2RQ6A

Solution structure of the epsilon subunit of the f1-atpase from thermosynechococcus elongatus bp-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase epsilon chain
publication title Structural and functional analysis of the intrinsic inhibitor subunit epsilon of F1-ATPase from photosynthetic organisms.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Hydrolase
total genus 24
structure length 138
sequence length 138
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rq6A02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2rq6A01
3VQYA 4Q6GA 2YIAA 2V7QH 2YI8A 2RQ7A 1FS0E 2QJ1A 3OFNH 4CS2A 2Q7GA 2YIBD 2YI9A 2YIBA 3VQWA 3FKSH 2PGGA 4CH4A 5K1XA 2QE7H 2ZCEA 3QTCA 5DN6I 1O9HA 3VQVA 2RJZA 2R72A 1O9GA 4ZIBA 2E5YA 3DSQA 2XNDH 4TQDA 4CH5A 2WSSH 2PUSA 3OEHH 2Q7HA 4ASUH 4BW9A 1H8EH 2E3CA 2HLDH 2ZNJA 1AQTA 2XOKH 5FL7H 4CH6A 2RQ6A 2ZIOA 4CS3A 4CH3A 2Q7EA 2ZNIA 3OAAH 3OE7H 2ZINA 4BWAA 1E79H 2HEPA 3BHPA 4YXWH 2R70A 4TQFA 3VQXA 3ZEDA 1BSNA 1G6UA 2JVDA 1BSHA 2ZIMA 5K1PA 4CS4A
chains in the Genus database with same CATH superfamily
1AJQA 2Y69B 3SJCC 4I0XA 3WB0A 1XL6A 2Q9LA 1JPXA 1XQ8A 2DWDC 2QKCA 2ZQMA 1AQTA 5KHKA 3OTOO 4UV9A 4JYBA 3CRMA 2WLNA 4J9YB 2ADPA 2WLJA 4FFKA 3RN4A 1I5YA 4MT8A 1JX9A 3B2EE 1M93A 2EIKC 2XNDH 2WPDG 1WPBA 2Q7HA 4G28B 1NVPB 3K5LA 1SQPH 1V54B 5H9CA 1PKXA 2BSKA 2UXBB 1Y74B 3TXSA 4JGSA 4XDKA 2EJ7A 4I4TA 2XAQA 2ZE8A 4XBFA 3B77A 4B3TB 2IU3A 1QHTA 3DSQA 4KUMA 2HFEC 4I7ZB 1OCRC 3WG7C 2HLDH 1S5LZ 4YY3B 4X1KB 1Q86W 4X88A 3ZIAG 2HHHO 3T1CA 5BY1A 3JSLA 4JYCA 2ZKOA 4PA9A 2A7WA 3K5NA 1L1FA 1WP8A 1YHQV 3RGBA 5BMVA 2GSMB 2JGDA 3ZCCA 1SQBH 4I50B 4O4JA 1DF4A 2Q5ZA 4ZI7A 1Q3EA 4EKWA 1I5XA 4LBEC 3FB5C 1GN4A 1HNZB 4WFGA 5B1BC 2PI5A 4LFCO 2ZXWB 4MTGA 5CA0B 3VBBA 4DV0O 4LFBB 1D5AA 1VEWA 2EX3A 4DV6B 2Y4UA 5JVDA 1WB7A 3CE2A 4UCUA 4LF7B 2DMXA 2WA4A 2QKAA 1FXKA 3T1YB 4RQFA 3F5WC 4JI2B 4FLYA 3NXSA 2YDEA 5H5NA 4TUYA 3CJHB 1F7YA 4LF4B 5BZBA 1K92A 1KBHA 1CXZB 1ZAUA 2ODMA 2RN9A 4CC5A 4IHJB 3ZRXA 2OCCC 1KB9F 2E5LO 4DW0A 4FLWA 2R70A 5DEDA 4H37A 4PV1B 4PA4A 1THZA 1YTFB 1SKVA 3BCCH 4P9PA 2ZCEA 2QWPB 4YIOA 3E22B 3K79A 1G4YB 4J41A 3TK1A 2IJKA 2ZM6O 1KC8W 4LWSB 3CD6V 4X9QA 1SZXA 2AW9A 4GYCB 2E76B 2IH3C 1PL4A 2PF4E 1XILA 1WA8A 2KSDA 4IIJB 5CA1B 1S77D 5EZYB 2EIJB 1GM8A 3G6BA 2PGGA 1H2SB 1BQ0A 3CYOA 1N34B 1PNMA 1Q6UA 2XT9A 1K5SA 5CN0A 5J9PC 4DV4O 3CC2V 3KKYA 5IY5B 1VQ8V 1RM1C 2PYLA 1JVMA 1HP8A 2IM9A 1XDCA 5C8YB 2NLJC 2B5UA 2OYQA 3UKMA 3APQA 1EN4A 1LUVA 3VQYA 4Q6GA 3ZHQA 4BW5A 4KXRA 3RYIB 3CSXA 4P2ZA 2XAFA 5LOVA 2EZOA 3HKEB 1Y74A 2JJ1G 5LA6B 3AG2B 5IT9N 2EULA 3L72H 4GX0A 2WLHA 1E79H 3JATB 2BE3A 3H1HH 4AHCA 2GDSA 1WJZA 4LF8O 2FL4A 2RQ7A 3P3PA 1VQOV 4JI6B 2P90A 4X1KA 3EVKA 5DN6I 4H13B 5FPRA 4JI3B 4MTOA 1VQ6V 1IBKO 1AP6A 2CAZC 2GTSA 4GKKO 3ZHVA 4D6TH 1EZJA 2JS5A 5B66Z 4E2LA 4JV5B 3U11A 2UUCB 4DK0A 1BZKA 2QR4A 1JQ0A 3RFRA 4I50A 1N0NA 1Y6XA 2EINB 4B7KA 2QWQB 1AR4A 3KG2A 1EFRG 5GTHZ 3QO7A 2WSSH 1FFXB 2YS8A 1U96A 4DV3B 1RPRA 1L0NH 2M7WA 4FPPA 5IJ0B 3UCSC 2Q67A 5LMUO 2YEVB 5JJNB 3IAYA 2EILC 1XMQO 3STLC 3SYAA 4O4IB 4EB6B 1QLEB 2OTJV 4DK1A 1WN7A 3CCMV 2QDOA 2B9ZA 1OCCC 3J80N 5EBLC 1B3QA 3GWOA 1N32B 3CJHA 4AQYO 1Z5VA 2ZE6A 3FD9A 1XHZA 4MVQA 4LNUB 4DV5B 2LO1A 1OJHA 2QJ1A 1BMFG 1O9HA 5B1AB 1AI4A 1FJGO 1FPOA 1R3JC 3GB7C 3OMAB 4L8JA 1ZSPA 5LP6C 1VF6A 4OPAA 1B04A 5E79Z 3QVNA 5FNVB 3E22A 2GBOA 2YXYA 3LSSA 3K08A 3SR2C 3G80A 2KKWA 3Q4HB 3K0DA 3IC7A 4O2AB 2LGQA 4UUJC 4YIPA 1KYOF 4X89A 2IJJA 1FXKC 3JCUZ 4IIJA 4CS3A 1Y67A 5CA1A 5EZYA 1RPOA 4TQFA 4JI0B 1N4CA 3B8NA 3ABMC 4X66O 2QTOA 3SPIA 1NVPD 4DR4O 2UXBO 1BQZA 5KMGB 3CMAV 4JAAA 5C8YA 2P7TC 4BIOA 2X6CA 1A32A 4B3TO 1M57B 2QTSA 5KUKA 1N36B 5KHHA 2OIEA 3SYQA 4DV7O 2JRIA 4NTXA 3RYIA 4YY3O 1QBZA 3HKEA 3E86A 5FL7G 3JCZA 2PI4A 4PJ0Z 5LA6A 3OE7G 3N27A 3D36A 2RDCA 1OZ0A 3E89A 3VQWA 1P84F 1DF5A 1Q6IA 2Y69C 3O9OA 5CMUA 4OXSA 2P4KA 2X7RB 1SETA 2DYSB 3N2KB 3SJAC 4R50A 1MMMA 1XEQA 1XL4A 4X65O 1VQ4V 4JI1O 3U10A 1MZFA 4DV1B 4K8ZA 3AK2A 3ABTA 3JAMN 4FZ1A 3ZMSA 4DR3O 2DJVA 4FIPC 3JYCA 4CBCA 4DR7B 4KHPB 2QE7G 1CPYA 4O4LB 5E1AC 4EFEA 2ZNIA 4YJ3B 1K33A 5JCOA 3WB2A 1V54C 1DLBA 3K0GA 2QWNB 2YSUB 2L6LA 5GTIZ 4FM1A 1FFXA 5LBQA 4YJ2B 2JJ2G 2XHBA 1K4DC 4LF7O 2ZD9A 5KX5B 3HKBB 2AXTZ 2O57A 1NI8A 2CTQA 3MHSC 3T1YO 3E8BA 3OTFA 4X64O 3KCXA 1ROPA 1AB3A 3DTUB 2W6IG 3H1LH 2YEVA 4JI2O 4NXNB 4FM0A 2UXCB 2YIDA 4LF4O 4C7UA 4U7OA 4O4IA 4EB6A 3AG4C 1M5IA 3TCUA 3VQXA 1F23A 1YDXA 5IWAB 1R3KC 4IGGA 2GUZB 5EBMC 4TT3G 1ZLZA 1H2GA 1YTFD 1VQPV 3CCJV 1DTOA 1PM9A 4O4HB 2RCVA 1QR9A 5FLXN 2XASA 4DV2B 3O65A 3LNMB 3MAQA 1KUQA 3HPLC 4I9WA 1XMOB 2ZXWC 2C2AA 2LW1A 2Q73A 3CX5F 1V55B 1QR8A 5FNVA 3AG3B 3ZHUA 5IDJA 2F1MA 1N34O 1R3LC 4H33A 3Q4HA 4O2AA 2ZR3A 3G6EV 2V4DA 3DXRB 1YJNV 2YXHA 4DRXB 2VQEB 4UVAA 1RP3B 3CEIA 4FLVA 1DGSA 4J7ZA 1IURA 1URFA 3CXCU 4ZKIA 1HNXB 2GHYA 5EC1C 5KMGA 3UM7A 5L3BA 4LH7A 1IBLB 4G27B 1BSMA 4GX1A 5IJ9B 4QPJA 4WCEV 2AHYA 2WLIB 4PA7A 1FS0G 