2RQ6A

Solution structure of the epsilon subunit of the f1-atpase from thermosynechococcus elongatus bp-1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
138
structure length
138
Chain Sequence
MVMTVRVIAPDKTVWDAPAEEVILPSTTGQLGILSNHAPLLTALETGVMRVRQDREWVAIALMGGFAEVENNEVTILVNGAERGDTIDLEKAKAEFAAAQAALAQAEQGESKQAKIQATQAFRRARARLQAAGGVVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the intrinsic inhibitor subunit epsilon of F1-ATPase from photosynthetic organisms.
pubmed doi rcsb
molecule keywords ATP synthase epsilon chain
molecule tags Hydrolase
source organism Thermosynechococcus elongatus
total genus 24
structure length 138
sequence length 138
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00401 ATP-synt_DE ATP synthase, Delta/Epsilon chain, long alpha-helix domain
A PF02823 ATP-synt_DE_N ATP synthase, Delta/Epsilon chain, beta-sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2rq6A02
2.60.15.10 Mainly Beta Sandwich ATP Synthase; domain 1 F0F1 ATP synthase delta/epsilon subunit, N-terminal 2rq6A01
4CS2A 2ZNJA 1E79H 2XNDH 3FKSH 3OE7H 2R70A 1O9HA 4YXWH 2YIBD 2RQ7A 2ZIMA 2WSSH 2E5YA 2HEPA 3ZEDA 1H8EH 3QTCA 5K1XA 4CH5A 1BSNA 2YI9A 2JVDA 2ZINA 4TQDA 4CH6A 2QE7H 3VQYA 4CS4A 5K1PA 3BHPA 1O9GA 2V7QH 3OFNH 2ZIOA 2YIBA 3DSQA 2RJZA 2E3CA 2Q7GA 3VQVA 1AQTA 5DN6I 2XOKH 3OAAH 5FL7H 2Q7HA 2PUSA 2YI8A 4TQFA 1G6UA 4CH4A 2HLDH 4CH3A 2ZCEA 4ZIBA 4Q6GA 4CS3A 2ZNIA 3OEHH 1BSHA 1FS0E 2RQ6A 2YIAA 3VQXA 3VQWA 4ASUH 2PGGA 2Q7EA 2R72A 4BWAA 4BW9A 2QJ1A
chains in the Genus database with same CATH superfamily
1CP9A 1SS3A 3FKSG 3KG2A 3QO5A 2LJ2A 5CA3A 2QE7H 5JCOC 3RYHA 2F4VB 1Y4MA 1COWG 3AEIA 4W4LA 3QNEA 4DV0B 1BMFG 3ABMC 4LFCB 4B3RO 1OCZB 4WBNB 1HR0O 3T4ZA 4K35A 4X66O 4JI3B 1XNQO 5DM6V 2UUAB 2B1GA 3ZHVA 3H1LH 4EFEA 5KX5A 2XOKH 3CS5A 1THZA 4ABMA 2CH7B 1FS0E 5F2VO 4GZRB 1N8RW 3EXAA 4X1KA 1G1XB 1CPYA 4QJFB 5L3BA 1M57B 4CS2A 1WA8B 3HKBA 1FXKA 2ZE7A 2RMKB 2D3OW 3JAMN 4HNAA 2QKAA 1DTOA 2ZE8A 3CWBH 2F1MA 4DV6B 1HWYA 1X59A 5DN6I 4RUEA 2IU0A 1EZJA 5H2FZ 1VQ9V 1FAFA 5LP6B 4LR3A 4DUYO 4X89A 5IJ0B 4UCVA 1FFXB 2OIGA 4TSFG 3ZMTA 3U10A 4JI6B 3CC2V 5E79Z 3F5TA 2UXBB 1IBMB 3OTOB 2CTRA 5CBFA 3ETGA 5KMGA 4DR4O 3RVZA 1FS0G 5J2TB 4O4HB 1NTKH 4DR7B 4K0KO 3CCSV 2RQ6A 3SDLA 1EN4A 2RN9A 1SKVA 4FLUA 2EZPA 2IM9A 1NVPD 4JYAB 3BPZA 3MHSC 2QKSA 4I4TA 3JD1A 1F51A 2ZINA 2EIMC 3H1IH 1GH6A 4EEQA 3GWOA 3FYEB 3ABLC 1QVFU 4X62B 2Y4TA 1TUBA 3JASB 3CRRA 3UO3A 3J80N 3TGUH 2EILC 2B9ZA 1IVSA 2WLLB 2EJRA 5EBWC 3RBZA 3T1HO 5CA0A 2RQ7A 5FNVA 1R1BA 5DEDA 2VQEO 2UUBB 4LF7B 1QNMA 1YITV 1RSOB 1I5YA 5FL7G 2LGWA 1XQ8A 2GSMB 4O2BA 4J42A 1SQFA 2LFSA 5J2UA 5EBLC 2F95B 3AK3A 3QG5A 1IX9A 4B3SB 5LOVA 2QTSA 3JD4A 1R3IC 3MDSA 1SQPH 2OCCC 4EKWA 3CMEV 2EIJC 1YF2A 2JJ2G 3M99B 4QE7A 2LO1A 4MSWC 1VQ6V 1OCRB 1SERA 2LW1A 2FB5A 2AZ0A 5L3CA 1R3LC 1VEWA 3JSNA 3JATA 2ZD9A 3K06A 2BOBC 4UV8A 1AI4A 2OT5A 4K8ZA 5B1BC 5JQGB 3UM7A 1GKFA 4UB8Z 3VQVA 1S0VA 4NXMO 3AK1A 2KG7B 1B3QA 1U96A 2DE0X 5EYPA 4JI3O 4BIZA 5GW7A 3D36C 5CMUA 1H2LA 2XNDG 2JRIA 4Z2WA 1VQKV 3PN1A 2GTAA 1Q81W 5LL6Y 1BL8A 1TUEB 1EM1A 2BCCH 4EB6B 2OTLV 1BHAA 3JARB 1XI1A 3K9AA 1BE3H 2PYJA 2YXYA 4I55B 2PZSA 5JCOA 5LYJB 4MTGA 2WSSH 2KQXA 3ASOC 3DTUB 2ZDIA 3ZRXA 5A9GA 4LFAB 2HHHO 2N04A 1L1FA 1I94O 3H1HH 2BSKA 4QIWF 4GKJB 3OD4A 2ARHA 3E22B 3JAKB 1NJIW 1R73A 1XNRB 1EBOA 2QEXV 3SPGA 2B1IA 5IY5B 1W59A 3RYCA 4UCOA 2JVDA 5JJEB 3UCSC 2QWRB 3K79A 1AQTA 3THOA 2VQFB 1V55C 5IWAB 2HJDA 4PD4F 3SJAC 1ZTEA 2GBOA 2LGQA 1KD1W 1K7DA 3G6BA 3GVMA 4YHHO 3H9VA 3FAVA 2Q8VA 2QWPB 4X1YA 3T1CA 5LMUB 1AR5A 1YEWA 1QLEC 1SQQH 4FJCC 1IBKB 3RYHB 2L35A 3D3IA 4DXWA 1MSWD 1IXMA 1NTMH 1GN6A 5IJ9B 3OAAG 3G71V 1XL6A 3E83A 5IYCO 3U11A 1XDCA 3OE7H 1IZ3A 2EIKB 1DLBA 3E86A 4DV7B 4UCSA 5IYZA 3K08A 4UVAA 3RT3C 4JI5O 1S77D 5J9PC 3AG2C 2VWKA 1VF7A 2V7QH 5EC2C 3TJTA 5KX5B 1PL4A 1AJQA 1GO3F 1K92A 4B3SO 3B8NA 3CCEV 3W7WA 2YEVB 2E74B 4KHPB 4K3AA 4X8AA 1FXKB 1ORQC 5B3SC 3ETDA 4PDRA 1EFRG 4IHJA 1H8EG 2ZXWB 1EN6A 3LDDA 3CRMA 2GHYA 3OMNB 4NB5A 3T1YO 3QO8A 3L72H 2UUCB 4LF4O 3O9OA 3ZCCA 3EVKA 3UO2A 4HBNA 1VIBA 1Q3EA 3RN4A 3CPWU 3P3PA 1PNLA 4BR6A 1L8DA 4O4IA 1QR8A 3AG3C 3OFNG 3CRCA 1YVWA 2BTQA 4WFHA 1G6UA 4JGSA 5C8YA 1M56B 2A7WA 3AG1B 1SA0A 2H8PC 2XUMA 4J11A 1JR9A 3OEEG 2DJVA 5B5EZ 1LR1A 2WLLA 5H5NA 4DR1O 4I4TB 2KSDA 4Q20A 2ZKOA 4LH6A 4B3RB 1HR0B 5JWPA 3LDCA 4X66B 1TUBB 1IURA 1AJNA 1XNQB 3CCRV 2DYRC 3B2EE 1SQGA 2HJFC 4B08A 1VQMV 1JVMA 3BY6A 1GN4A 1H2MA 5CA0B 4GKJO 1B6QA 4UB6Z 3ZHSA 2DW4A 2X0LA 2OYQA 3E8BA 4MTFA 4O4LA 1KYOF 4KXRA 4O2AA 3JD2A 3CP1A 3ABKB 4O2BB 4LH7A 3WB1A 2DMXA 1NZ6A 5B1AC 5J2UB 4RQFA 5A2QN 1YSCA 4PJ0Z 3K5NA 2ILMA 2WA3A 1OCOC 3WG7B 3E35A 4A5UB 4DUYB 2YXLA 2QWNB 4NTWA 2P06A 4OPHA 1GRJA 1URFA 3BAAA 2JS5A 2CTQA 1XHZA 4I7ZB 4FLYA 3CHXA 1YZBA 5JH7A 3JATB 2KG7A 4AILC 1IBKO 3TXSA 4DR4B 1E79G 5BR8O 4F6RA 4K0KB 5H6RA 3SJCC 2G38A 5LGTA 3AG4B 4H33A 4FPPA 4UV9A 3HB3B 3ZHQA 2Q69A 4FM0A 2Q7HA 2NLJC 1S76D 5LMNO 1T5EA 5EYPB 4NKGB 1RM1B 3OEHH 1OZ0A 