A;  1W0K G;  4LF9 B;  4WFG A;  2YUA A;  1NR7 A;  4IIJ B;  4KHP O;  5H5N A;  1ZUQ A;  4DV6 B;  1JVM A;  1KEC A;  2JJ2 G;  4D7S A;  1ZL8 A;  2DN9 A;  1HR0 O;  4GX2 A;  1KP2 A;  1YJ9 V;  2EIM C;  4BIZ A;  4PDM A;  3M8A A;  5JQG B;  1H2G A;  1JA8 A;  1S5J A;  1QQC A;  1OCO B;  3AG4 C;  4B3S B;  3IJ4 A;  4X9Q A;  5GTH Z;  1PD3 A;  4F4L A;  1AI4 A;  3RW0 A;  5LHG A;  1CP9 A;  5DEC A;  1L0N H;  4O4H B;  3LSS A;  3CRR A;  3HKE A;  5KA5 A;  2HHH B;  4DR7 B;  4B3R B;  4DV7 B;  3CC2 V;  1HW7 A;  4LWS A;  3VQX A;  4JI1 B;  3B8N A;  3ZMT A;  1HNZ B;  3ZRW A;  1Y74 A;  3R65 A;  1WA8 A;  4LF5 O;  4B3M O;  1B3Q A;  3H1H H;  2WLL B;  4J7J A;  3DXR A;  3W7U A;  3KCX A;  3K0G A;  4NR1 A;  3ZMS A;  1NVP B;  2EJ7 A;  4A5U B;  4UB8 Z;  3CCS V;  5B1B B;  4YJ2 B;  2RN9 A;  4Q20 A;  4MTO A;  4EB6 A;  1E79 G;  3SPG A;  4PA9 A;  4JI3 B;  1AQT A;  1B6Q A;  1S0V A;  2ZD9 A;  4JF3 A;  2YIC A;  3OAA G;  4WCE V;  2PZS A;  2WSS G;  2BTQ B;  3E86 A;  5CA3 A;  1Q6H A;  1TUB B;  5KX5 B;  3BFR A;  2B1G A;  5E1A C;  3P3P A;  1G8M A;  4J42 A;  2P5O A;  1I5X A;  2UU9 B;  4DUZ B;  4UCV A;  1OCC B;  2VQF O;  4RQF A;  4B08 A;  4BIO A;  3SDL A;  2NLJ C;  1RM1 B;  2OCC B;  4IYH A;  5CBH A;  4GLX A;  3IC7 A;  3K79 A;  4ASU G;  1IX9 A;  4EFE A;  4UXN A;  1JFF A;  5BMV B;  5FPO A;  3CSX A;  4BR6 A;  3ZRX A;  4O4L B;  1SQX H;  3AK1 A;  1YXB A;  3IC9 A;  3OEE G;  5J2U B;  3TCU A;  1GMG A;  1K33 A;  5IJ0 A;  1N36 O;  4LF4 O;  5L3E A;  3T1H O;  1IBM O;  2CTP A;  5L3C A;  1K4D C;  1SES A;  4LH7 A;  4X64 O;  1SF9 A;  3RYI A;  2CH7 A;  1OCR B;  4YY3 B;  4PDV A;  2OCH A;  1TAE A;  1G6U A;  2Q9L A;  3SYQ A;  3UQ8 A;  4JYC A;  5J2T A;  2LO1 A;  5KHH A;  4HYO A;  1SA0 A;  4JPR A;  3RYC A;  3H1L H;  1Q7Y W;  2WLI A;  1N34 B;  2CTR A;  3FKS G;  4CZZ A;  2AHZ A;  4JYA O;  1SZX A;  1XQ8 A;  3D3Q A;  2GUZ A;  4I50 A;  2CUG A;  1Q6U A;  3CC7 V;  2E5L B;  4GUN A;  5ITZ B;  3VOU A;  4DUY B;  4LFA B;  2ZE7 A;  4UCR A;  3IAY A;  1HP8 A;  1NH2 D;  1AJN A;  2E74 B;  1I94 O;  4J7K A;  1XUQ A;  4GX1 A;  2WLM A;  4DW0 A;  1ZTE A;  5LYJ A;  1E1R G;  3AG3 B;  4DR5 O;  3FAV A;  4MW3 A;  4TT3 G;  2UXD B;  3ZHR A;  3L72 H;  4X1K B;  4HNA B;  4YHH B;  1N33 B;  2AGA A;  1Q8I