2RQCA

Solution structure of rna-binding domain 3 of cugbp1 in complex with rna (ug)3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CUG-BP- and ETR-3-like factor 1
publication title Structural basis for the sequence-specific RNA-recognition mechanism of human CUG-BP1 RRM3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/rna
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rqcA00
2HGLA 2MPUA 1X4BA 2YH0A 3Q2SC 2PE8A 2DH7A 2DNRA 1H2TZ 1XN9A 1U1RA 2M7SA 1Q7YT 1A7GE 3SDEB 5CXTA 2OSQA 1F9FA 3G4SS 2NLWA 4CQ1A 3CCVS 3D2WA 3UCGA 2GO9A 3IWNC 2D9PA 3NNHA 3HHNB 3R1LA 3U1MA 3L3CA 2CQ0A 2VOPA 1PO6A 1G2EA 2ADBA 2VOOA 2KHCA 1KOHA 2MYFA 3VAGA 2DGOA 2L08A 1YITS 3N9UC 2MZQA 1DZ5A 2V94A 5GAHU 1P1TA 1YWXA 4WIIA 2MQPA 3Q2TC 4LMZA 2DHGA 2KVIA 2RS8A 2MQQA 2N3LA 4Y00A 5IM0A 3EGNA 2AYGA 3UD3P 2LECA 2RNEA 4WFBQ 4QU6A 5LXYA 2MJUA 3LPYA 4CH0S 4WCEQ 2MGZB 3P6YC 2CQHA 5DM6Q 1N88A 2M2BA 2DGVA 3IRWP 4Y0FA 2G4BA 3PIPQ 5CA5A 3J7ZT 2L41A 3CMAS 2XS5A 1X4EA 5LJ3Y 4TU9A 2OIHA 1VQKS 1VBXA 2AYBA 4TU7A 2E44A 4FXWA 1X5PA 5DDOC 2EVZA 2LEAA 2KH9A 2DITA 2RQ4A 3TO8A 2UP1A 2DO0A 1ZH5A 4YUDA 2CPJA 1WF0A 5DETA 2CQ4A 1WELA 2JX2A 1U6BA 4F02A 1FT8A 3CCJS 1X4GA 1M1KT 2FY1A 2F9JA 2I38A 3CTRA 4F25A 2MZJA 2CQBA 3SMZA 1WHXA 5LSLA 4W90B 2KXFA 4PKDB 2DH8A 2JVOA 3THTA 1YIJS 1A9NB 3UCZP 1HA1A 1WG5A 2DHXA 1FNXH 1RK8A 3I56S 2J0QD 2JVRA 1Q81T 3MOJB 2MY7A 4WF9Q 3ZZZA 1UAWA 4WFAQ 2DK2A 4PR6A 5LJ5Y 2ZJQQ 4J5OA 1H2VZ 4A8XA 2CPIA 2CPEA 2MQNA 2KN4A 2M8HA 3P49B 1U1MA 5DM7Q 4OZ1A 4TLQA 3CUNA 2RS2A 1QVGR 1PGZA 1X5TA 4BS2A 4RU2A 2CPXA 3B4MA 3CC4S 3G8TA 3MUTP 4ZKAA 1W2BR 1DRZA 2DHSA 2J8AA 2EK1A 1H6KX 2F9DA 3NS6A 2DHAA 3RW6A 1ZZFA 2E5JA 3HI9A 2LEBA 3RW7A 1N52B 3MI7X 2DNHA 3P3DA 2DH9A 4UY8T 1SJRA 1WI6A 2E5HA 3CCMS 3CCSS 5EN1A 2M9KA 1X4FA 5GADU 2G1DA 1SJ4P 4UQTA 5ITHA 1VC5A 2MKSA 2KRRA 5GAEU 2MHNA 3MDFA 1VQ6S 2RU3A 3SDEA 2MMYA 4LJMA 2N7CA 2DNKA 3R27A 1NJIT 5FJ4A 2AD9A 2WBRA 1JJ4A 2EK6A 2MKCA 1FXLA 2DISA 3CXCR 1WHVA 5D77A 1WTBA 2E5IA 3MD3A 2KM8C 1KC8T 2DGTA 