2JEXA 3HKEA 3JARA 2QM8A 2Q7EA 1V54B 4P9OA 5LGNA 4I55A 5AG2A 3SPHA 5LYJA 2PI5A 1AVMA 1PNKA 1BHBA 1GAXA 3T1HB 1JQ0A 3OR6C 4LFBO 1Y6XA 4JF3A 3K57A 1P7GA 2VQEB 4TV8B 4QGPA 3JAKA 4DW1A 1I08A 3SJBC 2DWEC 1ROPA 2W6JG 1QCEA 3R65A 4JI1O 3CRAA 3EHBB 5KUMA 3CC7V 1ZWIC 1L0LH 1K8AW 1PL0A 1Q6HA 4KP4A 1IXBA 3ABMB 4ZHQB 3B8MA 4NTXA 2XAFA 1H38A 5BXZA 2LFRA 3K59A 1S3JA 3CB2A 2ZM6O 2DQ0A 3SYQA 1WJZA 3B09A 4W4KA 4BW9A 1S72V 2WLMA 4JZ2A 1NTZH 2WLNA 4QPJA 1AI6A 3CCUV 1UPGA 1E1RG 3RYCB 4JYCA 1XMQO 4OGQB 1VQOV 1KC8W 1PNMA 2NN4A 4PI2A 2PI4A 2Q68A 4JAAA 2QM7A 1YTFD 2IU3A 2CAZC 1GK9A 3TETA 5B1OA 5IJ9A 4I0XA 2Y69C 3WU2Z 3BABA 1XMOO 3G67A 3FAVB 1F23A 4NXMB 4BIOA 4WF9V 2F23A 3ZIAG 4GLXA 4X1YB 3ZHTA 2HFEC 1JX9A 3ZEDA 1Q82W 2V4DA 2A06H 1M1KW 4MTOA 5B1NA 3N2GB 1YI2V 2HVJC 4MVUA 4JI2O 1QBZA 4Q6GA 4MVZA 1VQ4V 3E8HA 5DECA 2YEVA 4FZ0A 4FFBA 2YIBD 5IYZB 4UXNA 3I56V 1KKCA 4WFAV 3WB0A 5LGUA 1YIJV 3ASNB 2P7TC 1SETA 4J41A 5JJNB 2HHHB 1VP7A 4DK0A 1I94B 4CC6A 2GV9A 3L75H 4JI7O 1XEQA 5IYBO 4IHJB 2Z0AA 1VQ5V 4PA4A 3IC7A 4D7SA 1JJ2U 4G28B 4MTXA 1NS1A 2QTOA 4OX9O 3ZBHA 1MMMA 4NYKA 4O4IB 1GM7A 2JGDA 2E76B 1OV9A 4YHHB 1EN5A 2BTQB 3X2QB 5C8YB 4TQFA 2NNUA 3L70H 1SA0B 4FM2A 4AI8A 2Z3YA 2P5OA 2EIJB 4YXWH 3L73H 3STZC 4PA7A 2ADPA 3WFVA 1TGOA 5LP6C 4PA3A 2YUAA 4AHCA 4PELA 1M93A 3I55V 1K33A 1R6NA 3BVOA 2P22C 4TT3G 4FVMA 1YCIA 1ZAUA 3ZRWA 4H44B 3CCQV 1Q7YW 3FB6C 3H1KH 1AB3A 4BIUA 4JI5B 4IT5A 4QNHB 5B1BB 2EJ7A 2WAMA 1MA1A 2XAJA 4DV1O 2R9AA 2QSAA 1AI5A 2NR5A 4IYHA 3CSXA 4ICGA 4O4LB 4PA9A 1US6A 3HPLC 1AJPA 1S5HC 3ICXA 4JI0O 3JAWA 1DF4A 3N2KA 4O2AB 2JEUA 2M6YA 1XBLA 3J7AU 2E5LO 4P9PA 4DV4O 4GKKO 1HNZO 4MS2A 3T1YB 1I0HA 1PP9H 4DW0A 4O4JB 3MAQA 4J10A 3FKSH 2XHBA 1JMKC 1XL4A 1DK1A 4IYIA 2AW9A 4LF4B 2FL4A 1KQSU 2FKXA 4E2LA 2LQTA 1NVPB 4JYYA 1N0JA 4NVPA 3QO7A 1N34O 3ASOB 4WFGA 1RPRA 5JH7B 2RDCA 4DR2O 3KZIZ 2HLDG 1SZTA 4F6RB 3TK1A 1JCHA 2YC0A 2ZR2A 2Q9LA 3CC4V 3RWRD 2JGUA 2P4KA 4DR1B 1TVKB 1N33O 3HKEB 3T2MA 4FIPC 2M7WA 4TV8A 4GX2A 3GB7C 2E3CA 3JSLA 5LHIA 4FLXA 2Y0IA 4TUYA 4UCUA 1F4MA 2L6LA 1OCRC 1V55B 1M4UA 3RYIB 1RPOA 1XILA 3CCVV 2Q4PA 4ZHQA 4FLZA 1BQ0A 5H6QA 2AGAA 2HP8A 2A79B 3JD0A 2ATKC 2YI8A 4OPAA 4CS3A 1CXZB 1K34A 1QLEB 4XDKA 5LA6A 4X20A 1AROP 3OUFA 2H3OA 3FB7C 1R6TA 1P7BA 1R3KC 3ETEA 2W0FC 2WPDG 3NR7A 3G4SV 4CH5A 2W6IG 1Y66A 2W0XA 4FFKA 3Q4HA 4CH6A 1NH2D 1KKDA 1PD3A 3SYPA 4FM1A 1KBHA 3D3QA 2IJJA 1BGYH 1QLNA 4JAVA 4UCRA 2ZE6A 4I50A 1OCCC 2QR4A 2OTJV 5ITZA 3M8AA 2XT9A 1B06A 2AXTZ 4JTCB 4DV3B 4N21A 4H0LB 5BR8B 3RGBA 4X88A 4I0XB 3N2GA 3ZRVA 3S3XA 2ZQMA 3C90A 2P4VA 1OHHG 4DR6O 5LMNB 1GM8A 1GM9A 2BOCC 3GWKC 1N36O 1NR1A 1V9PA 3CCLV 3HKDA 4PA6A 1MABG 5FL7H 1SQXH 5IY5C 4HYOA 3DGEA 2E75B 5CA1A 2R9IA 5FPRA 1JFFB 3ZS8C 4FFBB 4PDVA 4LFBB 4IL6Z 1H8HG 5EIBD 2ITCC 5CBHA 3OW2U 4JI1B 3QF7A 2BE3A 4QPKA 3F7YC 5BMVA 1LUVA 4ZIBA 4RWUA 1W0KG 5FLXN 2OWOA 4LF6O 3OTFA 4X1IA 1YJWV 2ZM6B 5KLVH 2UU9O 5CB4B 4X64O 4LC1A 3DSQA 5IYDO 3ZN1A 2X6BA 1QHTA 2EIKC 3OMIB 4DK1A 1XMQB 2DQ3A 3M7MX 4YY3O 4MW3A 4PV1B 4X65B 1ZL8A 1XHXA 3G80A 2Q0OC 4I9WA 2IW5A 4LF5B 2XNDH 1WAZA 1WPBA 2KKWA 2JGDB 1JOYA 1XMOB 1CEZA 2Q73A 5B1AB 2QE7G 1TAEA 1FXKC 4RAIA 2YIBA 3U0ZA 4WFEA 1VARA 2K9PA 3MHHC 1WPXA 2WLHA 2DYSB 1QVGU 4LF8O 3SPCA 5GTIZ 4JI2B 3ZX6A 2QDOA 5GONB 3SYOA 5BY1A 4J7ZA 3K9SA 1FYJA 2Q6AA 3ZRWB 3S3WA 3D36A 1S5LZ 2XOKG 2Q5ZA 1AR4A 5L3DA 3HR0A 1PV0A 3JYCA 1J5EO 5LHHA 2MW2B 2YDEA 3ML0A 4JTDB 4NXNO 4O4JA 5FPOA 3OGIB 3JAWB 4JI7B 4DUZO 3N2KB 2B5UA 2X7RB 2F43G 4E4EA 4DV5O 1VQLV 3WB2A 1YDXA 3IGAC 4UVCA 2UXCO 4P30A 5EIBC 4DV2O 4DV3O 2UXNA 3OGCC 2QM4A 3A0RA 3SPJA 1HNXO 3P30A 4OX9B 4L8JA 4EFBA 3OAAH 4ZI7A 4IGGA 2VS0A 4XBFA 1TVKA 2YXHA 2EINC 5D5PA 2PYLA 2PGGA 5KHHA 4ZKIA 3P32A 2R70A 5CN0A 4H37A 2AHZA 3RYIA 1KUQA 5IE9A 1HP8A 4KL1A 3I5DA 2P90A 1NR7A 3ZHUA 4MVOA 1SQBH 1YHQV 2ZT9B 3E8FA 4L87A 3CXHF 1R6KA 5KHGA 2GDSA 1D5AA 1KU9A 2O57A 4TUYB 4YXWG 1N32O 3SJQC 2EBOA 2XAQA 2OCHA 3RW0A 2IJKA 2Y69B 3STLC 4FMTA 4DV1B 4AQYB 2ZR3A 4YJ3A 1LNQA 2RJZA 2WWWA 4U7NA 4UCTA 3BCCH 3CRQA 3T4DA 4X20B 5LA6B 4JI0B 4MVMA 4JPRA 3AG4C 2JIZG 3DC6A 1M90W 3ZMSA 2E5LB 1A32A 1N4CA 2CGNA 4DV4B 1Y67A 1JA8A 1Z5VA 4GKKB 3C3SA 1HNZB 1RM1C 1PPJH 1Q43A 2JK5C 3Q4HB 2UXDO 3OFNH 2RNBA 4X65O 3UQ8A 1K9MW 2VRZA 4I9QA 1E1QG 4LF5O 1PM9A 5IT9N 4I50B 3NXSA 4ZOLB 3FX7A 4DR3O 3TCUA 1N34B 1AR1B 5ITZB 1LUWA 2WLIA 3APQA 3QTCA 4DR2B 4YIPA 1MZEA 4TV9A 2ZIOA 1WP7A 3N27A 3RYFA 2ZDIC 4GT1A 2F66C 3K03A 3W7UA 3B40A 3KCXA 4U3JB 1KECA 1Y74B 3OUSA 2QJ1A 1JFFA 1S5JA 1Z2GA 4MVSA 4B3TO 1N33B 1ZLZA 3F7VC 4DR5O 1DF5A 5GTHZ 4PI0A 3SYAA 3HKDB 3P3NA 1FJGO 3AG7A 3JD3A 1H2NA 5L3FA 4RO2A 5CA1B 1QQCA 3ZRSA 2QKCA 4J80A 2EIMB 3H1JH 4JASA 5H9CA 1HNWO 4JV5O 4JTAB 3FYIB 5EK0A 3CXCU 3ABLB 4F4LA 1QR9A 2WSSG 4FK5C 1P84F 3SR2C 1J95A 5HFMA 3DXRA 2IH3C 3H01A 4LF9O 5CB4A 2EILB 1OCZC 3A8TA 5BMVB 1K5SA 1B04A 1XUQA 3K0GA 1BSHA 1BCCH 3LSUA 4ASUH 1Q8IA 4X1IB 1VQPV 1YTFB 1BS3A 1GN3A 4GX0A 1E79H 1P49A 4C7UA 2HEPA 2XASA 4B3MO 4X9QA 2CTPA 3CE2A 3HKCA 1M57C 4MW8A 4LP8A 2XTAA 1IDSA 3LNNA 