2HP8A 3K3WA 1US6A 5KLVH 3D3IA 1VF6C 3HB3B 4X1IB 4JI6O 4GUNA 1TGOA 3RW0A 2QWOB 1SQXH 1L8DA 3ZN0A 3K03A 3BY6A 4DUYB 1IBMO 3H1JH 4JI3O 4X62B 3AG1B 2XNDG 3J7AU 3P32A 3SPCA 4W4KA 1P7BA 1UPGA 4RUFA 2AZ2A 2OWOA 2UUAO 2QA4V 4B3SB 1JCHA 3FB6C 4J7JA 3N2KA 2RNBA 5EIBD 4JV5O 3OM3B 2UUCO 2KG7B 3APOA 1YVWA 4UB6Z 2WA3A 1S5JA 2P4VA 3HR0A 4HBNA 2DYRB 2ZE5A 5CB4B 1M4UA 4JTDB 5KHGA 1VF5B 3ABKB 1M56B 2HLDG 5CBGA 1Q6HA 1NU1H 3P30A 1GN2A 4O4LA 2AHZA 4J80A 3X2QB 5LHHA 4GLXA 4PDVA 3ETQA 4TOIA 3RYCB 4RUEA 2Z0AA 2VQFB 4YJ2A 3ETGA 4FLTA 3AG2C 3HKBA 2JEXA 4ZOLB 3K06A 5EC2C 3L74H 2QSAA 4O2BB 1N32O 5LXTB 5BXZA 4K0KO 2JDIG 1HR0B 4DV5O 1DK1A 5CBFA 2ZE7A 2CUGA 3T1HB 5BR8O 5EIBC 2ZDIC 5GONB 2N74A 2EIMB 2WLLA 3PJSK 3ZEDA 2HG5C 3W7UA 1B06A 1AJPA 2YIAA 4O4HA 2KQXA 4CH4A 1N8RW 5JCOC 1KKDA 3BAAA 2FKXA 4P9OA 3T2MA 1JFFB 4FLUA 4YXWH 1VQ7V 4N23A 2UXNA 3T4ZA 3BA8A 4QJFB 3FX7A 4OX9O 2YI8A 1PNLA 1HWYA 5IYBO 3IJ4A 1MNGA 2DQ0A 4DR5O 3F5TA 1YF2A 3A0RA 1K9MW 2GTAA 2K1EA 3DXRA 1AVMA 4JI8B 5H6RA 2IU0A 4DRXA 4FFBB 4NTYA 3ML0A 4FK5C 1H8EG 3QG5A 4LR3A 1U97A 4BR6A 1N36O 2XOKG 4I5SA 3SYCA 5B3SB 2XAGA 1BE3H 1BSHA 3T4DA 1MSDA 1OCOB 2HVJC 2AZ0A 1XNRB 3GWKC 5IJ9A 2YUAA 3ZHTA 1NR1A 4HZ3A 2ILMA 1H8EH 2XOKH 2KB1A 3P3NA 2WLIA 3ICXA 1AR1B 4YHHB 1HW7A 2UUBO 1SERA 5B1OA 4DR2B 1AJNA 1E1RG 1R6TA 3A0BZ 4X1IA 1SA0B 1M9NA 1PP9H 3CRRA 5L3EA 2YIBA 2HJDA 4D7TA 1ZUQA 4UCOA 5A9GA 4DR6B 4B3MB 4NXMO 3OFNG 1K3EA 1H2NA 4LF6O 2E3CA 3ZMTA 3QF7A 1BS3A 1GKFA 2KG7A 4J7KA 3OAAH 1RSOB 1R73A 5KA6A 3SJQC 2F23A 1IXMA 1JJOA 1B6QA 4BIZA 4K8XA 1E79G 1WLEA 1NH2B 3OFNH 5CB4A 5HFMA 1FXHA 4FZ0A 1NKDA 4PDRA 5H6QA 2BOCC 3MD0A 2Q69A 1WB8A 4CC6A 2A3QA 1M57C 4CH3A 1PD3A 1XOUA 4JF3A 4NXNO 2P5OA 1I94B 1UJWB 3SPJA 3BPZA 3RYCA 1BL8A 1OCZC 1QQCA 2F93B 1JA8A 3ZN1A 1NR7A 4B3RB 3CP1A 4J10A 4JASA 1HNWB 4ZOLA 4JI4B 1J5EO 2QWRB 5IWAO 1Q5OA 2R9RB 4O2BA 3W7WA 5LXTA 1P49A 2WSSG 5IYDO 1I7FA 3D8CA 4LP8A 5KA5A 3R65A 2JVDA 2ZIMA 1WAZA 4DV2O 4PD4F 2P67A 4UCRA 5GONA 3HKCB 3OTOB 3OW2U 1L0LH 4PA6A 1XMOO 4GCZA 3ZJZA 1W0KG 2ARHA 5ITZB 3FYEB 2HKOA 1YCIA 1NQTA 4OPHA 4QE9A 5CA0A 3K58A 3ZMZA 3AG7A 1ZX3A 3OR6C 3C90A 3PN1A 4X8AA 1JFFA 3WFVA 3BEHA 4DXWA 2VQEO 3VOUA 1H2MA 1FYJA 3LDEA 4GKJO 2VWKA 3BVOA 2F95B 2N05A 4XDLA 4F6RB 4UCSA 1QNMA 3HKDB 2WLMA 1S3JA 4R7CA 3EHBB 3E83A 1K4CC 3EFFK 2Y0PA 1SZTA 3S3WA 2W0FC 4RWUA 4FFBA 2BTQB 4IHJA 4LF9B 3M7MX 2EZPA 4TSFG 1UFIA 1PL0A 1NZ6A 2ZR2A 5DM6V 3BA9A 2OCCB 4CZZA 1AILA 3CCVV 2X6BA 1FD9A 2Q7GA 2YIBD 3W7SA 1K34A 2QM8A 4OGQB 4B3SO 2UXDB 4LWSA 3OGCC 4TQDA 1GO3F 1V55C 1SA0A 4WFEA 2P6JA 3AG3C 1P7GA 3JD4A 3OR7C 1R6NA 2H3OA 3B4SA 2ZINA 5LHIA 1VQLV 2XTAA 4LFCB 2QEXV 1KU9A 3ASNC 2LFRA 4DV0B 3K5MA 1S0VA 3CWBH 3STZC 1LR1A 1BCCH 4D7SA 1RSOA 1KMIZ 2CGOA 3ETDA 1NT2B 3J81N 2ZNJA 1EM1A 4DYLA 1MA1A 3K57A 4PHZA 5J2TB 4GT1A 4JI7B 2VQFO 1VP7A 4PI2A 2ITCC 1XI1A 3C3TA 3GVMA 3WU2Z 4DW1A 1TVKB 5H2FZ 1VQKV 4LCUC 1VQ5V 4G2KA 2JEUA 5KHJA 3JATA 2E5LB 1HR0O 3K04A 4DR1B 2ZT9B 3EXAA 4NB5A 2E74B 2HJFC 4WF9V 2IH1C 5IYCO 2X6AA 3AG1C 4NVPA 1VQMV 1HNZO 3ASOB 4MW8A 2ZM6B 4RO2A 2ITDC 4FLZA 2NNUA 4A5UB 4JAUA 4LFBO 1FFTB 3ZRVA 2H94A 4DV6O 3HKCA 3CXHF 1K97A 1FKAO 3E8FA 3ABKC 2CTWA 5C93A 1X4TA 2NR5A 1QVGU 4UV8A 4E4EA 5ITZA 4DV4B 5IJ0A 2RJZA 2E5YA 1XNQB 1QCEA 4QGPA 3M99B 5D5QA 4CH6A 2VWJA 1BT8A 3I5DA 4F6EA 4JI8O 4LC1A 4F6RA 3UO3A 3G4SV 1VARA 1FS0E 2ETNA 3HKDA 3FKSH 4GX2A 4U3JB 5LMNB 3ABUA 2DWEC 1OCCB 4EEQA 4BAYA 4GZRB 1XNRO 3IC9A 2XAJA 1E1QG 4LNUA 4QIWF 4IYIA 2BTQA 2DQ3A 2X0LA 1EN6A 2QM7A 1FAFA 2R9IA 3CPWU 2UU9B 2A06H 2EIMC 2HVKC 2JGDB 3RYFB 2JS3A 1GM7A 4J11A 1Q82W 1N33B 4MTFA 1K73W 3CCLV 1IBKB 5EK0A 4GKKB 1BHBA 4JI5B 3WB1A 5LP6B 2Z5UA 4DR6O 2CTRA 1SC5B 2DE0X 2Q8VA 4QNHB 1EZVH 1SQVH 1AI6A 2CDYA 4Z2WA 1JMKC 1NS1A 2RMKB 2Q0AA 2Q0OC 1F51A 1Y4MA 5L3FA 1BHAA 3QTCA 2B1IA 1G8MA 4CH5A 1Q43A 2ATKC 3ABLB 1NH2D 5JQGB 2L35A 1XMQB 3K5OA 1X59A 1AP5A 4EFBA 1G6UA 5B3SC 1M1KW 3W7XA 4ZBMA 4X20B 3SPGA 1Z5WA 5J2TA 3CB2A 4JYAB 3JD0A 2PUSA 2EJRA 2PYJA 2D2CB 3ZMUA 1YXBA 3U0ZA 4AQYB 2HR3A 5L3DA 1TVKA 1YIJV 4JI4O 1GH6A 3JSNA 4J42A 1SRYA 1R6KA 5DN6G 3LUTB 5LHGA 1COWG 1K7DA 1FJGB 4UCTA 4MSWC 2MK3A 2EIJC 4IL6Z 3JARB 1WPXA 1ORQC 1WA8B 3SYPA 3TJTA 1ZWIC 3DC6A 5IY5C 3JASB 5KHIA 4AILC 5LYJB 2FYUH 3CCSV 4DV3O 4U7NA 3D3QA 3CCUV 4F4LA 1XUQA 2WAMA 3AEIA 2QM4A 2A9HA 4YJ3A 2JGUA 5JH7B 2V7QG 3CCQV 2Q4PA 2F43G 2D3OW 4B7EA 4JYYA 5JJJB 3ZBHA 3K9SA 3D36C 4ASUG 4X66B 5KX5A 5LOVB 1PNKA 3TXQA 5CA3A 4DR4B 3BHPA 3RVZA 1KECA 5K1PA 1AR5A 4FMTA 2V7QH 3F7YC 4KL1A 5D5PA 4H44B 3RYHB 4IT5A 1JOYA 5L3CA 2BOBC 4DV7B 1RFYA 1YITV 5IYZB 4ASUH 5LGUA 1LUWA 1W59A 2QGNA 1NTMH 4LF9O 2Z3YA 1SQFA 3AG4B 5EBWC 2Q7EA 4J9ZB 3DC5A 4N21A 3CRQA 2JIZG 4U3JA 1Q90D 2GUZA 1WNSA 4MVSA 4YXWG 3CRCA 4I55B 1IX9A 2CTPA 1OHHG 2EINC 1YZBA 3ZHRA 3RT3C 1ENVA 2UXDO 3R66A 4X65B 2NN4A 3RYFA 3CCRV 4JI1B 2LJ2A 3OEHG 2XAHA 3E2EA 1D5NA 4DR3B 1KQSU 1QLNA 1ZL8B 3M8AA 2CH7B 5LP6A 4DUZB 4JI0O 3W7TA 1IXBA 4P30A 3L73H 4X1YB 1QLEC 1ZTEA 2Q68A 