2RQ9A

Solution structure of human acidic fibroblast growth factor (afgf) in the presence of a protein stabilizer ndsb-new
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
143
structure length
143
Chain Sequence
MNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Solution structure of human acidic fibroblast growth factor (aFGF) in the presence of a protein stabilizer NDSB-new
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2rq9A00
1OQLB 3WA1A 1FMZA 3JRRA 1S0FA 5EG6C 1M2TB 1AVAC 1KNMA 3D7WB 1JLXA 4ZBVB 3MPPG 4QBCA 3BAVA 3FJJA 2DS0A 3NBEA 3QYDA 3RTIB 5BQUA 1IILA 4LO8B 1YXWA 4J2KA 3S8KA 1TTUA 3FFZA 1Z4SA 3N7JA 4IYBA 1Q1UA 3UD7A 4ZKTB 4R6UB 2K4AB 4I4YA 1V6UA 2RSTA 2BEAA 3WO2A 1TWMA 1J0SA 2MLLB 2ZR1B 4HA2A 4KEJA 4QC4A 3IAGC 2VSEA 4X39A 9ILBA 4LO2C 2Y9FA 1ISYA 1RMLA 3O44A 3FUQA 3NBDA 4QD2B 2FDBM 1II4A 1R8OA 4QBVA 1ITBA 1JT3A 4GP0A 4H04A 5D61A 3CQAA 4ZFUB 4TLPA 1ISZA 1HIBA 4LO2A 4DENA 3HBWA 3QR5A 4HR6C 2DRYA 3VEQA 1QQLA 3LLPA 1P63A 2ET2A 1V6VA 3FJEA 5BVPI 3SNVA 4ENDA 1D0HA 3TC2A 1TWEA 1BARA 4IZXA 3BADA 3VUOA 3O4BA 3NBNA 1BFGA 2AQZA 3FJHA 3IM5A 4QKRA 1SR4C 2BFHA 5FZUA 2KH2A 1JQZA 5DZUA 4ZGRB 1TIEA 3CA6A 3I29B 2K8RA 3F62B 1R8NA 2HWMA 1RG8A 2AAIB 4A7YA 2R9KB 2M49A 1FV2A 3I2AA 3BA7A 5EC5A 4JAWA 1S0CA 4ZA3B 5G00A 2GO2A 2HWAA 3WINA 5DUYA 4AN6A 5BXSA 1MC9A 1XG6A 3BRFA 1PUMB 2WBCA 3AZWA 4LO3C 1IHKA 4J2YA 2FO1A 4Z8SB 1G9DA 1DIWA 2WRYA 2X2SA 4IQPA 1PUUB 5BP5A 3AJ6A 3IM6A 1DLLA 3H6RA 4X37A 1FGAA 3N7MA 1V6WA 5FZYA 3ZXDA 2AFGA 3WO3A 1G9AA 1ONKB 1EVTA 1AF9A 4KBBA 3UJ4A 1I1BA 2DRZA 4ZFWB 4I7IA 4ISRA 1HKNA 1NUNA 5FNWA 1ISVA 2K43A 3BX1C 1M16A 4EKXB 3H6RB 3OGFA 3O5WB 4GP3A 3ZC8A 3S8JA 4GOVA 3ILAA 1HWMB 3ZXGA 3CRGA 4KEKA 3FJ9A 1MD6A 4L4IA 1DFQA 1TOOA 1T4QA 3IM7A 4GOYA 2F8XC 3CA5A 1Q04A 4OWKA 3CU1B 3AKGA 3VSFA 2NM1A 3H6SE 1WBAA 1BLDA 1IOBA 1HWNB 2I1BA 1AFCA 3BA5A 1TP0A 1IRPA 4G6JA 4LO0C 3W9TA 4P0KA 4JQ0A 3BRDA 1DJSB 4P0LA 2FFUA 2X2TA 5JMCA 2E4MC 1JLYA 3JUTA 1A8DA 2Q9XA 3CA3A 4DEPA 3F1RA 3FGMA 2BEBA 4I4VA 3RMYA 4JP0A 3BB2A 1K5UA 2VLCA 4IZEA 2NTDA 1BASA 2P23A 5FZZA 3HMYA 3BTAA 1HWPB 3AKFA 4P6AA 4EFRA 2AXMA 3UJ0A 3HN1A 3OJMA 1DZDA 1IRAX 3O4AA 1RY7A 5FNXA 2D22A 4OEGA 4I0YA 4I4PA 3FJKA 3RSJA 3VSZA 2P39A 4I4QA 1N4KA 4Q9GA 4D8HA 3AH4A 2VXTI 1AVXB 2GZBA 4D0ZA 2Z48A 3NJ5A 2F2FC 3B9UA 3NBCA 3E8LC 4FVVA 2VU9A 3PG0A 3V0BA 3CRIA 4AN7B 3BAUA 5F8SA 2ZQNA 3KMVA 2J3PA 2KI4A 4GAIA 3AKIA 4QALA 1SR4A 1DFCA 1TFMB 3O49A 4I4XA 3AH2A 1PZZA 2KLLA 4LO1C 1JT5A 1W3FA 1YF8B 3P6JA 5BXPA 3RTJB 1VCLA 2QN4A 1WD4A 2IHOA 2NP0A 2MC2A 4QKSA 4OEFA 2D43A 2XOAA 31BIA 5GAQA 1AXMA 3CA4A 3N7KA 4F83A 4EEEB 1HCEA 1S0DA 3V0BB 1DZCA 1ISXA 1ILR1 3ZX7A 2IWTB 3V0AA 1DQGA 3I2XA 3FJAA 1FWVA 4USPA 4J2XA 2LIQA 4JKXB 3ZC9A 5JLVA 3A23A 2KKIA 2VXRA 4XFTA 4I37A 4EFPA 4LO3A 3BAHA 3P6IA 4I4UA 1EPWA 2ERMA 1G82A 6I1BA 1ABRB 1BFBA 1JT7A 1RZOB 4QO3A 2RG9B 3O4DA 2Y9XE 4A7KA 2KI6B 3K1XA 3UD8A 1V6XA 1HCDA 3OBTA 3BA4A 4IY8A 3UD9A 3BRGC 4JRAA 1EV2A 1YTOA 4Z9WB 3HOMA 5BXTA 4OWJA 4CJMA 3OJVA 1W3AA 2D7IA 2NVHA 4J23B 4J2SA 4ZOTA 4I1BA 4I4OA 2D20A 1S0LA 4KC3A 1S0EA 4ZFYB 1F31A 3O3QA 1XYFA 1QQKA 4Q91A 2DREA 2VSAA 8I1BA 1YBIA 2D44A 3N0KA 4P0JA 3N7LA 1ISWA 3POKA 4I96A 1Z2VA 3WMVA 4QD2C 4OUJA 4IHZA 5BQUC 1EYLA 4ISQA 3H6QA 3Q7XA 3UDAA 3FUOA 21BIA 1AVUA 1JT4A 5B2HA 5DVHA 4LO0A 4G6MA 5EHAA 3R4SA 4ZLBB 5D62A 4LO7B 3FJ8A 1XZZA 3BAQA 4USOA 2YUGA 4X3AA 4DCKC 2E4MA 1DQOA 4WBCA 4KEIA 1GGPB 4D0TA 1IJTA 2NZ9A 4JPZA 1E0OA 3EF2A 5F90A 3R4UA 3CA1A 1YYNA 3O4CA 3A07A 41BIA 5E24E 1JTCA 1PC8B 3FJIA 4II0A 2FFVA 2Z49A 2D1ZA 4XFUA 1K5VA 1AVWB 5BOWA 1FN0A 4IONA 3FJFA 4I4RA 3V79C 1WD3A 2MIBA 4H9WA 4XFSA 2D23A 4FGFA 4I6IA 1Z0HA 3AKHA 3WO4A 3FJDA 3HALA 1NZKA 2F2FA 1W3GA 3A22A 3T8SA 1G9BA 2L5XA 3O4OA 4XKIA 1HWOB 2Y9GA 3Q7WA 1FQ9A 2Y9WC 3BAOA 2FGFA 4G1RA 4LO1A 5F8WA 2UUSA 3CA0A 3WINC 3WMUA 1PWAA 1UPSA 