1IBLO 1JPXA 3O65A 3PJSK 4JI4O 4NTYA 1ZL8B 1WNSA 2V1DA 4J7KA 2OCCB 3ASNC 3VBBA 1FPOA 2ADQB 4J9ZB 4JZGA 1K5QA 4KUMA 4JI8O 3K3WA 2JS3A 4QE9A 5GONA 5L3EA 3K0DA 4GX1A 4DR6B 1AP5A 3W7TA 3LNMB 1AP6A 1N36B 3CJHA 4GYCB 2QWQB 2YIAA 1NKDA 2HVKC 2DWDC 5L3GA 4AQYO 2GUZA 4LNUA 3OE7G 2AZ2A 4DRXA 1M5IA 2E5YA 3G6EV 2H94A 4R8CA 3JCUZ 4YJ2B 1KMIZ 2WLJA 2V7QG 4WFFA 3R66A 3OMAB 5C93A 5KHKA 1U97A 5DN6G 2DN9A 2F93B 1PKXA 2XAGA 3DC5A 4LWSA 2Y4UA 1UJWB 2A3QA 1N0NA 1RP3B 2ETNA 3A2FA 3BRCA 3X2QC 2ZNJA 4N23A 3CYOA 3CCJV 2LP7A 2UXXA 4WFBV 4FLTA 4LF6B 3ZMZA 5LXTB 2YSUB 3IAYA 1Q5OA 4R7CA 2UU9B 2RCVA 4CC5A 4J7JA 4FLWA 2FMLA 2X6AA 4X64B 3VQWA 2GTSA 3L9DA 2Q0AA 4GUNA 5KHIA 3BFRA 4Z1VA 3APOA 2F4VO 2CTWA 1WB7A 4YY3B 2K1EA 4NR1A 1FXHA 3B4SA 4DV0O 4PDLA 5JVDA 2IJIA 4LFCO 4I5SA 1KB9F 4ZI7B 4MVRA 2Z5UA 4CH4A 3W7SA 4TWKA 1VF6C 3ABTA 3VQXA 3UT5A 3KKYA 2UUAO 2VWJA 3FFQA 1BZKA 4LBEC 4CZZA 4Z1MG 1G8MA 3JALA 3C3TA 2YI9A 5KHJA 4LF8B 1GN2A 2PTMA 1OCCB 2X6CA 1JJOA 2CK3G 1SC5B 5EC1C 2R72A 1Y76B 4BWAA 3CEIA 5HFLA 1YJNV 2CDYA 4DV6O 1O9HA 3IJ4A 1NBMG 4KFMA 1SRYA 2CUGA 1NQTA 3LDEA 1J5EB 2HG5C 4B7EA 3CD6V 1AILA 1M9NA 2YIDA 4YJ3B 1K4DC 3VOUA 3BA9A 1O9GA 4GX5A 5EZYB 3BA8A 3E89A 3A0BZ 3ZN0A 4K8XA 1FXVA 4NXNB 1ENVA 4DUZB 4JI6O 3AG2B 4ZOLA 4IIJB 4DV5B 2UXBO 1IBMO 1TA8A 3L74H 3OTOO 3ABUA 3A0HZ 4UFZA 3RVYA 1WB8A 5K1XA 2UXCB 4DR7O 5CBGA 4DV2B 3KCYA 1W2BU 1K3EA 5B3SB 1VQ7V 1Q90D 3IFXA 3ZHRA 4P2ZA 1F4NA 2FTKA 1OJHA 2ZNIA 4JYAO 1HNXB 2MK3A 3LSQA 3FD9A 3F5WC 4HAMA 4U3JA 1KP2A 1Y74A 4WBNA 2WLIB 3K04A 2N05A 1H2SB 4G2KA 4X62O 4WCEV 1FD9A 4UVBA 4TV9B 2P6JA 3RYFB 3UKMA 3OEHG 1L0NH 2CH7A 3AG3B 2JJ1G 2UUBO 4FLVA 4LF7O 5KA6A 1I7FA 2DOSA 1WA8A 1Q6UA 4MVQA 4U3FH 4PHZA 2ZIMA 2ZE5A 4TOIA 2D2CB 2EZOA 4RUFA 3B77A 3AK2A 1I5XA 1ZUQA 1N32B 3ZMVA 1K97A 4XDLA 4X1KB 1WN7A 1NH2B 3K5LA 1HDJA 2N74A 4G27B 4ZBMA 4PDMA 2JDIG 5LP6A 3HKBB 1P4RA 1W0JG 1K73W 5IJ0A 5BZBA 3RFRA 4HNAB 1FFXA 1WP8A 1AI7A 2DYRB 3DXRB 4CBCA 1GTOA 1QU7A 3QVNA 4BW5A 1KP3A 3SYCA 5KA5A 4D6TH 4B7KA 5J2TA 4O4HA 1BT8A 2UXDB 4DO2A 1SZXA 2IBZH 2HLDH 4FZ1A 1D2DA 1MNGA 2KB1A 1Q86W 4DR3B 3HKCB 1Q6IA 1BSNA 2XAHA 4TQDA 5KMGB 4CS4A 2EX3A 2Y0PA 2A9HA 1RFYA 3SPIA 2IJHA 2HKOA 2BTOA 2QA4V 2ZXWC 1ZX3A 1OCOB 1NT2B 3JASA 2ODMA 2OIEA 3CMAV 3IC9A 1FKAO 1Z5WA 4D7TA 3OT7A 3LUTB 2AHYA 4F6EA 1H2GA 2QWOB 1XREA 4OXSA 5K1PA 3BHPA 5JJJB 4XDJA 4B3TB 2Q67A 4YJ2A 1BQZA 3JCZA 2LW7A 1EZVH 2YICA 4DR5B 3CJHB 1RSOA 1XOUA 4U7OA 2A0LA 5LHGA 1SQVH 1FJGB 4LFAO 3K5MA 3FB5C 2GUZB 4LNUB 5FNVB 4DRXB 1MG1A 3ZJZA 3E8GA 4BAYA 2EULA 1M56C 2EINB 3EFFK 1VF6A 3SGIA 5TISZ 3AG1C 1FFTB 1HNWB 4JV5B 5LXTA 1X4TA 1SESA 1XNRO 1K4CC 4LWSB 5IDJA 1NI8A 4LF9B 1VQ8V 2ITDC 3J81N 2Q7GA 5LOVB 3OM3B 3L71H 1D5NA 4GCZA 3ETQA 1UFIA 3W7XA 4MT8A 5D5QA 1R3JC 2VQFO 3E2EA 2CGOA 2CE4A 5IWAO 2DYSC 4HZ3A 4RQEA 2PY5A 5JQGA 5KUKA 3ZMUA 4B3MB 1H2KA 4ASUG 5LMUO 2Y48A 2FYUH 5KAFZ 5B66Z 1IBLB 5EBMC 4JI4B 3ABKC 1MSDA 1BSMA 1SF9A 5JVDB 3CCMV 4JI8B 4H13B 2R9RB 4EB6A 4YIOA 4CH3A 3UT5B 3WG7C 1MZFA 1VMGA 4DV7O 1YJ9V 3CX5F 1ZSPA 1WLEA 1F7YA 3TXQA 1Y76A 2WA4A 1G4YB 2YS8A 3JALB 1GMGA 1VQNV 5LBQA 3LSSA 2P67A 1H8EH 1DGSA 2WLKA 4DYLA 4UUJC 3VQYA 3K5OA 3D8CA 3FB8C 2HR3A 4KHPO 1MOFA 2PF4E 4LCUC 5EZYA 3OR7C 4R50A 2ZCEA 4JAUA 3E22A 4J9YB 2PUSA 1HW7A 1VF5B 1YXBA 1NU1H 4IIJA 2QGNA 4JYBA 2BSKB 5KAIZ 2UUCO 3MD0A 1V54C 3BEHA 3K58A 2IH1C 2C2AA 4R6ZA 5E1AC
chains in the Genus database with same CATH topology
5CA0B 4LNUA 5ITZA 4DRXA 1M5IA 2E5YA 2OYQA 4O4LA 4YJ2B 1KMIZ 2QE7H 4DV3B 5JCOC 3RYHA 2F4VB 5BR8B 3RGBA 5KHKA 4O2AA 2F93B 4LH7A 4O2BB 3N2GA 3WB1A 4DV0B 5J2UB 4LFCB 4WBNB 3A2FA 3BRCA 3K5NA 2ZNJA 5LMNB 4JI3B 4FLTA 2UUAB 4LF6B 4DUYB 2YXLA 5LXTB 1V9PA 3IAYA 3HKDA 1Q5OA 2UU9B 4CC5A 4EFEA 5KX5A 5FL7H 2XOKH 3BAAA 2JS5A 4FLWA 4X64B 5CA1A 1FS0E 1XHZA 5FPRA 3VQWA 4X1KA 4FLYA 1JFFB 3CHXA 3ZS8C 5JH7A 2Q0AA 3JATB 5KHIA 4AILC 4CS2A 4FFBB 4DR4B 3HKBA 4LFBB 5EIBD 4F6RA 4HNAA 4YY3B 4K0KB 2F1MA 3SJCC 5JVDA 4JI1B 3QF7A 4DV6B 4ZI7B 5BMVA 5DN6I 4FM0A 2Q7HA 4CH4A 1T5EA 4ZIBA 5EYPB 3OEHH 5LP6B 4LR3A 3HKEA 3VQXA 3UT5A 3JARA 2OWOA 5IJ0B 2Q7EA 3OTFA 4UCVA 2VWJA 3FFQA 4X1IA 1FFXB 2ZM6B 4I55A 3U10A 4JI6B 5LYJA 3JALA 5CB4B 2YI9A 5KHJA 4LF8B 2UXBB 2PTMA 1IBMB 3OTOB 3T1HB 5KMGA 3DSQA 1QHTA 5J2TB 1JJOA 4DK1A 4O4HB 3K57A 2VQEB 1XMQB 4TV8B 3M7MX 4DR7B 2RQ6A 3JAKA 4X65B 1XHXA 2R72A 4BWAA 3SJBC 1SKVA 4FLUA 4LF5B 2XNDH 1WPBA 2IM9A 1O9HA 4JYAB 2KKWA 3BPZA 4I4TA 1XMOB 4ZHQB 1J5EB 2ZINA 4YJ3B 1TAEA 3BA9A 1O9GA 5EZYB 3BA8A 4EEQA 3K59A 2YIBA 3CB2A 4X62B 4K8XA 4NXNB 3U0ZA 1TUBA 3JASB 4DUZB 4BW9A 4ZOLA 4IIJB 4DV5B 1TA8A 4JI2B 5GONB 5CA0A 2RQ7A 5FNVA 4UFZA 3RYCB 5K1XA 2UXCB 2UUBB 4DV2B 4PI2A 4LF7B 2CAZC 5IJ9A 1XQ8A 4O2BA 2ZNIA 1SQFA 3BABA 1HNXB 5J2UA 4U3JA 2F95B 4WBNA 3QG5A 4NXMB 4B3SB 5LOVA 4GLXA 4X1YB 1H2SB 4O4JA 3ZEDA 5FPOA 3JAWB 4JI7B 2V4DA 3N2KB 4TV9B 3RYFB 3N2GB 3WB2A 4Q6GA 5EIBC 3JSNA 4FLVA 3JATA 1I7FA 4FFBA 2YIBD 4PHZA 2ZIMA 5IYZB 4TOIA 4K8ZA 5JQGB 2QM4A 3WB0A 4OX9B 4L8JA 1N32B 4EFBA 3VQVA 5JJNB 3OAAH 4ZI7A 4X1KB 1WN7A 1TVKA 3K5LA 