2RQ6A

Solution structure of the epsilon subunit of the f1-atpase from thermosynechococcus elongatus bp-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the intrinsic inhibitor subunit epsilon of F1-ATPase from photosynthetic organisms.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Hydrolase
molecule keywords ATP synthase epsilon chain
total genus 24
structure length 138
sequence length 138
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rq6A02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2rq6A01
2Q7HA 1BSNA 1E79H 4YXWH 2WSSH 2E5YA 3DSQA 3VQVA 2ZIMA 4BWAA 4CH4A 2XOKH 4Q6GA 2RQ6A 2ZNJA 4CH5A 2HLDH 4ASUH 2R72A 2QE7H 3BHPA 4CS3A 3ZEDA 2XNDH 1G6UA 1O9GA 2YI9A 2YIBD 3OE7H 2YIAA 3OAAH 4TQFA 3VQWA 5FL7H 3VQXA 2YIBA 1AQTA 1O9HA 2YI8A 5K1PA 4CH6A 1H8EH 4TQDA 2Q7EA 2PGGA 2R70A 2HEPA 5K1XA 2ZNIA 3OEHH 3VQYA 2V7QH 2E3CA 5DN6I 1BSHA 2ZCEA 4CS4A 2Q7GA 4CS2A 2RJZA 2ZIOA 4ZIBA 2RQ7A 4BW9A 3QTCA 4CH3A 1FS0E 2JVDA 2ZINA 3FKSH 2PUSA 2QJ1A 3OFNH
chains in the Genus database with same CATH superfamily
1N8RW 3ICXA 5IJ9A 2FYUH 5FPOA 1Q82W 1W0KG 2Q0OC 3EFFK 5KUMA 4PA4A 4FM2A 5HFMA 4JI2B 1SC5B 1K3EA 4JTAB 4I9QA 3HKEA 2VQFB 1SESA 1HR0O 2CGOA 4I55B 2ITCC 1LR1A 5B1BB 1VEWA 2A9HA 2EZOA 2AHZA 3ZHUA 4UXNA 3AG3B 3NR7A 1ZLZA 3JD4A 2IJHA 2QWRB 3JATB 5DN6I 1QVGU 2NNUA 3BAAA 2EZPA 3SYCA 4PELA 2CH7A 2ZR3A 2EIKB 3CWBH 4RO2A 1ZL8A 4E2LA 2ARHA 1K7DA 2NN4A 2AW9A 2HLDH 1K4CC 1BZKA 2WAMA 1AROP 4TT3G 2YIBD 4QNHB 3ZRSA 4GT1A 4J9YB 3GVMA 2PTMA 4MTGA 3SYOA 2P4KA 1YTFB 1MA1A 5JCOC 2YIDA 1KU9A 2ITDC 3LUTB 4IHJA 2DJVA 2Z3YA 2V4DA 1QNMA 3RYFB 3VQVA 2G38A 2HR3A 3K9SA 2YXYA 3VOUA 1G6UA 1XL4A 4D7TA 1Z5VA 1IBKO 5E79Z 1RM1B 3K9AA 4UV8A 5BR8B 1N33B 1EFRG 1RSOB 3CCQV 5EBLC 2EX3A 2VRZA 4ZHQA 2OTLV 3LNMB 1IBKB 4DXWA 3WB1A 4NB5A 2EIKC 4XDJA 3OMNB 5LP6A 1EM1A 2ZIMA 3JYCA 1VF6C 2QR4A 1N36O 2DQ0A 5IYZB 2IU3A 4O4LA 1TGOA 2ILMA 3TK1A 4UVCA 2XTAA 3CCVV 4QE7A 3RWRD 2UUBB 2D2CB 4JI3O 1PP9H 4EFBA 1QLNA 3ZMTA 5KHIA 4H44B 1A32A 3QO8A 3AG1C 3N27A 4DV7B 4P2ZA 4MVSA 4OX9O 4ZOLA 1CPYA 2WLKA 4U7OA 5J2UB 2ZT9B 4JI2O 4DV5O 4I0XA 4DR2O 1OHHG 1H2LA 3CRAA 1OV9A 2VS0A 4AHCA 4K35A 2H3OA 4X20B 4L87A 2O57A 1H8EG 2NR5A 1RFYA 4DUYB 3OAAH 2BSKA 4X1KB 4R50A 3T4ZA 2ADQB 3ZMUA 2BE3A 2CH7B 5LHGA 2AXTZ 1PD3A 3CCSV 1FXHA 4MTOA 3I5DA 4X62O 1EN5A 1PNKA 3OM3B 1XNRB 3HPLC 1Q7YW 1MMMA 2Q68A 1IURA 4X1IA 3TGUH 1GN2A 4FLXA 3K57A 3ABKC 3OTOO 1YI2V 1OCOB 1XMQB 3ZS8C 2IH3C 3K0DA 4K0KO 1MZFA 3I55V 1XHZA 2UXNA 1DLBA 1OCRB 4FMTA 4TUYA 3LDCA 1QHTA 2QKAA 1I94O 2WWWA 2B1GA 4PDMA 1KYOF 2HJFC 2EULA 4LWSA 2QEXV 4R8CA 3F7VC 1I94B 1IBLO 2OTJV 5DECA 1S5HC 4TSFG 1E79H 2Q6AA 1QVFU 4LF9B 1FS0G 2OYQA 1EN4A 3DGEA 4W4LA 4PI2A 1I0HA 1MSDA 1S5JA 1HDJA 2LQTA 3BA8A 1IBMO 1VF6A 3JAWA 1I5XA 3CX5F 1GH6A 3KKYA 1ROPA 1VMGA 1QR9A 2PYLA 4UFZA 4DV4O 1JQ0A 5IYZA 2VWJA 4JI7B 1VP7A 2YDEA 1O9GA 4KHPB 4NR1A 4LF6B 1IXBA 1FXVA 4DV4B 5KMGB 1US6A 2LGQA 5L3FA 2QWPB 4O4JB 2M6YA 3B09A 4DR2B 2KKWA 2IJKA 1Q6HA 2VQFO 4LF4B 4HZ3A 3CS5A 1K5QA 1L1FA 1HNWO 4DUZO 4QGPA 3MHHC 1H2NA 5IDJA 4DUYO 2DOSA 3OE7G 1NT2B 2GUZA 3CCJV 2HP8A 3VQYA 2RN9A 5LGNA 4YJ2A 2ZDIA 2X6CA 5D5PA 4LFBO 1FXKC 2KSDA 1WB7A 1KC8W 1G8MA 2ZE7A 1CXZB 2XASA 4GCZA 1XL6A 5J2TA 1SQFA 1AILA 2BOCC 1QBZA 5LMNB 1VQ4V 2E5LO 2JDIG 2EILB 1R73A 1TVKB 3ZRVA 3BRCA 1S5LZ 5BZBA 4IIJA 4DRXA 4WBNB 2ZXWB 2XOKH 1VQ9V 1AVMA 2ETNA 3BFRA 1YSCA 3K3WA 1F4MA 4LR3A 3CCEV 3D3QA 1NH2B 2XAFA 4OPAA 4CS4A 4B3RO 2XAGA 3JAKA 4HAMA 2D3OW 3CCMV 2H94A 3A0BZ 3RYCA 4DR3O 4DV3B 5KHGA 2UU9O 2XOKG 3OD4A 4FLTA 4O2AA 1L8DA 4NVPA 1JCHA 5EC2C 4C7UA 1IBMB 2YIBA 2B1IA 2ODMA 2LW1A 3T1YO 2RJZA 5H6RA 3J80N 1JPXA 3ASOC 5J2TB 1BHAA 3W7SA 4JI7O 4XDKA 2UUBO 4RUFA 3ZBHA 4FK5C 3T1YB 3H9VA 1SQXH 3RGBA 1QCEA 2UXCO 1KQSU 1WPBA 4DR5B 1VQ7V 5GW7A 1Q86W 4G2KA 3FB5C 1BSMA 1BCCH 5J9PC 3BA9A 2UXCB 2V7QH 3ABKB 4B3SB 3FB7C 3RVZA 4GKJB 4I50B 3DXRB 1ZUQA 4CH4A 1H38A 3A2FA 3SJBC 4YJ3B 3U0ZA 2Y0IA 2YSUB 1EBOA 1DGSA 2XNDG 2OCCC 4ZIBA 1SERA 1R3KC 3ETDA 3CC7V 2QWOB 1WAZA 4JTCB 1BQZA 3JAMN 1SQBH 2P90A 4DO2A 2EJRA 4DW0A 2W0XA 1XUQA 3FAVA 1K92A 4GKKB 4I0XB 2DWDC 1FFXA 2GV9A 2ZKOA 2UUCO 3WB0A 4PI0A 5C8YA 5LYJB 1FJGB 1COWG 4X64O 4HYOA 1YHQV 2LGWA 1NH2D 1OCZB 2WA4A 2AZ2A 2A79B 3LDEA 5LHIA 2VQEO 4MVOA 4PA7A 3CB2A 3BEHA 4RQEA 3H1JH 3ZRWA 2XNDH 4JPRA 1KP2A 3GWKC 4GYCB 2YXHA 1M57C 3RVYA 3WG7B 3ZMSA 5FL7G 5CA1B 2HJDA 2B5UA 4PDRA 5EYPB 4NTWA 4UB8Z 5KA5A 4U3JA 1PNMA 1URFA 4DV0O 1WA8B 5H9CA 1GO3F 1XI1A 2JK5C 5JH7B 2ZCEA 4LFCB 1GAXA 3BVOA 1U97A 4YIOA 1KKDA 2QWNB 4DR3B 4DR5O 2XHBA 2WPDG 4DV1B 3W7TA 4PHZA 1VF5B 2ZE6A 1J95A 3CJHB 3M7MX 1L0NH 1WP7A 3Q4HB 1ZWIC 3HB3B 1ZAUA 1R6NA 2HVKC 4XBFA 4JI3B 5K1PA 2H8PC 3RYHB 3WG7C 3N2GA 1HNXO 4BR6A 1K97A 3OFNH 2PI4A 1R3IC 3ZHVA 3U10A 5EZYB 5FNVA 1M56B 3RT3C 2Q0AA 1ZX3A 2YS8A 3C3TA 1TUBA 3ZHSA 4DR1O 3K03A 3HKDB 4B3SO 3B4SA 3QG5A 1ZTEA 3BCCH 2P7TC 4GKJO 3CRQA 1W59A 5JH7A 1YIJV 4B08A 3H1LH 2LJ2A 5LXTB 4LFBB 2DW4A 3MD0A 2IJIA 