2D24A 1XHBA 4YOLA 3MALA 5I1BA 2RQ9A 3Q7YA 3OGGA 2LIEA 4PC4A 2HW9A 4I2SA 3VT0A 4EFQA 2VUAA 3IIRA 3VT1A 5BP5C 1CVSA 3RMXA 2Q3NB 3OJ2A 4F34A 5BXRA 3BAGA 4I3NA 3FJCA 3CRHA 1SZ6B 1BLAA 1T9FA 4OEEA 1FMMS 2ZQOA 1QXMA 5DSSB 5D63A 1L2HA 1WBCA 3FJBA 4OW4A 4GAFA 4G9NA 4I1EA 3OBRA 3LTQA 2QYIB 4Q9PA 3V0AB 1G9CA 4IY9A 3PMEA 1IT0A 1BFFA 3HSMA 4EB2B 4X38A 2D7RA 3AZVA 1FV3A 4I4SA 1JY0A 1CE7B 3VWCA 3AH1A 3CAHA 3P53A 2NYYA 3A21A 4G9MA 7I1BA 4I8MA 1FWUA 1S0BA 3C9ZA 3PUBA 4OWLA 4HJJA 5HPZA 5F8YA 3VT2A 1I1EA 4JKQA 4A7ZA 4LO7C 1BFCA 1Q03A 3PHZA 2HZ9A 3AJ5A 4L4HA 2ESUA 1BA7A 1S0GA
chains in the Genus database with same CATH superfamily
1OQLB 3WA1A 1FMZA 3JRRA 1S0FA 5EG6C 1M2TB 1AVAC 1KNMA 3D7WB 1JLXA 4ZBVB 3MPPG 4QBCA 3BAVA 3FJJA 2DS0A 3NBEA 3QYDA 3RTIB 5BQUA 1IILA 4LO8B 1YXWA 4J2KA 3S8KA 1TTUA 3FFZA 1Z4SA 3N7JA 4IYBA 1Q1UA 3UD7A 4ZKTB 4R6UB 2K4AB 4I4YA 1V6UA 2RSTA 2BEAA 3WO2A 1TWMA 1J0SA 2MLLB 2ZR1B 4HA2A 4KEJA 4QC4A 3IAGC 2VSEA 4X39A 9ILBA 4LO2C 2Y9FA 1ISYA 1RMLA 3O44A 3FUQA 3NBDA 4QD2B 2FDBM 1II4A 1R8OA 4QBVA 1ITBA 1JT3A 4GP0A 4H04A 5D61A 3CQAA 4ZFUB 4TLPA 1ISZA 1HIBA 4LO2A 4DENA 3HBWA 3QR5A 4HR6C 2DRYA 3VEQA 1QQLA 3LLPA 1P63A 2ET2A 1V6VA 3FJEA 5BVPI 3SNVA 4ENDA 1D0HA 3TC2A 1TWEA 1BARA 4IZXA 3BADA 3VUOA 3O4BA 3NBNA 1BFGA 2AQZA 3FJHA 3IM5A 4QKRA 1SR4C 2BFHA 5FZUA 2KH2A 1JQZA 5DZUA 4ZGRB 1TIEA 3CA6A 3I29B 2K8RA 3F62B 1R8NA 2HWMA 1RG8A 2AAIB 4A7YA 2R9KB 2M49A 1FV2A 3I2AA 3BA7A 5EC5A 4JAWA 1S0CA 4ZA3B 5G00A 2GO2A 2HWAA 3WINA 5DUYA 4AN6A 5BXSA 1MC9A 1XG6A 3BRFA 1PUMB 2WBCA 3AZWA 4LO3C 1IHKA 4J2YA 2FO1A 4Z8SB 1G9DA 1DIWA 2WRYA 2X2SA 4IQPA 1PUUB 5BP5A 3AJ6A 3IM6A 1DLLA 3H6RA 4X37A 1FGAA 3N7MA 1V6WA 5FZYA 3ZXDA 2AFGA 3WO3A 1G9AA 1ONKB 1EVTA 1AF9A 4KBBA 3UJ4A 1I1BA 2DRZA 4ZFWB 4I7IA 4ISRA 1HKNA 1NUNA 5FNWA 1ISVA 2K43A 3BX1C 1M16A 4EKXB 3H6RB 3OGFA 3O5WB 4GP3A 3ZC8A 3S8JA 4GOVA 3ILAA 1HWMB 3ZXGA 3CRGA 4KEKA 3FJ9A 1MD6A 4L4IA 1DFQA 1TOOA 1T4QA 3IM7A 4GOYA 2F8XC 3CA5A 1Q04A 4OWKA 3CU1B 3AKGA 3VSFA 2NM1A 3H6SE 1WBAA 1BLDA 1IOBA 1HWNB 2I1BA 1AFCA 3BA5A 1TP0A 1IRPA 4G6JA 4LO0C 3W9TA 4P0KA 4JQ0A 3BRDA 1DJSB 4P0LA 2FFUA 2X2TA 5JMCA 2E4MC 1JLYA 3JUTA 1A8DA 2Q9XA 3CA3A 4DEPA 3F1RA 3FGMA 2BEBA 4I4VA 3RMYA 4JP0A 4H75A 3BB2A 1K5UA 2VLCA 4IZEA 2NTDA 1BASA 2P23A 5FZZA 3HMYA 3BTAA 1HWPB 3AKFA 4P6AA 4EFRA 2AXMA 3UJ0A 3HN1A 3OJMA 1DZDA 1IRAX 3O4AA 1RY7A 5FNXA 2D22A 4OEGA 4I0YA 4I4PA 3FJKA 3RSJA 3VSZA 2P39A 4I4QA 1N4KA 4Q9GA 4D8HA 3AH4A 2VXTI 1AVXB 2GZBA 4D0ZA 2Z48A 3NJ5A 2F2FC 3B9UA 3NBCA 3E8LC 4FVVA 2VU9A 3PG0A 3V0BA 3CRIA 4AN7B 3BAUA 5F8SA 2ZQNA 3KMVA 2J3PA 2KI4A 4GAIA 3AKIA 4QALA 1SR4A 1DFCA 1TFMB 3O49A 4I4XA 3AH2A 1PZZA 2KLLA 4LO1C 1JT5A 1W3FA 1YF8B 3P6JA 5BXPA 3RTJB 1VCLA 2QN4A 1WD4A 2IHOA 2NP0A 2MC2A 4QKSA 4OEFA 2D43A 2XOAA 31BIA 5GAQA 1AXMA 3CA4A 3N7KA 4F83A 4EEEB 1HCEA 1S0DA 3V0BB 1DZCA 1ISXA 1ILR1 3ZX7A 2IWTB 3V0AA 1DQGA 3I2XA 3FJAA 1FWVA 4USPA 4J2XA 2LIQA 4JKXB 3ZC9A 5JLVA 3A23A 2KKIA 2VXRA 4XFTA 4I37A 4EFPA 4LO3A 3BAHA 3P6IA 4I4UA 1EPWA 2ERMA 1G82A 6I1BA 1ABRB 1BFBA 1JT7A 2NS2A 1RZOB 4QO3A 2RG9B 3O4DA 2Y9XE 4A7KA 2KI6B 3K1XA 3UD8A 1V6XA 1HCDA 3OBTA 3BA4A 4IY8A 3UD9A 3BRGC 4JRAA 1EV2A 1YTOA 4Z9WB 3HOMA 5BXTA 4OWJA 4CJMA 3OJVA 1W3AA 4MZFB 2D7IA 2NVHA 4J23B 4J2SA 4ZOTA 4I1BA 4I4OA 2D20A 1S0LA 4KC3A 1S0EA 4ZFYB 1F31A 3O3QA 1XYFA 1QQKA 4Q91A 2DREA 2VSAA 8I1BA 1YBIA 2D44A 3N0KA 4P0JA 3N7LA 1ISWA 3POKA 4I96A 1Z2VA 3WMVA 4UY4A 4QD2C 4OUJA 4IHZA 5BQUC 1EYLA 4ISQA 3H6QA 3Q7XA 3UDAA 3FUOA 21BIA 1AVUA 1JT4A 5B2HA 5DVHA 4LO0A 4G6MA 5EHAA 3R4SA 4ZLBB 5D62A 4LO7B 3FJ8A 1XZZA 3BAQA 4USOA 2YUGA 4X3AA 4DCKC 2E4MA 1DQOA 4WBCA 4KEIA 1GGPB 4D0TA 1IJTA 2NZ9A 4JPZA 1E0OA 3EF2A 5F90A 3R4UA 3CA1A 1YYNA 3O4CA 3A07A 41BIA 5E24E 1JTCA 1PC8B 3FJIA 4II0A 2FFVA 2Z49A 2D1ZA 4XFUA 1K5VA 1AVWB 5BOWA 1FN0A 4IONA 3FJFA 4I4RA 3V79C 1WD3A 2MIBA 4H9WA 4XFSA 