2HHHB 4DK0A 1I94B 4CC6A 2GV9A 5D5PA 5EYPA 5LP6A 2PYLA 2PGGA 3HKBB 5KHHA 5IJ0A 3RFRA 4HNAB 4IHJB 1FFXA 2R70A 3RYIA 3PN1A 4KL1A 4D7SA 4EB6B 3JARB 1XI1A 5J2TA 4O4HA 5KHGA 2UXDB 1D5AA 1KU9A 2PYJA 2HLDH 4TUYB 4I55B 2PZSA 5JCOA 5LYJB 2WSSH 4O4IB 4DR3B 4LFAB 3HKCB 1BSNA 4DV1B 4TQDA 5KMGB 4AQYB 4CS4A 4YHHB 2EX3A 4YJ3A 4GKJB 2BTQB 2RJZA 4UCTA 5C8YB 4TQFA 3E22B 3JAKB 2BTOA 4X20B 1SA0B 1NT2B 3JASA 5LA6B 4FM2A 4JI0B 1XNRB 2E5LB 1Z5WA 4D7TA 2P5OA 4YXWH 4DV4B 1Z5VA 4GKKB 1TGOA 1HNZB 5LP6C 1Q43A 3RYCA 4UCOA 2JVDA 5JJEB 4AHCA 1M93A 5K1PA 3BHPA 5JJJB 3OFNH 4B3TB 3UQ8A 4YJ2A 2P22C 4FVMA 4I9QA 3THOA 1AQTA 1ZAUA 2VQFB 4DR5B 1RSOA 4JI5B 5IWAB 4I50B 4ZOLB 1FJGB 3SJAC 3K5MA 4LNUB 5FNVB 2R9AA 1N34B 5ITZB 4DRXB 4X1YA 3CSXA 5LMUB 4O4LB 1YEWA 3QTCA 4DR2B 3SGIA 3ICXA 1IBKB 3RYHB 1HNWB 3JAWA 4JV5B 5LXTA 1X4TA 3N2KA 4O2AB 4TV9A 2ZIOA 3RYFA 5IJ9B 2F66C 4LF9B 4U3JB 3T1YB 2Q7GA 5LOVB 2QJ1A 1JFFA 3U11A 1S5JA 3ETQA 4O4JB 3MAQA 1N33B 3FKSH 2XHBA 3OE7H 1JMKC 5D5QA 4DV7B 4UCSA 5IYZA 4LF4B 4PI0A 3HKDB 2PY5A 2VWKA 1VF7A 5JQGA 2V7QH 5KX5B 4NVPA 4B3MB 5CA1B 1QQCA 5JH7B 4KHPB 1IBLB 4F6RB 4JI4B 4IHJA 3SR2C 5JVDB 3RWRD 2JGUA 5CB4A 4JI8B 5BMVB 4DR1B 1B04A 1TVKB 4EB6A 4CH3A 3HKEB 3UT5B 1BSHA 2UUCB 4TV8A 4ASUH 1Q8IA 4X1IB 2E3CA 3JSLA 4FLXA 4TUYA 1E79H 4HBNA 4UCUA 1Q3EA 1M4UA 3RYIB 3JALB 1P49A 2HEPA 1H8EH 1DGSA 1L8DA 4O4IA 3HKCA 3VQYA 4ZHQA 3K5OA 4FLZA 2BTQA 3LNNA 5EZYA 2YI8A 1G6UA 5C8YA 2ZCEA 3E22A 4CS3A 1WNSA 4X20A 1SA0A 5LA6A 2PUSA 1HW7A 4IIJA 4I4TB 5GONA 4LH6A 4B3RB 4CH5A 1HR0B 4CH6A 4FM1A 4DR6B 4X66B 3K58A 1TUBB 1XNQB 1N36B 4UCRA 4GYCB 3B2EE 2YIAA 4I50A 1SQGA 4B08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS2 A;  2ZNJ A;  1E79 H;  2XND H;  3FKS H;  3OE7 H;  2R70 A;  1O9H A;  4YXW H;  2YIB D;  2RQ7 A;  2ZIM A;  2WSS H;  2E5Y A;  2HEP A;  3ZED A;  1H8E H;  3QTC A;  5K1X A;  4CH5 A;  1BSN A;  2YI9 A;  2JVD A;  2ZIN A;  4TQD A;  4CH6 A;  2QE7 H;  3VQY A;  4CS4 A;  5K1P A;  3BHP A;  1O9G A;  2V7Q H;  3OFN H;  2ZIO A;  2YIB A;  3DSQ A;  2RJZ A;  2E3C A;  2Q7G A;  3VQV A;  1AQT A;  5DN6 I;  2XOK H;  3OAA H;  5FL7 H;  2Q7H A;  2PUS A;  2YI8 A;  4TQF A;  1G6U A;  4CH4 A;  2HLD H;  4CH3 A;  2ZCE A;  4ZIB A;  4Q6G A;  4CS3 A;  2ZNI A;  3OEH H;  1BSH A;  1FS0 E;  2RQ6 A;  2YIA A;  3VQX A;  3VQW A;  4ASU H;  2PGG A;  2Q7E A;  2R72 A;  4BWA A;  4BW9 A;  2QJ1 A; 
#chains in the Genus database with same CATH topology
 1CP9 A;  1SS3 A;  3FKS G;  3KG2 A;  3QO5 A;  2LJ2 A;  5CA3 A;  2QE7 H;  5JCO C;  3RYH A;  2F4V B;  1Y4M A;  1COW G;  3AEI A;  4W4L A;  3QNE A;  4DV0 B;  1BMF G;  3ABM C;  4LFC B;  4B3R O;  1OCZ B;  4WBN B;  1HR0 O;  3T4Z A;  4K35 A;  4X66 O;  4JI3 B;  1XNQ O;  5DM6 V;  2UUA B;  2B1G A;  3ZHV A;  3H1L H;  4EFE A;  5KX5 A;  2XOK H;  3CS5 A;  1THZ A;  4ABM A;  2CH7 B;  1FS0 E;  5F2V O;  4GZR B;  1N8R W;  3EXA A;  4X1K A;  1G1X B;  1CPY A;  4QJF B;  5L3B A;  1M57 B;  4CS2 A;  1WA8 B;  3HKB A;  1FXK A;  2ZE7 A;  2RMK B;  2D3O W;  3JAM N;  4HNA A;  2QKA A;  1DTO A;  2ZE8 A;  3CWB H;  2F1M A;  4DV6 B;  1HWY A;  1X59 A;  5DN6 I;  4RUE A;  2IU0 A;  1EZJ A;  5H2F Z;  1VQ9 V;  1FAF A;  5LP6 B;  4LR3 A;  4DUY O;  4X89 A;  5IJ0 B;  4UCV A;  1FFX B;  2OIG A;  4TSF G;  3ZMT A;  3U10 A;  4JI6 B;  3CC2 V;  5E79 Z;  3F5T A;  2UXB B;  1IBM B;  3OTO B;  2CTR A;  5CBF A;  3ETG A;  5KMG A;  4DR4 O;  3RVZ A;  1FS0 G;  5J2T B;  4O4H B;  1NTK H;  4DR7 B;  4K0K O;  3CCS V;  2RQ6 A;  3SDL A;  1EN4 A;  2RN9 A;  1SKV A;  4FLU A;  2EZP A;  2IM9 A;  1NVP D;  4JYA B;  3BPZ A;  3MHS C;  2QKS A;  4I4T A;  3JD1 A;  1F51 A;  2ZIN A;  2EIM C;  3H1I H;  1GH6 A;  4EEQ A;  3GWO A;  3FYE B;  3ABL C;  1QVF U;  4X62 B;  2Y4T A;  1TUB A;  3JAS B;  3CRR A;  3UO3 A;  3J80 N;  3TGU H;  2EIL C;  2B9Z A;  1IVS A;  2WLL B;  2EJR A;  5EBW C;  3RBZ A;  3T1H O;  5CA0 A;  2RQ7 A;  5FNV A;  1R1B A;  5DED A;  2VQE O;  2UUB B;  4LF7 B;  1QNM A;  1YIT V;  1RSO B;  1I5Y A;  5FL7 G;  2LGW A;  1XQ8 A;  2GSM B;  4O2B A;  4J42 A;  1SQF A;  2LFS A;  5J2U A;  5EBL C;  2F95 B;  3AK3 A;  3QG5 A;  1IX9 A;  4B3S B;  5LOV A;  2QTS A;  3JD4 A;  1R3I C;  3MDS A;  1SQP H;  2OCC C;  4EKW A;  3CME V;  2EIJ C;  1YF2 A;  2JJ2 G;  3M99 B;  4QE7 A;  2LO1 A;  4MSW C;  1VQ6 V;  1OCR B;  1SER A;  2LW1 A;  2FB5 A;  2AZ0 A;  5L3C A;  1R3L C;  1VEW A;  3JSN A;  3JAT A;  2ZD9 A;  3K06 A;  2BOB C;  4UV8 A;  1AI4 A;  2OT5 A;  4K8Z A;  5B1B C;  5JQG B;  3UM7 A;  1GKF A;  4UB8 Z;  3VQV A;  1S0V A;  4NXM O;  3AK1 A;  2KG7 B;  1B3Q A;  1U96 A;  2DE0 X;  5EYP A;  4JI3 O;  4BIZ A;  5GW7 A;  3D36 C;  5CMU A;  1H2L A;  2XND G;  2JRI A;  4Z2W A;  1VQK V;  3PN1 A;  2GTA A;  1Q81 W;  5LL6 Y;  1BL8 A;  1TUE B;  1EM1 A;  2BCC H;  4EB6 B;  2OTL V;  1BHA A;  3JAR B;  1XI1 A;  3K9A A;  1BE3 H;  2PYJ A;  2YXY A;  4I55 B;  2PZS A;  5JCO A;  5LYJ B;  4MTG A;  2WSS H;  2KQX A;  3ASO C;  3DTU B;  2ZDI A;  3ZRX A;  5A9G A;  4LFA B;  2HHH O;  2N04 A;  1L1F A;  1I94 O;  3H1H H;  2BSK A;  4QIW F;  4GKJ B;  3OD4 