1AR5A 1P7GA 3FYIB 3ZJZA 1XNQO 1JJOA 3DC6A 4PA6A 1D5AA 1MG1A 4DW1A 4TWKA 1W0JG 4LF7O 1BGYH 4X1YB 1FKAO 5JJJB 1I5YA 1M93A 2IU0A 3RN4A 1YXBA 2WA3A 4RQFA 4K8ZA 1QLEC 2A0LA 4DK1A 4LNUB 4MVUA 1WLEA 5IJ0A 4GZRB 2BCCH 2ADPA 1D2DA 2LW7A 4YHHB 3X2QB 1YDXA 5EIBC 4MTXA 2UXDB 4D6TH 4DV2B 4LF5O 1S72V 3SR2C 1WJZA 3OUFA 1WPXA 2UUAO 2Q5ZA 1AJPA 1WA8A 4U7NA 1S0VA 4UCTA 4BWAA 3SGIA 2QWQB 4WFAV 4IHJB 4CS3A 4GX5A 3SDLA 4LF6O 1NR1A 3FD9A 5KA6A 3T1HB 1IZ3A 1S3JA 2WLNA 3K5LA 5CBHA 4FFBB 4DV5B 2E3CA 2P5OA 3OW2U 1M4UA 1BE3H 3K59A 1XREA 4KHPO 2Q8VA 3P3NA 1KUQA 3AG3C 4J42A 4QJFB 1GTOA 4DUZB 3H1HH 2BTOA 4PV1B 1UPGA 3UQ8A 2Y4TA 2DYRB 3K5OA 1CEZA 1FPOA 4QIWF 2GTSA 2CTRA 1YVWA 4MSWC 1XBLA 3WFVA 1E79G 2EBOA 3HKDA 4DV6O 3WB2A 4Q6GA 2ZNJA 4H13B 4F4LA 2XAJA 5BMVA 4RAIA 1I08A 2JS3A 1I7FA 1AQTA 1JFFA 1YITV 1KMIZ 2A3QA 4EEQA 1Q81W 4KUMA 2CGNA 5CA3A 2F66C 1IVSA 1KKCA 4J9ZB 3JARA 1HNWB 1MZEA 1XNQB 4NYKA 4WCEV 4JF3A 4AI8A 3ML0A 2JGUA 3A8TA 2B9ZA 1B6QA 1THZA 1GM9A 4LF7B 4PDVA 3QO5A 4ZOLB 4Z2WA 4I7ZB 3OMAB 2X6BA 1FS0E 3BY6A 3O65A 4LBEC 3JCUZ 2WSSH 1H2SB 1PKXA 3TJTA 4WFHA 2XT9A 5DEDA 1P84F 1HP8A 4J11A 1JOYA 1H2GA 4B7KA 5IY5B 5JJEB 5EYPA 3AK1A 3GWOA 5EK0A 4DRXB 1K4DC 5BY1A 5CA1A 4JI5O 3LSSA 1HWYA 1EN6A 1NTMH 3ZN0A 3CC2V 4X8AA 5KHKA 4LNUA 3QNEA 4JYBA 1N34B 1VQNV 3TCUA 2QM7A 1YEWA 2PF4E 3CMEV 1B06A 5JCOA 2Y48A 4LF9O 5JQGB 2Q73A 3P30A 3ZRWB 2WLLB 4D7SA 2Y69C 3ASNC 4O2AB 3L72H 3RYIB 2RNBA 5B3SC 2QKSA 3DTUB 5B66Z 2WLMA 4DR6B 1EZJA 1K73W 2Z0AA 4KP4A 4JI4B 4JZGA 4BW5A 4IL6Z 5LYJA 3A0HZ 3SPJA 3DSQA 2JJ1G 4NTXA 4JI6O 2X6AA 2DYSC 3W7UA 1F7YA 5EBWC 4ABMA 5CA0A 2DN9A 4UCOA 4JASA 3T1CA 2AHYA 3OTFA 4MT8A 2Q7EA 3CEIA 2R9RB 2EIJB 2CE4A 1SZTA 4JAUA 3P3PA 3CCRV 3ASOB 4FZ1A 1KP3A 4J7ZA 4YY3B 1F4NA 4IYHA 1DK1A 2WLHA 4YJ3A 3N2GB 4NKGB 3JATA 5IYCO 3CD6V 1VQOV 2E5YA 1LUWA 5LBQA 4GLXA 4LP8A 1QR8A 4DR4O 4O2BB 5DM6V 1VQMV 4YJ2B 1NBMG 3B77A 3CSXA 1NU1H 5EIBD 4JYCA 4X64B 4LH6A 4PA9A 2X0LA 5B3SB 2EIMC 1PM9A 1VQ8V 1GMGA 4TV9A 1MNGA 4LC1A 3ABMB 4MW3A 3G80A 2ZE5A 3SYPA 2JJ2G 2NLJC 3L9DA 3K58A 4XDLA 1PPJH 4BAYA 4Z1MG 3JASA 1HNZO 1XQ8A 1NVPD 3G67A 3KZIZ 3L70H 1NVPB 2IM9A 2YICA 2EINB 4JV5B 1Q8IA 4KL1A 4UCSA 3OTOB 3S3WA 1J5EB 3JSNA 2QTOA 5GTIZ 3RYCB 2JGDA 4W4KA 4CH6A 4DR6O 3ZHTA 5BXZA 2GHYA 2W6IG 4YHHO 3FKSH 4DV1O 2L35A 1VQ5V 2QJ1A 1P4RA 1RSOA 3VBBA 3C3SA 3RBZA 1KB9F 3ZHQA 3A0RA 5JJNB 5EBMC 5HFLA 1WNSA 1OCOC 1SQVH 1WB8A 2GBOA 4NXNO 2AGAA 4H33A 1UFIA 1YJWV 3OT7A 4YY3O 2QSAA 4P9OA 1JA8A 4NXNB 2ZD9A 3E86A 2ZM6B 3C90A 4JI6B 1H2KA 3L73H 4GX2A 1GKFA 4KFMA 3PJSK 1FXKB 1Q6UA 3AG2B 2ZM6O 3CP1A 5BMVB 1AR4A 2F1MA 1TUEB 3HR0A 2M7WA 3CJHA 3D8CA 4K3AA 1K5SA 4GX0A 2WLIA 1P49A 3DXRA 1AI6A 2KQXA 2R9AA 2QA4V 3FX7A 2W6JG 1R3LC 1B3QA 3UM7A 3E83A 3OEEG 5B1OA 3DC5A 1XMQO 4B3MO 4DYLA 4FM1A 3MAQA 4ZI7A 5K1XA 4O4JA 1IDSA 4DK0A 3M99B 4O4IA 4B3TO 3B40A 3F5WC 5KUKA 1ZSPA 2R9IA 2ZDIC 3EHBB 1FXKA 4ICGA 4O4HB 4UCRA 4CC6A 1QQCA 3PN1A 5IJ9B 4FVMA 3E8BA 3OEHH 3ZMVA 1F51A 4CS2A 1E1QG 3OAAG 1R3JC 3ABTA 4J7JA 2Q7HA 2K9PA 5JVDB 5H6QA 5L3GA 2P22C 4L8JA 5B1BC 1SA0A 1XDCA 4JI8O 3LDDA 3WU2Z 1BT8A 4NXMB 5CB4A 3K5MA 1Q43A 1OZ0A 3UO2A 2EIJC 1Y66A 1T5EA 4O2BA 5LGUA 5B1AB 1K34A 3T1HO 1YZBA 4JGSA 4JYAO 3ABLC 2CK3G 4IIJB 4FM0A 3IGAC 2EJ7A 3AG2C 4X1YA 1OCCB 3E22A 3J81N 4O4HA 3FKSG 4DV2O 2EILC 2W0FC 4GUNA 3CC4V 1G4YB 3B2EE 4ZBMA 1X4TA 1BSHA 3JASB 4H0LB 3MHSC 2ZINA 3L75H 1BMFG 4R6ZA 2JEUA 1K9MW 4TV9B 2JEXA 1M1KW 3QF7A 3OR7C 3OGIB 4WF9V 2E74B 3SPGA 4PJ0Z 3KCYA 5B1NA 3VQXA 2GUZB 1H8EH 1Z2GA 2HVJC 2YC0A 5CBFA 4X66O 2WLIB 3JCZA 3D3IA 2JIZG 3IAYA 3HKEB 3FAVB 4IYIA 5C93A 5FNVB 5EZYA 4G28B 3JD1A 5GONB 4WFFA 4K8XA 2DYRC 2WLJA 4X66B 1V9PA 4CH5A 2WLLA 2LO1A 4X20A 3H01A 1CP9A 2CTWA 4AILC 1IX9A 3E89A 2HFEC 3ZN1A 1D5NA 1JR9A 2F43G 3IFXA 3ZRXA 1ZL8B 1M9NA 3OEHG 4JAAA 1WN7A 4JI1O 3Q4HA 4O4IB 2VQEB 4F6RA 1GM7A 4CH3A 2WSSG 3W7XA 4AQYO 3M8AA 2F4VO 4JI1B 3K04A 1YJ9V 2V7QG 4FLYA 3K08A 5LMNO 4JI8B 2LFRA 3AEIA 3G4SV 4FLWA 2F95B 3AK2A 1NS1A 4I55A 2DMXA 2PY5A 3ZMZA 4UVBA 5LHHA 3SJQC 5KAFZ 2UU9B 4Z1VA 2GTAA 2K1EA 4NTYA 3FFQA 3CPWU 3E8GA 1M90W 4JYAB 1H2MA 2QM8A 3KG2A 4JTDB 4O4LB 4FIPC 1N32B 4CZZA 5LGTA 2OCCB 5LP6B 4B3RB 5CBGA 4TUYB 3THOA 2UXDO 1NTZH 4X65B 4ZHQB 1VQLV 2Y0PA 2HKOA 5LA6A 1JFFB 1KECA 1MABG 2ZR2A 5E1AC 5KAIZ 3UO3A 1YF2A 2ATKC 1V55B 2BTQB 2KG7A 1R6KA 3JAKB 2OCHA 1Y74A 4UCVA 3RYFA 4FLUA 2FL4A 1LUVA 2PI5A 2UXBO 4WFBV 1X59A 1UJWB 1OJHA 3E2EA 2HLDG 1SRYA 4WFGA 1HW7A 2FTKA 2QDOA 5IYDO 1FD9A 4DV0B 5LOVB 3J7AU 4HBNA 1HNXB 1QLEB 3K0GA 4WBNA 3NXSA 1B04A 4LF4O 2BOBC 4F6RB 1SF9A 2P4VA 3APOA 3JD3A 3L74H 2CDYA 4QPJA 4X1KA 2BSKB 2XUMA 3JARB 4X89A 1FYJA 2Q7GA 1R6TA 3OR6C 5F2VO 2L6LA 1XEQA 1RP3B 4OPHA 4AQYB 4X88A 3STZC 3X2QC 1MOFA 5KHJA 1VQPV 1GN3A 1SQQH 5B5EZ 3T4DA 2XAQA 2AZ0A 2DWEC 1K33A 1AJQA 3JAWB 1G1XB 3CMAV 1AI7A 3CCLV 3P32A 4F6EA 3JD2A 1M57B 2OT5A 1SETA 1Y74B 3L71H 4UVAA 1WP8A 2JVDA 2BTQA 2KG7B 1XHXA 2P6JA 5IT9N 2RDCA 3ASNB 3ETEA 2QE7G 1S77D 4H37A 1Q6IA 