3K59A 1IDSA 3OEHH 4MS2A 4BW9A 3TGUH 2F4VB 3RVYA 3TETA 3DGEA 2ZIOA 3L71H 3FAVB 3OMIB 3G67A 2R9AA 1FXVA 4NR1A 1GM9A 4JI7O 5AG2A 2A0LA 3B8MA 3QNEA 3ETEA 4X64B 4K3AA 1GRJA 4JPRA 4TV9B 5JQGA 2Y0IA 4ZIBA 2DW4A 3SDLA 4Q20A 1W0JG 5B1AC 2VRZA 3OD4A 2F66C 2OIGA 1D2DA 4KP4A 1YEWA 5JWPA 4DR1O 4X20A 3IFXA 5GW7A 2OT5A 3OEEG 1I0HA 5KUMA 3FB7C 3OAAG 1M90W 2PTMA 3LSQA 3QO5A 1XHXA 5CBHA 1HDJA 2WWWA 1AI5A 4DV1O 3JAWB 4PI0A 1F4NA 1VQNV 4KFMA 4NKGB 1MSWD 4R6ZA 5LGTA 4MTXA 4I9QA 3RWRD 3CCEV 1S72V 4DR7O 4KHPO 2IJHA 3JARA 4LF5B 3ZS8C 1AROP 4LFAB 1NTKH 1T5EA 5B5EZ 4PDMA 3JASA 4WFAV 2EIKB 5LYJA 3CC7V 1MOFA 1JJ2U 4UB8Z 3LSUA 3C3SA 4JZ2A 4TWKA 1XNQO 2FB5A 4LH6A 5B1NA 3L9DA 1Q8IA 2M6YA 5JH7A 1VQ9V 2LQTA 2UXCO 3JD1A 2CE4A 4TV8B 3NR7A 2XUMA 2BCCH 1GN6A 4R8CA 3I55V 1R3IC 3IGAC 3FB8C 1OCRB 3WG7B 3UT5B 5A2QN 5LMNO 2DYSC 1WP7A 1KD1W 3RYHA 1AI7A 1PPJH 2JK5C 2H8PC 3ZRWB 5F2VO 5J2UB 4JTCB 5IYZA 3FYIB 4MW3A 1IZ3A 2N04A 3JAKB 2IJIA 3H1KH 2Q6AA 2UU9O 4L87A 3ZRSA 4BIUA 4HNAB 1MG1A 3ASOC 1Q81W 1IBMB 2QKSA 1N33O 1TUEB 2IW5A 3FFQA 4JI5O 2UUAB 2OCHA 4I55A 3B40A 2Y4TA 4K35A 3SYOA 3SJBC 5B1BB 1I08A 3N2GB 1SF9A 4UXNA 1K8AW 2LW7A 4MVRA 4FVMA 4PELA 1ZL8A 2CH7A 1GN3A 1MABG 2W0XA 3CS5A 2AGAA 1HNXO 4X1YA 1PV0A 4ZHQB 4WBNB 1IBLO 2MW2B 1W2BU 3JD3A 2LGWA 1IVSA 2YI9A 2YICA 3FAVA 4WFBV 2R72A 2PZSA 5DECA 3LDCA 4PDLA 4Z1VA 4AI8A 2HHHB 4UCVA 4JYAO 2RQ6A 1XREA 1H2LA 4TV9A 3K9AA 4Z1MG 1TUBB 5LGNA 3JD2A 3S3XA 4K0KB 4DUYO 3BABA 1VMGA 4X62O 2FMLA 4HAMA 4MVMA 3OMNB 5LL6Y 1F4MA 3MDSA 2VS0A 5BR8B 1TAEA 4H0LB 2LFSA 1JR9A 3JALB 1NBMG 1S76D 3SGIA 1YI2V 1Q7YW 1Y76B 3H9VA 5JJEB 4ABMA 1H8HG 3JAWA 1OV9A 1J95A 1TA8A 1SESA 1BGYH 5EYPB 1MZEA 3MHHC 4MVUA 1EN5A 1NJIW 4UVCA 4MVZA 1RM1B 3OT7A 3KCYA 3ABLC 3A8TA 4OX9B 2HEPA 2OTLV 1G1XB 4NTWA 4PA3A 4DR5B 4NYKA 1GMGA 1Y66A 3AK1A 2K9PA 4GX5A 2PY5A 4TV8A 1YJWV 1R1BA 1VIBA 3SPHA 2G38A 2W6JG 4I0XB 3T1HO 3QO8A 1BSNA 1OCZB 3UT5A 2P06A 2FTKA 2YC0A 3UO2A 3B09A 4U3FH 3ZX6A 3ZRWA 4XDJA 3CRAA 5J2UA 1VF7A 2UUBB 1QVFU 2A79B 3G71V 4JAVA 3JAKA 5FL7H 2E75B 3CHXA 2GV9A 2DYRC 3OE7H 2ADQB 4HNAA 3H01A 3OGIB 1M56C 3LNNA 3A0HZ 4NXMB 2UXXA 2ZDIA 1P4RA 4LF6B 5L3GA 5K1XA 5IE9A 4RQEA 3OUFA 2BSKB 1CEZA 3X2QC 4DUZO 5FPOA 5KAIZ 5KAFZ 3N2GA 1Z2GA 3FKSG 4B08A 4I4TB 1XBLA 3LDDA 4JTAB 2F4VO 3H1IH 2Y48A 4BWAA 4DO2A 3OUSA 2EILB 2P22C 1KP2A 1SS3A 3BRCA 5HFLA 2WLKA 4CS2A 1S5HC 3ZHSA 2QE7H 1GAXA 3VQVA 3F7VC 4W4LA 1H2KA 4ZHQA 4WBNA 4FJCC 1YSCA 1LNQA 4LF8B 4QPKA 4FLXA 5BMVB 2V1DA 4YHHO 1N0JA 1KP3A 3A2FA 4O4JB 4DR2O 1J5EB 4ZI7B 2CK3G 4HYOA 1EBOA 2WLLB 1KKCA 4WFFA 3I56V 1TUBA 2DOSA 4B3MO 3L75H 2CGNA 3E8HA 4RAIA 3BFRA 1GTOA 4WFHA 3JALA 2DN9A 4CS4A 2BTOA 2LP7A 4UFZA 5JVDB 4LF5O 1YJ9V 4LFAO 1Y76A 3E35A 1H38A 1O9GA 2B1GA 3CC4V 1SQQH 3ZMVA 3RBZA 4IYHA 3UQ8A 1QU7A 1NTZH 1FXKB 4JZGA 5LMUB 5EYPA 4UVBA 3ASNB 4TUYB 3ABMB 2IBZH 3THOA 3KZIZ 3CMEV 4GKJB 1K5QA 3L70H 1I94O 1CP9A 1GK9A 1OCOC 4FM2A 4MVOA 4ICGA 5TISZ 4B3RO 1HNWO 1V9PA 2YXLA 3AK3A 2EBOA 3E8GA 4QE7A 1SQGA
chains in the Genus database with same CATH topology
4X64B 3PN1A 4TV9B 1JFFA 5JQGA 4ZIBA 3SJCC 2VWKA 4F6RB 2F95B 3WB0A 4DR7B 1XQ8A 4UCSA 4KHPB 2F66C 1AQTA 5KHKA 4O4LB 3HKDB 4EFEA 1YEWA 2ZNIA 4YJ3B 5JCOA 3WB2A 4X20A 4FM1A 1FFXA 4YJ2B 2XHBA 5KX5B 3HKBB 4FFBA 2PTMA 2BTQB 4IHJA 1XHXA 4LF9B 3M7MX 3B2EE 3OTFA 1M93A 3JAWB 2XNDH 4PI0A 1WPBA 2Q7HA 3BA9A 4NXNB 4FM0A 3K5LA 2UXCB 4I9QA 3RWRD 4O4IA 4EB6A 1M5IA 3JARA 2UXBB 3VQXA 4LF5B 3ZS8C 4LFAB 1T5EA 4I4TA 2Q7GA 2YIBD 3JASA 4B3TB 2UXDB 5IWAB 1QHTA 5LYJA 3DSQA 4TQDA 1SA0A 4K8ZA 2HLDH 4YY3B 4O4HB 4LH6A 1Q8IA 4X1KB 2ZINA 4LFCB 5JH7A 1KU9A 4DV2B 3JSLA 3MAQA 4DV0B 4TV8B 3K5MA 1XMOB 4D7SA 3K5NA 1RSOA 1KMIZ 3RGBA 5FNVA 5BMVA 1NT2B 2ZNJA 2F1MA 4I50B 4O4JA 3UT5B 4ZI7A 3RYHA 1Q3EA 3K57A 4PHZA 5J2TB 4JI7B 4O2AA 1HNZB 5J2UB 4PI2A 5IYZA 1XI1A 2V4DA 3JAKB 4DRXB 2VQEB 1TVKB 4FLVA 1DGSA 4HNAB 5CA0B 5KHJA 1IBMB 4LFBB 1D5AA 3JATA 2EX3A 2E5LB 1HNXB 4DR1B 4DV6B 3FFQA 5KMGA 5JVDA 2UUAB 4LH7A 4I55A 4UCUA 1IBLB 4NVPA 5IJ9B 4LF7B 3SJBC 3N2GB 3T1YB 4JI2B 4FLYA 4FVMA 4TUYA 2ZM6B 4X1IB 1TGOA 4LF4B 4FLZA 1L8DA 1ZAUA 4CC5A 4DUYB 4IHJB 4X62B 4FLWA 3HKCA 2R70A 4X1YA 2OWOA 4B3SB 4ZHQB 4WBNB 1X4TA 1SKVA 3N2KA 5EIBD 5ITZA 4DV4B 2YI9A 2ZCEA 5IJ0A 2RJZA 2R72A 2PZSA 1S5JA 2E5YA 3E22B 1XNQB 4HBNA 5D5QA 2HHHB 4UCVA 4CH6A 2RQ6A 5CB4B 2VWJA 1M4UA 5KHGA 4TV9A 1TUBB 4K0KB 4GYCB 3BABA 4F6RA 4IIJB 5CA1B 1FS0E 5EZYB 4O4LA 3HKDA 3FKSH 2PGGA 4GLXA 1H2SB 5BR8B 3ETQA 4TOIA 4U3JB 1N34B 1TAEA 5LMNB 3JALB 4EEQA 3RYCB 3SGIA 2VQFB 4YJ2A 2PYLA 4FLTA 2IM9A 3HKBA 4LNUA 5C8YB 5JJEB 2BTQA 2OYQA 4ZOLB 3JAWA 2UU9B 1TA8A 4O2BB 3RYFB 3VQYA 4Q6GA 5EYPB 5LXTB 1N33B 3RYIB 1IBKB 1HR0B 3CSXA 4GKKB 5LOVA 3HKEB 4JI5B 3WB1A 5LA6B 3T1HB 5LP6B 5EIBC 5GONB 4OX9B 1E79H 2HEPA 3JATB 3ZEDA 1JMKC 4AHCA 4DR5B 2Q0AA 2YIAA 2RQ7A 4O4HA 4JI6B 4CH4A 4X1KA 3QTCA 5DN6I 5JCOC 5FPRA 4CH5A 4JI3B 3BAAA 1Q43A 2CAZC 2PY5A 4TV8A 4FLUA 1JFFB 5JQGB 2JS5A 1XMQB 4YXWH 3K5OA 4JV5B 3U11A 2UUCB 