A;  2ARH A;  3E22 B;  3JAK B;  1NJI W;  1R73 A;  1XNR B;  1EBO A;  2QEX V;  3SPG A;  2B1I A;  5IY5 B;  1W59 A;  3RYC A;  4UCO A;  2JVD A;  5JJE B;  3UCS C;  2QWR B;  3K79 A;  1AQT A;  3THO A;  2VQF B;  1V55 C;  5IWA B;  2HJD A;  4PD4 F;  3SJA C;  1ZTE A;  2GBO A;  2LGQ A;  1KD1 W;  1K7D A;  3G6B A;  3GVM A;  4YHH O;  3H9V A;  3FAV A;  2Q8V A;  2QWP B;  4X1Y A;  3T1C A;  5LMU B;  1AR5 A;  1YEW A;  1QLE C;  1SQQ H;  4FJC C;  1IBK B;  3RYH B;  2L35 A;  3D3I A;  4DXW A;  1MSW D;  1IXM A;  1NTM H;  1GN6 A;  5IJ9 B;  3OAA G;  3G71 V;  1XL6 A;  3E83 A;  5IYC O;  3U11 A;  1XDC A;  3OE7 H;  1IZ3 A;  2EIK B;  1DLB A;  3E86 A;  4DV7 B;  4UCS A;  5IYZ A;  3K08 A;  4UVA A;  3RT3 C;  4JI5 O;  1S77 D;  5J9P C;  3AG2 C;  2VWK A;  1VF7 A;  2V7Q H;  5EC2 C;  3TJT A;  5KX5 B;  1PL4 A;  1AJQ A;  1GO3 F;  1K92 A;  4B3S O;  3B8N A;  3CCE V;  3W7W A;  2YEV B;  2E74 B;  4KHP B;  4K3A A;  4X8A A;  1FXK B;  1ORQ C;  5B3S C;  3ETD A;  4PDR A;  1EFR G;  4IHJ A;  1H8E G;  2ZXW B;  1EN6 A;  3LDD A;  3CRM A;  2GHY A;  3OMN B;  4NB5 A;  3T1Y O;  3QO8 A;  3L72 H;  2UUC B;  4LF4 O;  3O9O A;  3ZCC A;  3EVK A;  3UO2 A;  4HBN A;  1VIB A;  1Q3E A;  3RN4 A;  3CPW U;  3P3P A;  1PNL A;  4BR6 A;  1L8D A;  4O4I A;  1QR8 A;  3AG3 C;  3OFN G;  3CRC A;  1YVW A;  2BTQ A;  4WFH A;  1G6U A;  4JGS A;  5C8Y A;  1M56 B;  2A7W A;  3AG1 B;  1SA0 A;  2H8P C;  2XUM A;  4J11 A;  1JR9 A;  3OEE G;  2DJV A;  5B5E Z;  1LR1 A;  2WLL A;  5H5N A;  4DR1 O;  4I4T B;  2KSD A;  4Q20 A;  2ZKO A;  4LH6 A;  4B3R B;  1HR0 B;  5JWP A;  3LDC A;  4X66 B;  1TUB B;  1IUR A;  1AJN A;  1XNQ B;  3CCR V;  2DYR C;  3B2E E;  1SQG A;  2HJF C;  4B08 A;  1VQM V;  1JVM A;  3BY6 A;  1GN4 A;  1H2M A;  5CA0 B;  4GKJ O;  1B6Q A;  4UB6 Z;  3ZHS A;  2DW4 A;  2X0L A;  2OYQ A;  3E8B A;  4MTF A;  4O4L A;  1KYO F;  4KXR A;  4O2A A;  3JD2 A;  3CP1 A;  3ABK B;  4O2B B;  4LH7 A;  3WB1 A;  2DMX A;  1NZ6 A;  5B1A C;  5J2U B;  4RQF A;  5A2Q N;  1YSC A;  4PJ0 Z;  3K5N A;  2ILM A;  2WA3 A;  1OCO C;  3WG7 B;  3E35 A;  4A5U B;  4DUY B;  2YXL A;  2QWN B;  4NTW A;  2P06 A;  4OPH A;  1GRJ A;  1URF A;  3BAA A;  2JS5 A;  2CTQ A;  1XHZ A;  4I7Z B;  4FLY A;  3CHX A;  1YZB A;  5JH7 A;  3JAT B;  2KG7 A;  4AIL C;  1IBK O;  3TXS A;  4DR4 B;  1E79 G;  5BR8 O;  4F6R A;  4K0K B;  5H6R A;  3SJC C;  2G38 A;  5LGT A;  3AG4 B;  4H33 A;  4FPP A;  4UV9 A;  3HB3 B;  3ZHQ A;  2Q69 A;  4FM0 A;  2Q7H A;  2NLJ C;  1S76 D;  5LMN O;  1T5E A;  5EYP B;  4NKG B;  1RM1 B;  3OEH H;  1OZ0 A;  2JEX A;  3HKE A;  3JAR A;  2QM8 A;  2Q7E A;  1V54 B;  4P9O A;  5LGN A;  4I55 A;  5AG2 A;  3SPH A;  5LYJ A;  2PI5 A;  1AVM A;  1PNK A;  1BHB A;  1GAX A;  3T1H B;  1JQ0 A;  3OR6 C;  4LFB O;  1Y6X A;  4JF3 A;  3K57 A;  1P7G A;  2VQE B;  4TV8 B;  4QGP A;  3JAK A;  4DW1 A;  1I08 A;  3SJB C;  2DWE C;  1ROP A;  2W6J G;  1QCE A;  3R65 A;  4JI1 O;  3CRA A;  3EHB B;  5KUM A;  3CC7 V;  1ZWI C;  1L0L H;  1K8A W;  1PL0 A;  1Q6H A;  4KP4 A;  1IXB A;  3ABM B;  4ZHQ B;  3B8M A;  4NTX A;  2XAF A;  1H38 A;  5BXZ A;  2LFR A;  3K59 A;  1S3J A;  3CB2 A;  2ZM6 O;  2DQ0 A;  3SYQ A;  1WJZ A;  3B09 A;  4W4K A;  4BW9 A;  1S72 V;  2WLM A;  4JZ2 A;  1NTZ H;  2WLN A;  4QPJ A;  1AI6 A;  3CCU V;  1UPG A;  1E1R G;  3RYC B;  4JYC A;  1XMQ O;  4OGQ B;  1VQO V;  1KC8 W;  1PNM A;  2NN4 A;  4PI2 A;  2PI4 A;  2Q68 A;  4JAA A;  2QM7 A;  1YTF D;  2IU3 A;  2CAZ C;  1GK9 A;  3TET A;  5B1O A;  5IJ9 A;  4I0X A;  2Y69 C;  3WU2 Z;  3BAB A;  1XMO O;  3G67 A;  3FAV B;  1F23 A;  4NXM B;  4BIO A;  4WF9 V;  2F23 A;  3ZIA G;  4GLX A;  4X1Y B;  3ZHT A;  2HFE C;  1JX9 A;  3ZED A;  1Q82 W;  2V4D A;  2A06 H;  1M1K W;  4MTO A;  5B1N A;  3N2G B;  1YI2 V;  2HVJ C;  4MVU A;  4JI2 O;  1QBZ A;  4Q6G A;  4MVZ A;  1VQ4 V;  3E8H A;  5DEC A;  2YEV A;  4FZ0 A;  4FFB A;  2YIB D;  5IYZ B;  4UXN A;  3I56 V;  1KKC A;  4WFA V;  3WB0 A;  5LGU A;  1YIJ V;  3ASN B;  2P7T C;  1SET A;  4J41 A;  5JJN B;  2HHH B;  1VP7 A;  4DK0 A;  1I94 B;  4CC6 A;  2GV9 A;  3L75 H;  4JI7 O;  1XEQ A;  5IYB O;  4IHJ B;  2Z0A A;  1VQ5 V;  4PA4 A;  3IC7 A;  4D7S A;  1JJ2 U;  4G28 B;  4MTX A;  1NS1 A;  2QTO A;  4OX9 O;  3ZBH A;  1MMM A;  4NYK A;  4O4I B;  1GM7 A;  2JGD A;  2E76 B;  1OV9 A;  4YHH B;  1EN5 A;  2BTQ B;  3X2Q B;  5C8Y B;  4TQF A;  2NNU A;  3L70 H;  1SA0 B;  4FM2 A;  4AI8 A;  2Z3Y A;  2P5O A;  2EIJ B;  4YXW H;  3L73 H;  3STZ C;  4PA7 A;  2ADP A;  3WFV A;  1TGO A;  5LP6 C;  4PA3 A;  2YUA A;  4AHC A;  4PEL A;  1M93 A;  3I55 V;  1K33 A;  1R6N A;  3BVO A;  2P22 C;  4TT3 G;  4FVM A;  1YCI A;  1ZAU A;  3ZRW A;  4H44 B;  3CCQ V;  1Q7Y W;  3FB6 C;  3H1K H;  1AB3 A;  4BIU A;  4JI5 B;  4IT5 A;  4QNH B;  5B1B B;  2EJ7 A;  2WAM A;  1MA1 A;  2XAJ A;  4DV1 O;  2R9A A;  2QSA A;  1AI5 A;  2NR5 A;  4IYH A;  3CSX A;  4ICG A;  4O4L B;  4PA9 A;  1US6 A;  3HPL C;  1AJP A;  1S5H C;  3ICX A;  4JI0 O;  3JAW A;  1DF4 A;  3N2K A;  4O2A B;  2JEU A;  2M6Y A;  1XBL A;  3J7A U;  2E5L O;  4P9P A;  4DV4 O;  4GKK O;  1HNZ O;  4MS2 