1J5EO 1H8HG 4BIZA 3ABUA 1Y67A 5IJ0B 3O9OA 4DR7O 5JQGA 1DF4A 1TAEA 2N74A 2Z5UA 3G6BA 5KMGA 4B7EA 2UUAB 4JI5B 4TQDA 4JV5O 4E4EA 1VARA 5TISZ 1N0JA 1BQ0A 5KHHA 2EINC 1N34O 3UKMA 4FFBA 4MW8A 1ORQC 5CA0B 4I5SA 2DQ3A 1IXMA 3SPIA 2YEVB 3HKBA 1E1RG 4LH7A 3ABMC 2UXXA 5IWAB 4JZ2A 5BR8O 4HNAB 1N33O 4GX1A 1YTFD 3OMIB 3SJAC 3FB6C 3LSQA 2QKCA 5L3DA 4PD4F 4FJCC 4I4TA 4RWUA 4P9PA 5IWAO 2Q4PA 5LA6B 1PL0A 1NR7A 3AK3A 5LL6Y 1SZXA 3CRRA 4LWSB 4TV8B 3D36A 3OGCC 4OX9B 1AB3A 1AJNA 4IGGA 1BHBA 4LFCO 4KXRA 1VIBA 2KB1A 3R66A 3SYAA 3QTCA 2IBZH 2FKXA 3CHXA 4YXWH 3H1IH 3CRMA 2Q69A 1NJIW 4B3MB 3BHPA 2UXBB 1HR0B 5AG2A 1OCRC 2OWOA 5J2UA 3APQA 2CTPA 4FLVA 1PNLA 4LFAB 5LMUO 5KLVH 4Q20A 2LFSA 1BL8A 5KX5B 4JAVA 4I9WA 2QGNA 4BIOA 5LMUB 1XNRO 4ASUH 4J80A 3B8MA 1TUBB 1XILA 4EFEA 3ETQA 4DR1B 3AG4B 5FLXN 3IJ4A 2MW2B 4MVZA 1AR1B 1HNZB 1Y4MA 1RM1C 4R7CA 1OCZC 3CE2A 4OGQB 1AI5A 5LOVA 1K8AW 1KBHA 2E5LB 3E8FA 4NXMO 1Q3EA 3OE7H 5IYBO 1Y76B 1MSWD 4MVQA 4GKKO 1QU7A 2HHHB 4HNAA 3E8HA 3RFRA 3AG7A 1EZVH 2Q9LA 1V55C 3LSUA 5C8YB 3SPCA 3JD0A 2EIMB 1RPOA 3TXQA 5IE9A 4U3JB 2ZQMA 1JX9A 2JGDB 3G6EV 3AG1B 2ZE8A 1Q90D 2ZNIA 2E75B 2YXLA 5L3CA 1U96A 4DV3O 1JVMA 5FPRA 3OUSA 1YCIA 4X65O 4YIPA 3CRCA 5ITZA 3ZX6A 2R72A 5DN6G 4BIUA 3RW0A 4N21A 3JALA 2YIAA 5H2FZ 3HKCA 4ZI7B 1P7BA 5LXTA 1N36B 4X1IB 3F5TA 4FLZA 2CTQA 3UCSC 2PGGA 4UUJC 3S3XA 1SKVA 3ZIAG 1NTKH 4EKWA 2FMLA 3SYQA 5JVDA 3FYEB 4QPKA 4WFEA 3EVKA 4FPPA 2ZXWC 1M56C 5LP6C 3TETA 3UT5A 4JI4O 4TQFA 4FFKA 4JYYA 2N05A 4P30A 3BPZA 4LF8O 1FFTB 4LFAO 5EC1C 1SQPH 1KD1W 2CAZC 2F4VB 3RYHA 2UUCB 1NQTA 5GONA 3CYOA 4MTFA 2Y69B 4J41A 1SQGA 3BABA 1AP6A 4QE9A 2QTSA 3ETGA 3VQWA 5B1AC 1BS3A 5A9GA 4FZ0A 3K79A 3EXAA 2IW5A 5KX5A 1JMKC 3K06A 5D5QA 3CCUV 1FAFA 1DTOA 2RMKB 3B8NA 2VWKA 1BSNA 4N23A 3CXCU 1W2BU 3HKCB 2OIEA 3JALB 2RCVA 4X62B 3SJCC 4UV9A 4ZKIA 4A5UB 5ITZB 2FB5A 4EB6B 3N2KA 4DR7B 1O9HA 2E76B 4JI0O 2GSMB 2HEPA 4K0KB 3G71V 1TVKA 1TA8A 1R1BA 5L3BA 1JJ2U 4LF5B 2XAHA 4YXWG 2Q67A 1F23A 3OFNG 1IBLB 5CB4B 2HHHO 2IH1C 2DYSB 5L3EA 1VQ6V 1XMOB 4J10A 2F93B 4OXSA 1NZ6A 5H5NA 1DF5A 1XMOO 1ENVA 3HKBB 2A7WA 1XOUA 1L0LH 4G27B 4J7KA 2C2AA 1M5IA 2CUGA 2YI8A 5A2QN 2F23A 4LF8B 2P67A 3AG4C 4BW9A 3U11A 3ZCCA 1PV0A 5CMUA 2JRIA 2MK3A 1AP5A 1GM8A 4DV6B 1Y6XA 4MS2A 3ZEDA 1V54B 2YI9A 5FL7H 4I50A 1N4CA 2R70A 3MDSA 2PZSA 3UT5B 2A06H 2IJJA 4U3FH 4RUEA 2HG5C 3STLC 1YJNV 1OCCC 2DE0X 3ABLB 3FB8C 2GDSA 3W7WA 1NKDA 3E35A 3QO7A 1VQKV 3T2MA 3QVNA 1FFXB 2QE7H 2LP7A 3SPHA 1Q5OA 4PDLA 1NI8A 3I56V 3ZHRA 2OIGA 3H1KH 1PL4A 3IC9A 4UB6Z 4DR4B 2YUAA 2V1DA 4LCUC 2Y4UA 4TOIA 2RQ6A 5GTHZ 2PYJA 4TV8A 1SS3A 3E22B 4B3TB 1V54C 4MVMA 4PA3A 4I4TB 1LNQA 2N04A 3F7YC 3N2KB 1N0NA 1GRJA 4MVRA 4EB6A 3GB7C 2QM4A 4JI0B 2P06A 3IC7A 1FJGO 2ZIOA 2RQ7A 1GN4A 4IT5A 5JWPA 2JS5A 3K5NA 3R65A 1Z5WA 4ASUG 1GN6A 2YEVA 4UCUA 1N32O 4CC5A 3LNNA 1AI4A 1SA0B 3TXSA 1VF7A 4CBCA 1S76D 4DV7O 2X7RB 3D36C 3RYIA 1Y76A 3CXHF 4X9QA 5CN0A 1RPRA 3JSLA 1GK9A 3KCXA 2PUSA 5IY5C
chains in the Genus database with same CATH topology
4GKJB 5EIBD 3ICXA 4I50B 4FFBA 4CH4A 5IJ9A 3A2FA 4X64B 3SJBC 5CA0B 4YJ3B 5FPOA 4LH6A 3U0ZA 3HKBA 4LH7A 4TV9A 4FM2A 1DGSA 4JI2B 5IWAB 4I9QA 3HKEA 4HNAB 4ZIBA 3K58A 2VQFB 3JASA 4I55B 3SJAC 1XQ8A 2IM9A 4I4TA 4JV5B 1Q8IA 4KL1A 4UCSA 5LA6B 3OTOB 4TV8B 4GKKB 1J5EB 1FFXA 2GV9A 3JSNA 4OX9B 3WB0A 4PI0A 5C8YA 5LYJB 3RYCB 4CH6A 1FJGB 3JATB 2PUSA 5DN6I 3BAAA 3FKSH 3QTCA 2QJ1A 1RSOA 3CHXA 4YXWH 2HLDH 3CB2A 4B3MB 3BHPA 2XNDH 5JJNB 2YIBD 1HR0B 2UXBB 2OWOA 5J2UA 2PTMA 4GYCB 4FLVA 1WNSA 4LFAB 5JCOC 1KU9A 4IHJA 5CA1B 5KX5B 2V4DA 5EYPB 3RYFB 3VQVA 5LMUB 4NXNB 4ASUH 2ZM6B 1TUBB 4U3JA 4JI6B 1G6UA 4EFEA 3ETQA 4DR1B 4D7TA 1Z5VA 1XI1A 5BMVB 5BR8B 5JH7B 1N33B 2F1MA 2ZCEA 4LFCB 2EX3A 4ZHQA 1HNZB 4DR3B 1IBKB 3WB1A 5LP6A 1P49A 2XHBA 4DV1B 2R9AA 5LOVA 2ZIMA 4PHZA 2E5LB 3M7MX 1Q3EA 5IYZB 3OE7H 1ZAUA 4O4LA 1TGOA 4JI3B 4FM1A 5K1PA 3MAQA 4ZI7A 5K1XA 4O4JA 4DK0A 3RYHB 2HHHB 3N2GA 3RWRD 2UUBB 4HNAA 4EFBA 3RFRA 4O4IA 3OFNH 5KHIA 3U10A 5C8YB 5EZYB 5FNVA 4O4HB 4UCRA 2Q0AA 4DV7B 1TUBA 4U3JB 4CC6A 1QQCA 3PN1A 4ZOLA 5IJ9B 4FVMA 3HKDB 5J2UB 2ZNIA 3QG5A 3OEHH 2YXLA 4CS2A 5FPRA 5JH7A 4B08A 2Q7HA 5LXTB 5JVDB 4LFBB 4AHCA 2P22C 5ITZA 4L8JA 2R72A 4X20B 1SA0A 1JJOA 3JALA 2YIAA 4DUYB 3OAAH 3HKCA 4ZI7B 5LXTA 1N36B 4NXMB 4X1IB 4X1KB 1D5AA 5CB4A 3K5MA 4FLZA 1Q43A 2PGGA 1SKVA 1T5EA 4O2BA 4X1YB 5JJJB 1M93A 5JVDA 4K8ZA 4IIJB 4DK1A 4FM0A 5LP6C 4LNUB 1XNRB 4X1YA 3E22A 5IJ0A 4O4HA 3UT5A 4TQFA 3B2EE 4X1IA 4YHHB 1X4TA 3BPZA 5EIBC 4FLXA 3K57A 2UXDB 1BSHA 3JASB 1XMQB 4DV2B 2F4VB 2CAZC 2ZINA 3ZS8C 3RYHA 2UUCB 3SR2C 5GONA 4TV9B 4UCTA 4BWAA 3SGIA 4IHJB 3QF7A 1SQGA 3BABA 4CS3A 1XHZA 3T1HB 3VQWA 3VQXA 4TUYA 1QHTA 3K5LA 4FFBB 1H8EH 4DV5B 5KX5A 1JMKC 2E3CA 2P5OA 5D5QA 1M4UA 3IAYA 3HKEB 3K59A 1I94B 2VWKA 5EZYA 5FNVB 1BSNA 5GONB 1E79H 4K8XA 4DUZB 2BTOA 3HKCB 4X66B 4LF9B 1V9PA 3JALB 4CH5A 2OYQA 4X20A 4X62B 3UQ8A 3SJCC 4PI2A 5ITZB 4AILC 3K5OA 4EB6B 1S5JA 3N2KA 4DR7B 