4DK0A 1BSNA 4EFBA 1G6UA 3BA8A 3RFRA 2YI8A 3UT5A 4I50A 4X20B 1Z5WA 5J2TA 3CB2A 4JYAB 2WSSH 2PUSA 5J2UA 1FFXB 1VF7A 2PYJA 2UUBB 3U0ZA 3JAKA 4JI8B 4DRXA 4DV3B 4AQYB 5FL7H 4FFBB 1TVKA 3CHXA 2GV9A 3OE7H 3JSNA 5IJ0B 3QG5A 4LR3A 4HNAA 5JJNB 3IAYA 1BSHA 3LNNA 4NXMB 4LF6B 1FJGB 4UCTA 4O4IB 4EB6B 5K1XA 1XNRB 3JARB 5IJ9A 4DK1A 1WN7A 5FPOA 1H8EH 3N2GA 4B08A 2XOKH 4I4TB 3ICXA 4YHHB 3JASB 5KHIA 1HW7A 4AILC 4BWAA 5LYJB 4DR2B 1N32B 4X1IA 1Z5VA 1SA0B 2P22C 3BRCA 1XHZA 4LNUB 4DV5B 2QJ1A 4CS2A 2YIBA 2QE7H 4D7TA 2QM4A 1O9HA 4UCOA 4YJ3A 2JGUA 3VQVA 5JH7B 4B3MB 4DR6B 4ZHQA 2E3CA 4WBNA 3QF7A 5JJJB 4L8JA 3OAAH 5LP6C 4X66B 5KX5A 5LOVB 4DR4B 1B04A 3BHPA 1JJOA 4LF8B 5FNVB 4FLXA 3E22A 5BMVB 5K1PA 3SR2C 3A2FA 4O4JB 2V7QH 4K8XA 1J5EB 4KL1A 4ZI7B 2KKWA 5D5PA 3RYHB 3OFNH 5CB4A 4O2AB 4DV7B 1TUBA 5IYZB 4ASUH 1SQFA 4CC6A 4IIJA 4CS3A 5CA1A 4CH3A 2Q7EA 5EZYA 2P5OA 4TQFA 4U3JA 4JI0B 1WNSA 1I94B 3JALA 3BPZA 3RYCA 4CS4A 2BTOA 1QQCA 4UFZA 5JVDB 5KMGB 4I55B 2F93B 5C8YA 1O9GA 4B3RB 1HNWB 4ZOLA 4JI4B 3UQ8A 1Q5OA 4O2BA 3RYFA 4X65B 5LMUB 5EYPA 1N36B 4JI1B 5KHHA 5LXTA 1P49A 3RYIA 1I7FA 4TUYB 4DR3B 3HKEA 3THOA 2JVDA 2ZIMA 5LA6A 5LP6A 4GKJB 4DUZB 3VQWA 4UCRA 5GONA 3HKCB 3OTOB 4X1YB 3K59A 3OEHH 4BW9A 2F4VB 4FM2A 3N2KB 3SJAC 5ITZB 2ZIOA 1V9PA 2YXLA 2R9AA 5CA0A 3K58A 3U10A 1SQGA 4DV1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQY A;  4Q6G A;  2YIA A;  2V7Q H;  2YI8 A;  2RQ7 A;  1FS0 E;  2QJ1 A;  3OFN H;  4CS2 A;  2Q7G A;  2YIB D;  2YI9 A;  2YIB A;  3VQW A;  3FKS H;  2PGG A;  4CH4 A;  5K1X A;  2QE7 H;  2ZCE A;  3QTC A;  5DN6 I;  1O9H A;  3VQV A;  2RJZ A;  2R72 A;  1O9G A;  4ZIB A;  2E5Y A;  3DSQ A;  2XND H;  4TQD A;  4CH5 A;  2WSS H;  2PUS A;  3OEH H;  2Q7H A;  4ASU H;  4BW9 A;  1H8E H;  2E3C A;  2HLD H;  2ZNJ A;  1AQT A;  2XOK H;  5FL7 H;  4CH6 A;  2RQ6 A;  2ZIO A;  4CS3 A;  4CH3 A;  2Q7E A;  2ZNI A;  3OAA H;  3OE7 H;  2ZIN A;  4BWA A;  1E79 H;  2HEP A;  3BHP A;  4YXW H;  2R70 A;  4TQF A;  3VQX A;  3ZED A;  1BSN A;  1G6U A;  2JVD A;  1BSH A;  2ZIM A;  5K1P A;  4CS4 A; 
#chains in the Genus database with same CATH topology
 1AJQ A;  2Y69 B;  3SJC C;  4I0X A;  3WB0 A;  1XL6 A;  2Q9L A;  1JPX A;  1XQ8 A;  2DWD C;  2QKC A;  2ZQM A;  1AQT A;  5KHK A;  3OTO O;  4UV9 A;  4JYB A;  3CRM A;  2WLN A;  4J9Y B;  2ADP A;  2WLJ A;  4FFK A;  3RN4 A;  1I5Y A;  4MT8 A;  1JX9 A;  3B2E E;  1M93 A;  2EIK C;  2XND H;  2WPD G;  1WPB A;  2Q7H A;  4G28 B;  1NVP B;  3K5L A;  1SQP H;  1V54 B;  5H9C A;  1PKX A;  2BSK A;  2UXB B;  1Y74 B;  3TXS A;  4JGS A;  4XDK A;  2EJ7 A;  4I4T A;  2XAQ A;  2ZE8 A;  4XBF A;  3B77 A;  4B3T B;  2IU3 A;  1QHT A;  3DSQ A;  4KUM A;  2HFE C;  4I7Z B;  1OCR C;  3WG7 C;  2HLD H;  1S5L Z;  4YY3 B;  4X1K B;  1Q86 W;  4X88 A;  3ZIA G;  2HHH O;  3T1C A;  5BY1 A;  3JSL A;  4JYC A;  2ZKO A;  4PA9 A;  2A7W A;  3K5N A;  1L1F A;  1WP8 A;  1YHQ V;  3RGB A;  5BMV A;  2GSM B;  2JGD A;  3ZCC A;  1SQB H;  4I50 B;  4O4J A;  1DF4 A;  2Q5Z A;  4ZI7 A;  1Q3E A;  4EKW A;  1I5X A;  4LBE C;  3FB5 C;  1GN4 A;  1HNZ B;  4WFG A;  5B1B C;  2PI5 A;  4LFC O;  2ZXW B;  4MTG A;  5CA0 B;  3VBB A;  4DV0 O;  4LFB B;  1D5A A;  1VEW A;  2EX3 A;  4DV6 B;  2Y4U A;  5JVD A;  1WB7 A;  3CE2 A;  4UCU A;  4LF7 B;  2DMX A;  2WA4 A;  2QKA A;  1FXK A;  3T1Y B;  4RQF A;  3F5W C;  4JI2 B;  4FLY A;  3NXS A;  2YDE A;  5H5N A;  4TUY A;  3CJH B;  1F7Y A;  4LF4 B;  5BZB A;  1K92 A;  1KBH A;  1CXZ B;  1ZAU A;  2ODM A;  2RN9 A;  4CC5 A;  4IHJ B;  3ZRX A;  2OCC C;  1KB9 F;  2E5L O;  4DW0 A;  4FLW A;  2R70 A;  5DED A;  4H37 A;  4PV1 B;  4PA4 A;  1THZ A;  1YTF B;  1SKV A;  3BCC H;  4P9P A;  2ZCE A;  2QWP B;  4YIO A;  3E22 B;  3K79 A;  1G4Y B;  4J41 A;  3TK1 A;  2IJK A;  2ZM6 O;  1KC8 W;  4LWS B;  3CD6 V;  4X9Q A;  1SZX A;  2AW9 A;  4GYC B;  2E76 B;  2IH3 C;  1PL4 A;  2PF4 E;  1XIL A;  1WA8 A;  2KSD A;  4IIJ B;  5CA1 B;  1S77 D;  5EZY B;  2EIJ B;  1GM8 A;  3G6B A;  2PGG A;  1H2S B;  1BQ0 A;  3CYO A;  1N34 B;  1PNM A;  1Q6U A;  2XT9 A;  1K5S A;  5CN0 A;  5J9P C;  4DV4 O;  3CC2 V;  3KKY A;  5IY5 B;  1VQ8 V;  1RM1 C;  2PYL A;  1JVM A;  1HP8 A;  2IM9 A;  1XDC A;  5C8Y B;  2NLJ C;  2B5U A;  2OYQ A;  3UKM A;  3APQ A;  1EN4 A;  1LUV A;  3VQY A;  4Q6G A;  3ZHQ A;  4BW5 A;  4KXR A;  3RYI B;  3CSX A;  4P2Z A;  2XAF A;  5LOV A;  2EZO A;  3HKE B;  1Y74 A;  2JJ1 G;  5LA6 B;  3AG2 B;  5IT9 N;  2EUL A;  3L72 H;  4GX0 A;  2WLH A;  1E79 H;  3JAT B;  2BE3 A;  3H1H H;  4AHC A;  2GDS A;  1WJZ A;  4LF8 O;  2FL4 A;  2RQ7 A;  3P3P A;  1VQO V;  4JI6 B;  2P90 A;  4X1K A;  3EVK A;  5DN6 I;  4H13 B;  5FPR A;  4JI3 B;  4MTO A;  1VQ6 V;  1IBK O;  1AP6 A;  2CAZ C;  2GTS A;  4GKK O;  3ZHV A;  4D6T H;  1EZJ A;  2JS5 A;  5B66 Z;  4E2L A;  4JV5 B;  3U11 A;  2UUC B;  4DK0 A;  1BZK A;  2QR4 A;  1JQ0 A;  3RFR A;  4I50 A;  1N0N A;  1Y6X A;  2EIN B;  4B7K A;  2QWQ B;  1AR4 A;  3KG2 A;  1EFR G;  5GTH Z;  3QO7 A;  2WSS H;  1FFX B;  2YS8 A;  1U96 A;  