A;  3T1Y B;  1I0H A;  1PP9 H;  4DW0 A;  4O4J B;  3MAQ A;  4J10 A;  3FKS H;  2XHB A;  1JMK C;  1XL4 A;  1DK1 A;  4IYI A;  2AW9 A;  4LF4 B;  2FL4 A;  1KQS U;  2FKX A;  4E2L A;  2LQT A;  1NVP B;  4JYY A;  1N0J A;  4NVP A;  3QO7 A;  1N34 O;  3ASO B;  4WFG A;  1RPR A;  5JH7 B;  2RDC A;  4DR2 O;  3KZI Z;  2HLD G;  1SZT A;  4F6R B;  3TK1 A;  1JCH A;  2YC0 A;  2ZR2 A;  2Q9L A;  3CC4 V;  3RWR D;  2JGU A;  2P4K A;  4DR1 B;  1TVK B;  1N33 O;  3HKE B;  3T2M A;  4FIP C;  2M7W A;  4TV8 A;  4GX2 A;  3GB7 C;  2E3C A;  3JSL A;  5LHI A;  4FLX A;  2Y0I A;  4TUY A;  4UCU A;  1F4M A;  2L6L A;  1OCR C;  1V55 B;  1M4U A;  3RYI B;  1RPO A;  1XIL A;  3CCV V;  2Q4P A;  4ZHQ A;  4FLZ A;  1BQ0 A;  5H6Q A;  2AGA A;  2HP8 A;  2A79 B;  3JD0 A;  2ATK C;  2YI8 A;  4OPA A;  4CS3 A;  1CXZ B;  1K34 A;  1QLE B;  4XDK A;  5LA6 A;  4X20 A;  1ARO P;  3OUF A;  2H3O A;  3FB7 C;  1R6T A;  1P7B A;  1R3K C;  3ETE A;  2W0F C;  2WPD G;  3NR7 A;  3G4S V;  4CH5 A;  2W6I G;  1Y66 A;  2W0X A;  4FFK A;  3Q4H A;  4CH6 A;  1NH2 D;  1KKD A;  1PD3 A;  3SYP A;  4FM1 A;  1KBH A;  3D3Q A;  2IJJ A;  1BGY H;  1QLN A;  4JAV A;  4UCR A;  2ZE6 A;  4I50 A;  1OCC C;  2QR4 A;  2OTJ V;  5ITZ A;  3M8A A;  2XT9 A;  1B06 A;  2AXT Z;  4JTC B;  4DV3 B;  4N21 A;  4H0L B;  5BR8 B;  3RGB A;  4X88 A;  4I0X B;  3N2G A;  3ZRV A;  3S3X A;  2ZQM A;  3C90 A;  2P4V A;  1OHH G;  4DR6 O;  5LMN B;  1GM8 A;  1GM9 A;  2BOC C;  3GWK C;  1N36 O;  1NR1 A;  1V9P A;  3CCL V;  3HKD A;  4PA6 A;  1MAB G;  5FL7 H;  1SQX H;  5IY5 C;  4HYO A;  3DGE A;  2E75 B;  5CA1 A;  2R9I A;  5FPR A;  1JFF B;  3ZS8 C;  4FFB B;  4PDV A;  4LFB B;  4IL6 Z;  1H8H G;  5EIB D;  2ITC C;  5CBH A;  3OW2 U;  4JI1 B;  3QF7 A;  2BE3 A;  4QPK A;  3F7Y C;  5BMV A;  1LUV A;  4ZIB A;  4RWU A;  1W0K G;  5FLX N;  2OWO A;  4LF6 O;  3OTF A;  4X1I A;  1YJW V;  2ZM6 B;  5KLV H;  2UU9 O;  5CB4 B;  4X64 O;  4LC1 A;  3DSQ A;  5IYD O;  3ZN1 A;  2X6B A;  1QHT A;  2EIK C;  3OMI B;  4DK1 A;  1XMQ B;  2DQ3 A;  3M7M X;  4YY3 O;  4MW3 A;  4PV1 B;  4X65 B;  1ZL8 A;  1XHX A;  3G80 A;  2Q0O C;  4I9W A;  2IW5 A;  4LF5 B;  2XND H;  1WAZ A;  1WPB A;  2KKW A;  2JGD B;  1JOY A;  1XMO B;  1CEZ A;  2Q73 A;  5B1A B;  2QE7 G;  1TAE A;  1FXK C;  4RAI A;  2YIB A;  3U0Z A;  4WFE A;  1VAR A;  2K9P A;  3MHH C;  1WPX A;  2WLH A;  2DYS B;  1QVG U;  4LF8 O;  3SPC A;  5GTI Z;  4JI2 B;  3ZX6 A;  2QDO A;  5GON B;  3SYO A;  5BY1 A;  4J7Z A;  3K9S A;  1FYJ A;  2Q6A A;  3ZRW B;  3S3W A;  3D36 A;  1S5L Z;  2XOK G;  2Q5Z A;  1AR4 A;  5L3D A;  3HR0 A;  1PV0 A;  3JYC A;  1J5E O;  5LHH A;  2MW2 B;  2YDE A;  3ML0 A;  4JTD B;  4NXN O;  4O4J A;  5FPO A;  3OGI B;  3JAW B;  4JI7 B;  4DUZ O;  3N2K B;  2B5U A;  2X7R B;  2F43 G;  4E4E A;  4DV5 O;  1VQL V;  3WB2 A;  1YDX A;  3IGA C;  4UVC A;  2UXC O;  4P30 A;  5EIB C;  4DV2 O;  4DV3 O;  2UXN A;  3OGC C;  2QM4 A;  3A0R A;  3SPJ A;  1HNX O;  3P30 A;  4OX9 B;  4L8J A;  4EFB A;  3OAA H;  4ZI7 A;  4IGG A;  2VS0 A;  4XBF A;  1TVK A;  2YXH A;  2EIN C;  5D5P A;  2PYL A;  2PGG A;  5KHH A;  4ZKI A;  3P32 A;  2R70 A;  5CN0 A;  4H37 A;  2AHZ A;  3RYI A;  1KUQ A;  5IE9 A;  1HP8 A;  4KL1 A;  3I5D A;  2P90 A;  1NR7 A;  3ZHU A;  4MVO A;  1SQB H;  1YHQ V;  2ZT9 B;  3E8F A;  4L87 A;  3CXH F;  1R6K A;  5KHG A;  2GDS A;  1D5A A;  1KU9 A;  2O57 A;  4TUY B;  4YXW G;  1N32 O;  3SJQ C;  2EBO A;  2XAQ A;  2OCH A;  3RW0 A;  2IJK A;  2Y69 B;  3STL C;  4FMT A;  4DV1 B;  4AQY B;  2ZR3 A;  4YJ3 A;  1LNQ A;  2RJZ A;  2WWW A;  4U7N A;  4UCT A;  3BCC H;  3CRQ A;  3T4D A;  4X20 B;  5LA6 B;  4JI0 B;  4MVM A;  4JPR A;  3AG4 C;  2JIZ G;  3DC6 A;  1M90 W;  3ZMS A;  2E5L B;  1A32 A;  1N4C A;  2CGN A;  4DV4 B;  1Y67 A;  1JA8 A;  1Z5V A;  4GKK B;  3C3S A;  1HNZ B;  1RM1 C;  1PPJ H;  1Q43 A;  2JK5 C;  3Q4H B;  2UXD O;  3OFN H;  2RNB A;  4X65 O;  3UQ8 A;  1K9M W;  2VRZ A;  4I9Q A;  1E1Q G;  4LF5 O;  1PM9 A;  5IT9 N;  4I50 B;  3NXS A;  4ZOL B;  3FX7 A;  4DR3 O;  3TCU A;  1N34 B;  1AR1 B;  5ITZ B;  1LUW A;  2WLI A;  3APQ A;  3QTC A;  4DR2 B;  4YIP A;  1MZE A;  4TV9 A;  2ZIO A;  1WP7 A;  3N27 A;  3RYF A;  2ZDI C;  4GT1 A;  2F66 C;  3K03 A;  3W7U A;  3B40 A;  3KCX A;  4U3J B;  1KEC A;  1Y74 B;  3OUS A;  2QJ1 A;  1JFF A;  1S5J A;  1Z2G A;  4MVS A;  4B3T O;  1N33 B;  1ZLZ A;  3F7V C;  4DR5 O;  1DF5 A;  5GTH Z;  4PI0 A;  3SYA A;  3HKD B;  3P3N A;  1FJG O;  3AG7 A;  3JD3 A;  1H2N A;  5L3F A;  4RO2 A;  5CA1 B;  1QQC A;  3ZRS A;  2QKC A;  4J80 A;  2EIM B;  3H1J H;  4JAS A;  5H9C A;  1HNW O;  4JV5 O;  4JTA B;  3FYI B;  5EK0 A;  3CXC U;  3ABL B;  4F4L A;  1QR9 A;  2WSS G;  4FK5 C;  1P84 F;  3SR2 C;  1J95 A;  5HFM A;  3DXR A;  2IH3 C;  3H01 A;  4LF9 O;  5CB4 A;  2EIL B;  1OCZ C;  3A8T A;  5BMV B;  1K5S A;  1B04 A;  1XUQ A;  3K0G A;  1BSH A;  1BCC H;  3LSU A;  4ASU H;  1Q8I A;  4X1I B;  1VQP V;  1YTF B;  1BS3 A;  1GN3 A;  4GX0 A;  1E79 H;  1P49 A;  4C7U A;  2HEP A;  2XAS A;  4B3M O;  4X9Q A;  2CTP A;  3CE2 A;  3HKC A;  1M57 C;  4MW8 A;  4LP8 A;  2XTA