1O9HA 3BA8A 2HEPA 1WN7A 4K0KB 4O4IB 2VQEB 1TVKA 1TA8A 4F6RA 3JAWA 4CH3A 4LF5B 3HKDA 4JI1B 3WB2A 2PYLA 4UFZA 4Q6GA 2ZNJA 5IYZA 2VWJA 4FLYA 4JI7B 1O9GA 4JI8B 4KHPB 5BMVA 1IBLB 5CB4B 1I7FA 4LF6B 4FLWA 2F95B 1AQTA 1JFFA 4DV4B 5KMGB 4I55A 2PY5A 1KMIZ 1XMOB 4EEQA 2UU9B 2F93B 2F66C 3FFQA 4O4JB 4JYAB 4DR2B 2KKWA 3JARA 1HNWB 1XNQB 4LF4B 4O4LB 1N32B 3HKBB 2JGUA 4LF7B 1M5IA 1NT2B 5LP6B 2YI8A 4ZOLB 4B3RB 4TUYB 4LF8B 3THOA 3VQYA 4YJ2A 4X65B 5D5PA 4BW9A 4ZHQB 1FS0E 3U11A 5LA6A 1JFFB 2WSSH 1H2SB 5J2TA 2BTQB 4DV6B 1SQFA 3ZEDA 5JJEB 2YI9A 3JAKB 5FL7H 4UCVA 5EYPA 3RYFA 5LMNB 4FLUA 4I50A 4DRXB 2R70A 5CA1A 2PZSA 3UT5B 1TVKB 1HW7A 3BRCA 5KHKA 4LNUA 4DV0B 5LOVB 4IIJA 4DRXA 4WBNB 1N34B 4HBNA 1HNXB 4WBNA 1YEWA 5JCOA 2XOKH 1B04A 5JQGB 1FFXB 2QE7H 1Q5OA 4D7SA 4F6RB 4O2AB 4LR3A 3RYIB 4X1KA 3JARB 4DR4B 4DR6B 4CS4A 2Q7GA 3JAKA 4AQYB 4JI4B 5LYJA 3RYCA 5KHJA 4DV3B 5KHGA 3DSQA 4TOIA 2RQ6A 4FLTA 4O2AA 3JAWB 2PYJA 4TV8A 1L8DA 3E22B 4NVPA 4B3TB 5CA0A 4I4TB 4UCOA 1IBMB 2YIBA 3N2KB 3OTFA 2Q7EA 4EB6A 2QM4A 4JI0B 2RJZA 2ZIOA 2RQ7A 2JVDA 2BTQA 1XHXA 5J2TB 2JS5A 3K5NA 1Z5WA 3T1YB 4YY3B 4UCUA 3RGBA 4CC5A 3LNNA 5IJ0B 1WPBA 1SA0B 4DR5B 5JQGA 1VF7A 3N2GB 4YJ3A 1TAEA 3JATA 5KMGA 2UUAB 2E5YA 4JI5B 4TQDA 3RYIA 3BA9A 4GLXA 2UXCB 2V7QH 4B3SB 4O2BB 5KHHA 3JSLA 4YJ2B 3CSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7H A;  1BSN A;  1E79 H;  4YXW H;  2WSS H;  2E5Y A;  3DSQ A;  3VQV A;  2ZIM A;  4BWA A;  4CH4 A;  2XOK H;  4Q6G A;  2RQ6 A;  2ZNJ A;  4CH5 A;  2HLD H;  4ASU H;  2R72 A;  2QE7 H;  3BHP A;  4CS3 A;  3ZED A;  2XND H;  1G6U A;  1O9G A;  2YI9 A;  2YIB D;  3OE7 H;  2YIA A;  3OAA H;  4TQF A;  3VQW A;  5FL7 H;  3VQX A;  2YIB A;  1AQT A;  1O9H A;  2YI8 A;  5K1P A;  4CH6 A;  1H8E H;  4TQD A;  2Q7E A;  2PGG A;  2R70 A;  2HEP A;  5K1X A;  2ZNI A;  3OEH H;  3VQY A;  2V7Q H;  2E3C A;  5DN6 I;  1BSH A;  2ZCE A;  4CS4 A;  2Q7G A;  4CS2 A;  2RJZ A;  2ZIO A;  4ZIB A;  2RQ7 A;  4BW9 A;  3QTC A;  4CH3 A;  1FS0 E;  2JVD A;  2ZIN A;  3FKS H;  2PUS A;  2QJ1 A;  3OFN H; 
#chains in the Genus database with same CATH topology
 1N8R W;  3ICX A;  5IJ9 A;  2FYU H;  5FPO A;  1Q82 W;  1W0K G;  2Q0O C;  3EFF K;  5KUM A;  4PA4 A;  4FM2 A;  5HFM A;  4JI2 B;  1SC5 B;  1K3E A;  4JTA B;  4I9Q A;  3HKE A;  2VQF B;  1SES A;  1HR0 O;  2CGO A;  4I55 B;  2ITC C;  1LR1 A;  5B1B B;  1VEW A;  2A9H A;  2EZO A;  2AHZ A;  3ZHU A;  4UXN A;  3AG3 B;  3NR7 A;  1ZLZ A;  3JD4 A;  2IJH A;  2QWR B;  3JAT B;  5DN6 I;  1QVG U;  2NNU A;  3BAA A;  2EZP A;  3SYC A;  4PEL A;  2CH7 A;  2ZR3 A;  2EIK B;  3CWB H;  4RO2 A;  1ZL8 A;  4E2L A;  2ARH A;  1K7D A;  2NN4 A;  2AW9 A;  2HLD H;  1K4C C;  1BZK A;  2WAM A;  1ARO P;  4TT3 G;  2YIB D;  4QNH B;  3ZRS A;  4GT1 A;  4J9Y B;  3GVM A;  2PTM A;  4MTG A;  3SYO A;  2P4K A;  1YTF B;  1MA1 A;  5JCO C;  2YID A;  1KU9 A;  2ITD C;  3LUT B;  4IHJ A;  2DJV A;  2Z3Y A;  2V4D A;  1QNM A;  3RYF B;  3VQV A;  2G38 A;  2HR3 A;  3K9S A;  2YXY A;  3VOU A;  1G6U A;  1XL4 A;  4D7T A;  1Z5V A;  1IBK O;  5E79 Z;  1RM1 B;  3K9A A;  4UV8 A;  5BR8 B;  1N33 B;  1EFR G;  1RSO B;  3CCQ V;  5EBL C;  2EX3 A;  2VRZ A;  4ZHQ A;  2OTL V;  3LNM B;  1IBK B;  4DXW A;  3WB1 A;  4NB5 A;  2EIK C;  4XDJ A;  3OMN B;  5LP6 A;  1EM1 A;  2ZIM A;  3JYC A;  1VF6 C;  2QR4 A;  1N36 O;  2DQ0 A;  5IYZ B;  2IU3 A;  4O4L A;  1TGO A;  2ILM A;  3TK1 A;  4UVC A;  2XTA A;  3CCV V;  4QE7 A;  3RWR D;  2UUB B;  2D2C B;  4JI3 O;  1PP9 H;  4EFB A;  1QLN A;  3ZMT A;  5KHI A;  4H44 B;  1A32 A;  3QO8 A;  3AG1 C;  3N27 A;  4DV7 B;  4P2Z A;  4MVS A;  4OX9 O;  4ZOL A;  1CPY A;  2WLK A;  4U7O A;  5J2U B;  2ZT9 B;  4JI2 O;  4DV5 O;  4I0X A;  4DR2 O;  1OHH G;  1H2L A;  3CRA A;  1OV9 A;  2VS0 A;  4AHC A;  4K35 A;  2H3O A;  4X20 B;  4L87 A;  2O57 A;  1H8E G;  2NR5 A;  1RFY A;  4DUY B;  3OAA H;  2BSK A;  4X1K B;  4R50 A;  3T4Z A;  2ADQ B;  3ZMU A;  2BE3 A;  2CH7 B;  5LHG A;  2AXT Z;  1PD3 A;  3CCS V;  1FXH A;  4MTO A;  3I5D A;  4X62 O;  1EN5 A;  1PNK A;  3OM3 B;  1XNR B;  3HPL C;  1Q7Y W;  1MMM A;  2Q68 A;  1IUR A;  4X1I A;  3TGU H;  1GN2 A;  4FLX A;  3K57 A;  3ABK C;  3OTO O;  1YI2 V;  1OCO B;  1XMQ B;  3ZS8 C;  2IH3 C;  3K0D A;  4K0K O;  1MZF A;  3I55 V;  1XHZ A;  2UXN A;  1DLB A;  1OCR B;  4FMT A;  4TUY A;  3LDC A;  1QHT A;  2QKA A;  1I94 O;  2WWW A;  2B1G A;  4PDM A;  1KYO F;  2HJF C;  2EUL A;  4LWS A;  2QEX V;  4R8C A;  3F7V C;  1I94 B;  1IBL O;  2OTJ V;  5DEC A;  1S5H C;  4TSF G;  1E79 H;  2Q6A A;  1QVF U;  4LF9 B;  1FS0 G;  2OYQ A;  1EN4 A;  3DGE A;  4W4L A;  4PI2 A;  1I0H A;  1MSD A;  1S5J A;  1HDJ A;  2LQT A;  3BA8 A;  1IBM O;  1VF6 A;  3JAW A;  1I5X A;  3CX5 F;  1GH6 A;  3KKY A;  1ROP A;  1VMG A;  1QR9 A;  2PYL A;  4UFZ A;  4DV4 O;  1JQ0 A;  5IYZ A;  2VWJ A;  4JI7 B;  1VP7 A;  2YDE A;  1O9G A;  4KHP B;  4NR1 A;  4LF6 B;  1IXB A;  1FXV A;  4DV4 B;  5KMG B;  1US6 A;  2LGQ A;  5L3F A;  2QWP B;  4O4J B;  2M6Y A;  3B09 