2D23A 4FGFA 4I6IA 1Z0HA 3AKHA 3WO4A 3FJDA 3HALA 1NZKA 2F2FA 1W3GA 3A22A 4MZHA 3T8SA 1G9BA 2L5XA 3O4OA 4XKIA 1HWOB 2Y9GA 3Q7WA 1FQ9A 2Y9WC 3BAOA 2FGFA 4G1RA 4LO1A 5F8WA 2UUSA 3CA0A 3WINC 3WMUA 1PWAA 1UPSA 2D24A 1XHBA 4YOLA 3MALA 5I1BA 2RQ9A 3Q7YA 3OGGA 2LIEA 4PC4A 2HW9A 4I2SA 3VT0A 4EFQA 2VUAA 3IIRA 3VT1A 5BP5C 1CVSA 3RMXA 2Q3NB 3OJ2A 4F34A 5BXRA 3BAGA 4I3NA 3FJCA 3CRHA 1SZ6B 1BLAA 1T9FA 4OEEA 1FMMS 2ZQOA 1QXMA 5DSSB 5D63A 1L2HA 1WBCA 3FJBA 4OW4A 4GAFA 4G9NA 4I1EA 3OBRA 3LTQA 2QYIB 4Q9PA 3V0AB 1G9CA 4IY9A 4MZGB 3PMEA 1IT0A 1BFFA 3HSMA 4EB2B 4X38A 2D7RA 3AZVA 1FV3A 4I4SA 1JY0A 1CE7B 3VWCA 3AH1A 3CAHA 3P53A 2NYYA 3A21A 4G9MA 7I1BA 4I8MA 1FWUA 1S0BA 3C9ZA 3PUBA 4OWLA 4HJJA 5HPZA 5F8YA 3VT2A 1I1EA 4JKQA 4A7ZA 4LO7C 1BFCA 1Q03A 3PHZA 2HZ9A 3AJ5A 4L4HA 2ESUA 1BA7A 1S0GA
chains in the Genus database with same CATH topology
1OQLB 3WA1A 1FMZA 3JRRA 1S0FA 5EG6C 1M2TB 1AVAC 1KNMA 3D7WB 1JLXA 4ZBVB 3MPPG 4QBCA 3BAVA 3FJJA 2DS0A 3NBEA 3QYDA 3RTIB 5BQUA 1IILA 4LO8B 1YXWA 4J2KA 3S8KA 1TTUA 3FFZA 1Z4SA 3N7JA 4IYBA 1Q1UA 3UD7A 4ZKTB 4R6UB 2K4AB 4I4YA 1V6UA 2RSTA 2BEAA 3WO2A 1TWMA 1J0SA 2MLLB 2ZR1B 4HA2A 4KEJA 4QC4A 3IAGC 2VSEA 4X39A 9ILBA 4LO2C 2Y9FA 1ISYA 1RMLA 3O44A 3FUQA 3NBDA 4QD2B 2FDBM 1II4A 1R8OA 4QBVA 1ITBA 1JT3A 4GP0A 4H04A 5D61A 3CQAA 4ZFUB 4TLPA 1ISZA 1HIBA 4LO2A 4DENA 3HBWA 3QR5A 4HR6C 2DRYA 3VEQA 1QQLA 3LLPA 1P63A 2ET2A 1V6VA 3FJEA 5BVPI 3SNVA 4ENDA 1D0HA 3TC2A 1TWEA 1BARA 4IZXA 3BADA 3VUOA 3O4BA 3NBNA 1BFGA 2AQZA 3FJHA 3IM5A 4QKRA 1SR4C 2BFHA 5FZUA 2KH2A 1JQZA 5DZUA 4ZGRB 1TIEA 3CA6A 3I29B 2K8RA 3F62B 1R8NA 2HWMA 1RG8A 2AAIB 4A7YA 2R9KB 2M49A 1FV2A 3I2AA 3BA7A 5EC5A 4JAWA 1S0CA 4ZA3B 5G00A 2GO2A 2HWAA 3WINA 5DUYA 4AN6A 5BXSA 1MC9A 1XG6A 3BRFA 1PUMB 2WBCA 3AZWA 4LO3C 1IHKA 4J2YA 2FO1A 4Z8SB 1G9DA 1DIWA 2WRYA 2X2SA 4IQPA 1PUUB 5BP5A 3AJ6A 3IM6A 1DLLA 3H6RA 4X37A 1FGAA 3N7MA 1V6WA 5FZYA 3ZXDA 2AFGA 3WO3A 1G9AA 1ONKB 1EVTA 1AF9A 4KBBA 3UJ4A 1I1BA 2DRZA 4ZFWB 4I7IA 4ISRA 1HKNA 1NUNA 5FNWA 1ISVA 2K43A 3BX1C 1M16A 4EKXB 3H6RB 3OGFA 3O5WB 4GP3A 3ZC8A 3S8JA 4GOVA 3ILAA 1HWMB 3ZXGA 3CRGA 4KEKA 3FJ9A 1MD6A 4L4IA 1DFQA 1TOOA 1T4QA 3IM7A 4GOYA 2F8XC 3CA5A 1Q04A 4OWKA 3CU1B 3AKGA 3VSFA 2NM1A 3H6SE 1WBAA 1BLDA 1IOBA 1HWNB 2I1BA 1AFCA 3BA5A 1TP0A 1IRPA 4G6JA 4LO0C 3W9TA 4P0KA 4JQ0A 3BRDA 1DJSB 4P0LA 2FFUA 2X2TA 5JMCA 2E4MC 1JLYA 3JUTA 1A8DA 2Q9XA 3CA3A 4DEPA 3F1RA 3FGMA 2BEBA 4I4VA 3RMYA 4JP0A 4H75A 3BB2A 1K5UA 2VLCA 4IZEA 2NTDA 1BASA 2P23A 5FZZA 3HMYA 3BTAA 1HWPB 3AKFA 4P6AA 4EFRA 2AXMA 3UJ0A 3HN1A 3OJMA 1DZDA 1IRAX 3O4AA 1RY7A 5FNXA 2D22A 4OEGA 4I0YA 4I4PA 3FJKA 3RSJA 3VSZA 2P39A 4I4QA 1N4KA 4Q9GA 4D8HA 3AH4A 2VXTI 1AVXB 2GZBA 4D0ZA 2Z48A 3NJ5A 2F2FC 3B9UA 3NBCA 3E8LC 4FVVA 2VU9A 3PG0A 3V0BA 3CRIA 4AN7B 3BAUA 5F8SA 2ZQNA 3KMVA 2J3PA 2KI4A 4GAIA 3AKIA 4QALA 1SR4A 1DFCA 1TFMB 3O49A 4I4XA 3AH2A 1PZZA 2KLLA 4LO1C 1JT5A 1W3FA 1YF8B 3P6JA 5BXPA 3RTJB 1VCLA 2QN4A 1WD4A 2IHOA 2NP0A 2MC2A 4QKSA 4OEFA 2D43A 2XOAA 31BIA 5GAQA 1AXMA 3CA4A 3N7KA 4F83A 4EEEB 1HCEA 1S0DA 3V0BB 1DZCA 1ISXA 1ILR1 3ZX7A 2IWTB 3V0AA 1DQGA 3I2XA 3FJAA 1FWVA 4USPA 4J2XA 2LIQA 4JKXB 3ZC9A 5JLVA 3A23A 2KKIA 2VXRA 4XFTA 4I37A 4EFPA 4LO3A 3BAHA 3P6IA 4I4UA 1EPWA 2ERMA 1G82A 6I1BA 1ABRB 1BFBA 1JT7A 2NS2A 1RZOB 4QO3A 2RG9B 3O4DA 2Y9XE 4A7KA 2KI6B 3K1XA 3UD8A 1V6XA 1HCDA 3OBTA 3BA4A 4IY8A 3UD9A 3BRGC 4JRAA 1EV2A 1YTOA 4Z9WB 3HOMA 5BXTA 4OWJA 4CJMA 3OJVA 1W3AA 4MZFB 2D7IA 2NVHA 4J23B 4J2SA 4ZOTA 4I1BA 4I4OA 2D20A 1S0LA 4KC3A 1S0EA 4ZFYB 1F31A 3O3QA 1XYFA 1QQKA 4Q91A 2DREA 2VSAA 8I1BA 1YBIA 2D44A 3N0KA 4P0JA 3N7LA 1ISWA 3POKA 4I96A 1Z2VA 3WMVA 4UY4A 4QD2C 4OUJA 4IHZA 5BQUC 1EYLA 4ISQA 3H6QA 3Q7XA 3UDAA 3FUOA 21BIA 1AVUA 1JT4A 5B2HA 5DVHA 4LO0A 4G6MA 5EHAA 3R4SA 4ZLBB 5D62A 4LO7B 3FJ8A 1XZZA 3BAQA 4USOA 2YUGA 4X3AA 4DCKC 2E4MA 1DQOA 4WBCA 4KEIA 