A;  1IDS A;  3LNN A;  1IBL O;  1JPX A;  3O65 A;  3PJS K;  4JI4 O;  4NTY A;  1ZL8 B;  1WNS A;  2V1D A;  4J7K A;  2OCC B;  3ASN C;  3VBB A;  1FPO A;  2ADQ B;  4J9Z B;  4JZG A;  1K5Q A;  4KUM A;  4JI8 O;  3K3W A;  2JS3 A;  4QE9 A;  5GON A;  5L3E A;  3K0D A;  4GX1 A;  4DR6 B;  1AP5 A;  3W7T A;  3LNM B;  1AP6 A;  1N36 B;  3CJH A;  4GYC B;  2QWQ B;  2YIA A;  1NKD A;  2HVK C;  2DWD C;  5L3G A;  4AQY O;  2GUZ A;  4LNU A;  3OE7 G;  2AZ2 A;  4DRX A;  1M5I A;  2E5Y A;  3G6E V;  2H94 A;  4R8C A;  3JCU Z;  4YJ2 B;  1KMI Z;  2WLJ A;  2V7Q G;  4WFF A;  3R66 A;  3OMA B;  5C93 A;  5KHK A;  1U97 A;  5DN6 G;  2DN9 A;  2F93 B;  1PKX A;  2XAG A;  3DC5 A;  4LWS A;  2Y4U A;  1UJW B;  2A3Q A;  1N0N A;  1RP3 B;  2ETN A;  3A2F A;  3BRC A;  3X2Q C;  2ZNJ A;  4N23 A;  3CYO A;  3CCJ V;  2LP7 A;  2UXX A;  4WFB V;  4FLT A;  4LF6 B;  3ZMZ A;  5LXT B;  2YSU B;  3IAY A;  1Q5O A;  4R7C A;  2UU9 B;  2RCV A;  4CC5 A;  4J7J A;  4FLW A;  2FML A;  2X6A A;  4X64 B;  3VQW A;  2GTS A;  3L9D A;  2Q0A A;  4GUN A;  5KHI A;  3BFR A;  4Z1V A;  3APO A;  2F4V O;  2CTW A;  1WB7 A;  4YY3 B;  2K1E A;  4NR1 A;  1FXH A;  3B4S A;  4DV0 O;  4PDL A;  5JVD A;  2IJI A;  4LFC O;  4I5S A;  1KB9 F;  4ZI7 B;  4MVR A;  2Z5U A;  4CH4 A;  3W7S A;  4TWK A;  1VF6 C;  3ABT A;  3VQX A;  3UT5 A;  3KKY A;  2UUA O;  2VWJ A;  3FFQ A;  1BZK A;  4LBE C;  4CZZ A;  4Z1M G;  1G8M A;  3JAL A;  3C3T A;  2YI9 A;  5KHJ A;  4LF8 B;  1GN2 A;  2PTM A;  1OCC B;  2X6C A;  1JJO A;  2CK3 G;  1SC5 B;  5EC1 C;  2R72 A;  1Y76 B;  4BWA A;  3CEI A;  5HFL A;  1YJN V;  2CDY A;  4DV6 O;  1O9H A;  3IJ4 A;  1NBM G;  4KFM A;  1SRY A;  2CUG A;  1NQT A;  3LDE A;  1J5E B;  2HG5 C;  4B7E A;  3CD6 V;  1AIL A;  1M9N A;  2YID A;  4YJ3 B;  1K4D C;  3VOU A;  3BA9 A;  1O9G A;  4GX5 A;  5EZY B;  3BA8 A;  3E89 A;  3A0B Z;  3ZN0 A;  4K8X A;  1FXV A;  4NXN B;  1ENV A;  4DUZ B;  4JI6 O;  3AG2 B;  4ZOL A;  4IIJ B;  4DV5 B;  2UXB O;  1IBM O;  1TA8 A;  3L74 H;  3OTO O;  3ABU A;  3A0H Z;  4UFZ A;  3RVY A;  1WB8 A;  5K1X A;  2UXC B;  4DR7 O;  5CBG A;  4DV2 B;  3KCY A;  1W2B U;  1K3E A;  5B3S B;  1VQ7 V;  1Q90 D;  3IFX A;  3ZHR A;  4P2Z A;  1F4N A;  2FTK A;  1OJH A;  2ZNI A;  4JYA O;  1HNX B;  2MK3 A;  3LSQ A;  3FD9 A;  3F5W C;  4HAM A;  4U3J A;  1KP2 A;  1Y74 A;  4WBN A;  2WLI B;  3K04 A;  2N05 A;  1H2S B;  4G2K A;  4X62 O;  4WCE V;  1FD9 A;  4UVB A;  4TV9 B;  2P6J A;  3RYF B;  3UKM A;  3OEH G;  1L0N H;  2CH7 A;  3AG3 B;  2JJ1 G;  2UUB O;  4FLV A;  4LF7 O;  5KA6 A;  1I7F A;  2DOS A;  1WA8 A;  1Q6U A;  4MVQ A;  4U3F H;  4PHZ A;  2ZIM A;  2ZE5 A;  4TOI A;  2D2C B;  2EZO A;  4RUF A;  3B77 A;  3AK2 A;  1I5X A;  1ZUQ A;  1N32 B;  3ZMV A;  1K97 A;  4XDL A;  4X1K B;  1WN7 A;  1NH2 B;  3K5L A;  1HDJ A;  2N74 A;  4G27 B;  4ZBM A;  4PDM A;  2JDI G;  5LP6 A;  3HKB B;  1P4R A;  1W0J G;  1K73 W;  5IJ0 A;  5BZB A;  3RFR A;  4HNA B;  1FFX A;  1WP8 A;  1AI7 A;  2DYR B;  3DXR B;  4CBC A;  1GTO A;  1QU7 A;  3QVN A;  4BW5 A;  1KP3 A;  3SYC A;  5KA5 A;  4D6T H;  4B7K A;  5J2T A;  4O4H A;  1BT8 A;  2UXD B;  4DO2 A;  1SZX A;  2IBZ H;  2HLD H;  4FZ1 A;  1D2D A;  1MNG A;  2KB1 A;  1Q86 W;  4DR3 B;  3HKC B;  1Q6I A;  1BSN A;  2XAH A;  4TQD A;  5KMG B;  4CS4 A;  2EX3 A;  2Y0P A;  2A9H A;  1RFY A;  3SPI A;  2IJH A;  2HKO A;  2BTO A;  2QA4 V;  2ZXW C;  1ZX3 A;  1OCO B;  1NT2 B;  3JAS A;  2ODM A;  2OIE A;  3CMA V;  3IC9 A;  1FKA O;  1Z5W A;  4D7T A;  3OT7 A;  3LUT B;  2AHY A;  4F6E A;  1H2G A;  2QWO B;  1XRE A;  4OXS A;  5K1P A;  3BHP A;  5JJJ B;  4XDJ A;  4B3T B;  2Q67 A;  4YJ2 A;  1BQZ A;  3JCZ A;  2LW7 A;  1EZV H;  2YIC A;  4DR5 B;  3CJH B;  1RSO A;  1XOU A;  4U7O A;  2A0L A;  5LHG A;  1SQV H;  1FJG B;  4LFA O;  3K5M A;  3FB5 C;  2GUZ B;  4LNU B;  5FNV B;  4DRX B;  1MG1 A;  3ZJZ A;  3E8G A;  4BAY A;  2EUL A;  1M56 C;  2EIN B;  3EFF K;  1VF6 A;  3SGI A;  5TIS Z;  3AG1 C;  1FFT B;  1HNW B;  4JV5 B;  5LXT A;  1X4T A;  1SES A;  1XNR O;  1K4C C;  4LWS B;  5IDJ A;  1NI8 A;  4LF9 B;  1VQ8 V;  2ITD C;  3J81 N;  2Q7G A;  5LOV B;  3OM3 B;  3L71 H;  1D5N A;  4GCZ A;  3ETQ A;  1UFI A;  3W7X A;  4MT8 A;  5D5Q A;  1R3J C;  2VQF O;  3E2E A;  2CGO A;  2CE4 A;  5IWA O;  2DYS C;  4HZ3 A;  4RQE A;  2PY5 A;  5JQG A;  5KUK A;  3ZMU A;  4B3M B;  1H2K A;  4ASU G;  5LMU O;  2Y48 A;  2FYU H;  5KAF Z;  5B66 Z;  1IBL B;  5EBM C;  4JI4 B;  3ABK C;  1MSD A;  1BSM A;  1SF9 A;  5JVD B;  3CCM V;  4JI8 B;  4H13 B;  2R9R B;  4EB6 A;  4YIO A;  4CH3 A;  3UT5 B;  3WG7 C;  1MZF A;  1VMG A;  4DV7 O;  1YJ9 V;  3CX5 F;  1ZSP A;  1WLE A;  1F7Y A;  3TXQ A;  1Y76 A;  2WA4 A;  1G4Y B;  2YS8 A;  3JAL B;  1GMG A;  1VQN V;  5LBQ A;  3LSS A;  2P67 A;  1H8E H;  1DGS A;  2WLK A;  4DYL A;  4UUJ C;  3VQY A;  3K5O A;  3D8C A;  3FB8 C;  2HR3 A;  4KHP O;  1MOF A;  2PF4 E;  4LCU C;  5EZY A;  3OR7 C;  4R50 A;  2ZCE A;  4JAU A;  3E22 A;  4J9Y B;  2PUS A;  1HW7 A;  1VF5 B;  1YXB A;  1NU1 H;  4IIJ A;  2QGN A;  4JYB A;  2BSK B;  5KAI Z;  2UUC O;  3MD0 A;  1V54 C;  3BEH A;  3K58 A;  2IH1 C;  2C2A A;  4R6Z A;  5E1A C; 