A;  4DR2 B;  2KKW A;  2IJK A;  1Q6H A;  2VQF O;  4LF4 B;  4HZ3 A;  3CS5 A;  1K5Q A;  1L1F A;  1HNW O;  4DUZ O;  4QGP A;  3MHH C;  1H2N A;  5IDJ A;  4DUY O;  2DOS A;  3OE7 G;  1NT2 B;  2GUZ A;  3CCJ V;  2HP8 A;  3VQY A;  2RN9 A;  5LGN A;  4YJ2 A;  2ZDI A;  2X6C A;  5D5P A;  4LFB O;  1FXK C;  2KSD A;  1WB7 A;  1KC8 W;  1G8M A;  2ZE7 A;  1CXZ B;  2XAS A;  4GCZ A;  1XL6 A;  5J2T A;  1SQF A;  1AIL A;  2BOC C;  1QBZ A;  5LMN B;  1VQ4 V;  2E5L O;  2JDI G;  2EIL B;  1R73 A;  1TVK B;  3ZRV A;  3BRC A;  1S5L Z;  5BZB A;  4IIJ A;  4DRX A;  4WBN B;  2ZXW B;  2XOK H;  1VQ9 V;  1AVM A;  2ETN A;  3BFR A;  1YSC A;  3K3W A;  1F4M A;  4LR3 A;  3CCE V;  3D3Q A;  1NH2 B;  2XAF A;  4OPA A;  4CS4 A;  4B3R O;  2XAG A;  3JAK A;  4HAM A;  2D3O W;  3CCM V;  2H94 A;  3A0B Z;  3RYC A;  4DR3 O;  4DV3 B;  5KHG A;  2UU9 O;  2XOK G;  3OD4 A;  4FLT A;  4O2A A;  1L8D A;  4NVP A;  1JCH A;  5EC2 C;  4C7U A;  1IBM B;  2YIB A;  2B1I A;  2ODM A;  2LW1 A;  3T1Y O;  2RJZ A;  5H6R A;  3J80 N;  1JPX A;  3ASO C;  5J2T B;  1BHA A;  3W7S A;  4JI7 O;  4XDK A;  2UUB O;  4RUF A;  3ZBH A;  4FK5 C;  3T1Y B;  3H9V A;  1SQX H;  3RGB A;  1QCE A;  2UXC O;  1KQS U;  1WPB A;  4DR5 B;  1VQ7 V;  5GW7 A;  1Q86 W;  4G2K A;  3FB5 C;  1BSM A;  1BCC H;  5J9P C;  3BA9 A;  2UXC B;  2V7Q H;  3ABK B;  4B3S B;  3FB7 C;  3RVZ A;  4GKJ B;  4I50 B;  3DXR B;  1ZUQ A;  4CH4 A;  1H38 A;  3A2F A;  3SJB C;  4YJ3 B;  3U0Z A;  2Y0I A;  2YSU B;  1EBO A;  1DGS A;  2XND G;  2OCC C;  4ZIB A;  1SER A;  1R3K C;  3ETD A;  3CC7 V;  2QWO B;  1WAZ A;  4JTC B;  1BQZ A;  3JAM N;  1SQB H;  2P90 A;  4DO2 A;  2EJR A;  4DW0 A;  2W0X A;  1XUQ A;  3FAV A;  1K92 A;  4GKK B;  4I0X B;  2DWD C;  1FFX A;  2GV9 A;  2ZKO A;  2UUC O;  3WB0 A;  4PI0 A;  5C8Y A;  5LYJ B;  1FJG B;  1COW G;  4X64 O;  4HYO A;  1YHQ V;  2LGW A;  1NH2 D;  1OCZ B;  2WA4 A;  2AZ2 A;  2A79 B;  3LDE A;  5LHI A;  2VQE O;  4MVO A;  4PA7 A;  3CB2 A;  3BEH A;  4RQE A;  3H1J H;  3ZRW A;  2XND H;  4JPR A;  1KP2 A;  3GWK C;  4GYC B;  2YXH A;  1M57 C;  3RVY A;  3WG7 B;  3ZMS A;  5FL7 G;  5CA1 B;  2HJD A;  2B5U A;  4PDR A;  5EYP B;  4NTW A;  4UB8 Z;  5KA5 A;  4U3J A;  1PNM A;  1URF A;  4DV0 O;  1WA8 B;  5H9C A;  1GO3 F;  1XI1 A;  2JK5 C;  5JH7 B;  2ZCE A;  4LFC B;  1GAX A;  3BVO A;  1U97 A;  4YIO A;  1KKD A;  2QWN B;  4DR3 B;  4DR5 O;  2XHB A;  2WPD G;  4DV1 B;  3W7T A;  4PHZ A;  1VF5 B;  2ZE6 A;  1J95 A;  3CJH B;  3M7M X;  1L0N H;  1WP7 A;  3Q4H B;  1ZWI C;  3HB3 B;  1ZAU A;  1R6N A;  2HVK C;  4XBF A;  4JI3 B;  5K1P A;  2H8P C;  3RYH B;  3WG7 C;  3N2G A;  1HNX O;  4BR6 A;  1K97 A;  3OFN H;  2PI4 A;  1R3I C;  3ZHV A;  3U10 A;  5EZY B;  5FNV A;  1M56 B;  3RT3 C;  2Q0A A;  1ZX3 A;  2YS8 A;  3C3T A;  1TUB A;  3ZHS A;  4DR1 O;  3K03 A;  3HKD B;  4B3S O;  3B4S A;  3QG5 A;  1ZTE A;  3BCC H;  2P7T C;  4GKJ O;  3CRQ A;  1W59 A;  5JH7 A;  1YIJ V;  4B08 A;  3H1L H;  2LJ2 A;  5LXT B;  4LFB B;  2DW4 A;  3MD0 A;  2IJI A;  1AR5 A;  1P7G A;  3FYI B;  3ZJZ A;  1XNQ O;  1JJO A;  3DC6 A;  4PA6 A;  1D5A A;  1MG1 A;  4DW1 A;  4TWK A;  1W0J G;  4LF7 O;  1BGY H;  4X1Y B;  1FKA O;  5JJJ B;  1I5Y A;  1M93 A;  2IU0 A;  3RN4 A;  1YXB A;  2WA3 A;  4RQF A;  4K8Z A;  1QLE C;  2A0L A;  4DK1 A;  4LNU B;  4MVU A;  1WLE A;  5IJ0 A;  4GZR B;  2BCC H;  2ADP A;  1D2D A;  2LW7 A;  4YHH B;  3X2Q B;  1YDX A;  5EIB C;  4MTX A;  2UXD B;  4D6T H;  4DV2 B;  4LF5 O;  1S72 V;  3SR2 C;  1WJZ A;  3OUF A;  1WPX A;  2UUA O;  2Q5Z A;  1AJP A;  1WA8 A;  4U7N A;  1S0V A;  4UCT A;  4BWA A;  3SGI A;  2QWQ B;  4WFA V;  4IHJ B;  4CS3 A;  4GX5 A;  3SDL A;  4LF6 O;  1NR1 A;  3FD9 A;  5KA6 A;  3T1H B;  1IZ3 A;  1S3J A;  2WLN A;  3K5L A;  5CBH A;  4FFB B;  4DV5 B;  2E3C A;  2P5O A;  3OW2 U;  1M4U A;  1BE3 H;  3K59 A;  1XRE A;  4KHP O;  2Q8V A;  3P3N A;  1KUQ A;  3AG3 C;  4J42 A;  4QJF B;  1GTO A;  4DUZ B;  3H1H H;  2BTO A;  4PV1 B;  1UPG A;  3UQ8 A;  2Y4T A;  2DYR B;  3K5O A;  1CEZ A;  1FPO A;  4QIW F;  2GTS A;  2CTR A;  1YVW A;  4MSW C;  1XBL A;  3WFV A;  1E79 G;  2EBO A;  3HKD A;  4DV6 O;  3WB2 A;  4Q6G A;  2ZNJ A;  4H13 B;  4F4L A;  2XAJ A;  5BMV A;  4RAI A;  1I08 A;  2JS3 A;  1I7F A;  1AQT A;  1JFF A;  1YIT V;  1KMI Z;  2A3Q A;  4EEQ A;  1Q81 W;  4KUM A;  2CGN A;  5CA3 A;  2F66 C;  1IVS A;  1KKC A;  4J9Z B;  3JAR A;  1HNW B;  1MZE A;  1XNQ B;  4NYK A;  4WCE V;  4JF3 A;  4AI8 A;  3ML0 A;  2JGU A;  3A8T A;  2B9Z A;  1B6Q A;  1THZ A;  1GM9 A;  4LF7 B;  4PDV A;  3QO5 A;  4ZOL B;  4Z2W A;  4I7Z B;  3OMA B;  2X6B A;  1FS0 E;  3BY6 A;  3O65 A;  4LBE C;  3JCU Z;  2WSS H;  1H2S B;  1PKX A;  3TJT A;  4WFH A;  2XT9 A;  5DED A;  1P84 F;  1HP8 A;  4J11 A;  1JOY A;  1H2G A;  4B7K A;  5IY5 B;  5JJE B;  5EYP A;  3AK1 A;  3GWO A;  5EK0 A;  4DRX B;  1K4D C;  5BY1 A;  5CA1 A;  4JI5 O;  3LSS A;  1HWY A;  1EN6 A;  1NTM H;  3ZN0 A;  3CC2 V;  4X8A A;  5KHK A;  4LNU A;  3QNE A;  4JYB A;  1N34 B;  1VQN V;  3TCU A;  2QM7 