1GGPB 4D0TA 1IJTA 2NZ9A 4JPZA 1E0OA 3EF2A 5F90A 3R4UA 3CA1A 1YYNA 3O4CA 3A07A 41BIA 5E24E 1JTCA 1PC8B 3FJIA 4II0A 2FFVA 2Z49A 2D1ZA 4XFUA 1K5VA 1AVWB 5BOWA 1FN0A 4IONA 3FJFA 4I4RA 3V79C 1WD3A 2MIBA 4H9WA 4XFSA 2D23A 4FGFA 4I6IA 1Z0HA 3AKHA 3WO4A 3FJDA 3HALA 1NZKA 2F2FA 1W3GA 3A22A 4MZHA 3T8SA 1G9BA 2L5XA 3O4OA 4XKIA 1HWOB 2Y9GA 3Q7WA 1FQ9A 2Y9WC 3BAOA 2FGFA 4G1RA 4LO1A 5F8WA 2UUSA 3CA0A 3WINC 3WMUA 1PWAA 1UPSA 2D24A 1XHBA 4YOLA 3MALA 5I1BA 2RQ9A 3Q7YA 3OGGA 2LIEA 4PC4A 2HW9A 4I2SA 3VT0A 4EFQA 2VUAA 3IIRA 3VT1A 5BP5C 1CVSA 3RMXA 2Q3NB 3OJ2A 4F34A 5BXRA 3BAGA 4I3NA 3FJCA 3CRHA 1SZ6B 1BLAA 1T9FA 4OEEA 1FMMS 2ZQOA 1QXMA 5DSSB 5D63A 1L2HA 1WBCA 3FJBA 4OW4A 4GAFA 4G9NA 4I1EA 3OBRA 3LTQA 2QYIB 4Q9PA 3V0AB 1G9CA 4IY9A 4MZGB 3PMEA 1IT0A 1BFFA 3HSMA 4EB2B 4X38A 2D7RA 3AZVA 1FV3A 4I4SA 1JY0A 1CE7B 3VWCA 3AH1A 3CAHA 3P53A 2NYYA 3A21A 4G9MA 7I1BA 4I8MA 1FWUA 1S0BA 3C9ZA 3PUBA 4OWLA 4HJJA 5HPZA 5F8YA 3VT2A 1I1EA 4JKQA 4A7ZA 4LO7C 1BFCA 1Q03A 3PHZA 2HZ9A 3AJ5A 4L4HA 2ESUA 1BA7A 1S0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQL B;  3WA1 A;  1FMZ A;  3JRR A;  1S0F A;  5EG6 C;  1M2T B;  1AVA C;  1KNM A;  3D7W B;  1JLX A;  4ZBV B;  3MPP G;  4QBC A;  3BAV A;  3FJJ A;  2DS0 A;  3NBE A;  3QYD A;  3RTI B;  5BQU A;  1IIL A;  4LO8 B;  1YXW A;  4J2K A;  3S8K A;  1TTU A;  3FFZ A;  1Z4S A;  3N7J A;  4IYB A;  1Q1U A;  3UD7 A;  4ZKT B;  4R6U B;  2K4A B;  4I4Y A;  1V6U A;  2RST A;  2BEA A;  3WO2 A;  1TWM A;  1J0S A;  2MLL B;  2ZR1 B;  4HA2 A;  4KEJ A;  4QC4 A;  3IAG C;  2VSE A;  4X39 A;  9ILB A;  4LO2 C;  2Y9F A;  1ISY A;  1RML A;  3O44 A;  3FUQ A;  3NBD A;  4QD2 B;  2FDB M;  1II4 A;  1R8O A;  4QBV A;  1ITB A;  1JT3 A;  4GP0 A;  4H04 A;  5D61 A;  3CQA A;  4ZFU B;  4TLP A;  1ISZ A;  1HIB A;  4LO2 A;  4DEN A;  3HBW A;  3QR5 A;  4HR6 C;  2DRY A;  3VEQ A;  1QQL A;  3LLP A;  1P63 A;  2ET2 A;  1V6V A;  3FJE A;  5BVP I;  3SNV A;  4END A;  1D0H A;  3TC2 A;  1TWE A;  1BAR A;  4IZX A;  3BAD A;  3VUO A;  3O4B A;  3NBN A;  1BFG A;  2AQZ A;  3FJH A;  3IM5 A;  4QKR A;  1SR4 C;  2BFH A;  5FZU A;  2KH2 A;  1JQZ A;  5DZU A;  4ZGR B;  1TIE A;  3CA6 A;  3I29 B;  2K8R A;  3F62 B;  1R8N A;  2HWM A;  1RG8 A;  2AAI B;  4A7Y A;  2R9K B;  2M49 A;  1FV2 A;  3I2A A;  3BA7 A;  5EC5 A;  4JAW A;  1S0C A;  4ZA3 B;  5G00 A;  2GO2 A;  2HWA A;  3WIN A;  5DUY A;  4AN6 A;  5BXS A;  1MC9 A;  1XG6 A;  3BRF A;  1PUM B;  2WBC A;  3AZW A;  4LO3 C;  1IHK A;  4J2Y A;  2FO1 A;  4Z8S B;  1G9D A;  1DIW A;  2WRY A;  2X2S A;  4IQP A;  1PUU B;  5BP5 A;  3AJ6 A;  3IM6 A;  1DLL A;  3H6R A;  4X37 A;  1FGA A;  3N7M A;  1V6W A;  5FZY A;  3ZXD A;  2AFG A;  3WO3 A;  1G9A A;  1ONK B;  1EVT A;  1AF9 A;  4KBB A;  3UJ4 A;  1I1B A;  2DRZ A;  4ZFW B;  4I7I A;  4ISR A;  1HKN A;  1NUN A;  5FNW A;  1ISV A;  2K43 A;  3BX1 C;  1M16 A;  4EKX B;  3H6R B;  3OGF A;  3O5W B;  4GP3 A;  3ZC8 A;  3S8J A;  4GOV A;  3ILA A;  1HWM B;  3ZXG A;  3CRG A;  4KEK A;  3FJ9 A;  1MD6 A;  4L4I A;  1DFQ A;  1TOO A;  1T4Q A;  3IM7 A;  4GOY A;  2F8X C;  3CA5 A;  1Q04 A;  4OWK A;  3CU1 B;  3AKG A;  3VSF A;  2NM1 A;  3H6S E;  1WBA A;  1BLD A;  1IOB A;  1HWN B;  2I1B A;  1AFC A;  3BA5 A;  1TP0 A;  1IRP A;  4G6J A;  4LO0 C;  3W9T A;  4P0K A;  4JQ0 A;  3BRD A;  1DJS B;  4P0L A;  2FFU A;  2X2T A;  5JMC A;  2E4M C;  1JLY A;  3JUT A;  1A8D A;  2Q9X A;  3CA3 A;  4DEP A;  3F1R A;  3FGM A;  2BEB A;  4I4V A;  3RMY A;  4JP0 A;  3BB2 A;  1K5U A;  2VLC A;  4IZE A;  2NTD A;  1BAS A;  2P23 A;  5FZZ A;  3HMY A;  3BTA A;  1HWP B;  3AKF A;  4P6A A;  4EFR A;  2AXM A;  3UJ0 A;  3HN1 A;  3OJM A;  1DZD A;  1IRA X;  3O4A A;  1RY7 A;  5FNX A;  2D22 A;  4OEG A;  4I0Y A;  4I4P A;  3FJK A;  3RSJ A;  3VSZ A;  2P39 A;  4I4Q A;  1N4K A;  4Q9G A;  4D8H A;  3AH4 A;  2VXT I;  1AVX B;  2GZB A;  4D0Z A;  2Z48 A;  3NJ5 A;  2F2F C;  