3VAFA 1H2UX 2LMIA 2OTLS 1WHYA 2RRAA 2M8DB 3K0JA 1IQTA 2MKHA 2FPHX 1QM9A 4QQBA 5GAGU 2ADCA 2HGMA 2K8GA 2U1AA 3ZZYA 3CCES 1VBYA 3EGZA 3CMES 1BY9A 2CQ3A 2MSTA 4LIRA 2CQDA 2HZCA 3S01A 1N8RT 3OW2R 1URNA 1FO1A 1KQSR 2DO4A 2KRBA 2A3JA 2FHOB 3VAIA 5LXRA 2MGZA 3LQVA 1HL6A 2MKJA 1UFWA 1K9MT 1X5SA 2RRBA 5GMKa 4M5DB 2JRSA 1K73T 1VQ4S 4FXVA 1D9AA 2MB0B 1S79A 2ERRA 2KG1A 1YJWS 3MUVP 1YJNS 3PIOQ 3G96A 1WHWA 2M70A 5DDQC 3VF0B 1U1NA 1VBZA 5CYJA 2XSFA 3DLLQ 5JVGQ 2YKAA 4IOCQ 1U1OA 1R8PA 3US5A 2MZSA 3BO3A 1U1PA 4PRFA 5HO4A 1Q82T 3MD1A 2CQCA 3VALA 1B7FA 2DNYA 1R8HA 3I55S 3MURP 2OJ3A 2CQPA 2RUGA 3G8SA 2J76E 1VQ5S 3CULA 2BZ2A 2CPZA 1WWHA 2DNPA 2E5GA 1OIAA 3U1LA 4WFNQ 1HD0A 1O0PA 2B0GA 5BJRA 1SJFA 1VQLS 2XNQA 2LA6A 3JB9k 2AYEA 4CIOA 3G9CA 4C4WA 2FC9A 2MY8A 2M0GB 2FC8A 2KXHA 5MLCV 1FJCA 5IFMA 2DNLA 2OSRA 1DBDA 2CPDA 3CCRS 1X4CA 3CC2S 2DNMA 1JJHA 5DDRC 2NZ4A 2RT3A 3FEYB 1N54B 1VQMS 1UP1A 2J0SD 2CQIA 3R1HA 3MXHP 1WF2A 2KYXA 2LQ5A 2DIUA 2MKKA 1YI2S 4TU8A 1YJ9S 1DHMA 2DNGA 2CPYA 4C7QA 2CQGA 2DGUA 2D3OR 1WI8A 2LXIA 1K8AT 1M90T 3CPWR 2ZJRQ 4OZ0A 2MZ1A 3NMRA 2L9WA 2LXUA 4CH1A 1FHTA 2DNOA 2CQ1A 4IO9Q 2XNRA 1D8ZA 3H2VE 3DXBA 3ULHA 1X4AA 2KFYA 4YOEA 3TP2A 2YH1A 1OPIA 2DGWA 2YWKA 2VODA 1JMTA 2DNNA 2G0CA 1CVJA 2LCWA 2Q79A 5H1SV 2SXLA 1X5OA 2MQMA 3VAKA 3H2UB 1M5PC 1U6FA 2MQLA 1VQNS 1YHQS 2F3JA 1SJQA 3G6ES 1AUDA 2MJNA 2CJKA 1U2FA 2DGXA 1RKJA 2XS2A 2KU7A 2X1BA 1KOOA 2JWNA 1WG1A 1OO0B 2RQCA 4WKRA 5IM0B 2LYVA 3VAJA 2DGSA 2QFJA 2LA4A 3G71S 5DDPC 5JVHQ 3VAMA 2CQ2A 1U1QA 2KT5A 1UW4A 3J7YU 4IUFA 2MKIA 4P6QA 2VONA 2KI2A 1WEZA 1NO8A 1VQ7S 3BO2A 3UD4P 1Q86T 1WG4A 1L3KA 4W92B 2DGQA 2X1GA 1QVFR 1VQ9S 1M5KC 2MZRA 2QEXS 1WEXA 2CPFA 3CCUS 1WF1A 2LKZA 4C0OC 2DIVA 3P5TL 1FJ7A 3NS5A 2QA4S 3CCQS 1FJEB 1U1LA 3S8SA 3CC7S 1SXLA 2D9OA 2I2YA 3EX7B 3NNAA 2XB2D 2DNQA 2PEHA 4ERDA 4QU7A 1VQPS 4U67Q 4QPTA 1VC0A 5LSOA 3B4DA 2M4MA 1S72S 3VAHA 1P27B 2RVJA 2XS7A 3BEGB 3S7RA 3CD6S 2M88A 3BO4A 1JJ2R 1X4DA 1X4HA 2HYIB 2YTCA 4EGLA 4YB1P 2OTJS 2DB1A 3UE2A 3CCLS 1HD1A 