A;  4DV1 B;  3ASO B;  2XHB A;  2QTO A;  1P4R A;  3STL C;  5J9P C;  2YSU B;  1I5Y A;  2CAZ C;  5H2F Z;  1UJW B;  4X65 O;  2OT5 A;  1YF2 A;  2X6A A;  2QGN A;  2KG7 A;  1M1K W;  2D3O W;  4GKK O;  2VQE B;  2IJI A;  3UKM A;  1TGO A;  3DTU B;  4DO2 A;  1K73 W;  3CS5 A;  2Z5U A;  1IUR A;  4NTX A;  2Y0P A;  2P7T C;  5LMN B;  2MW2 B;  2YXH A;  1AI6 A;  2DYS C;  1VF7 A;  2K9P A;  4U7N A;  1BSN A;  1YTF B;  4GX5 A;  4O4I A;  4MW8 A;  4DYL A;  3ASN B;  4HBN A;  4JI7 O;  2IJH A;  4WF9 V;  1BL8 A;  2WLJ A;  3W7X A;  2YEV A;  4JV5 B;  3OTO O;  2A79 B;  2EIN B;  3RYH A;  2NN4 A;  1NQT A;  4K8X A;  3B4S A;  3RBZ A;  2DQ0 A;  5IE9 A;  3K03 A;  4U3J B;  4LR3 A;  1F4M A;  4UCT A;  1TUE B;  4FFB A;  5B1A B;  5KHI A;  3UO3 A;  1LNQ A;  4RUF A;  1XL4 A;  4AQY O;  3KKY A;  2VS0 A;  4WBN A;  3WB2 A;  3GVM A;  2QWP B;  4LC1 A;  3BA9 A;  5CB4 A;  1WN7 A;  1AR5 A;  5LMU O;  2EIL B;  5LA6 B;  5LOV A;  2LP7 A;  4LF8 B;  2IJK A;  3C3T A;  2YIB A;  3MHS C;  3X2Q C;  2B5U A;  2E5Y A;  1HDJ A;  4R6Z A;  1ZSP A;  4FIP C;  4JAV A;  5EK0 A;  2JVD A;  3RFR A;  4MVQ A;  4BW9 A;  4GKJ O;  1S76 D;  4C7U A;  1FXV A;  1V55 C;  2Y4T A;  3F7Y C;  5IWA O;  2NNU A;  4BIU A;  1FJG B;  1P49 A;  3OR7 C;  2AZ0 A;  5C8Y B;  3J7A U;  2QE7 G;  3L74 H;  2Q69 A;  3MHH C;  5IT9 N;  5CA0 B;  1M9N A;  4JTC B;  1SQB H;  3SJQ C;  4AHC A;  4LCU C;  5JJE B;  1XMQ O;  4MVZ A;  1Z2G A;  3H01 A;  1J95 A;  2ZKO A;  2UUA B;  4P2Z A;  3OGC C;  3I55 V;  5HFM A;  4WFA V;  4FLV A;  1BHA A;  3MAQ A;  3CCJ V;  2QWO B;  1NU1 H;  5GON A;  3A0H Z;  1H2S B;  1IXM A;  4I4T B;  2ZXW B;  3MDS A;  1XIL A;  1KKD A;  1QLE B;  1EN5 A;  5FL7 G;  5B5E Z;  1FS0 G;  5LGU A;  3JAR B;  1SZT A;  2CGN A;  2UXB B;  1R6K A;  4NKG B;  4OPH A;  4JI6 O;  4RAI A;  4W4L A;  5B1O A;  3EXA A;  5LP6 A;  1SA0 B;  4YJ3 B;  1IBK B;  2PGG A;  4TV9 B;  1G1X B;  4EEQ A;  3QF7 A;  4ABM A;  4UCO A;  2V7Q H;  3A8T A;  4CH4 A;  2JS3 A;  1M56 B;  4QPJ A;  3ZHV A;  4IT5 A;  1K3E A;  4DV0 B;  3WG7 C;  2YXL A;  4ZKI A;  3VQY A;  4YIP A;  2Y69 C;  5BXZ A;  3T1C A;  4PA6 A;  1PPJ H;  1MZF A;  4DV3 B;  2MK3 A;  1K4C C;  4J9Y B;  2EJR A;  1XMO O;  3GB7 C;  2AW9 A;  1KUQ A;  4RQE A;  1VQM V;  2PY5 A;  5CN0 A;  