4DV3 B;  1RPR A;  1L0N H;  2M7W A;  4FPP A;  5IJ0 B;  3UCS C;  2Q67 A;  5LMU O;  2YEV B;  5JJN B;  3IAY A;  2EIL C;  1XMQ O;  3STL C;  3SYA A;  4O4I B;  4EB6 B;  1QLE B;  2OTJ V;  4DK1 A;  1WN7 A;  3CCM V;  2QDO A;  2B9Z A;  1OCC C;  3J80 N;  5EBL C;  1B3Q A;  3GWO A;  1N32 B;  3CJH A;  4AQY O;  1Z5V A;  2ZE6 A;  3FD9 A;  1XHZ A;  4MVQ A;  4LNU B;  4DV5 B;  2LO1 A;  1OJH A;  2QJ1 A;  1BMF G;  1O9H A;  5B1A B;  1AI4 A;  1FJG O;  1FPO A;  1R3J C;  3GB7 C;  3OMA B;  4L8J A;  1ZSP A;  5LP6 C;  1VF6 A;  4OPA A;  1B04 A;  5E79 Z;  3QVN A;  5FNV B;  3E22 A;  2GBO A;  2YXY A;  3LSS A;  3K08 A;  3SR2 C;  3G80 A;  2KKW A;  3Q4H B;  3K0D A;  3IC7 A;  4O2A B;  2LGQ A;  4UUJ C;  4YIP A;  1KYO F;  4X89 A;  2IJJ A;  1FXK C;  3JCU Z;  4IIJ A;  4CS3 A;  1Y67 A;  5CA1 A;  5EZY A;  1RPO A;  4TQF A;  4JI0 B;  1N4C A;  3B8N A;  3ABM C;  4X66 O;  2QTO A;  3SPI A;  1NVP D;  4DR4 O;  2UXB O;  1BQZ A;  5KMG B;  3CMA V;  4JAA A;  5C8Y A;  2P7T C;  4BIO A;  2X6C A;  1A32 A;  4B3T O;  1M57 B;  2QTS A;  5KUK A;  1N36 B;  5KHH A;  2OIE A;  3SYQ A;  4DV7 O;  2JRI A;  4NTX A;  3RYI A;  4YY3 O;  1QBZ A;  3HKE A;  3E86 A;  5FL7 G;  3JCZ A;  2PI4 A;  4PJ0 Z;  5LA6 A;  3OE7 G;  3N27 A;  3D36 A;  2RDC A;  1OZ0 A;  3E89 A;  3VQW A;  1P84 F;  1DF5 A;  1Q6I A;  2Y69 C;  3O9O A;  5CMU A;  4OXS A;  2P4K A;  2X7R B;  1SET A;  2DYS B;  3N2K B;  3SJA C;  4R50 A;  1MMM A;  1XEQ A;  1XL4 A;  4X65 O;  1VQ4 V;  4JI1 O;  3U10 A;  1MZF A;  4DV1 B;  4K8Z A;  3AK2 A;  3ABT A;  3JAM N;  4FZ1 A;  3ZMS A;  4DR3 O;  2DJV A;  4FIP C;  3JYC A;  4CBC A;  4DR7 B;  4KHP B;  2QE7 G;  1CPY A;  4O4L B;  5E1A C;  4EFE A;  2ZNI A;  4YJ3 B;  1K33 A;  5JCO A;  3WB2 A;  1V54 C;  1DLB A;  3K0G A;  2QWN B;  2YSU B;  2L6L A;  5GTI Z;  4FM1 A;  1FFX A;  5LBQ A;  4YJ2 B;  2JJ2 G;  2XHB A;  1K4D C;  4LF7 O;  2ZD9 A;  5KX5 B;  3HKB B;  2AXT Z;  2O57 A;  1NI8 A;  2CTQ A;  3MHS C;  3T1Y O;  3E8B A;  3OTF A;  4X64 O;  3KCX A;  1ROP A;  1AB3 A;  3DTU B;  2W6I G;  3H1L H;  2YEV A;  4JI2 O;  4NXN B;  4FM0 A;  2UXC B;  2YID A;  4LF4 O;  4C7U A;  4U7O A;  4O4I A;  4EB6 A;  3AG4 C;  1M5I A;  3TCU A;  3VQX A;  1F23 A;  1YDX A;  5IWA B;  1R3K C;  4IGG A;  2GUZ B;  5EBM C;  4TT3 G;  1ZLZ A;  1H2G A;  1YTF D;  1VQP V;  3CCJ V;  1DTO A;  1PM9 A;  4O4H B;  2RCV A;  1QR9 A;  5FLX N;  2XAS A;  4DV2 B;  3O65 A;  3LNM B;  3MAQ A;  1KUQ A;  3HPL C;  4I9W A;  1XMO B;  2ZXW C;  2C2A A;  2LW1 A;  2Q73 A;  3CX5 F;  1V55 B;  1QR8 A;  5FNV A;  3AG3 B;  3ZHU A;  5IDJ A;  2F1M A;  1N34 O;  1R3L C;  4H33 A;  3Q4H A;  4O2A A;  2ZR3 A;  3G6E V;  2V4D A;  3DXR B;  1YJN V;  2YXH A;  4DRX B;  2VQE B;  4UVA A;  1RP3 B;  3CEI A;  4FLV A;  1DGS A;  4J7Z A;  1IUR A;  1URF A;  3CXC U;  4ZKI A;  1HNX B;  2GHY A;  5EC1 C;  5KMG A;  3UM7 A;  5L3B A;  4LH7 A;  1IBL B;  4G27 B;  1BSM A;  4GX1 A;  5IJ9 B;  4QPJ A;  4WCE V;  2AHY A;  2WLI B;  4PA7 A;  1FS0 G;  2HP8 A;  3K3W A;  1US6 A;  5KLV H;  3D3I A;  1VF6 C;  3HB3 B;  4X1I B;  4JI6 O;  4GUN A;  1TGO A;  3RW0 A;  2QWO B;  1SQX H;  1L8D A;  3ZN0 A;  3K03 A;  3BY6 A;  4DUY B;  1IBM O;  3H1J H;  4JI3 O;  4X62 B;  3AG1 B;  2XND G;  3J7A U;  3P32 A;  3SPC A;  4W4K A;  1P7B A;  1UPG A;  4RUF A;  2AZ2 A;  2OWO A;  2UUA O;  2QA4 V;  4B3S B;  1JCH A;  3FB6 C;  4J7J A;  3N2K A;  2RNB A;  5EIB D;  4JV5 O;  3OM3 B;  2UUC O;  2KG7 B;  3APO A;  1YVW A;  4UB6 Z;  2WA3 A;  1S5J A;  2P4V A;  3HR0 A;  4HBN A;  2DYR B;  2ZE5 A;  5CB4 B;  1M4U A;  4JTD B;  5KHG A;  1VF5 B;  3ABK B;  1M56 B;  2HLD G;  5CBG A;  1Q6H A;  1NU1 H;  3P30 A;  1GN2 A;  4O4L A;  2AHZ A;  4J80 A;  3X2Q B;  5LHH A;  4GLX A;  4PDV A;  3ETQ A;  4TOI A;  3RYC B;  4RUE A;  2Z0A A;  2VQF B;  4YJ2 A;  3ETG A;  4FLT A;  3AG2 C;  3HKB A;  2JEX A;  4ZOL B;  3K06 A;  5EC2 C;  3L74 H;  2QSA A;  4O2B B;  1N32 O;  5LXT B;  5BXZ A;  4K0K O;  2JDI G;  1HR0 B;  4DV5 O;  1DK1 A;  5CBF A;  2ZE7 A;  2CUG A;  3T1H B;  5BR8 O;  5EIB C;  2ZDI C;  5GON B;  2N74 A;  2EIM B;  2WLL A;  3PJS K;  3ZED A;  2HG5 C;  3W7U A;  1B06 A;  1AJP A;  2YIA A;  4O4H A;  2KQX A;  4CH4 A;  1N8R W;  5JCO C;  1KKD A;  3BAA A;  2FKX A;  4P9O A;  3T2M A;  1JFF B;  4FLU A;  4YXW H;  1VQ7 V;  4N23 A;  2UXN A;  3T4Z A;  3BA8 A;  4QJF B;  3FX7 A;  4OX9 O;  2YI8 A;  1PNL A;  1HWY A;  5IYB O;  3IJ4 A;  1MNG A;  2DQ0 A;  4DR5 O;  3F5T A;  1YF2 A;  3A0R A;  1K9M W;  2GTA A;  2K1E A;  3DXR A;  1AVM A;  4JI8 B;  5H6R A;  2IU0 A;  4DRX A;  4FFB B;  4NTY A;  3ML0 A;  4FK5 C;  1H8E G;  3QG5 A;  4LR3 A;  1U97 A;  4BR6 A;  1N36 O;  2XOK G;  4I5S A;  3SYC A;  5B3S B;  2XAG A;  1BE3 H;  1BSH A;  3T4D A;  1MSD A;  1OCO B;  2HVJ C;  2AZ0 A;  1XNR B;  3GWK C;  5IJ9 A;  2YUA A;  3ZHT A;  1NR1 A;  4HZ3 A;  2ILM A;  1H8E H;  2XOK H;  2KB1 A;  3P3N A;  2WLI A;  3ICX A;  1AR1 B;  4YHH B;  1HW7 A;  2UUB O;  1SER A;  5B1O A;  4DR2 B;  1AJN A;  1E1R G;  1R6T A;  3A0B Z;  4X1I A;  1SA0 B;  1M9N