1ZZNA 4Z2XA 1VQ8S 2X1FA 1SJ3P 4V19X 2N82B 2AYMA 2MXYA 2KG0A 5D78A 5GVQA 2N3OA 1NU4A 2KXNB 3UCUP 2CPHA 2X1AA 1U1KA 2MZTA 3BS9A 3SXLA 1WEYA 1M5OC 3CF5Q 1M5VC 2K3KA 4ED5A 1X0FA 3NNCA 4IOAQ 2MSSA 2DNZA 1KD1T 2MQOA 4F26A 2O3DA 5IQQA 3MUMP 1VQOS 2HGNA 2HVZA 2U2FA 1YTYA 2BOPA 3FEXB 1OWXA 3UWTA 3TYTA 1VC6A 3THPA 2GHPA 3S6EA 3V4MA 2ZJPQ 2M52A 5HL7Q 2KM8B
chains in the Genus database with same CATH superfamily
4Y2CA 1Y7PA 2DH7A 3AB2B 1Q7YT 4UOCA 1RT3A 3MPYA 4NLDA 2VQFJ 2D9PA 3OTOF 3OT9A 4NYOA 3BDPA 2RU9A 2D7SA 1N36J 2V94A 2V2VA 1YWXA 2XY7A 2XMVA 2HMIB 3M2UB 3W8PA 1WOSA 4QZVB 5LXYA 4X66J 3AQOA 3DRPA 4WCEQ 1I94J 3I6PA 1N88A 1R31A 3NY0A 3ZXWA 4DFKA 1D8YA 4DR2J 1VQKS 3R2DJ 2VFTA 4EWTA 3D6MB 3PACA 1VI7A 4I67A 3T1HF 3FUYA 5AJ3J 3PG9A 2ZITA 1X7VA 2FY1A 2I38A 1O8BA 4X64F 2CQBA 3LF0A 4UUWA 4I7FA 2V5HG 4NASA 1NKEA 3R7SB 1WG5A 3LALA 3KLFA 1WD6A 2GHVC 1Y5NB 1S4EA 1FNOA 2UXBJ 3AJ2A 4A8XA 2R2TA 2YWGA 2ZH2A 3OSPA 4NXNF 2YBVA 3N6LA 4CCHA 5IOLA 1QVGR 3I0RB 2YNIA 3CC4S 5KFUA 2NSCA 4X4SA 4DX7A 4ZCIA 4KB7A 4WZMA 2VBXA 3V6KA 1WI6A 4U7UK 1U8WA 1NNDA 3ZO7A 2IRUA 4DPYA 2OEMA 5IC4B 3Q83A 3TQ1A 2QL7B 5BYRA 2NUUG 5K9FA 3CB4A 2MMYA 3TZYA 5FJ4A 1T9TA 2DISA 1GAOA 2DD8S 1RAAB 3NGUA 3O1LA 1YRUA 2CAJA 5HVHA 4USIA 1QM9A 3A13A 3C3LA 3CCES 1NK8A 1G4CA 2W4CA 1JQGA 3HFKA 1KQSR 3DU5A 2FHOB 3MFHA 4UF4A 5LXRA 4GO5X 4ZP7A 3W5ZA 4KE5A 4XK8C 4OYIA 2GAGC 2ATCB 3HSDA 2NXUA 1YJNS 1F5AA 3FZBA 2M70A 3KK1B 1SH2A 4DV6F 5J2NA 2AEJA 1R8PA 4DN9A 3BO3A 2XY5A 3UVJB 3MEEA 5B0AA 3FNNA 2Z2YB 5HMZA 4DLEA 4PPDA 4P75A 1VLOA 1VQLS 1DTQB 2E9RX 3BH6B 3KG0A 1VCTA 1GQEA 2VQFF 2DNLA 2OSRA 4WFXA 3K5MA 3WC2A 1N36F 4YP3A 1RYSA 1WF2A 2Y1LB 1B99A 1DHMA 2RMLA 4C2MA 2ZUGA 2WSEC 2JC1A 5KT6A 1NDKA 2D3ZA 4X66F 1QD1A 1U25A 3Q86A 1I94F 1SB6A 1RTDB 4L6V3 4DR2F 1FTRA 1RWPB 3VAKA 2BJ1A 1VQNS 5DGBA 2OKQA 5AJ3F 2HVDA 2CJKA 5IV3A 2FJVA 2HURA 4O4RA 4IFYA 5J2QA 4JI5J 2X51A 4CP5A 1HBOA 2DGQA 1Q1KA 2UXBF 1QVFR 2RQMA 4YB6A 4C0OC 3K5PA 2HHTA 2XO6A 4ID5A 4ZHRA 2FHMA 4DSFA 1WORA 4KKOA 3RU0A 1KVJA 