#chains in the Genus database with same CATH homology
 5CA0 B;  4LNU A;  5ITZ A;  4DRX A;  1M5I A;  2E5Y A;  2OYQ A;  4O4L A;  4YJ2 B;  1KMI Z;  2QE7 H;  4DV3 B;  5JCO C;  3RYH A;  2F4V B;  5BR8 B;  3RGB A;  5KHK A;  4O2A A;  2F93 B;  4LH7 A;  4O2B B;  3N2G A;  3WB1 A;  4DV0 B;  5J2U B;  4LFC B;  4WBN B;  3A2F A;  3BRC A;  3K5N A;  2ZNJ A;  5LMN B;  4JI3 B;  4FLT A;  2UUA B;  4LF6 B;  4DUY B;  2YXL A;  5LXT B;  1V9P A;  3IAY A;  3HKD A;  1Q5O A;  2UU9 B;  4CC5 A;  4EFE A;  5KX5 A;  5FL7 H;  2XOK H;  3BAA A;  2JS5 A;  4FLW A;  4X64 B;  5CA1 A;  1FS0 E;  1XHZ A;  5FPR A;  3VQW A;  4X1K A;  4FLY A;  1JFF B;  3CHX A;  3ZS8 C;  5JH7 A;  2Q0A A;  3JAT B;  5KHI A;  4AIL C;  4CS2 A;  4FFB B;  4DR4 B;  3HKB A;  4LFB B;  5EIB D;  4F6R A;  4HNA A;  4YY3 B;  4K0K B;  2F1M A;  3SJC C;  5JVD A;  4JI1 B;  3QF7 A;  4DV6 B;  4ZI7 B;  5BMV A;  5DN6 I;  4FM0 A;  2Q7H A;  4CH4 A;  1T5E A;  4ZIB A;  5EYP B;  3OEH H;  5LP6 B;  4LR3 A;  3HKE A;  3VQX A;  3UT5 A;  3JAR A;  2OWO A;  5IJ0 B;  2Q7E A;  3OTF A;  4UCV A;  2VWJ A;  3FFQ A;  4X1I A;  1FFX B;  2ZM6 B;  4I55 A;  3U10 A;  4JI6 B;  5LYJ A;  3JAL A;  5CB4 B;  2YI9 A;  5KHJ A;  4LF8 B;  2UXB B;  2PTM A;  1IBM B;  3OTO B;  3T1H B;  5KMG A;  3DSQ A;  1QHT A;  5J2T B;  1JJO A;  4DK1 A;  4O4H B;  3K57 A;  2VQE B;  1XMQ B;  4TV8 B;  3M7M X;  4DR7 B;  2RQ6 A;  3JAK A;  4X65 B;  1XHX A;  2R72 A;  4BWA A;  3SJB C;  1SKV A;  4FLU A;  4LF5 B;  2XND H;  1WPB A;  2IM9 A;  1O9H A;  4JYA B;  2KKW A;  3BPZ A;  4I4T A;  1XMO B;  4ZHQ B;  1J5E B;  2ZIN A;  4YJ3 B;  1TAE A;  3BA9 A;  1O9G A;  5EZY B;  3BA8 A;  4EEQ A;  3K59 A;  2YIB A;  3CB2 A;  4X62 B;  4K8X A;  4NXN B;  3U0Z A;  1TUB A;  3JAS B;  4DUZ B;  4BW9 A;  4ZOL A;  4IIJ B;  4DV5 B;  1TA8 A;  4JI2 B;  5GON B;  5CA0 A;  2RQ7 A;  5FNV A;  4UFZ A;  3RYC B;  5K1X A;  2UXC B;  2UUB B;  4DV2 B;  4PI2 A;  4LF7 B;  2CAZ C;  5IJ9 A;  1XQ8 A;  4O2B A;  2ZNI A;  1SQF A;  3BAB A;  1HNX B;  5J2U A;  4U3J A;  2F95 B;  4WBN A;  3QG5 A;  4NXM B;  4B3S B;  5LOV A;  4GLX A;  4X1Y B;  1H2S B;  4O4J A;  3ZED A;  5FPO A;  3JAW B;  4JI7 B;  2V4D A;  3N2K B;  4TV9 B;  3RYF B;  3N2G B;  3WB2 A;  4Q6G A;  5EIB C;  3JSN A;  4FLV A;  3JAT A;  1I7F A;  4FFB A;  2YIB D;  4PHZ A;  2ZIM A;  5IYZ B;  4TOI A;  4K8Z A;  5JQG B;  2QM4 A;  3WB0 A;  4OX9 B;  4L8J A;  1N32 B;  4EFB A;  3VQV A;  5JJN B;  3OAA H;  4ZI7 A;  4X1K B;  1WN7 A;  1TVK A;  3K5L A;  2HHH B;  4DK0 A;  1I94 B;  4CC6 A;  2GV9 A;  5D5P A;  5EYP A;  5LP6 A;  2PYL A;  2PGG A;  3HKB B;  5KHH A;  5IJ0 A;  3RFR A;  4HNA B;  4IHJ B;  1FFX A;  2R70 A;  3RYI A;  3PN1 A;  4KL1 A;  4D7S A;  4EB6 B;  3JAR B;  1XI1 A;  5J2T A;  4O4H A;  5KHG A;  2UXD B;  1D5A A;  1KU9 A;  2PYJ A;  2HLD H;  4TUY B;  4I55 B;  2PZS A;  5JCO A;  5LYJ B;  2WSS H;  4O4I B;  4DR3 B;  4LFA B;  3HKC B;  1BSN A;  4DV1 B;  4TQD A;  5KMG B;  4AQY B;  4CS4 A;  4YHH B;  2EX3 A;  4YJ3 A;  4GKJ B;  2BTQ B;  2RJZ A;  4UCT A;  5C8Y B;  4TQF A;  3E22 B;  3JAK B;  2BTO A;  4X20 B;  1SA0 B;  1NT2 B;  3JAS A;  5LA6 B;  4FM2 A;  4JI0 B;  1XNR B;  2E5L B;  1Z5W A;  4D7T A;  2P5O A;  4YXW H;  4DV4 B;  1Z5V A;  4GKK B;  1TGO A;  1HNZ B;  5LP6 C;  1Q43 A;  3RYC A;  4UCO A;  2JVD A;  5JJE B;  4AHC A;  1M93 A;  5K1P A;  3BHP A;  5JJJ B;  3OFN H;  4B3T B;  3UQ8 A;  4YJ2 A;  2P22 C;  4FVM A;  4I9Q A;  3THO A;  1AQT A;  1ZAU A;  2VQF B;  4DR5 B;  1RSO A;  4JI5 B;  5IWA B;  4I50 B;  4ZOL B;  1FJG B;  3SJA C;  3K5M A;  4LNU B;  5FNV B;  2R9A A;  1N34 B;  5ITZ B;  4DRX B;  4X1Y A;  3CSX A;  5LMU B;  4O4L B;  1YEW A;  3QTC A;  4DR2 B;  3SGI A;  3ICX A;  1IBK B;  3RYH B;  1HNW B;  3JAW A;  4JV5 B;  5LXT A;  1X4T A;  3N2K A;  4O2A B;  4TV9 A;  2ZIO A;  3RYF A;  5IJ9 B;  2F66 C;  4LF9 B;  4U3J B;  3T1Y B;  2Q7G A;  5LOV B;  2QJ1 A;  1JFF A;  3U11 A;  1S5J A;  3ETQ A;  4O4J B;  3MAQ A;  1N33 B;  3FKS H;  2XHB A;  3OE7 H;  1JMK C;  5D5Q A;  4DV7 B;  4UCS A;  5IYZ A;  4LF4 B;  4PI0 A;  3HKD B;  2PY5 A;  2VWK A;  1VF7 A;  5JQG A;  2V7Q H;  5KX5 B;  4NVP A;  4B3M B;  5CA1 B;  1QQC A;  5JH7 B;  4KHP B;  1IBL B;  4F6R B;  4JI4 B;  4IHJ A;  3SR2 C;  5JVD B;  3RWR D;  2JGU A;  5CB4 A;  4JI8 B;  5BMV B;  4DR1 B;  1B04 A;  1TVK B;  4EB6 A;  4CH3 A;  3HKE B;  3UT5 B;  1BSH A;  2UUC B;  4TV8 A;  4ASU H;  1Q8I A;  4X1I B;  2E3C A;  3JSL A;  4FLX A;  4TUY A;  1E79 H;  4HBN A;  4UCU A;  1Q3E A;  1M4U A;  3RYI B;  3JAL B;  1P49 A;  2HEP A;  1H8E H;  1DGS A;  1L8D A;  4O4I A;  3HKC A;  3VQY A;  4ZHQ A;  3K5O A;  4FLZ A;  2BTQ A;  3LNN A;  5EZY A;  2YI8 A;  1G6U A;  5C8Y A;  2ZCE A;  3E22 A;  4CS3 A;  1WNS A;  4X20 A;  1SA0 A;  5LA6 A;  2PUS A;  1HW7 A;  4IIJ A;  4I4T B;  5GON A;  4LH6 A;  4B3R B;  4CH5 A;  1HR0 B;  4CH6 A;  4FM1 A;  4DR6 B;  4X66 B;  3K58 A;  1TUB B;  1XNQ B;  1N36 B;  4UCR A;  4GYC B;  3B2E E;  2YIA A;  4I50 A;  1SQG A;  4B08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...