3B9U A;  3NBC A;  3E8L C;  4FVV A;  2VU9 A;  3PG0 A;  3V0B A;  3CRI A;  4AN7 B;  3BAU A;  5F8S A;  2ZQN A;  3KMV A;  2J3P A;  2KI4 A;  4GAI A;  3AKI A;  4QAL A;  1SR4 A;  1DFC A;  1TFM B;  3O49 A;  4I4X A;  3AH2 A;  1PZZ A;  2KLL A;  4LO1 C;  1JT5 A;  1W3F A;  1YF8 B;  3P6J A;  5BXP A;  3RTJ B;  1VCL A;  2QN4 A;  1WD4 A;  2IHO A;  2NP0 A;  2MC2 A;  4QKS A;  4OEF A;  2D43 A;  2XOA A;  31BI A;  5GAQ A;  1AXM A;  3CA4 A;  3N7K A;  4F83 A;  4EEE B;  1HCE A;  1S0D A;  3V0B B;  1DZC A;  1ISX A;  1ILR 1;  3ZX7 A;  2IWT B;  3V0A A;  1DQG A;  3I2X A;  3FJA A;  1FWV A;  4USP A;  4J2X A;  2LIQ A;  4JKX B;  3ZC9 A;  5JLV A;  3A23 A;  2KKI A;  2VXR A;  4XFT A;  4I37 A;  4EFP A;  4LO3 A;  3BAH A;  3P6I A;  4I4U A;  1EPW A;  2ERM A;  1G82 A;  6I1B A;  1ABR B;  1BFB A;  1JT7 A;  1RZO B;  4QO3 A;  2RG9 B;  3O4D A;  2Y9X E;  4A7K A;  2KI6 B;  3K1X A;  3UD8 A;  1V6X A;  1HCD A;  3OBT A;  3BA4 A;  4IY8 A;  3UD9 A;  3BRG C;  4JRA A;  1EV2 A;  1YTO A;  4Z9W B;  3HOM A;  5BXT A;  4OWJ A;  4CJM A;  3OJV A;  1W3A A;  2D7I A;  2NVH A;  4J23 B;  4J2S A;  4ZOT A;  4I1B A;  4I4O A;  2D20 A;  1S0L A;  4KC3 A;  1S0E A;  4ZFY B;  1F31 A;  3O3Q A;  1XYF A;  1QQK A;  4Q91 A;  2DRE A;  2VSA A;  8I1B A;  1YBI A;  2D44 A;  3N0K A;  4P0J A;  3N7L A;  1ISW A;  3POK A;  4I96 A;  1Z2V A;  3WMV A;  4QD2 C;  4OUJ A;  4IHZ A;  5BQU C;  1EYL A;  4ISQ A;  3H6Q A;  3Q7X A;  3UDA A;  3FUO A;  21BI A;  1AVU A;  1JT4 A;  5B2H A;  5DVH A;  4LO0 A;  4G6M A;  5EHA A;  3R4S A;  4ZLB B;  5D62 A;  4LO7 B;  3FJ8 A;  1XZZ A;  3BAQ A;  4USO A;  2YUG A;  4X3A A;  4DCK C;  2E4M A;  1DQO A;  4WBC A;  4KEI A;  1GGP B;  4D0T A;  1IJT A;  2NZ9 A;  4JPZ A;  1E0O A;  3EF2 A;  5F90 A;  3R4U A;  3CA1 A;  1YYN A;  3O4C A;  3A07 A;  41BI A;  5E24 E;  1JTC A;  1PC8 B;  3FJI A;  4II0 A;  2FFV A;  2Z49 A;  2D1Z A;  4XFU A;  1K5V A;  1AVW B;  5BOW A;  1FN0 A;  4ION A;  3FJF A;  4I4R A;  3V79 C;  1WD3 A;  2MIB A;  4H9W A;  4XFS A;  2D23 A;  4FGF A;  4I6I A;  1Z0H A;  3AKH A;  3WO4 A;  3FJD A;  3HAL A;  1NZK A;  2F2F A;  1W3G A;  3A22 A;  3T8S A;  1G9B A;  2L5X A;  3O4O A;  4XKI A;  1HWO B;  2Y9G A;  3Q7W A;  1FQ9 A;  2Y9W C;  3BAO A;  2FGF A;  4G1R A;  4LO1 A;  5F8W A;  2UUS A;  3CA0 A;  3WIN C;  3WMU A;  1PWA A;  1UPS A;  2D24 A;  1XHB A;  4YOL A;  3MAL A;  5I1B A;  2RQ9 A;  3Q7Y A;  3OGG A;  2LIE A;  4PC4 A;  2HW9 A;  4I2S A;  3VT0 A;  4EFQ A;  2VUA A;  3IIR A;  3VT1 A;  5BP5 C;  1CVS A;  3RMX A;  2Q3N B;  3OJ2 A;  4F34 A;  5BXR A;  3BAG A;  4I3N A;  3FJC A;  3CRH A;  1SZ6 B;  1BLA A;  1T9F A;  4OEE A;  1FMM S;  2ZQO A;  1QXM A;  5DSS B;  5D63 A;  1L2H A;  1WBC A;  3FJB A;  4OW4 A;  4GAF A;  4G9N A;  4I1E A;  3OBR A;  3LTQ A;  2QYI B;  4Q9P A;  3V0A B;  1G9C A;  4IY9 A;  3PME A;  1IT0 A;  1BFF A;  3HSM A;  4EB2 B;  4X38 A;  2D7R A;  3AZV A;  1FV3 A;  4I4S A;  1JY0 A;  1CE7 B;  3VWC A;  3AH1 A;  3CAH A;  3P53 A;  2NYY A;  3A21 A;  4G9M A;  7I1B A;  4I8M A;  1FWU A;  1S0B A;  3C9Z A;  3PUB A;  4OWL A;  4HJJ A;  5HPZ A;  5F8Y A;  3VT2 A;  1I1E A;  4JKQ A;  4A7Z A;  4LO7 C;  1BFC A;  1Q03 A;  3PHZ A;  2HZ9 A;  3AJ5 A;  4L4H A;  2ESU A;  1BA7 A;  1S0G A; 
#chains in the Genus database with same CATH topology
 1OQL B;  3WA1 A;  1FMZ A;  3JRR A;  1S0F A;  5EG6 C;  1M2T B;  1AVA C;  1KNM A;  3D7W B;  1JLX A;  4ZBV B;  3MPP G;  4QBC A;  3BAV A;  3FJJ A;  2DS0 A;  3NBE A;  3QYD A;  3RTI B;  5BQU A;  1IIL A;  4LO8 B;  1YXW A;  4J2K A;  3S8K A;  1TTU A;  3FFZ A;  1Z4S A;  3N7J A;  4IYB A;  1Q1U A;  3UD7 A;  4ZKT B;  4R6U B;  2K4A B;  4I4Y A;  1V6U A;  2RST A;  2BEA A;  3WO2 A;  1TWM A;  1J0S A;  2MLL B;  2ZR1 B;  4HA2 A;  4KEJ A;  4QC4 A;  3IAG C;  2VSE A;  4X39 A;  9ILB A;  4LO2 C;  2Y9F A;  1ISY A;  1RML A;  3O44 A;  3FUQ A;  3NBD A;  4QD2 B;  2FDB M;  1II4 A;  1R8O