1N32J 2Z56B 2R2UA 1FRKA 2GA7A 3UCUP 2CPHA 4CLSA 1IJFB 3PKMA 3CF5Q 1S76D 1HQEB 1S57A 1SL1A 4J9MA 1VLYA 3ILLA 3ITHA 3R7BB 1LKZA 4F3MA 3BGFA 4ECWA 4J9UE 1PJ7A 3Q2SC 3NBPB 5CZXA 1NK9A 5KOXA 2V8DA 3EYZA 4J9KA 4Y2KA 4NLRA 4C0BA 4IH5A 2YNGA 4LSZB 5IT9U 4NLSA 4NL5A 1RACB 2HHQA 3R3TA 4DL3A 2KZMA 1AA1B 2HFVA 1P1TA 3DOLB 3OTEA 2GMLA 3MM9B 2AYGA 4ES2A 3KLHB 1NK6A 3IWLA 3P6YC 3LP0A 2QL5B 1FK9B 1T9XA 4UZBA 4PG6A 4CLYA 2R7RA 2F8EX 3LP2B 3JQJA 2RQ4A 5IWAJ 4B9TA 1RI7A 2WONB 1WELA 3C46A 1VYAA 4F0KA 2QN6B 4Y65A 4EZ6A 1HA1A 4YR2A 4F3OA 2GX8A 4WFAQ 5HMYA 2FUG9 2F7VA 2CPIA 2MQNA 2Z2ZA 4DOZA 4PYAA 2VG7A 2RS2A 4P9SA 4FS2A 3UN2A 5D8HB 2VA2A 2EFQA 4FP9A 1NSKL 4CT8A 3JSMA 4PCQA 1SKWA 4IG0B 4JI5F 4UY8T 3E2EA 2L48A 5EN1A 1IR1A 4CLFA 3FFIA 1UEUA 1VC5A 1A0OB 4M5GA 1NAQA 4RW4B 1JJ4A 2PI5A 4X65J 1VISA 2UZAA 1UWBB 4JI2F 1JLGA 1UJ6A 2K8GA 4DR3J 1MN9A 3OUYB 3EGZA 1N0VC 4ZA1A 3PRBA 3B54A 2HZCA 1BQMB 3MR6A 2DRBA 2GGPB 1FO1A 2VPXB 2YWWA 3LGMA 4AL6A 2B4VA 2DR7A 1N32F 2L9NA 4QIGA 5KG6A 3K7RA 2QX0A 1VQ4S 4Q2MA 4RNMA 1WHWA 1FERA 4DQPA 3FMWA 4MMOA 1IKXB 5JVGQ 3MPVA 4ZK7M 4NLUA 1BGXT 2RAQA 1BE4A 3MEDA 3E01A 2BQ3A 3IXQA 3D3CJ 1S1TB 3D5MA 2FVRA 2QLJB 1V9OA 2IC3A 3V5RA 2OFHX 2XO7A 1SJFA 3L95X 4L76A 4TQSA 4LR7A 2CJ9A 3QAEA 5MLCV 4NZ6A 3TUIC 5KFFA 1CG2A 3IC1A 2CQIA 1DARA 3MXHP 4A8QA 2WW8A 2HQ3A 1ZS6A 2YQ3A 4A8MP 3I96A 1NZAA 3L09A 1EP4A 2D3O1 3M8SA 5GAGI 4OYBA 2OPPB 4RKUC 1S77D 2AJQA 4URQU 3HVWA 4JV0A 3SCLE 4ZVQB 3DGPA 4J9QA 4O4GA 2GIFA 2SXLA 5IWAF 2BXJA 3HX9A 4M5KA 3E8OA 3CJ2A 3GV7B 1TKXB 4F50A 2E5LJ 1IWGA 3G6ES 3GFYA 1CJVB 3A4TA 4C11A 2QFJA 2J0XA 3UN5A 3TQEA 2XWXA 2V50A 2V8GA 1U47A 4DV1J 5KFSA 2KI2A 1VQ7S 1H74A 3CMQA 4C3KA 2EW9A 1M5KC 1WEXA 1YVFA 4UTGA 3CCUS 2LKZA 4XPEA 3QLHA 4DMZA 2ZWPA 4R25A 1HNWJ 4Z37A 1EB0A 2A10A 3IP0A 1PAEX 3CJ8A 4J9LA 2ZM6J 4DF4A 2PEHA 1VQPS 4U67Q 3DYAB 3I9V9 1ZM4A 3M9OB 5A8RA 5HAOA 3PX6A 4EGLA 4Q0BB 1F5CA 2LVWA 4N8OA 3AHPA 1FKPB 1SV5A 1HD1A 1VQ8S 4A46A 1XJWB 1YJUA 2N3OA 1U09A 3KUGA 4X65F 3ILIA 3DN9A 5A8KB 1RGVA 5F0WA 2MQOA 3FC9A 4QYRA 3MR2A 1FKAF 2EKYA 3F0NA 1H38A 2U2FA 4M5JA 2I5JB 3FEXB 1TKZB 4RU9A 3QIDA 4RL1A 4M5HA 2GHPA 3S6EA 2OJ3A 4YEAA 2YH0A 3KMQA 5AXKA 5FDLA 2XZTB 4CQ1A 1N5VA 2J6UA 1RT2A 5HMXA 1ZYQA 3QPIA 1NB2A 3R1LA 2DY9A 1U24A 3WIUA 3OD2A 2K1RB 2RE1A 2HHUA 4L74A 4PQUB 3OL6A 4NLPA 3BSCA 5FLXY 3OL9A 2CG8A 3MWBA 1P9YA 4CNZA 3DDIA 5ETSA 5KT5A 3GMGA 2LECA 2LQBA 2ZEJA 3T1YJ 4PEOA 3QBCA 2ZVSA 1EHWA 2DGVA 1AW0A 4USTA 4Z7YA 2WK4A 4KPCA 1HNVA 4ILRA 1X5PA 4NA2A 1XMOJ 2EVZA 1BMQB 5KT3A 3F73A 1ZH5A 5B09A 2H5IB 3OTCA 4WFYA 4RW7B 1MNEA 1HYSA 4H4KA 4KGMA 2VDHA 1T8EA 4CDIA 5LSLA 4W90B 2QL9B 1PYTA 1AB8A 3AB4B 2WHOA 5KG2A 4ZVUB 3I56S 2VB6A 5LJ5Y 5G0RA 3IN5A 4B9MA 4I6AA 1L3SA 5J2PB 3EVMA 3SQGA 2QE5A 2F8HA 2ZH6A 1Q8KA 3EGVA 5SZTA 2E5LF 3G8TA 1F1BB 4DG1B 3HZEA 3K89A 4ED8A 1SJRA 2LU2A 4DV1F 3GCXP 4C8OA 3W2WB 3MPWA 1U48A 1HWUA 4ZN1A 1KHWA 3T3FA 1FXDA 1HWLA 4RLEA 3OVBA 1NHUA 4ZS6A 5E3PA 3M8QB 1HNWF 1REVB 2E5IA 4N8NA 3FCHA 2BRLA 3LW5C 2ZM6F 2FLNA 3WIVA 5U47A 2FLOA 1T7PA 3VZHA 3A8KA 1IM4A 3CMES 3LANA 4ZVTB 1O51A 2PSZA 5KG4A 1D0EA 2DO4A 1SIWB 1EETA 1KNZA 2AJ0A 1JLFB 2XC9A 4A8WA 5E5NA 4P72A 1U1NA 2FGCA 3HHLB 3LWLA 2YKAA 1U1OA 1SBRA 4B3RJ 1RT7A 4CO4A 4X4PA 3I55S 2V67A 1WWHA 3KUEA 3DLKA 3V81B 1T03A 3QT5A 2BM1A 3N01A 2D1CA 2B9YA 5KG0A 3NGDA 1H72C 2FC8A 3FZ2A 1RTIA 5E3QA 2CPDA 1FTCA 2J7UA 4RNOA 4LRDA 2GC8A 3GJQB 1YI2S 3KJVA 1RWUA 4K4SA 1DLOA 4Q44A 2AGPA 1UEKA 3HVTA 2BJ7A 3GQCA 2VQEJ 3T1YF 4IYQA 1NMEB 2L9WA 2IM3A 3MTJA 1QSLA 4CH1A 1XIQA 1R89A 4J9OA 2OFGX 1NH7A 4RZRA 4QR0A 3DM2B 2VIHA 2BV3A 2FY8A 4WE1A 4B3MJ 3QJJA 2W01A 3G87A 4P2FA 5D4LA 1XMOF 1B4SA 3C15A 4E98A 3EE3A 3TEHB 2F3JA 2B51A 2FVSA 2QC3A 1FEEA 3CJTA 4KAIA 3AJDA 3PX0A 1L3TA 5ETRA 3IR6B 5IM0B 3ET6A 3NP5A 3RBZA 1KKHA 2ZOGA 5HQMA 2J7WA 3R2CJ 3G8QA 2XLJA 4H4OA 4Y34A 4X4RA 4O0IA 3RRKA 2FHJA 4OHVA 3Q8UA 1C1BA 5T41A 2EXUA 3T19A 1K0VA 1N5TA 4MAKA 4YR0A 1JKHB 3AQPA 2C3OA 4JYAF 1JJ2R 2HQFA 2E1MC 2OTJS 3VGUA 2QLBB 1NSAA 2AYMA 2PFFB 5K8OA 2F8MA 5A0YB 1K47A 1KSPA 4C6AA 3B82A 3SFGA 3DGVA 1RABB 