A;  1PP9 H;  3CRR A;  5L3E A;  2YIB A;  2HJD A;  4D7T A;  1ZUQ A;  4UCO A;  5A9G A;  4DR6 B;  4B3M B;  4NXM O;  3OFN G;  1K3E A;  1H2N A;  4LF6 O;  2E3C A;  3ZMT A;  3QF7 A;  1BS3 A;  1GKF A;  2KG7 A;  4J7K A;  3OAA H;  1RSO B;  1R73 A;  5KA6 A;  3SJQ C;  2F23 A;  1IXM A;  1JJO A;  1B6Q A;  4BIZ A;  4K8X A;  1E79 G;  1WLE A;  1NH2 B;  3OFN H;  5CB4 A;  5HFM A;  1FXH A;  4FZ0 A;  1NKD A;  4PDR A;  5H6Q A;  2BOC C;  3MD0 A;  2Q69 A;  1WB8 A;  4CC6 A;  2A3Q A;  1M57 C;  4CH3 A;  1PD3 A;  1XOU A;  4JF3 A;  4NXN O;  2P5O A;  1I94 B;  1UJW B;  3SPJ A;  3BPZ A;  3RYC A;  1BL8 A;  1OCZ C;  1QQC A;  2F93 B;  1JA8 A;  3ZN1 A;  1NR7 A;  4B3R B;  3CP1 A;  4J10 A;  4JAS A;  1HNW B;  4ZOL A;  4JI4 B;  1J5E O;  2QWR B;  5IWA O;  1Q5O A;  2R9R B;  4O2B A;  3W7W A;  5LXT A;  1P49 A;  2WSS G;  5IYD O;  1I7F A;  3D8C A;  4LP8 A;  5KA5 A;  3R65 A;  2JVD A;  2ZIM A;  1WAZ A;  4DV2 O;  4PD4 F;  2P67 A;  4UCR A;  5GON A;  3HKC B;  3OTO B;  3OW2 U;  1L0L H;  4PA6 A;  1XMO O;  4GCZ A;  3ZJZ A;  1W0K G;  2ARH A;  5ITZ B;  3FYE B;  2HKO A;  1YCI A;  1NQT A;  4OPH A;  4QE9 A;  5CA0 A;  3K58 A;  3ZMZ A;  3AG7 A;  1ZX3 A;  3OR6 C;  3C90 A;  3PN1 A;  4X8A A;  1JFF A;  3WFV A;  3BEH A;  4DXW A;  2VQE O;  3VOU A;  1H2M A;  1FYJ A;  3LDE A;  4GKJ O;  2VWK A;  3BVO A;  2F95 B;  2N05 A;  4XDL A;  4F6R B;  4UCS A;  1QNM A;  3HKD B;  2WLM A;  1S3J A;  4R7C A;  3EHB B;  3E83 A;  1K4C C;  3EFF K;  2Y0P A;  1SZT A;  3S3W A;  2W0F C;  4RWU A;  4FFB A;  2BTQ B;  4IHJ A;  4LF9 B;  3M7M X;  2EZP A;  4TSF G;  1UFI A;  1PL0 A;  1NZ6 A;  2ZR2 A;  5DM6 V;  3BA9 A;  2OCC B;  4CZZ A;  1AIL A;  3CCV V;  2X6B A;  1FD9 A;  2Q7G A;  2YIB D;  3W7S A;  1K34 A;  2QM8 A;  4OGQ B;  4B3S O;  2UXD B;  4LWS A;  3OGC C;  4TQD A;  1GO3 F;  1V55 C;  1SA0 A;  4WFE A;  2P6J A;  3AG3 C;  1P7G A;  3JD4 A;  3OR7 C;  1R6N A;  2H3O A;  3B4S A;  2ZIN A;  5LHI A;  1VQL V;  2XTA A;  4LFC B;  2QEX V;  1KU9 A;  3ASN C;  2LFR A;  4DV0 B;  3K5M A;  1S0V A;  3CWB H;  3STZ C;  1LR1 A;  1BCC H;  4D7S A;  1RSO A;  1KMI Z;  2CGO A;  3ETD A;  1NT2 B;  3J81 N;  2ZNJ A;  1EM1 A;  4DYL A;  1MA1 A;  3K57 A;  4PHZ A;  5J2T B;  4GT1 A;  4JI7 B;  2VQF O;  1VP7 A;  4PI2 A;  2ITC C;  1XI1 A;  3C3T A;  3GVM A;  3WU2 Z;  4DW1 A;  1TVK B;  5H2F Z;  1VQK V;  4LCU C;  1VQ5 V;  4G2K A;  2JEU A;  5KHJ A;  3JAT A;  2E5L B;  1HR0 O;  3K04 A;  4DR1 B;  2ZT9 B;  3EXA A;  4NB5 A;  2E74 B;  2HJF C;  4WF9 V;  2IH1 C;  5IYC O;  2X6A A;  3AG1 C;  4NVP A;  1VQM V;  1HNZ O;  3ASO B;  4MW8 A;  2ZM6 B;  4RO2 A;  2ITD C;  4FLZ A;  2NNU A;  4A5U B;  4JAU A;  4LFB O;  1FFT B;  3ZRV A;  2H94 A;  4DV6 O;  3HKC A;  3CXH F;  1K97 A;  1FKA O;  3E8F A;  3ABK C;  2CTW A;  5C93 A;  1X4T A;  2NR5 A;  1QVG U;  4UV8 A;  4E4E A;  5ITZ A;  4DV4 B;  5IJ0 A;  2RJZ A;  2E5Y A;  1XNQ B;  1QCE A;  4QGP A;  3M99 B;  5D5Q A;  4CH6 A;  2VWJ A;  1BT8 A;  3I5D A;  4F6E A;  4JI8 O;  4LC1 A;  4F6R A;  3UO3 A;  3G4S V;  1VAR A;  1FS0 E;  2ETN A;  3HKD A;  3FKS H;  4GX2 A;  4U3J B;  5LMN B;  3ABU A;  2DWE C;  1OCC B;  4EEQ A;  4BAY A;  4GZR B;  1XNR O;  3IC9 A;  2XAJ A;  1E1Q G;  4LNU A;  4QIW F;  4IYI A;  2BTQ A;  2DQ3 A;  2X0L A;  1EN6 A;  2QM7 A;  1FAF A;  2R9I A;  3CPW U;  2UU9 B;  2A06 H;  2EIM C;  2HVK C;  2JGD B;  3RYF B;  2JS3 A;  1GM7 A;  4J11 A;  1Q82 W;  1N33 B;  4MTF A;  1K73 W;  3CCL V;  1IBK B;  5EK0 A;  4GKK B;  1BHB A;  4JI5 B;  3WB1 A;  5LP6 B;  2Z5U A;  4DR6 O;  2CTR A;  1SC5 B;  2DE0 X;  2Q8V A;  4QNH B;  1EZV H;  1SQV H;  1AI6 A;  2CDY A;  4Z2W A;  1JMK C;  1NS1 A;  2RMK B;  2Q0A A;  2Q0O C;  1F51 A;  1Y4M A;  5L3F A;  1BHA A;  3QTC A;  2B1I A;  1G8M A;  4CH5 A;  1Q43 A;  2ATK C;  3ABL B;  1NH2 D;  5JQG B;  2L35 A;  1XMQ B;  3K5O A;  1X59 A;  1AP5 A;  4EFB A;  1G6U A;  5B3S C;  1M1K W;  3W7X A;  4ZBM A;  4X20 B;  3SPG A;  1Z5W A;  5J2T A;  3CB2 A;  4JYA B;  3JD0 A;  2PUS A;  2EJR A;  2PYJ A;  2D2C B;  3ZMU A;  1YXB A;  3U0Z A;  4AQY B;  2HR3 A;  5L3D A;  1TVK A;  1YIJ V;  4JI4 O;  1GH6 A;  3JSN A;  4J42 A;  1SRY A;  1R6K A;  5DN6 G;  3LUT B;  5LHG A;  1COW G;  1K7D A;  1FJG B;  4UCT A;  4MSW C;  2MK3 A;  2EIJ C;  4IL6 Z;  3JAR B;  1WPX A;  1ORQ C;  1WA8 B;  3SYP A;  3TJT A;  1ZWI C;  3DC6 A;  5IY5 C;  3JAS B;  5KHI A;  4AIL C;  5LYJ B;  2FYU H;  3CCS V;  4DV3 O;  4U7N A;  3D3Q A;  3CCU V;  4F4L A;  1XUQ A;  2WAM A;  3AEI A;  2QM4 A;  2A9H A;  4YJ3 A;  2JGU A;  5JH7 B;  2V7Q G;  3CCQ V;  2Q4P A;  2F43 G;  2D3O W;  4B7E A;  4JYY A;  5JJJ B;  3ZBH A;  3K9S A;  3D36 C;  4ASU G;  4X66 B;  5KX5 A;  5LOV B;  1PNK A;  3TXQ A;  5CA3 A;  4DR4 B;  3BHP A;  3RVZ A;  1KEC A;  5K1P A;  1AR5 A;  4FMT A;  2V7Q H;  3F7Y C;  4KL1 A;  5D5P A;  4H44 B;  3RYH B;  4IT5 A;  1JOY A;  5L3C A;  2BOB C;  4DV7 B;  1RFY A;  1YIT V;  5IYZ B;  4ASU H;  5LGU A;  1LUW A;  1W59 A;  2QGN A;  1NTM H;  4LF9 O;  2Z3Y A;  1SQF A;  3AG4 B;  5EBW C;  2Q7E A;  4J9Z B;  