A;  4QBV A;  1ITB A;  1JT3 A;  4GP0 A;  4H04 A;  5D61 A;  3CQA A;  4ZFU B;  4TLP A;  1ISZ A;  1HIB A;  4LO2 A;  4DEN A;  3HBW A;  3QR5 A;  4HR6 C;  2DRY A;  3VEQ A;  1QQL A;  3LLP A;  1P63 A;  2ET2 A;  1V6V A;  3FJE A;  5BVP I;  3SNV A;  4END A;  1D0H A;  3TC2 A;  1TWE A;  1BAR A;  4IZX A;  3BAD A;  3VUO A;  3O4B A;  3NBN A;  1BFG A;  2AQZ A;  3FJH A;  3IM5 A;  4QKR A;  1SR4 C;  2BFH A;  5FZU A;  2KH2 A;  1JQZ A;  5DZU A;  4ZGR B;  1TIE A;  3CA6 A;  3I29 B;  2K8R A;  3F62 B;  1R8N A;  2HWM A;  1RG8 A;  2AAI B;  4A7Y A;  2R9K B;  2M49 A;  1FV2 A;  3I2A A;  3BA7 A;  5EC5 A;  4JAW A;  1S0C A;  4ZA3 B;  5G00 A;  2GO2 A;  2HWA A;  3WIN A;  5DUY A;  4AN6 A;  5BXS A;  1MC9 A;  1XG6 A;  3BRF A;  1PUM B;  2WBC A;  3AZW A;  4LO3 C;  1IHK A;  4J2Y A;  2FO1 A;  4Z8S B;  1G9D A;  1DIW A;  2WRY A;  2X2S A;  4IQP A;  1PUU B;  5BP5 A;  3AJ6 A;  3IM6 A;  1DLL A;  3H6R A;  4X37 A;  1FGA A;  3N7M A;  1V6W A;  5FZY A;  3ZXD A;  2AFG A;  3WO3 A;  1G9A A;  1ONK B;  1EVT A;  1AF9 A;  4KBB A;  3UJ4 A;  1I1B A;  2DRZ A;  4ZFW B;  4I7I A;  4ISR A;  1HKN A;  1NUN A;  5FNW A;  1ISV A;  2K43 A;  3BX1 C;  1M16 A;  4EKX B;  3H6R B;  3OGF A;  3O5W B;  4GP3 A;  3ZC8 A;  3S8J A;  4GOV A;  3ILA A;  1HWM B;  3ZXG A;  3CRG A;  4KEK A;  3FJ9 A;  1MD6 A;  4L4I A;  1DFQ A;  1TOO A;  1T4Q A;  3IM7 A;  4GOY A;  2F8X C;  3CA5 A;  1Q04 A;  4OWK A;  3CU1 B;  3AKG A;  3VSF A;  2NM1 A;  3H6S E;  1WBA A;  1BLD A;  1IOB A;  1HWN B;  2I1B A;  1AFC A;  3BA5 A;  1TP0 A;  1IRP A;  4G6J A;  4LO0 C;  3W9T A;  4P0K A;  4JQ0 A;  3BRD A;  1DJS B;  4P0L A;  2FFU A;  2X2T A;  5JMC A;  2E4M C;  1JLY A;  3JUT A;  1A8D A;  2Q9X A;  3CA3 A;  4DEP A;  3F1R A;  3FGM A;  2BEB A;  4I4V A;  3RMY A;  4JP0 A;  4H75 A;  3BB2 A;  1K5U A;  2VLC A;  4IZE A;  2NTD A;  1BAS A;  2P23 A;  5FZZ A;  3HMY A;  3BTA A;  1HWP B;  3AKF A;  4P6A A;  4EFR A;  2AXM A;  3UJ0 A;  3HN1 A;  3OJM A;  1DZD A;  1IRA X;  3O4A A;  1RY7 A;  5FNX A;  2D22 A;  4OEG A;  4I0Y A;  4I4P A;  3FJK A;  3RSJ A;  3VSZ A;  2P39 A;  4I4Q A;  1N4K A;  4Q9G A;  4D8H A;  3AH4 A;  2VXT I;  1AVX B;  2GZB A;  4D0Z A;  2Z48 A;  3NJ5 A;  2F2F C;  3B9U A;  3NBC A;  3E8L C;  4FVV A;  2VU9 A;  3PG0 A;  3V0B A;  3CRI A;  4AN7 B;  3BAU A;  5F8S A;  2ZQN A;  3KMV A;  2J3P A;  2KI4 A;  4GAI A;  3AKI A;  4QAL A;  1SR4 A;  1DFC A;  1TFM B;  3O49 A;  4I4X A;  3AH2 A;  1PZZ A;  2KLL A;  4LO1 C;  1JT5 A;  1W3F A;  1YF8 B;  3P6J A;  5BXP A;  3RTJ B;  1VCL A;  2QN4 A;  1WD4 A;  2IHO A;  2NP0 A;  2MC2 A;  4QKS A;  4OEF A;  2D43 A;  2XOA A;  31BI A;  5GAQ A;  1AXM A;  3CA4 A;  3N7K A;  4F83 A;  4EEE B;  1HCE A;  1S0D A;  3V0B B;  1DZC A;  1ISX A;  1ILR 1;  3ZX7 A;  2IWT B;  3V0A A;  1DQG A;  3I2X A;  3FJA A;  1FWV A;  4USP A;  4J2X A;  2LIQ A;  4JKX B;  3ZC9 A;  5JLV A;  3A23 A;  2KKI A;  2VXR A;  4XFT A;  4I37 A;  4EFP A;  4LO3 A;  3BAH A;  3P6I A;  4I4U A;  1EPW A;  2ERM A;  1G82 A;  6I1B A;  1ABR B;  1BFB A;  1JT7 A;  2NS2 A;  1RZO B;  4QO3 A;  2RG9 B;  3O4D A;  2Y9X E;  4A7K A;  2KI6 B;  3K1X A;  3UD8 A;  1V6X A;  1HCD A;  3OBT A;  3BA4 A;  4IY8 A;  3UD9 A;  3BRG C;  4JRA A;  1EV2 A;  1YTO A;  4Z9W B;  3HOM A;  5BXT A;  4OWJ A;  4CJM A;  3OJV A;  1W3A A;  4MZF B;  2D7I A;  2NVH A;  4J23 B;  4J2S A;  4ZOT A;  4I1B A;  4I4O A;  2D20 A;  1S0L A;  4KC3 A;  1S0E A;  4ZFY B;  1F31 A;  3O3Q A;  1XYF A;  1QQK A;  4Q91 A;  2DRE A;  2VSA A;  8I1B A;  1YBI A;  2D44 A;  3N0K A;  4P0J A;  3N7L A;  1ISW A;  3POK A;  4I96 A;  1Z2V A;  3WMV A;  4UY4 A;  4QD2 C;  4OUJ A;  4IHZ A;  5BQU C;  1EYL A;  4ISQ A;  3H6Q A;  3Q7X A;  3UDA A;  3FUO A;  21BI A;  1AVU A;  1JT4 A;  5B2H A;  5DVH A;  4LO0 A;  4G6M A;  5EHA A;  3R4S A;  4ZLB B;  5D62 A;  4LO7 B;  3FJ8 A;  1XZZ A;  3BAQ A;  4USO A;  2YUG A;  4X3A A;  4DCK C;  2E4M A;  1DQO A;  4WBC