4LF7J 1TR0A 5L39A 1NJXA 2NQPA 4PPZA 1FDNA 3OR1A 5HL7Q 3D0HE 3TVYA 3GLJA 4CM0A 2AF6A 4B9VA 4ED0A 1F9FA 4ZVRB 4G3IA 1BQXA 2PA8D 3W66A 4ZLNA 2C3MA 3CDAA 5HP1B 4X4QA 2CQ0A 4GC7A 3MFIA 4O3RA 4B3RF 2IDLA 3EDQB 4XDDA 4EZ9A 4W98A 3T5KA 2QJ3A 1IR2A 4O3OA 4WFBQ 2GQQA 2OPRB 1UA0A 4I2PA 1X8DA 3NWGA 1NLKL 2M2BA 2O01C 3GSIA 3R7NB 3W63A 3DOMB 4AXIA 4JV2A 3MCNA 3NL0A 2BM0A 3CO0P 4N5SA 3HZGA 1S9EB 1ZTWA 1KQFB 2CDQA 2UXCJ 4CLPA 1LFWA 2VQEF 1JLCA 5HI7A 3OLAA 4WF9Q 1RK8A 2IM0A 1RT4A 3WZ0A 4B3MF 2CPEA 2OPSA 4AXJA 1LQ9A 5I3UA 2PA3A 1PILA 1VGYA 1CULA 3IAS9 4BS2A 4BHQA 2GQCA 1NEEA 3HJVA 2BQUA 5KFJA 2IBOA 1S0MA 3A8JA 4C8YA 4X62F 4DR4J 5A6PA 5CAAA 5F8NA 4DX8H 5KFRA 3BYRA 2QSFA 4PXCA 3MMBB 2AZ3A 3R5JB 3GSDA 4XDCA 2ZH3A 1N33J 2CDRB 3BBCA 5D77A 5C2CA 4R5PA 2W7OA 5JXSA 1JXLA 2CYYA 2MKHA 3SIPB 1SL2A 4YDXA 2DT9A 2XMAA 3ZZYA 3PM9A 2ROPA 3EVOA 1QJHA 2CQ3A 4LFAJ 3RR8A 2FJDB 4FBTA 3CDBA 1RTZA 3HF5A 1ZOTA 2MGZA 4QBUA 2W9BA 1IBLJ 3N4WA 3UQSA 1D9AA 2MB0B 4LUBA 3MUVP 3W61A 1XMQJ 5HO4A 2K3IA 4I0WA 3MGJA 4DZDA 1AZSA 2JHEA 5AXMA 4DCOB 1S9GA 3KNGA 1R8HA 2PIIA 2CQPA 3AXKA 1VQ5S 4DL6A 1S10A 1DJ0A 2LLZA 3BKFA 3DLEA 1YRXA 1OIAA 2R7SA 3EICA 3KG1A 3JB9k 3G6XA 2KXHA 2NR0A 5K8NA 1G3OA 2V0NA 3M9MB 4YFUA 3CCRS 1VHIA 2XTJP 5EX0A 2OUGA 3LUYA 5ETNA 4KH0B 2VD3A 1LK5A 4XIUA 1ZA2B 4GKKJ 3KK3A 3M1VB 3V2UC 1H73A 5M2UA 1HMVA 2PI4A 2V6AA 5L1KA 4RPFA 2HQCA 2CQ1A 4WTOB 1JNRB 2QA2A 3D68A 1T05B 4ELVA 2ZH1A 3AA9A 2HHVA 4EBDA 5AE3A 4CO5A 5B08A 1F2GA 4G65A 1UETA 2Z4PA 1U2FA 2KU7A 2UXCF 4DV3F 3G71S 4RW8B 5KFGA 4P71A 2HS0A 1ZAWA 3ENQA 4NMLA 2YX7A 2W2QP 1RP5A 2YKMB 3CVKA 3DHXA 2VC1A 5KAKA 4Y2AA 1TFYA 3GPAA 2ZBIA 2PFDA 3IS9A 3S8SA 4FN5A 2VV5A 1PKUA 4ERDA 3LO3A 2UVVA 4DR4F 3V6JA 2DRDA 1NK0A 2AT1B 2ACMA 3D0IE 1S49A 3BH7B 2HYIB 1T9UA 4YB1P 3NG8A 1WC0A 3UE2A 3NCRA 2CWKA 4HI1A 1OQ6A 3OL8A 3Q8YA 2NCKL 2O66A 1SJ3P 1IKYA 1LW0A 2KL8A 2X1AA 1N33F 3LGNA 1RAEB 1WKKA 3TA0A 4YDDB 1WEYA 5HQ8A 4LT6A 3CJ0A 4NLVA 2K7KA 1B0PA 1MU2A 3WX4A 1NUEA 5H9EJ 4RW9A 4UOHA 3I5CA 4DZ6A 3GIJA 2CADA 