3DC5 A;  4N21 A;  3CRQ A;  2JIZ G;  4U3J A;  1Q90 D;  2GUZ A;  1WNS A;  4MVS A;  4YXW G;  3CRC A;  4I55 B;  1IX9 A;  2CTP A;  1OHH G;  2EIN C;  1YZB A;  3ZHR A;  3RT3 C;  1ENV A;  2UXD O;  3R66 A;  4X65 B;  2NN4 A;  3RYF A;  3CCR V;  4JI1 B;  2LJ2 A;  3OEH G;  2XAH A;  3E2E A;  1D5N A;  4DR3 B;  1KQS U;  1QLN A;  1ZL8 B;  3M8A A;  2CH7 B;  5LP6 A;  4DUZ B;  4JI0 O;  3W7T A;  1IXB A;  4P30 A;  3L73 H;  4X1Y B;  1QLE C;  1ZTE A;  2Q68 A;  3K59 A;  1IDS A;  3OEH H;  4MS2 A;  4BW9 A;  3TGU H;  2F4V B;  3RVY A;  3TET A;  3DGE A;  2ZIO A;  3L71 H;  3FAV B;  3OMI B;  3G67 A;  2R9A A;  1FXV A;  4NR1 A;  1GM9 A;  4JI7 O;  5AG2 A;  2A0L A;  3B8M A;  3QNE A;  3ETE A;  4X64 B;  4K3A A;  1GRJ A;  4JPR A;  4TV9 B;  5JQG A;  2Y0I A;  4ZIB A;  2DW4 A;  3SDL A;  4Q20 A;  1W0J G;  5B1A C;  2VRZ A;  3OD4 A;  2F66 C;  2OIG A;  1D2D A;  4KP4 A;  1YEW A;  5JWP A;  4DR1 O;  4X20 A;  3IFX A;  5GW7 A;  2OT5 A;  3OEE G;  1I0H A;  5KUM A;  3FB7 C;  3OAA G;  1M90 W;  2PTM A;  3LSQ A;  3QO5 A;  1XHX A;  5CBH A;  1HDJ A;  2WWW A;  1AI5 A;  4DV1 O;  3JAW B;  4PI0 A;  1F4N A;  1VQN V;  4KFM A;  4NKG B;  1MSW D;  4R6Z A;  5LGT A;  4MTX A;  4I9Q A;  3RWR D;  3CCE V;  1S72 V;  4DR7 O;  4KHP O;  2IJH A;  3JAR A;  4LF5 B;  3ZS8 C;  1ARO P;  4LFA B;  1NTK H;  1T5E A;  5B5E Z;  4PDM A;  3JAS A;  4WFA V;  2EIK B;  5LYJ A;  3CC7 V;  1MOF A;  1JJ2 U;  4UB8 Z;  3LSU A;  3C3S A;  4JZ2 A;  4TWK A;  1XNQ O;  2FB5 A;  4LH6 A;  5B1N A;  3L9D A;  1Q8I A;  2M6Y A;  5JH7 A;  1VQ9 V;  2LQT A;  2UXC O;  3JD1 A;  2CE4 A;  4TV8 B;  3NR7 A;  2XUM A;  2BCC H;  1GN6 A;  4R8C A;  3I55 V;  1R3I C;  3IGA C;  3FB8 C;  1OCR B;  3WG7 B;  3UT5 B;  5A2Q N;  5LMN O;  2DYS C;  1WP7 A;  1KD1 W;  3RYH A;  1AI7 A;  1PPJ H;  2JK5 C;  2H8P C;  3ZRW B;  5F2V O;  5J2U B;  4JTC B;  5IYZ A;  3FYI B;  4MW3 A;  1IZ3 A;  2N04 A;  3JAK B;  2IJI A;  3H1K H;  2Q6A A;  2UU9 O;  4L87 A;  3ZRS A;  4BIU A;  4HNA B;  1MG1 A;  3ASO C;  1Q81 W;  1IBM B;  2QKS A;  1N33 O;  1TUE B;  2IW5 A;  3FFQ A;  4JI5 O;  2UUA B;  2OCH A;  4I55 A;  3B40 A;  2Y4T A;  4K35 A;  3SYO A;  3SJB C;  5B1B B;  1I08 A;  3N2G B;  1SF9 A;  4UXN A;  1K8A W;  2LW7 A;  4MVR A;  4FVM A;  4PEL A;  1ZL8 A;  2CH7 A;  1GN3 A;  1MAB G;  2W0X A;  3CS5 A;  2AGA A;  1HNX O;  4X1Y A;  1PV0 A;  4ZHQ B;  4WBN B;  1IBL O;  2MW2 B;  1W2B U;  3JD3 A;  2LGW A;  1IVS A;  2YI9 A;  2YIC A;  3FAV A;  4WFB V;  2R72 A;  2PZS A;  5DEC A;  3LDC A;  4PDL A;  4Z1V A;  4AI8 A;  2HHH B;  4UCV A;  4JYA O;  2RQ6 A;  1XRE A;  1H2L A;  4TV9 A;  3K9A A;  4Z1M G;  1TUB B;  5LGN A;  3JD2 A;  3S3X A;  4K0K B;  4DUY O;  3BAB A;  1VMG A;  4X62 O;  2FML A;  4HAM A;  4MVM A;  3OMN B;  5LL6 Y;  1F4M A;  3MDS A;  2VS0 A;  5BR8 B;  1TAE A;  4H0L B;  2LFS A;  1JR9 A;  3JAL B;  1NBM G;  1S76 D;  3SGI A;  1YI2 V;  1Q7Y W;  1Y76 B;  3H9V A;  5JJE B;  4ABM A;  1H8H G;  3JAW A;  1OV9 A;  1J95 A;  1TA8 A;  1SES A;  1BGY H;  5EYP B;  1MZE A;  3MHH C;  4MVU A;  1EN5 A;  1NJI W;  4UVC A;  4MVZ A;  1RM1 B;  3OT7 A;  3KCY A;  3ABL C;  3A8T A;  4OX9 B;  2HEP A;  2OTL V;  1G1X B;  4NTW A;  4PA3 A;  4DR5 B;  4NYK A;  1GMG A;  1Y66 A;  3AK1 A;  2K9P A;  4GX5 A;  2PY5 A;  4TV8 A;  1YJW V;  1R1B A;  1VIB A;  3SPH A;  2G38 A;  2W6J G;  4I0X B;  3T1H O;  3QO8 A;  1BSN A;  1OCZ B;  3UT5 A;  2P06 A;  2FTK A;  2YC0 A;  3UO2 A;  3B09 A;  4U3F H;  3ZX6 A;  3ZRW A;  4XDJ A;  3CRA A;  5J2U A;  1VF7 A;  2UUB B;  1QVF U;  2A79 B;  3G71 V;  4JAV A;  3JAK A;  5FL7 H;  2E75 B;  3CHX A;  2GV9 A;  2DYR C;  3OE7 H;  2ADQ B;  4HNA A;  3H01 A;  3OGI B;  1M56 C;  3LNN A;  3A0H Z;  4NXM B;  2UXX A;  2ZDI A;  1P4R A;  4LF6 B;  5L3G A;  5K1X A;  5IE9 A;  4RQE A;  3OUF A;  2BSK B;  1CEZ A;  3X2Q C;  4DUZ O;  5FPO A;  5KAI Z;  5KAF Z;  3N2G A;  1Z2G A;  3FKS G;  4B08 A;  4I4T B;  1XBL A;  3LDD A;  4JTA B;  2F4V O;  3H1I H;  2Y48 A;  4BWA A;  4DO2 A;  3OUS A;  2EIL B;  2P22 C;  1KP2 A;  1SS3 A;  3BRC A;  5HFL A;  2WLK A;  4CS2 A;  1S5H C;  3ZHS A;  2QE7 H;  1GAX A;  3VQV A;  3F7V C;  4W4L A;  1H2K A;  4ZHQ A;  4WBN A;  4FJC C;  1YSC A;  1LNQ A;  4LF8 B;  4QPK A;  4FLX A;  5BMV B;  2V1D A;  4YHH O;  1N0J A;  1KP3 A;  3A2F A;  4O4J B;  4DR2 O;  1J5E B;  4ZI7 B;  2CK3 G;  4HYO A;  1EBO A;  2WLL B;  1KKC A;  4WFF A;  3I56 V;  1TUB A;  2DOS A;  4B3M O;  3L75 H;  2CGN A;  3E8H A;  4RAI A;  3BFR A;  1GTO A;  4WFH A;  3JAL A;  2DN9 A;  4CS4 A;  2BTO A;  2LP7 A;  4UFZ A;  5JVD B;  4LF5 O;  1YJ9 V;  4LFA O;  1Y76 A;  3E35 A;  1H38 A;  1O9G A;  2B1G A;  3CC4 V;  1SQQ H;  3ZMV A;  3RBZ A;  4IYH A;  3UQ8 A;  1QU7 A;  1NTZ H;  1FXK B;  4JZG A;  5LMU B;  5EYP A;  4UVB A;  3ASN B;  4TUY B;  3ABM B;  2IBZ H;  3THO A;  3KZI Z;  3CME V;  4GKJ B;  1K5Q A;  3L70 H;  1I94 O;  1CP9 A;  1GK9 A;  1OCO C;  4FM2 A;  4MVO A;  4ICG A;  5TIS Z;  4B3R O;  1HNW O;  1V9P A;  2YXL A;  3AK3 A;  2EBO A;  3E8G A;  4QE7 A;  1SQG A; 