3FAV B;  2ZM6 O;  1P7B A;  5KHG A;  4I0X A;  3CB2 A;  3ZCC A;  5D5P A;  3H1I H;  1NKD A;  2CDY A;  1VQ7 V;  4LFB O;  3OMA B;  1B06 A;  4JTD B;  1L8D A;  1TVK B;  1YJW V;  1JR9 A;  3ICX A;  4G27 B;  3BRC A;  1URF A;  4JAA A;  1VQO V;  3QG5 A;  4TUY B;  2UXC O;  2BCC H;  2OWO A;  1RP3 B;  2JIZ G;  4UVC A;  5IYB O;  4B7E A;  3BAB A;  2BSK B;  3LNN A;  4TQF A;  1PP9 H;  5JVD A;  1YCI A;  4ZBM A;  1YZB A;  5KMG B;  2ADP A;  4NB5 A;  1S77 D;  2QM7 A;  4OGQ B;  1FYJ A;  3NR7 A;  1JQ0 A;  2N74 A;  3AG2 C;  3FFQ A;  2Q7H A;  3B8M A;  4JI2 O;  3E83 A;  4LF7 B;  4J10 A;  4P9P A;  4B3T B;  2IU0 A;  4BWA A;  1N32 B;  1SET A;  1KBH A;  2DQ3 A;  1DLB A;  1NTK H;  1FPO A;  1WPB A;  3JAM N;  1GRJ A;  1V54 B;  2EIK B;  3N2G B;  3Q4H B;  3NXS A;  4X1Y B;  5L3G A;  4NXN O;  1DF5 A;  3JAL B;  3RYH B;  5D5Q A;  2CK3 G;  4IYI A;  2XAQ A;  3OM3 B;  1R3L C;  3JAK B;  3HKC A;  2R9A A;  4DXW A;  2XAH A;  4TOI A;  1Q5O A;  4FFB B;  2ITD C;  5IYZ B;  4U7O A;  4NTY A;  3EFF K;  4AIL C;  3ZMU A;  4LFC B;  3ABM B;  4Z2W A;  2GHY A;  1Q90 D;  2F66 C;  3OTF A;  4MVU A;  4CS3 A;  1QNM A;  3N2K A;  4MT8 A;  3BHP A;  2HLD H;  2W6I G;  5LOV B;  1OZ0 A;  3D3I A;  3CCV V;  1NI8 A;  4TSF G;  3OE7 G;  1KYO F;  2IU3 A;  4JI5 B;  2WA3 A;  2BTO A;  5A9G A;  2IJJ A;  3CJH B;  1Y4M A;  1PNK A;  4DV6 O;  4FZ0 A;  3K06 A;  1HNW B;  2JGD B;  3JAT B;  2GV9 A;  1MMM A;  1J5E B;  1M5I A;  1HNX O;  1BSM A;  3L70 H;  3QO5 A;  2GBO A;  4QE9 A;  1FXK B;  4H0L B;  4B3S O;  4JAU A;  1K5S A;  4LP8 A;  3FB7 C;  1BE3 H;  1M93 A;  3JAS B;  1QCE A;  2CGO A;  2FB5 A;  5LP6 C;  1NVP D;  4D6T H;  2HHH O;  2Q68 A;  1Q86 W;  1QBZ A;  2L35 A;  1SQF A;  4ZOL A;  4KHP B;  1RSO A;  1XHZ A;  3G71 V;  1XL6 A;  1HNZ O;  4GZR B;  3JAW B;  1SRY A;  3SYA A;  3CEI A;  2JGU A;  1JCH A;  2PI4 A;  1ORQ C;  4PI2 A;  3OFN G;  5EZY A;  2H8P C;  1OJH A;  5FNV A;  4IHJ A;  2EIM B;  1Y76 B;  3WB0 A;  4LBE C;  2DYR C;  5LXT B;  4MVM A;  4DR6 B;  1FKA O;  3ETQ A;  3AG4 B;  3ZBH A;  2HEP A;  3TXQ A;  3JD0 A;  4OX9 B;  1AVM A;  2A3Q A;  3E35 A;  5FLX N;  4YXW G;  2BOB C;  1Q81 W;  2JJ1 G;  3UT5 B;  2X0L A;  1PL4 A;  4NVP A;  3O65 A;  5B1N A;  3VBB A;  4FM2 A;  4J80 A;  5EYP A;  2QWQ B;  1GM7 A;  4K0K O;  4MVS A;  1IXB A;  1E79 H;  4TV8 B;  4DUZ O;  4F6R A;  1OHH G;  2M7W A;  1R3K C;  1F51 A;  4X1I A;  4BAY A;  1R6N A;  3JD4 A;  3OAA H;  3HR0 A;  2A0L A;  3KZI Z;  2XAS A;  3T4Z A;  4FLZ A;  1BQ0 A;  2WSS H;  4RUE A;  4I0X B;  1JX9 A;  2R70 A;  1KD1 W;  1WLE A;  1AJQ A;  2HKO A;  2XOK G;  1MAB G;  3CHX A;  3M7M X;  5E79 Z;  4UCU A;  3ZX6 A;  4L8J A;  3VQW A;  5BZB A;  1NZ6 A;  3ZED A;  3I5D A;  2LW7 A;  1KKC A;  3ABK C;  2RMK B;  2VWK A;  3RN4 A;  4ASU H;  4O2B B;  3E8H A;  3AK2 A;  4YY3 O;  2VQF B;  4FPP A;  3ZN1 A;  4JZG A;  1L1F A;  1P7G A;  1GN6 A;  4ZI7 A;  2ODM A;  2GDS A;  4UVA A;  2L6L A;  4MVO A;  5CA1 A;  1N34 O;  3K58 A;  5KUM A;  1UFI A;  3CXH F;  4PDR A;  1BHB A;  3HKB B;  3QO8 A;  1PM9 A;  3E2E A;  3FB8 C;  2E5L O;  3SJA C;  1FFX B;  4DUY O;  4LFA O;  2ILM A;  1Z5V A;  1N8R W;  2LW1 A;  4DR1 B;  3LSU A;  3ABL C;  5JH7 B;  4FLW A;  4I9Q A;  4DRX A;  4TQD A;  3FKS H;  4JZ2 A;  3CCL V;  3K04 A;  2F93 B;  1VIB A;  3APO A;  3L9D A;  3PJS K;  4X62 B;  2UXD O;  1QVG U;  1CEZ A;  3K9S A;  3CXC U;  1GKF A;  5K1P A;  1AR4 A;  1H8E G;  1VF5 B;  4O2A A;  5H6R A;  1N33 O;  3ETD A;  2QWR B;  1WNS A;  4DR3 B;  5IJ9 B;  1Q3E A;  1X59 A;  2FYU H;  2LGQ A;  1A32 A;  2ZE6 A;  4LNU A;  2QA4 V;  5EC2 C;  2LJ2 A;  1W2B U;  1YTF D;  4HZ3 A;  1R6T A;  4FM0 A;  3BPZ A;  1WP8 A;  2DWE C;  2VQE O;  3SGI A;  4JI8 O;  2ETN A;  3RYF A;  4E2L A;  3T1Y O;  3ZIA G;  3ETE A;  2ZQM A;  3BVO A;  3K5O A;  4YIO A;  1R1B A;  2OYQ A;  2KSD A;  4Z1V A;  3WFV A;  3IFX A;  3CCE V;  1Q43 A;  1I0H A;  3G4S V;  5LMN O;  2Q7E A;  1AB3 A;  1ZL8 B;  5TIS Z;  2F43 G;  2Q73 A;  5H6Q A;  1P84 F;  1M90 W;  2F4V O;  1AI5 A;  2CTW A;  4XDK A;  1F23 A;  2PYJ A;  3K59 A;  1BGY H;  3G6E V;  1WB8 A;  4P9O A;  3R66 A;  1VQ9 V;  5IY5 C;  2ZIM A;  4JV5 O;  1Y66 A;  2H3O A;  2Q67 A;  5DN6 I;  4ZHQ A;  4X65 B;  3HKD A;  3E8G A;  3HKE B;  1W59 A;  3D8C A;  1VQ6 V;  2JRI A;  2P4K A;  3LDC A;  5B1A C;  3U11 A;  1XNQ B;  3OGI B;  2DJV A;  3SPC A;  4LWS B;  4Q6G A;  5EZY B;  1ROP A;  5GW7 A;  4X20 A;  4X89 A;  3ZRW B;  1Y74 B;  1WA8 B;  2CTQ A;  1GN3 A;  4I7Z B;  4EKW A;  3J80 N;  2QSA A;  2JK5 C;  1GM8 A;  3DXR B;  2DYS B;  2YS8 