1J27A 1FESA 1QAYA 3D66A 4KYZA 1M0SA 4RNFA 2UVRA 3EM1A 3KG4A 1GTHA 1IBLF 1HQUB 5CXTA 2BJ9A 3J7YI 2DY1A 1XMQF 3UR3C 2L08A 3VR1A 1SUQA 1S12A 2IJFA 3ZNJ1 3BSAA 3UD3P 4WTYA 2KHDA 2A0FB 4CH0S 3IWXA 4H4MB 2E7VA 4CTAB 3SCKE 4NYPA 1TL1B 1Y3KA 3TAQA 3J7ZT 1XR5A 1TVRA 3IG1A 1EQMA 2BJ8A 3MM8B 1S6PB 4MFBA 4ZCLA 4DQRA 5DETA 2P2CB 5T7LA 4QIWD 3AAWB 4GKKF 3MECB 1M1KT 3TUPA 3HHLD 4OX7A 4Q45A 1KFSA 3TAPA 3RAMA 2BE2B 5FIIA 3QQCD 2W4DA 4ZDNA 4CYUB 2HHSA 4ED2A 1RT6B 2JVRA 2YX4A 2HFZA 1Y11A 4U6PA 3QIPA 2DBBA 3OXGA 3O2IA 5D0HA 4O3PA 4DJBA 1R8AA 1TL7A 2WSCC 1S1VB 3MUTP 1YBAA 1RHUB 2F9DA 3H7HB 5AE2A 2Y1JA 2G2ZA 4ED3A 4Q8EA 2JEIA 4Q2LA 2ACYA 1SJ4P 1RHJB 4ZOSA 3RAQA 2YPZA 4EI2A 3OVAA 4M63A 3M8WA 4I56A 2B5JB 1FE4A 3MAAA 1SQEA 4AL7A 4M95A 2J8SA 3OL7A 4G1PA 5BR8J 1SJ1A 1FX2A 3W60A 2ATLA 1RADB 3LAKA 4HVZA 1PG5B 1URNA 2ZD1A 1GMWA 2A3JA 2MDAA 2BE9B 4MIWA 2RRBA 5LSRA 4FXVA 3I5BA 4P7TA 5HBMA 4OQJA 1CQMA 2WVCA 1MSWD 5J2MB 5KFLA 1YK9A 4DEZA 4PUOB 1S7HA 1JJCB 2EPIA 2HNYB 5CD4A 4OI0A 3BQ0A 1ZM3A 1VHFA 1ZM2A 4J91A 2VG5B 4LF1A 2WRMA 4IG3B 3VVTA 1O0PA 3J7A1 2QRRA 3KKFA 2AYEA 4YQWA 2P9GA 1J5OA 5M2PA 2LXFA 1DBDA 5CYMA 1PCAA 1JLBB 1PC5A 2Y3YA 1VQMS 4CLTA 1U02A 3R5GA 4TU8A 4KHMA 4DI6A 2HIYA 4HDHA 3POTB 3G86A 5C25B 2W2MP 1K8AT 1DQ8A 4IO1A 4ZPTR 3ZC4A 2VG6B 4OZ0A 2V2ZA 4F4KA 1FHTA 2W8LA 3ZZRA 2P6TA 1RSCA 4DR6J 2HAIA 4G1QA 4AE5A 2FIUA 5H9FJ 1TP7A 2Q79A 4I1TA 3PW0A 1U6FA 2BOAA 1O6XA 2BYCA 3OR2A 3T9ZA 3GV8B 4TLRA 5K8PA 1EARA 3GG0A 4B08A 2AJ1A 5DDPC 5JVHQ 1YX2A 1RAIB 2MKIA 3TA2A 4P6QA 4LF2A 1GX6A 1FK9A 3K5OA 1L3KA 2R4FA 1U49A 5F9LA 2AEFA 2KT2A 2OD4A 4LSLA 3B78A 3ZZPA 4I2QB 2XSJB 5KFHA 2DIVA 4GMKA 1WDTA 1R0AA 3V6DA 2D9OA 1EIYB 4ECXA 3ISND 1HIYA 4C98A 1F3FA 1B7YB 4U95A 4K0KJ 3H42A 3PJWA 3CCLS 3BB5A 3H5SA 4DX5A 1CJUA 3TUJC 5CZVA 2FVPA 2KXNB 5ETOA 2HHHJ 1U0SA 3DCAA 2IAJA 2VPWB 4ELTA 1TU0B 5HSPA 5KFEA 2BABA 4ZPWR 5BR8F 4NCGB 5K14B 2WVBA 2JEFA 2BOPA 1P8GA 4BCAA 4ZCKA 2B6AB 1QDUB 5CABA 2ZJPQ 3EMTA 3IRXA 3OTBA 3OFEA 1BWEA 3WQPA 1FRHA 2HQGA 1MROB 2ZE2B 