#chains in the Genus database with same CATH homology
 4X64 B;  3PN1 A;  4TV9 B;  1JFF A;  5JQG A;  4ZIB A;  3SJC C;  2VWK A;  4F6R B;  2F95 B;  3WB0 A;  4DR7 B;  1XQ8 A;  4UCS A;  4KHP B;  2F66 C;  1AQT A;  5KHK A;  4O4L B;  3HKD B;  4EFE A;  1YEW A;  2ZNI A;  4YJ3 B;  5JCO A;  3WB2 A;  4X20 A;  4FM1 A;  1FFX A;  4YJ2 B;  2XHB A;  5KX5 B;  3HKB B;  4FFB A;  2PTM A;  2BTQ B;  4IHJ A;  1XHX A;  4LF9 B;  3M7M X;  3B2E E;  3OTF A;  1M93 A;  3JAW B;  2XND H;  4PI0 A;  1WPB A;  2Q7H A;  3BA9 A;  4NXN B;  4FM0 A;  3K5L A;  2UXC B;  4I9Q A;  3RWR D;  4O4I A;  4EB6 A;  1M5I A;  3JAR A;  2UXB B;  3VQX A;  4LF5 B;  3ZS8 C;  4LFA B;  1T5E A;  4I4T A;  2Q7G A;  2YIB D;  3JAS A;  4B3T B;  2UXD B;  5IWA B;  1QHT A;  5LYJ A;  3DSQ A;  4TQD A;  1SA0 A;  4K8Z A;  2HLD H;  4YY3 B;  4O4H B;  4LH6 A;  1Q8I A;  4X1K B;  2ZIN A;  4LFC B;  5JH7 A;  1KU9 A;  4DV2 B;  3JSL A;  3MAQ A;  4DV0 B;  4TV8 B;  3K5M A;  1XMO B;  4D7S A;  3K5N A;  1RSO A;  1KMI Z;  3RGB A;  5FNV A;  5BMV A;  1NT2 B;  2ZNJ A;  2F1M A;  4I50 B;  4O4J A;  3UT5 B;  4ZI7 A;  3RYH A;  1Q3E A;  3K57 A;  4PHZ A;  5J2T B;  4JI7 B;  4O2A A;  1HNZ B;  5J2U B;  4PI2 A;  5IYZ A;  1XI1 A;  2V4D A;  3JAK B;  4DRX B;  2VQE B;  1TVK B;  4FLV A;  1DGS A;  4HNA B;  5CA0 B;  5KHJ A;  1IBM B;  4LFB B;  1D5A A;  3JAT A;  2EX3 A;  2E5L B;  1HNX B;  4DR1 B;  4DV6 B;  3FFQ A;  5KMG A;  5JVD A;  2UUA B;  4LH7 A;  4I55 A;  4UCU A;  1IBL B;  4NVP A;  5IJ9 B;  4LF7 B;  3SJB C;  3N2G B;  3T1Y B;  4JI2 B;  4FLY A;  4FVM A;  4TUY A;  2ZM6 B;  4X1I B;  1TGO A;  4LF4 B;  4FLZ A;  1L8D A;  1ZAU A;  4CC5 A;  4DUY B;  4IHJ B;  4X62 B;  4FLW A;  3HKC A;  2R70 A;  4X1Y A;  2OWO A;  4B3S B;  4ZHQ B;  4WBN B;  1X4T A;  1SKV A;  3N2K A;  5EIB D;  5ITZ A;  4DV4 B;  2YI9 A;  2ZCE A;  5IJ0 A;  2RJZ A;  2R72 A;  2PZS A;  1S5J A;  2E5Y A;  3E22 B;  1XNQ B;  4HBN A;  5D5Q A;  2HHH B;  4UCV A;  4CH6 A;  2RQ6 A;  5CB4 B;  2VWJ A;  1M4U A;  5KHG A;  4TV9 A;  1TUB B;  4K0K B;  4GYC B;  3BAB A;  4F6R A;  4IIJ B;  5CA1 B;  1FS0 E;  5EZY B;  4O4L A;  3HKD A;  3FKS H;  2PGG A;  4GLX A;  1H2S B;  5BR8 B;  3ETQ A;  4TOI A;  4U3J B;  1N34 B;  1TAE A;  5LMN B;  3JAL B;  4EEQ A;  3RYC B;  3SGI A;  2VQF B;  4YJ2 A;  2PYL A;  4FLT A;  2IM9 A;  3HKB A;  4LNU A;  5C8Y B;  5JJE B;  2BTQ A;  2OYQ A;  4ZOL B;  3JAW A;  2UU9 B;  1TA8 A;  4O2B B;  3RYF B;  3VQY A;  4Q6G A;  5EYP B;  5LXT B;  1N33 B;  3RYI B;  1IBK B;  1HR0 B;  3CSX A;  4GKK B;  5LOV A;  3HKE B;  4JI5 B;  3WB1 A;  5LA6 B;  3T1H B;  5LP6 B;  5EIB C;  5GON B;  4OX9 B;  1E79 H;  2HEP A;  3JAT B;  3ZED A;  1JMK C;  4AHC A;  4DR5 B;  2Q0A A;  2YIA A;  2RQ7 A;  4O4H A;  4JI6 B;  4CH4 A;  4X1K A;  3QTC A;  5DN6 I;  5JCO C;  5FPR A;  4CH5 A;  4JI3 B;  3BAA A;  1Q43 A;  2CAZ C;  2PY5 A;  4TV8 A;  4FLU A;  1JFF B;  5JQG B;  2JS5 A;  1XMQ B;  4YXW H;  3K5O A;  4JV5 B;  3U11 A;  2UUC B;  4DK0 A;  1BSN A;  4EFB A;  1G6U A;  3BA8 A;  3RFR A;  2YI8 A;  3UT5 A;  4I50 A;  4X20 B;  1Z5W A;  5J2T A;  3CB2 A;  4JYA B;  2WSS H;  2PUS A;  5J2U A;  1FFX B;  1VF7 A;  2PYJ A;  2UUB B;  3U0Z A;  3JAK A;  4JI8 B;  4DRX A;  4DV3 B;  4AQY B;  5FL7 H;  4FFB B;  1TVK A;  3CHX A;  2GV9 A;  3OE7 H;  3JSN A;  5IJ0 B;  3QG5 A;  4LR3 A;  4HNA A;  5JJN B;  3IAY A;  1BSH A;  3LNN A;  4NXM B;  4LF6 B;  1FJG B;  4UCT A;  4O4I B;  4EB6 B;  5K1X A;  1XNR B;  3JAR B;  5IJ9 A;  4DK1 A;  1WN7 A;  5FPO A;  1H8E H;  3N2G A;  4B08 A;  2XOK H;  4I4T B;  3ICX A;  4YHH B;  3JAS B;  5KHI A;  1HW7 A;  4AIL C;  4BWA A;  5LYJ B;  4DR2 B;  1N32 B;  4X1I A;  1Z5V A;  1SA0 B;  2P22 C;  3BRC A;  1XHZ A;  4LNU B;  4DV5 B;  2QJ1 A;  4CS2 A;  2YIB A;  2QE7 H;  4D7T A;  2QM4 A;  1O9H A;  4UCO A;  4YJ3 A;  2JGU A;  3VQV A;  5JH7 B;  4B3M B;  4DR6 B;  4ZHQ A;  2E3C A;  4WBN A;  3QF7 A;  5JJJ B;  4L8J A;  3OAA H;  5LP6 C;  4X66 B;  5KX5 A;  5LOV B;  4DR4 B;  1B04 A;  3BHP A;  1JJO A;  4LF8 B;  5FNV B;  4FLX A;  3E22 A;  5BMV B;  5K1P A;  3SR2 C;  3A2F A;  4O4J B;  2V7Q H;  4K8X A;  1J5E B;  4KL1 A;  4ZI7 B;  2KKW A;  5D5P A;  3RYH B;  3OFN H;  5CB4 A;  4O2A B;  4DV7 B;  1TUB A;  5IYZ B;  4ASU H;  1SQF A;  4CC6 A;  4IIJ A;  4CS3 A;  5CA1 A;  4CH3 A;  2Q7E A;  5EZY A;  2P5O A;  4TQF A;  4U3J A;  4JI0 B;  1WNS A;  1I94 B;  3JAL A;  3BPZ A;  3RYC A;  4CS4 A;  2BTO A;  1QQC A;  4UFZ A;  5JVD B;  5KMG B;  4I55 B;  2F93 B;  5C8Y A;  1O9G A;  4B3R B;  1HNW B;  4ZOL A;  4JI4 B;  3UQ8 A;  1Q5O A;  4O2B A;  3RYF A;  4X65 B;  5LMU B;  5EYP A;  1N36 B;  4JI1 B;  5KHH A;  5LXT A;  1P49 A;  3RYI A;  1I7F A;  4TUY B;  4DR3 B;  3HKE A;  3THO A;  2JVD A;  2ZIM A;  5LA6 A;  5LP6 A;  4GKJ B;  4DUZ B;  3VQW A;  4UCR A;  5GON A;  3HKC B;  3OTO B;  4X1Y B;  3K59 A;  3OEH H;  4BW9 A;  2F4V B;  4FM2 A;  3N2K B;  3SJA C;  5ITZ B;  2ZIO A;  1V9P A;  2YXL A;  2R9A A;  5CA0 A;  3K58 A;  3U10 A;  1SQG A;  4DV1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...