A;  1XNR B;  3UM7 A;  3HB3 B;  4J7Z A;  2JDI G;  4OXS A;  1YEW A;  4GCZ A;  2ZT9 B;  4LF8 O;  2Q0A A;  4EB6 B;  3DC5 A;  2C2A A;  2IM9 A;  2PTM A;  1GN2 A;  1KU9 A;  3RVY A;  2WA4 A;  1WJZ A;  2EIJ C;  1JOY A;  3E8F A;  4R7C A;  1GN4 A;  2Q8V A;  2QKC A;  4G28 B;  4X88 A;  4PI0 A;  2F1M A;  2AXT Z;  2EZO A;  5JCO C;  3CCU V;  2HVK C;  2HFE C;  2HJD A;  3BCC H;  1O9G A;  1S72 V;  1ZAU A;  3P30 A;  4PHZ A;  2R72 A;  1FXH A;  2AZ2 A;  4NTW A;  4CC5 A;  1QR9 A;  3AG1 C;  4K3A A;  3JCZ A;  4ICG A;  3FX7 A;  4I55 A;  1K5Q A;  2IH1 C;  2KKW A;  1K97 A;  1EZV H;  4UV9 A;  4MTX A;  3BY6 A;  1JFF B;  1VEW A;  4IIJ A;  2HP8 A;  2UUB B;  3X2Q B;  2QE7 H;  1EZJ A;  4GKJ B;  5KHJ A;  1F7Y A;  5C93 A;  3WB1 A;  5IJ0 B;  5IWA B;  2LGW A;  1IBL B;  1Q82 W;  1V55 B;  2UXB O;  4JI0 B;  5JQG A;  4QJF B;  3QNE A;  3SYP A;  3JSN A;  4WFH A;  2X6B A;  2ATK C;  2FML A;  3RYI B;  2CH7 B;  1U97 A;  5EIB D;  2Y4U A;  4O4H A;  1BMF G;  1S5L Z;  4J9Z B;  5LHI A;  5J2T B;  5FL7 H;  2ARH A;  5L3B A;  1YIT V;  2FKX A;  3RYC B;  4XDJ A;  2XT9 A;  1PL0 A;  2WLI B;  2XND G;  3B77 A;  3W7T A;  2WLH A;  4K35 A;  5LBQ A;  2QKS A;  2ZIN A;  1ZX3 A;  2XTA A;  4L87 A;  4NXM B;  3LUT B;  4X66 B;  4NYK A;  4DV0 O;  3L71 H;  1PNM A;  2GUZ B;  3F5T A;  1LUV A;  4I50 B;  2KQX A;  3UO2 A;  2WLL A;  3I56 V;  3GWK C;  4DV4 B;  4XDL A;  3RVZ A;  4DV3 O;  1XDC A;  2CE4 A;  3OMN B;  1SS3 A;  2P22 C;  4YJ2 A;  4FJC C;  3KCY A;  1US6 A;  3CCM V;  1AIL A;  1RFY A;  3O9O A;  4JYB A;  4FMT A;  5CBF A;  2FTK A;  1SC5 B;  1BSH A;  1FAF A;  5LYJ B;  2DMX A;  1K7D A;  4PDL A;  4XBF A;  1NBM G;  3CE2 A;  4JGS A;  2BTQ A;  4KUM A;  2R9R B;  1TUB A;  3SJC C;  1FD9 A;  1NTZ H;  2UUC B;  3ZRV A;  5KX5 A;  3TJT A;  1SQG A; 
#chains in the Genus database with same CATH homology
 3RYC A;  5EYP B;  1N34 B;  1SQF A;  3JSL A;  4F6R B;  4ZOL A;  4KHP B;  1RSO A;  4DR4 B;  1XHZ A;  4X1I B;  4AQY B;  1XQ8 A;  4FLY A;  2F95 B;  3JAW B;  4I50 A;  2JGU A;  2E5L B;  4PI2 A;  5EZY A;  5ITZ B;  5BMV A;  3K5L A;  5LMU B;  4DUY B;  4LFA B;  3E22 A;  3RGB A;  5FNV A;  3K5M A;  4IHJ A;  4O4L A;  3WB0 A;  4UCR A;  3IAY A;  5J2U A;  5LXT B;  3VQV A;  5JJJ B;  4ZIB A;  4LH6 A;  