2RQAA

Solution structure of lgp2 ctd
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
137
structure length
137
Chain Sequence
b'GPHMQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase DHX58
publication title Solution Structures of Cytosolic RNA Sensor MDA5 and LGP2 C-terminal Domains: IDENTIFICATION OF THE RNA RECOGNITION LOOP IN RIG-I-LIKE RECEPTORS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 14
structure length 137
sequence length 137
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11648 RIG-I_C-RD C-terminal domain of RIG-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.30 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A 2rqaA00
3LRRA 4BPBA 3ZD7A 2RMJA 4AY2A 4A2XA 4A2VA 3ZD6A 3NCUA 2W4RA 5F9HA 2RQBA 3EQTA 3GA3A 2YKGA 2QFDA 2QFBA 2RQAA 5E3HA 5F98A 5F9FA 3LRNA 3OG8A
chains in the Genus database with same CATH superfamily
2FU5A 1L1DA 2LOYA 3FACA 1FWQA 3LRRA 4BPBA 3HCJA 3WX1A 3ZD7A 2LVLA 2RMJA 4AY2A 4A2XA 1YZ1A 3CEZA 4V31A 3EBMA 1TXJA 3WX2A 4A2VA 1HXRA 3ZD6A 4CI3B 3NCUA 2W4RA 3E0OA 3HCHA 5F9HA 2RQBA 2KWBA 2HR9A 3EQTA 1H6QA 5AMHA 3GA3A 3HCGA 3DJMA 2YKGA 2KZNA 1H7YA 2QFDA 3E0MA 2QFBA 3HCIA 4TZ4C 2KV1A 2K8DA 2RQAA 5E3HA 5F98A 4TZCA 4V2YA 4TZUA 3MAOA 4V2ZA 5F9FA 4CI2B 3CXKA 3P3KA 4CI1B 4V30A 3LRNA 3OG8A
chains in the Genus database with same CATH topology
2FU5A 2LOYA 3FACA 1FWQA 3LRRA 4BPBA 3ZD7A 2LVLA 2RMJA 4AY2A 4A2XA 1YZ1A 3EBMA 1TXJA 4A2VA 3ZD6A 1HXRA 3NCUA 2W4RA 5F9HA 2RQBA 2KWBA 2HR9A 3EQTA 1H6QA 3GA3A 3DJMA 2YKGA 1H7YA 2QFDA 2QFBA 2RQAA 5E3HA 5F98A 5F9FA 3P3KA 3LRNA 3OG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LRR A;  4BPB A;  3ZD7 A;  2RMJ A;  4AY2 A;  4A2X A;  4A2V A;  3ZD6 A;  3NCU A;  2W4R A;  5F9H A;  2RQB A;  3EQT A;  3GA3 A;  2YKG A;  2QFD A;  2QFB A;  2RQA A;  5E3H A;  5F98 A;  5F9F A;  3LRN A;  3OG8 A; 
#chains in the Genus database with same CATH topology
 2FU5 A;  1L1D A;  2LOY A;  3FAC A;  1FWQ A;  3LRR A;  4BPB A;  3HCJ A;  3WX1 A;  3ZD7 A;  2LVL A;  2RMJ A;  4AY2 A;  4A2X A;  1YZ1 A;  3CEZ A;  4V31 A;  3EBM A;  1TXJ A;  3WX2 A;  4A2V A;  1HXR A;  3ZD6 A;  4CI3 B;  3NCU A;  2W4R A;  3E0O A;  3HCH A;  5F9H A;  2RQB A;  2KWB A;  2HR9 A;  3EQT A;  1H6Q A;  5AMH A;  3GA3 A;  3HCG A;  3DJM A;  2YKG A;  2KZN A;  1H7Y A;  2QFD A;  3E0M A;  2QFB A;  3HCI A;  4TZ4 C;  2KV1 A;  2K8D A;  2RQA A;  5E3H A;  5F98 A;  4TZC A;  4V2Y A;  4TZU A;  3MAO A;  4V2Z A;  5F9F A;  4CI2 B;  3CXK A;  3P3K A;  4CI1 B;  4V30 A;  3LRN A;  3OG8 A; 
#chains in the Genus database with same CATH homology
 2FU5 A;  2LOY A;  3FAC A;  1FWQ A;  3LRR A;  4BPB A;  3ZD7 A;  2LVL A;  2RMJ A;  4AY2 A;  4A2X A;  1YZ1 A;  3EBM A;  1TXJ A;  4A2V A;  3ZD6 A;  1HXR A;  3NCU A;  2W4R A;  5F9H A;  2RQB A;  2KWB A;  2HR9 A;  3EQT A;  1H6Q A;  3GA3 A;  3DJM A;  2YKG A;  1H7Y A;  2QFD A;  2QFB A;  2RQA A;  5E3H A;  5F98 A;  5F9F A;  3P3K A;  3LRN A;  3OG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...