A;  1YEW A;  2PF4 E;  3CME V;  1B06 A;  5JCO A;  2Y48 A;  4LF9 O;  5JQG B;  2Q73 A;  3P30 A;  3ZRW B;  2WLL B;  4D7S A;  2Y69 C;  3ASN C;  4O2A B;  3L72 H;  3RYI B;  2RNB A;  5B3S C;  2QKS A;  3DTU B;  5B66 Z;  2WLM A;  4DR6 B;  1EZJ A;  1K73 W;  2Z0A A;  4KP4 A;  4JI4 B;  4JZG A;  4BW5 A;  4IL6 Z;  5LYJ A;  3A0H Z;  3SPJ A;  3DSQ A;  2JJ1 G;  4NTX A;  4JI6 O;  2X6A A;  2DYS C;  3W7U A;  1F7Y A;  5EBW C;  4ABM A;  5CA0 A;  2DN9 A;  4UCO A;  4JAS A;  3T1C A;  2AHY A;  3OTF A;  4MT8 A;  2Q7E A;  3CEI A;  2R9R B;  2EIJ B;  2CE4 A;  1SZT A;  4JAU A;  3P3P A;  3CCR V;  3ASO B;  4FZ1 A;  1KP3 A;  4J7Z A;  4YY3 B;  1F4N A;  4IYH A;  1DK1 A;  2WLH A;  4YJ3 A;  3N2G B;  4NKG B;  3JAT A;  5IYC O;  3CD6 V;  1VQO V;  2E5Y A;  1LUW A;  5LBQ A;  4GLX A;  4LP8 A;  1QR8 A;  4DR4 O;  4O2B B;  5DM6 V;  1VQM V;  4YJ2 B;  1NBM G;  3B77 A;  3CSX A;  1NU1 H;  5EIB D;  4JYC A;  4X64 B;  4LH6 A;  4PA9 A;  2X0L A;  5B3S B;  2EIM C;  1PM9 A;  1VQ8 V;  1GMG A;  4TV9 A;  1MNG A;  4LC1 A;  3ABM B;  4MW3 A;  3G80 A;  2ZE5 A;  3SYP A;  2JJ2 G;  2NLJ C;  3L9D A;  3K58 A;  4XDL A;  1PPJ H;  4BAY A;  4Z1M G;  3JAS A;  1HNZ O;  1XQ8 A;  1NVP D;  3G67 A;  3KZI Z;  3L70 H;  1NVP B;  2IM9 A;  2YIC A;  2EIN B;  4JV5 B;  1Q8I A;  4KL1 A;  4UCS A;  3OTO B;  3S3W A;  1J5E B;  3JSN A;  2QTO A;  5GTI Z;  3RYC B;  2JGD A;  4W4K A;  4CH6 A;  4DR6 O;  3ZHT A;  5BXZ A;  2GHY A;  2W6I G;  4YHH O;  3FKS H;  4DV1 O;  2L35 A;  1VQ5 V;  2QJ1 A;  1P4R A;  1RSO A;  3VBB A;  3C3S A;  3RBZ A;  1KB9 F;  3ZHQ A;  3A0R A;  5JJN B;  5EBM C;  5HFL A;  1WNS A;  1OCO C;  1SQV H;  1WB8 A;  2GBO A;  4NXN O;  2AGA A;  4H33 A;  1UFI A;  1YJW V;  3OT7 A;  4YY3 O;  2QSA A;  4P9O A;  1JA8 A;  4NXN B;  2ZD9 A;  3E86 A;  2ZM6 B;  3C90 A;  4JI6 B;  1H2K A;  3L73 H;  4GX2 A;  1GKF A;  4KFM A;  3PJS K;  1FXK B;  1Q6U A;  3AG2 B;  2ZM6 O;  3CP1 A;  5BMV B;  1AR4 A;  2F1M A;  1TUE B;  3HR0 A;  2M7W A;  3CJH A;  3D8C A;  4K3A A;  1K5S A;  4GX0 A;  2WLI A;  1P49 A;  3DXR A;  1AI6 A;  2KQX A;  2R9A A;  2QA4 V;  3FX7 A;  2W6J G;  1R3L C;  1B3Q A;  3UM7 A;  3E83 A;  3OEE G;  5B1O A;  3DC5 A;  1XMQ O;  4B3M O;  4DYL A;  4FM1 A;  3MAQ A;  4ZI7 A;  5K1X A;  4O4J A;  1IDS A;  4DK0 A;  3M99 B;  4O4I A;  4B3T O;  3B40 A;  3F5W C;  5KUK A;  1ZSP A;  2R9I A;  2ZDI C;  3EHB B;  1FXK A;  4ICG A;  4O4H B;  4UCR A;  4CC6 A;  1QQC A;  3PN1 A;  5IJ9 B;  4FVM A;  3E8B A;  3OEH H;  3ZMV A;  1F51 A;  4CS2 A;  1E1Q G;  3OAA G;  1R3J C;  3ABT A;  4J7J A;  2Q7H A;  2K9P A;  5JVD B;  5H6Q A;  5L3G A;  2P22 C;  4L8J A;  5B1B C;  1SA0 A;  1XDC A;  4JI8 O;  3LDD A;  3WU2 Z;  1BT8 A;  4NXM B;  5CB4 A;  3K5M A;  1Q43 A;  1OZ0 A;  3UO2 A;  2EIJ C;  1Y66 A;  1T5E A;  4O2B A;  5LGU A;  5B1A B;  1K34 A;  3T1H O;  1YZB A;  4JGS A;  4JYA O;  3ABL C;  2CK3 G;  4IIJ B;  4FM0 A;  3IGA C;  2EJ7 A;  3AG2 C;  4X1Y A;  1OCC B;  3E22 A;  3J81 N;  4O4H A;  3FKS G;  4DV2 O;  2EIL C;  2W0F C;  4GUN A;  3CC4 V;  1G4Y B;  3B2E E;  4ZBM A;  1X4T A;  1BSH A;  3JAS B;  4H0L B;  3MHS C;  2ZIN A;  3L75 H;  1BMF G;  4R6Z A;  2JEU A;  1K9M W;  4TV9 B;  2JEX A;  1M1K W;  3QF7 A;  3OR7 C;  3OGI B;  4WF9 V;  2E74 B;  3SPG A;  4PJ0 Z;  3KCY A;  5B1N A;  3VQX A;  2GUZ B;  1H8E H;  1Z2G A;  2HVJ C;  2YC0 A;  5CBF A;  4X66 O;  2WLI B;  3JCZ A;  3D3I A;  2JIZ G;  3IAY A;  3HKE B;  3FAV B;  4IYI A;  5C93 A;  5FNV B;  5EZY A;  4G28 B;  3JD1 A;  5GON B;  4WFF A;  4K8X A;  2DYR C;  2WLJ A;  4X66 B;  1V9P A;  4CH5 A;  2WLL A;  2LO1 A;  4X20 A;  3H01 A;  1CP9 A;  2CTW A;  4AIL C;  1IX9 A;  3E89 A;  2HFE C;  3ZN1 A;  1D5N A;  1JR9 A;  2F43 G;  3IFX A;  3ZRX A;  1ZL8 B;  1M9N A;  3OEH G;  4JAA A;  1WN7 A;  4JI1 O;  3Q4H A;  4O4I B;  2VQE B;  4F6R A;  1GM7 A;  4CH3 A;  2WSS G;  3W7X A;  4AQY O;  3M8A A;  2F4V O;  4JI1 B;  3K04 A;  1YJ9 V;  2V7Q G;  4FLY A;  3K08 A;  5LMN O;  4JI8 B;  2LFR A;  3AEI A;  3G4S V;  4FLW A;  2F95 B;  3AK2 A;  1NS1 A;  4I55 A;  2DMX A;  2PY5 A;  3ZMZ A;  4UVB A;  5LHH A;  3SJQ C;  5KAF Z;  2UU9 B;  4Z1V A;  2GTA A;  2K1E A;  4NTY A;  3FFQ A;  3CPW U;  3E8G A;  1M90 W;  4JYA B;  1H2M A;  2QM8 A;  3KG2 A;  4JTD B;  4O4L B;  4FIP C;  1N32 B;  4CZZ A;  5LGT A;  2OCC B;  5LP6 B;  4B3R B;  5CBG A;  4TUY B;  3THO A;  2UXD O;  1NTZ H;  4X65 B;  4ZHQ B;  1VQL V;  2Y0P A;  2HKO A;  5LA6 A;  1JFF B;  1KEC A;  1MAB G;  2ZR2 A;  5E1A C;  5KAI Z;  3UO3 A;  1YF2 A;  2ATK C;  1V55 B;  2BTQ B;  2KG7 A;  1R6K A;  3JAK B;  2OCH A;  1Y74 A;  4UCV A;  3RYF A;  4FLU A;  2FL4 A;  1LUV A;  2PI5 A;  2UXB O;  4WFB V;  1X59 A;  1UJW B;  1OJH A;  3E2E A;  2HLD G;  1SRY A;  4WFG A;  1HW7 A;  2FTK A;  2QDO A;  5IYD O;  1FD9 A;  4DV0 B;  5LOV B;  3J7A U;  4HBN A;  1HNX B;  1QLE B;  3K0G A;  4WBN A;  3NXS A;  1B04 A;  4LF4 O;  2BOB C;  4F6R B;  1SF9 A;  2P4V A;  3APO A;  3JD3 A;  3L74 H;  2CDY A;  4QPJ A;  4X1K A;  2BSK B;  2XUM A;  3JAR B;  4X89 A;  1FYJ A;  2Q7G A;  1R6T A;  3OR6 C;  5F2V O;  2L6L A;  1XEQ A;  1RP3 B;  4OPH A;  4AQY B;  4X88 A;  3STZ C;  3X2Q C;  1MOF A;  5KHJ A;  1VQP V;  1GN3 A;  1SQQ H;  5B5E Z;  3T4D A;  2XAQ A;  2AZ0 A;  2DWE C;  1K33 A;  1AJQ A;  3JAW B;  1G1X B;  3CMA V;  1AI7 A;  3CCL V;  3P32 A;  4F6E A;  3JD2 A;  1M57 B;  2OT5 A;  1SET A;  1Y74 B;  3L71 H;  4UVA A;  1WP8 A;  2JVD A;  2BTQ A;  2KG7 B;  1XHX A;  2P6J A;  5IT9 N;  2RDC A;  3ASN B;  3ETE A;  2QE7 G;  1S77 D;  4H37 A;  1Q6I A;  1J5E O;  1H8H G;  4BIZ A;  3ABU A;  1Y67 A;  5IJ0 B;  3O9O A;  4DR7 O;  5JQG A;  1DF4 A;  1TAE A;  2N74 A;  2Z5U A;  3G6B A;  5KMG A;  4B7E A;  2UUA B;  4JI5 B;  4TQD A;  4JV5 O;  4E4E A;  1VAR A;  5TIS Z;  1N0J A;  1BQ0 A;  5KHH A;  2EIN C;  1N34 O;  3UKM A;  4FFB A;  4MW8 A;  1ORQ C;  5CA0 B;  4I5S A;  2DQ3 A;  1IXM A;  3SPI A;  2YEV B;  3HKB A;  1E1R G;  4LH7 A;  3ABM C;  2UXX A;  5IWA B;  4JZ2 A;  5BR8 O;  4HNA B;  1N33 O;  4GX1 A;  1YTF D;  3OMI B;  3SJA C;  3FB6 C;  3LSQ A;  2QKC A;  5L3D A;  4PD4 F;  4FJC C;  4I4T A;  4RWU A;  4P9P A;  5IWA O;  2Q4P A;  5LA6 B;  1PL0 A;  1NR7 A;  3AK3 A;  5LL6 Y;  1SZX A;  3CRR A;  4LWS B;  4TV8 B;  3D36 A;  3OGC C;  4OX9 B;  1AB3 A;  1AJN A;  4IGG A;  1BHB A;  4LFC O;  4KXR A;  1VIB A;  2KB1 A;  3R66 A;  3SYA A;  3QTC A;  2IBZ H;  2FKX A;  3CHX A;  4YXW H;  3H1I H;  3CRM A;  2Q69 A;  1NJI W;  4B3M B;  3BHP A;  2UXB B;  1HR0 B;  5AG2 A;  1OCR C;  2OWO A;  5J2U A;  3APQ A;  2CTP A;  4FLV A;  1PNL A;  4LFA B;  5LMU O;  5KLV H;  4Q20 A;  2LFS A;  1BL8 A;  5KX5 B;  4JAV A;  4I9W A;  2QGN A;  4BIO A;  5LMU B;  1XNR O;  4ASU H;  4J80 A;  3B8M A;  1TUB B;  1XIL A;  4EFE A;  3ETQ A;  4DR1 B;  3AG4 B;  5FLX N;  3IJ4 A;  2MW2 B;  4MVZ A;  1AR1 B;  1HNZ B;  1Y4M A;  1RM1 C;  4R7C A;  1OCZ C;  3CE2 A;  4OGQ B;  1AI5 A;  5LOV A;  1K8A W;  1KBH A;  2E5L B;  3E8F A;  4NXM O;  1Q3E A;  3OE7 H;  5IYB O;  1Y76 B;  1MSW D;  4MVQ A;  4GKK O;  1QU7 A;  2HHH B;  4HNA A;  3E8H A;  3RFR A;  3AG7 A;  1EZV H;  2Q9L A;  1V55 C;  3LSU A;  5C8Y B;  3SPC A;  3JD0 A;  2EIM B;  1RPO A;  3TXQ A;  5IE9 A;  4U3J B;  2ZQM A;  1JX9 A;  2JGD B;  3G6E V;  3AG1 B;  2ZE8 A;  1Q90 D;  2ZNI A;  2E75 B;  2YXL A;  5L3C A;  1U96 A;  4DV3 O;  1JVM A;  5FPR A;  3OUS A;  1YCI A;  4X65 O;  4YIP A;  3CRC A;  5ITZ A;  3ZX6 A;  2R72 A;  5DN6 G;  4BIU A;  3RW0 A;  4N21 A;  3JAL A;  2YIA A;  5H2F Z;  3HKC A;  4ZI7 B;  1P7B A;  5LXT A;  1N36 B;  4X1I B;  3F5T A;  4FLZ A;  2CTQ A;  3UCS C;  2PGG A;  4UUJ C;  3S3X A;  1SKV A;  3ZIA G;  1NTK H;  4EKW A;  2FML A;  3SYQ A;  5JVD A;  3FYE B;  4QPK A;  4WFE A;  3EVK A;  4FPP A;  2ZXW C;  1M56 C;  5LP6 C;  3TET A;  3UT5 A;  4JI4 O;  4TQF A;  4FFK A;  4JYY A;  2N05 A;  4P30 A;  3BPZ A;  4LF8 O;  1FFT B;  4LFA O;  5EC1 C;  1SQP H;  1KD1 W;  2CAZ C;  2F4V B;  3RYH A;  2UUC B;  1NQT A;  5GON A;  3CYO A;  4MTF A;  2Y69 B;  4J41 A;  1SQG A;  3BAB A;  1AP6 A;  4QE9 A;  2QTS A;  3ETG A;  3VQW A;  5B1A C;  1BS3 A;  5A9G A;  4FZ0 A;  3K79 A;  3EXA A;  2IW5 A;  5KX5 A;  1JMK C;  3K06 A;  5D5Q A;  3CCU V;  1FAF A;  1DTO A;  2RMK B;  3B8N A;  2VWK A;  1BSN A;  4N23 A;  3CXC U;  1W2B U;  3HKC B;  2OIE A;  3JAL B;  2RCV A;  4X62 B;  3SJC C;  4UV9 A;  4ZKI A;  4A5U B;  5ITZ B;  2FB5 A;  4EB6 B;  3N2K A;  4DR7 B;  1O9H A;  2E76 B;  4JI0 O;  2GSM B;  2HEP A;  4K0K B;  3G71 V;  1TVK A;  1TA8 A;  1R1B A;  5L3B A;  1JJ2 U;  4LF5 B;  2XAH A;  4YXW G;  2Q67 A;  1F23 A;  3OFN G;  1IBL B;  5CB4 B;  2HHH O;  2IH1 C;  2DYS B;  5L3E A;  1VQ6 V;  1XMO B;  4J10 A;  2F93 B;  4OXS A;  1NZ6 A;  5H5N A;  1DF5 A;  1XMO O;  1ENV A;  3HKB B;  2A7W A;  1XOU A;  1L0L H;  4G27 B;  4J7K A;  2C2A A;  1M5I A;  2CUG A;  2YI8 A;  5A2Q N;  2F23 A;  4LF8 B;  2P67 A;  3AG4 C;  4BW9 A;  3U11 A;  3ZCC A;  1PV0 A;  5CMU A;  2JRI A;  2MK3 A;  1AP5 A;  1GM8 A;  4DV6 B;  1Y6X A;  4MS2 A;  3ZED A;  1V54 B;  2YI9 A;  5FL7 H;  4I50 A;  1N4C A;  2R70 A;  3MDS A;  2PZS A;  3UT5 B;  2A06 H;  2IJJ A;  4U3F H;  4RUE A;  2HG5 C;  3STL C;  1YJN V;  1OCC C;  2DE0 X;  3ABL B;  3FB8 C;  2GDS A;  3W7W A;  1NKD A;  3E35 A;  3QO7 A;  1VQK V;  3T2M A;  3QVN A;  1FFX B;  2QE7 H;  2LP7 A;  3SPH A;  1Q5O A;  4PDL A;  1NI8 A;  3I56 V;  3ZHR A;  2OIG A;  3H1K H;  1PL4 A;  3IC9 A;  4UB6 Z;  4DR4 B;  2YUA A;  2V1D A;  4LCU C;  2Y4U A;  4TOI A;  2RQ6 A;  5GTH Z;  2PYJ A;  4TV8 A;  1SS3 A;  3E22 B;  4B3T B;  1V54 C;  4MVM A;  4PA3 A;  4I4T B;  1LNQ A;  2N04 A;  3F7Y C;  3N2K B;  1N0N A;  1GRJ A;  4MVR A;  4EB6 A;  3GB7 C;  2QM4 A;  4JI0 B;  2P06 A;  3IC7 A;  1FJG O;  2ZIO A;  2RQ7 A;  1GN4 A;  4IT5 A;  5JWP A;  2JS5 A;  3K5N A;  3R65 A;  1Z5W A;  4ASU G;  1GN6 A;  2YEV A;  4UCU A;  1N32 O;  4CC5 A;  3LNN A;  1AI4 A;  1SA0 B;  3TXS A;  1VF7 A;  4CBC A;  1S76 D;  4DV7 O;  2X7R B;  3D36 C;  3RYI A;  1Y76 A;  3CXH F;  4X9Q A;  5CN0 A;  1RPR A;  3JSL A;  1GK9 A;  3KCX A;  2PUS