A;  4KEI A;  1GGP B;  4D0T A;  1IJT A;  2NZ9 A;  4JPZ A;  1E0O A;  3EF2 A;  5F90 A;  3R4U A;  3CA1 A;  1YYN A;  3O4C A;  3A07 A;  41BI A;  5E24 E;  1JTC A;  1PC8 B;  3FJI A;  4II0 A;  2FFV A;  2Z49 A;  2D1Z A;  4XFU A;  1K5V A;  1AVW B;  5BOW A;  1FN0 A;  4ION A;  3FJF A;  4I4R A;  3V79 C;  1WD3 A;  2MIB A;  4H9W A;  4XFS A;  2D23 A;  4FGF A;  4I6I A;  1Z0H A;  3AKH A;  3WO4 A;  3FJD A;  3HAL A;  1NZK A;  2F2F A;  1W3G A;  3A22 A;  4MZH A;  3T8S A;  1G9B A;  2L5X A;  3O4O A;  4XKI A;  1HWO B;  2Y9G A;  3Q7W A;  1FQ9 A;  2Y9W C;  3BAO A;  2FGF A;  4G1R A;  4LO1 A;  5F8W A;  2UUS A;  3CA0 A;  3WIN C;  3WMU A;  1PWA A;  1UPS A;  2D24 A;  1XHB A;  4YOL A;  3MAL A;  5I1B A;  2RQ9 A;  3Q7Y A;  3OGG A;  2LIE A;  4PC4 A;  2HW9 A;  4I2S A;  3VT0 A;  4EFQ A;  2VUA A;  3IIR A;  3VT1 A;  5BP5 C;  1CVS A;  3RMX A;  2Q3N B;  3OJ2 A;  4F34 A;  5BXR A;  3BAG A;  4I3N A;  3FJC A;  3CRH A;  1SZ6 B;  1BLA A;  1T9F A;  4OEE A;  1FMM S;  2ZQO A;  1QXM A;  5DSS B;  5D63 A;  1L2H A;  1WBC A;  3FJB A;  4OW4 A;  4GAF A;  4G9N A;  4I1E A;  3OBR A;  3LTQ A;  2QYI B;  4Q9P A;  3V0A B;  1G9C A;  4IY9 A;  4MZG B;  3PME A;  1IT0 A;  1BFF A;  3HSM A;  4EB2 B;  4X38 A;  2D7R A;  3AZV A;  1FV3 A;  4I4S A;  1JY0 A;  1CE7 B;  3VWC A;  3AH1 A;  3CAH A;  3P53 A;  2NYY A;  3A21 A;  4G9M A;  7I1B A;  4I8M A;  1FWU A;  1S0B A;  3C9Z A;  3PUB A;  4OWL A;  4HJJ A;  5HPZ A;  5F8Y A;  3VT2 A;  1I1E A;  4JKQ A;  4A7Z A;  4LO7 C;  1BFC A;  1Q03 A;  3PHZ A;  2HZ9 A;  3AJ5 A;  4L4H A;  2ESU A;  1BA7 A;  1S0G A; 
#chains in the Genus database with same CATH homology
 1OQL B;  3WA1 A;  1FMZ A;  3JRR A;  1S0F A;  5EG6 C;  1M2T B;  1AVA C;  1KNM A;  3D7W B;  1JLX A;  4ZBV B;  3MPP G;  4QBC A;  3BAV A;  3FJJ A;  2DS0 A;  3NBE A;  3QYD A;  3RTI B;  5BQU A;  1IIL A;  4LO8 B;  1YXW A;  4J2K A;  3S8K A;  1TTU A;  3FFZ A;  1Z4S A;  3N7J A;  4IYB A;  1Q1U A;  3UD7 A;  4ZKT B;  4R6U B;  2K4A B;  4I4Y A;  1V6U A;  2RST A;  2BEA A;  3WO2 A;  1TWM A;  1J0S A;  2MLL B;  2ZR1 B;  4HA2 A;  4KEJ A;  4QC4 A;  3IAG C;  2VSE A;  4X39 A;  9ILB A;  4LO2 C;  2Y9F A;  1ISY A;  1RML A;  3O44 A;  3FUQ A;  3NBD A;  4QD2 B;  2FDB M;  1II4 A;  1R8O A;  4QBV A;  1ITB A;  1JT3 A;  4GP0 A;  4H04 A;  5D61 A;  3CQA A;  4ZFU B;  4TLP A;  1ISZ A;  1HIB A;  4LO2 A;  4DEN A;  3HBW A;  3QR5 A;  4HR6 C;  2DRY A;  3VEQ A;  1QQL A;  3LLP A;  1P63 A;  2ET2 A;  1V6V A;  3FJE A;  5BVP I;  3SNV A;  4END A;  1D0H A;  3TC2 A;  1TWE A;  1BAR A;  4IZX A;  3BAD A;  3VUO A;  3O4B A;  3NBN A;  1BFG A;  2AQZ A;  3FJH A;  3IM5 A;  4QKR A;  1SR4 C;  2BFH A;  5FZU A;  2KH2 A;  1JQZ A;  5DZU A;  4ZGR B;  1TIE A;  3CA6 A;  3I29 B;  2K8R A;  3F62 B;  1R8N A;  2HWM A;  1RG8 A;  2AAI B;  4A7Y A;  2R9K B;  2M49 A;  1FV2 A;  3I2A A;  3BA7 A;  5EC5 A;  4JAW A;  1S0C A;  4ZA3 B;  5G00 A;  2GO2 A;  2HWA A;  3WIN A;  5DUY A;  4AN6 A;  5BXS A;  1MC9 A;  1XG6 A;  3BRF A;  1PUM B;  2WBC A;  3AZW A;  4LO3 C;  1IHK A;  4J2Y A;  2FO1 A;  4Z8S B;  1G9D A;  1DIW A;  2WRY A;  2X2S A;  4IQP A;  1PUU B;  5BP5 A;  3AJ6 A;  3IM6 A;  1DLL A;  3H6R A;  4X37 A;  1FGA A;  3N7M A;  1V6W A;  5FZY A;  3ZXD A;  2AFG A;  3WO3 A;  1G9A A;  1ONK B;  1EVT A;  1AF9 A;  4KBB A;  3UJ4 A;  1I1B A;  2DRZ A;  4ZFW B;  4I7I A;  4ISR A;  1HKN A;  1NUN A;  5FNW A;  1ISV A;  2K43 A;  3BX1 C;  1M16 A;  4EKX B;  3H6R B;  3OGF A;  3O5W B;  4GP3 A;  3ZC8 A;  3S8J A;  4GOV A;  3ILA A;  1HWM B;  3ZXG A;  3CRG A;  4KEK A;  3FJ9 A;  1MD6 A;  4L4I A;  1DFQ A;  1TOO A;  1T4Q A;  3IM7 A;  4GOY A;  2F8X C;  3CA5 A;  1Q04 A;  4OWK A;  3CU1 B;  3AKG A;  3VSF A;  2NM1 A;  3H6S E;  1WBA A;  1BLD A;  1IOB A;  1HWN B;  2I1B A;  1AFC A;  3BA5 A;  1TP0 A;  1IRP A;  4G6J A;  4LO0 C;  3W9T A;  4P0K A;  4JQ0 A;  3BRD A;  1DJS B;  4P0L A;  2FFU A;  2X2T A;  