3JAT A;  4DR6 B;  1JMK C;  2YI8 A;  3ETQ A;  4O4I B;  2HEP A;  2UXC B;  5LYJ A;  4ZHQ B;  4EFB A;  4OX9 B;  3THO A;  4O4J A;  2UXD B;  2RJZ A;  4X1K B;  4DV2 B;  4DK1 A;  4HNA B;  1T5E A;  4YHH B;  1N33 B;  1Q8I A;  3UT5 B;  3JAS A;  4DV1 B;  2XHB A;  1XHX A;  4NVP A;  2CAZ C;  4ZI7 B;  4FM2 A;  5FPR A;  5EYP A;  3QTC A;  2YI9 A;  3K57 A;  3BA8 A;  5CA1 B;  1E79 H;  1XMQ B;  4TV8 B;  4F6R A;  4DV5 B;  4X1I A;  2VQE B;  2QM4 A;  3JAW A;  4K8Z A;  2ZNJ A;  1TGO A;  3OAA H;  4WBN B;  4FLZ A;  2WSS H;  5ITZ A;  1X4T A;  5CB4 B;  2R70 A;  4DR2 B;  4NXN B;  3U0Z A;  1O9H A;  5LXT A;  5LMN B;  5EIB C;  3CHX A;  3M7M X;  1VF7 A;  2XND H;  1BSN A;  4FM1 A;  4UCU A;  2E3C A;  4DRX B;  4O4I A;  3SJB C;  4L8J A;  4HBN A;  3VQW A;  2VWJ A;  4JI6 B;  3ZED A;  4LF6 B;  4KL1 A;  2RQ6 A;  4X1K A;  2VWK A;  4JV5 B;  4O2B B;  4HNA A;  3OE7 H;  4ASU H;  4CH3 A;  3UT5 A;  4FLX A;  4O2A B;  2VQF B;  5KHK A;  3RYH A;  4K8X A;  4ZI7 A;  4U3J B;  4LR3 A;  4I55 B;  4LNU B;  1I7F A;  4UCT A;  5CA1 A;  4FFB A;  4TV8 A;  4CH5 A;  3K58 A;  5KHI A;  5JJN B;  3HKB B;  4WBN A;  3WB2 A;  3RYF B;  5GON B;  3BA9 A;  3SJA C;  5CB4 A;  1WN7 A;  1FFX B;  1HNX B;  5LA6 B;  1XMO B;  1Z5V A;  5LOV A;  4DR1 B;  4LF8 B;  2ZM6 B;  1HR0 B;  5JH7 B;  4FLW A;  2YIB A;  4I9Q A;  4DRX A;  2E5Y A;  4TQD A;  3FKS H;  4CC6 A;  1D5A A;  4LFB B;  2EX3 A;  2JVD A;  3DSQ A;  2F93 B;  3RFR A;  3ZS8 C;  1QHT A;  4BW9 A;  1TA8 A;  3BAA A;  5LP6 B;  4X62 B;  4O2B A;  3OFN H;  5K1P A;  4O2A A;  1FJG B;  1P49 A;  2YIA A;  5C8Y B;  1WNS A;  4JI4 B;  3HKD B;  4DR3 B;  5IJ9 B;  4FLU A;  1Q3E A;  4U3J A;  4LNU A;  5CA0 B;  4AHC A;  1FS0 E;  2YIB D;  5JJE B;  2UUA B;  4X20 B;  4FM0 A;  3HKB A;  3BPZ A;  4LF5 B;  4B3M B;  4CH6 A;  4FLV A;  3MAQ A;  3SGI A;  4YXW H;  3RYF A;  5GON A;  4JI2 B;  1H2S B;  4I4T B;  1FFX A;  4UFZ A;  3K5O A;  5LA6 A;  5BR8 B;  1SKV A;  2OYQ A;  3U10 A;  2RQ7 A;  1Q43 A;  5JH7 A;  5K1X A;  2Q7E A;  3OEH H;  3JAR B;  1NT2 B;  2ZIO A;  2UXB B;  2PYJ A;  3K59 A;  3B2E E;  5LP6 A;  1SA0 B;  4UCS A;  4YJ3 B;  1IBK B;  4K0K B;  4D7T A;  2ZIM A;  2PGG A;  4CS4 A;  1B04 A;  4TV9 B;  4ZHQ A;  5DN6 I;  5JCO A;  4X65 B;  5C8Y A;  4EEQ A;  3HKD A;  