A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 4GKJ B;  5EIB D;  3ICX A;  4I50 B;  4FFB A;  4CH4 A;  5IJ9 A;  3A2F A;  4X64 B;  3SJB C;  5CA0 B;  4YJ3 B;  5FPO A;  4LH6 A;  3U0Z A;  3HKB A;  4LH7 A;  4TV9 A;  4FM2 A;  1DGS A;  4JI2 B;  5IWA B;  4I9Q A;  3HKE A;  4HNA B;  4ZIB A;  3K58 A;  2VQF B;  3JAS A;  4I55 B;  3SJA C;  1XQ8 A;  2IM9 A;  4I4T A;  4JV5 B;  1Q8I A;  4KL1 A;  4UCS A;  5LA6 B;  3OTO B;  4TV8 B;  4GKK B;  1J5E B;  1FFX A;  2GV9 A;  3JSN A;  4OX9 B;  3WB0 A;  4PI0 A;  5C8Y A;  5LYJ B;  3RYC B;  4CH6 A;  1FJG B;  3JAT B;  2PUS A;  5DN6 I;  3BAA A;  3FKS H;  3QTC A;  2QJ1 A;  1RSO A;  3CHX A;  4YXW H;  2HLD H;  3CB2 A;  4B3M B;  3BHP A;  2XND H;  5JJN B;  2YIB D;  1HR0 B;  2UXB B;  2OWO A;  5J2U A;  2PTM A;  4GYC B;  4FLV A;  1WNS A;  4LFA B;  5JCO C;  1KU9 A;  4IHJ A;  5CA1 B;  5KX5 B;  2V4D A;  5EYP B;  3RYF B;  3VQV A;  5LMU B;  4NXN B;  4ASU H;  2ZM6 B;  1TUB B;  4U3J A;  4JI6 B;  1G6U A;  4EFE A;  3ETQ A;  4DR1 B;  4D7T A;  1Z5V A;  1XI1 A;  5BMV B;  5BR8 B;  5JH7 B;  1N33 B;  2F1M A;  2ZCE A;  4LFC B;  2EX3 A;  4ZHQ A;  1HNZ B;  4DR3 B;  1IBK B;  3WB1 A;  5LP6 A;  1P49 A;  2XHB A;  4DV1 B;  2R9A A;  5LOV A;  2ZIM A;  4PHZ A;  2E5L B;  3M7M X;  1Q3E A;  5IYZ B;  3OE7 H;  1ZAU A;  4O4L A;  1TGO A;  4JI3 B;  4FM1 A;  5K1P A;  3MAQ A;  4ZI7 A;  5K1X A;  4O4J A;  4DK0 A;  3RYH B;  2HHH B;  3N2G A;  3RWR D;  2UUB B;  4HNA A;  4EFB A;  3RFR A;  4O4I A;  3OFN H;  5KHI A;  3U10 A;  5C8Y B;  5EZY B;  5FNV A;  4O4H B;  4UCR A;  2Q0A A;  4DV7 B;  1TUB A;  4U3J B;  4CC6 A;  1QQC A;  3PN1 A;  4ZOL A;  5IJ9 B;  4FVM A;  3HKD B;  5J2U B;  2ZNI A;  3QG5 A;  3OEH H;  2YXL A;  4CS2 A;  5FPR A;  5JH7 A;  4B08 A;  2Q7H A;  5LXT B;  5JVD B;  4LFB B;  4AHC A;  2P22 C;  5ITZ A;  4L8J A;  2R72 A;  4X20 B;  1SA0 A;  1JJO A;  3JAL A;  2YIA A;  4DUY B;  3OAA H;  3HKC A;  4ZI7 B;  5LXT A;  1N36 B;  4NXM B;  4X1I B;  4X1K B;  1D5A A;  5CB4 A;  3K5M A;  4FLZ A;  1Q43 A;  2PGG A;  1SKV A;  1T5E A;  4O2B A;  4X1Y B;  5JJJ B;  1M93 A;  5JVD A;  4K8Z A;  4IIJ B;  4DK1 A;  4FM0 A;  5LP6 C;  4LNU B;  1XNR B;  4X1Y A;  3E22 A;  5IJ0 A;  4O4H A;  3UT5 A;  4TQF A;  3B2E E;  4X1I A;  4YHH B;  1X4T A;  3BPZ A;  5EIB C;  4FLX A;  3K57 A;  2UXD B;  1BSH A;  3JAS B;  1XMQ B;  4DV2 B;  2F4V B;  2CAZ C;  2ZIN A;  3ZS8 C;  3RYH A;  2UUC B;  3SR2 C;  5GON A;  4TV9 B;  4UCT A;  4BWA A;  3SGI A;  4IHJ B;  3QF7 A;  1SQG A;  3BAB A;  4CS3 A;  1XHZ A;  3T1H B;  3VQW A;  3VQX A;  4TUY A;  1QHT A;  3K5L A;  4FFB B;  1H8E H;  4DV5 B;  5KX5 A;  1JMK C;  2E3C A;  2P5O A;  5D5Q A;  1M4U A;  3IAY A;  3HKE B;  3K59 A;  1I94 B;  2VWK A;  5EZY A;  5FNV B;  1BSN A;  5GON B;  1E79 H;  4K8X A;  4DUZ B;  2BTO A;  3HKC B;  4X66 B;  4LF9 B;  1V9P A;  3JAL B;  4CH5 A;  2OYQ A;  4X20 A;  4X62 B;  3UQ8 A;  3SJC C;  4PI2 A;  5ITZ B;  4AIL C;  3K5O A;  4EB6 B;  1S5J A;  3N2K A;  4DR7 B;  1O9H A;  3BA8 A;  2HEP A;  1WN7 A;  4K0K B;  4O4I B;  2VQE B;  1TVK A;  1TA8 A;  4F6R A;  3JAW A;  4CH3 A;  4LF5 B;  3HKD A;  4JI1 B;  3WB2 A;  2PYL A;  4UFZ A;  4Q6G A;  2ZNJ A;  5IYZ A;  2VWJ A;  4FLY A;  4JI7 B;  1O9G A;  4JI8 B;  4KHP B;  5BMV A;  1IBL B;  5CB4 B;  1I7F A;  4LF6 B;  4FLW A;  2F95 B;  1AQT A;  1JFF A;  4DV4 B;  5KMG B;  4I55 A;  2PY5 A;  1KMI Z;  1XMO B;  4EEQ A;  2UU9 B;  2F93 B;  2F66 C;  3FFQ A;  4O4J B;  4JYA B;  4DR2 B;  2KKW A;  3JAR A;  1HNW B;  1XNQ B;  4LF4 B;  4O4L B;  1N32 B;  3HKB B;  2JGU A;  4LF7 B;  1M5I A;  1NT2 B;  5LP6 B;  2YI8 A;  4ZOL B;  4B3R B;  4TUY B;  4LF8 B;  3THO A;  3VQY A;  4YJ2 A;  4X65 B;  5D5P A;  4BW9 A;  4ZHQ B;  1FS0 E;  3U11 A;  5LA6 A;  1JFF B;  2WSS H;  1H2S B;  5J2T A;  2BTQ B;  4DV6 B;  1SQF A;  3ZED A;  5JJE B;  2YI9 A;  3JAK B;  5FL7 H;  4UCV A;  5EYP A;  3RYF A;  5LMN B;  4FLU A;  4I50 A;  4DRX B;  2R70 A;  5CA1 A;  2PZS A;  3UT5 B;  1TVK B;  1HW7 A;  3BRC A;  5KHK A;  4LNU A;  4DV0 B;  5LOV B;  4IIJ A;  4DRX A;  4WBN B;  1N34 B;  4HBN A;  1HNX B;  4WBN A;  1YEW A;  5JCO A;  2XOK H;  1B04 A;  5JQG B;  1FFX B;  2QE7 H;  1Q5O A;  4D7S A;  4F6R B;  4O2A B;  4LR3 A;  3RYI B;  4X1K A;  3JAR B;  4DR4 B;  4DR6 B;  4CS4 A;  2Q7G A;  3JAK A;  4AQY B;  4JI4 B;  5LYJ A;  3RYC A;  5KHJ A;  4DV3 B;  5KHG A;  3DSQ A;  4TOI A;  2RQ6 A;  4FLT A;  4O2A A;  3JAW B;  2PYJ A;  4TV8 A;  1L8D A;  3E22 B;  4NVP A;  4B3T B;  5CA0 A;  4I4T B;  4UCO A;  1IBM B;  2YIB A;  3N2K B;  3OTF A;  2Q7E A;  4EB6 A;  2QM4 A;  4JI0 B;  2RJZ A;  2ZIO A;  2RQ7 A;  2JVD A;  2BTQ A;  1XHX A;  5J2T B;  2JS5 A;  3K5N A;  1Z5W A;  3T1Y B;  4YY3 B;  4UCU A;  3RGB A;  4CC5 A;  3LNN A;  5IJ0 B;  1WPB A;  1SA0 B;  4DR5 B;  5JQG A;  1VF7 A;  3N2G B;  4YJ3 A;  1TAE A;  3JAT A;  5KMG A;  2UUA B;  2E5Y A;  4JI5 B;  4TQD A;  3RYI A;  3BA9 A;  4GLX A;  2UXC B;  2V7Q H;  4B3S B;  4O2B B;  5KHH A;  3JSL A;  4YJ2 B;  3CSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...