5JMC A;  2E4M C;  1JLY A;  3JUT A;  1A8D A;  2Q9X A;  3CA3 A;  4DEP A;  3F1R A;  3FGM A;  2BEB A;  4I4V A;  3RMY A;  4JP0 A;  4H75 A;  3BB2 A;  1K5U A;  2VLC A;  4IZE A;  2NTD A;  1BAS A;  2P23 A;  5FZZ A;  3HMY A;  3BTA A;  1HWP B;  3AKF A;  4P6A A;  4EFR A;  2AXM A;  3UJ0 A;  3HN1 A;  3OJM A;  1DZD A;  1IRA X;  3O4A A;  1RY7 A;  5FNX A;  2D22 A;  4OEG A;  4I0Y A;  4I4P A;  3FJK A;  3RSJ A;  3VSZ A;  2P39 A;  4I4Q A;  1N4K A;  4Q9G A;  4D8H A;  3AH4 A;  2VXT I;  1AVX B;  2GZB A;  4D0Z A;  2Z48 A;  3NJ5 A;  2F2F C;  3B9U A;  3NBC A;  3E8L C;  4FVV A;  2VU9 A;  3PG0 A;  3V0B A;  3CRI A;  4AN7 B;  3BAU A;  5F8S A;  2ZQN A;  3KMV A;  2J3P A;  2KI4 A;  4GAI A;  3AKI A;  4QAL A;  1SR4 A;  1DFC A;  1TFM B;  3O49 A;  4I4X A;  3AH2 A;  1PZZ A;  2KLL A;  4LO1 C;  1JT5 A;  1W3F A;  1YF8 B;  3P6J A;  5BXP A;  3RTJ B;  1VCL A;  2QN4 A;  1WD4 A;  2IHO A;  2NP0 A;  2MC2 A;  4QKS A;  4OEF A;  2D43 A;  2XOA A;  31BI A;  5GAQ A;  1AXM A;  3CA4 A;  3N7K A;  4F83 A;  4EEE B;  1HCE A;  1S0D A;  3V0B B;  1DZC A;  1ISX A;  1ILR 1;  3ZX7 A;  2IWT B;  3V0A A;  1DQG A;  3I2X A;  3FJA A;  1FWV A;  4USP A;  4J2X A;  2LIQ A;  4JKX B;  3ZC9 A;  5JLV A;  3A23 A;  2KKI A;  2VXR A;  4XFT A;  4I37 A;  4EFP A;  4LO3 A;  3BAH A;  3P6I A;  4I4U A;  1EPW A;  2ERM A;  1G82 A;  6I1B A;  1ABR B;  1BFB A;  1JT7 A;  2NS2 A;  1RZO B;  4QO3 A;  2RG9 B;  3O4D A;  2Y9X E;  4A7K A;  2KI6 B;  3K1X A;  3UD8 A;  1V6X A;  1HCD A;  3OBT A;  3BA4 A;  4IY8 A;  3UD9 A;  3BRG C;  4JRA A;  1EV2 A;  1YTO A;  4Z9W B;  3HOM A;  5BXT A;  4OWJ A;  4CJM A;  3OJV A;  1W3A A;  4MZF B;  2D7I A;  2NVH A;  4J23 B;  4J2S A;  4ZOT A;  4I1B A;  4I4O A;  2D20 A;  1S0L A;  4KC3 A;  1S0E A;  4ZFY B;  1F31 A;  3O3Q A;  1XYF A;  1QQK A;  4Q91 A;  2DRE A;  2VSA A;  8I1B A;  1YBI A;  2D44 A;  3N0K A;  4P0J A;  3N7L A;  1ISW A;  3POK A;  4I96 A;  1Z2V A;  3WMV A;  4UY4 A;  4QD2 C;  4OUJ A;  4IHZ A;  5BQU C;  1EYL A;  4ISQ A;  3H6Q A;  3Q7X A;  3UDA A;  3FUO A;  21BI A;  1AVU A;  1JT4 A;  5B2H A;  5DVH A;  4LO0 A;  4G6M A;  5EHA A;  3R4S A;  4ZLB B;  5D62 A;  4LO7 B;  3FJ8 A;  1XZZ A;  3BAQ A;  4USO A;  2YUG A;  4X3A A;  4DCK C;  2E4M A;  1DQO A;  4WBC A;  4KEI A;  1GGP B;  4D0T A;  1IJT A;  2NZ9 A;  4JPZ A;  1E0O A;  3EF2 A;  5F90 A;  3R4U A;  3CA1 A;  1YYN A;  3O4C A;  3A07 A;  41BI A;  5E24 E;  1JTC A;  1PC8 B;  3FJI A;  4II0 A;  2FFV A;  2Z49 A;  2D1Z A;  4XFU A;  1K5V A;  1AVW B;  5BOW A;  1FN0 A;  4ION A;  3FJF A;  4I4R A;  3V79 C;  1WD3 A;  2MIB A;  4H9W A;  4XFS A;  2D23 A;  4FGF A;  4I6I A;  1Z0H A;  3AKH A;  3WO4 A;  3FJD A;  3HAL A;  1NZK A;  2F2F A;  1W3G A;  3A22 A;  4MZH A;  3T8S A;  1G9B A;  2L5X A;  3O4O A;  4XKI A;  1HWO B;  2Y9G A;  3Q7W A;  1FQ9 A;  2Y9W C;  3BAO A;  2FGF A;  4G1R A;  4LO1 A;  5F8W A;  2UUS A;  3CA0 A;  3WIN C;  3WMU A;  1PWA A;  1UPS A;  2D24 A;  1XHB A;  4YOL A;  3MAL A;  5I1B A;  2RQ9 A;  3Q7Y A;  3OGG A;  2LIE A;  4PC4 A;  2HW9 A;  4I2S A;  3VT0 A;  4EFQ A;  2VUA A;  3IIR A;  3VT1 A;  5BP5 C;  1CVS A;  3RMX A;  2Q3N B;  3OJ2 A;  4F34 A;  5BXR A;  3BAG A;  4I3N A;  3FJC A;  3CRH A;  1SZ6 B;  1BLA A;  1T9F A;  4OEE A;  1FMM S;  2ZQO A;  1QXM A;  5DSS B;  5D63 A;  1L2H A;  1WBC A;  3FJB A;  4OW4 A;  4GAF A;  4G9N A;  4I1E A;  3OBR A;  3LTQ A;  2QYI B;  4Q9P A;  3V0A B;  1G9C A;  4IY9 A;  4MZG B;  3PME A;  1IT0 A;  1BFF A;  3HSM A;  4EB2 B;  4X38 A;  2D7R A;  3AZV A;  1FV3 A;  4I4S A;  1JY0 A;  1CE7 B;  3VWC A;  3AH1 A;  3CAH A;  3P53 A;  2NYY A;  3A21 A;  4G9M A;  7I1B A;  4I8M A;  1FWU A;  1S0B A;  3C9Z A;  3PUB A;  4OWL A;  4HJJ A;  5HPZ A;  5F8Y A;  3VT2 A;  1I1E A;  4JKQ A;  4A7Z A;  4LO7 C;  1BFC A;  1Q03 A;  3PHZ A;  2HZ9 A;  3AJ5 A;  4L4H A;  2ESU A;  1BA7 A;  1S0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...