3QF7 A;  5IJ9 A;  4DK0 A;  4FLT A;  3HKE B;  2XOK H;  4UCO A;  2V7Q H;  5CA0 A;  4CH4 A;  3U11 A;  1XNQ B;  5JVD B;  4Q6G A;  5EZY B;  4X20 A;  3E22 B;  4DV0 B;  4LF9 B;  2YXL A;  3VQY A;  4CS2 A;  4I4T A;  4DV3 B;  4IIJ B;  1XNR B;  2Q7G A;  4DV6 B;  3RWR D;  1YEW A;  4D7S A;  2PY5 A;  4O4J B;  1N36 B;  3JAR A;  2Q0A A;  2PUS A;  5KHG A;  4LF4 B;  4EB6 B;  3CB2 A;  3T1H B;  2IM9 A;  2PTM A;  5D5P A;  1XI1 A;  1IBM B;  1KU9 A;  5JQG B;  4X64 B;  1S5J A;  1QQC A;  4B3S B;  1L8D A;  2JS5 A;  1TVK B;  3HKC B;  4PI0 A;  3ICX A;  4YJ3 A;  3BRC A;  2F1M A;  5JCO C;  3QG5 A;  4TV9 A;  4TUY B;  4O4H B;  2OWO A;  1O9G A;  4GYC B;  3HKE A;  1ZAU A;  3BAB A;  4PHZ A;  2HHH B;  2R72 A;  4DR7 B;  3LNN A;  4TQF A;  4B3R B;  4DV7 B;  4CC5 A;  5JVD A;  1HW7 A;  3VQX A;  5KMG B;  4JYA B;  4JI1 B;  2QJ1 A;  4I55 A;  3N2K B;  1HNZ B;  2KKW A;  1M4U A;  2ZNI A;  3FFQ A;  2Q7H A;  3A2F A;  1H8E H;  1JFF B;  4IIJ A;  4LF7 B;  2UUB B;  4B3T B;  2QE7 H;  4BWA A;  1N32 B;  4GKJ B;  1I94 B;  4YJ2 B;  1WPB A;  5KHJ A;  4EB6 A;  3WB1 A;  5IJ0 B;  1DGS A;  5IWA B;  1IBL B;  3N2G B;  4JI3 B;  4X1Y B;  1AQT A;  4JI0 B;  5JQG A;  4DR5 B;  3JAL B;  3RYH B;  2PYL A;  5D5Q A;  3JSN A;  3JAK B;  1TVK A;  3HKC A;  2R9A A;  1KMI Z;  2PZS A;  3RYI B;  2BTQ B;  1TUB B;  4TOI A;  5EIB D;  1Q5O A;  4TUY A;  4FFB B;  4O4H A;  5KX5 B;  5IYZ B;  2V4D A;  5J2T B;  5FL7 H;  4AIL C;  2P5O A;  3RYC B;  2UU9 B;  4JI8 B;  4LFC B;  4DUZ B;  3T1Y B;  4UCV A;  5KMG A;  4B08 A;  3K5N A;  2F66 C;  2ZIN A;  3OTF A;  4CS3 A;  4ZOL B;  4NXM B;  4GKK B;  3N2K A;  4X66 B;  3BHP A;  2HLD H;  5LOV B;  4I50 B;  4GLX A;  4JI5 B;  4EFE A;  2BTO A;  1JFF A;  1JJO A;  2F4V B;  5BMV B;  5FPO A;  4DV4 B;  3SR2 C;  3CSX A;  1Z5W A;  5FNV B;  4IHJ B;  4O4L B;  5J2U B;  1V9P A;  2P22 C;  4YJ2 A;  1HNW B;  3JAT B;  2GV9 A;  5IJ0 A;  3N2G A;  4FVM A;  1J5E B;  4X1Y A;  1M5I A;  1BSH A;  3JAL A;  4JI7 B;  5LYJ B;  4LH7 A;  3JAK A;  2ZCE A;  3OTO B;  3PN1 A;  3RYI A;  2BTQ A;  4YY3 B;  3SJC C;  1M93 A;  1TUB A;  2UUC B;  5KX5 A;  1TAE A;  1SQG A;  5IYZ A;  3JAS B;  1G6U A;  3UQ8 A;  5J2T A;  5LP6 C;  5KHH A;  1SA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...