4WKYA 3BM7A 4LVNP 1NSPA 3NEKA 4KC5A 1SH3A 1T9YA 2DXDA 4G1IA 3MEGA 4P10A 1DZ5A 4LRFA 2QA4G 5CHCB 3D6TB 2V34A 4A4JA 1KLMB 5HLFA 3J80Y 4DWIA 3P4UB 4TY8A 1QE1A 4ANCA 3R97A 2W25A 4DV7F 2UVUA 3UNYA 5KFMA 3OLBA 1S1XA 3PIPQ 4Y2MA 2HRTA 1PSDA 4B3OB 2E44A 3EZOA 1V3ZA 1C0TA 1V3RA 4ZPVR 1NJZA 1FWPA 2CPJA 3JAMU 4FVCA 3KLIA 1U6BA 3K57A 1D9FA 3QYYA 3CTRA 1JNZB 1RXOB 3D1OA 4ZIVA 2C3YA 2W1BA 3T9NA 4DR6F 3SFUA 2AMCB 5G4DA 3W5XA 1EX8A 3T5JA 2YX1A 2E7XA 3M9NB 3JTNA 5KFAA 5F8HA 3LP1B 3H4BA 4S0MA 4PABA 3C16B 1S6QA 3BKTA 4TXSA 2V9WA 3E51A 3M2VB 2ZOFA 2XG8A 4JI6J 1U2RA 4LJMA 4RUHA 3R27A 1KR4A 4Q8FA 1NZ8A 1KONA 4NOHA 2EK6A 3TUZC 4QYZK 4QW8A 1KVKA 1BQNB 4DX6A 2Q43A 4HACB 4J9VA 1GH8A 3C66A 3ZTPA 5KFDA 4FXDA 2C2RA 3F41A 5HROB 4LIRA 4K0KF 1JLQA 3OW2R 2KRBA 1FCAA 4HTIA 3CJKA 3I0SB 3D67A 1LWFB 5HATA 1RCXB 2HNZA 4M5DB 2BQRA 1FRLA 4NA1A 3IBCB 4OI1A 2ZBCA 2HHHF 3FBEA 1FD8A 5E7OB 3U02A 3MMCA 1IKVA 4WU2A 2NXEA 4ZVOB 2RKIA 2XMJA 3TAMB 1EZZB 4RW6B 5CCLA 2CQCA 4OYMA 2ASYA 1XNRF 1RWMB 1T9WA 3SCIE 1BC6A 1VBKA 5C24B 1B0VA 2DYAA 3I9ZA 4O3SA 3PJ9A 2G13A 4WFNQ 2J9DE 3C14A 1J2VA 2W7PA 2LA6A 2HVEA 4QIEA 4YS2A 3D6HB 4DV5J 1H7WA 1B3TA 2JLFA 4N41A 1W25A 1Q0NA 4NI2B 2NPFA 1YGYA 2NS1B 3AD7C 3FJ2A 4F36A 1HWJA 2I5JA 2KDOA 2OMLA 3KLGB 3HCXA 3CD5A 5L9XA 5CH7B 1P6TA 1TFWA 3VWSA 1NCLA 3B8HA 1RT3B 1DQAA 4YOEA 1YLXA 2YWKA 3PX4A 1P9QC 1CJKA 3IM8A 4FKXA 1KVIA 4OV6A 2MQLA 4M1KA 1SL0A 4PYDA 3DNCA 1DQ9A 2XYGB 3RBXA 1TTHB 4ZVEA 4ANEA 1RT5A 2HS4A 2R2RA 2R7UA 1D9DA 4RUCA 2BR0A 3DRPB 3JYTA 3PO4A 1WEZA 2B3TB 4YR3A 4K2JA 2X1GA 4K2XA 2MZRA 4IKAA 1YJRA 1HNZJ 1YBTA 2Y0BB 1GMUA 1LW2A 4C48A 5F3ZA 3KJQB 2JLEA 4IH7A 6FD1A 4ECYA 4J9SA 1S6OA 1F6TA 5JJBA 3NNAA 3IFEA 3DLHA 4I68A 2DNQA 1GMVA 4P2MA 5DG8A 2HRYA 1VRUA 3A12A 3AFGA 2AQ4A 1FI4A 4I7FB 3QGIA 2ZZTA 5LL6d 2KJWA 2UUBJ 2DB1A 2D3UA 1R43A 3KLFB 5KFTA 4JI6F 1J5EJ 1F60B 2ZNYA 2MXYA 5ADZA 1NU4A 3QSYB 1YJVA 5F0UA 1LWEA 1FA0A 3BSOA 2YNIB 4FPRA 3FQKA 4K4YA 1TUGB 3F56A 2IM2A 4UOGA 3CDWA 4ED6A 2R7OA 3M2RA 2HFOA 3GIKA 4NXMJ 1I51B 3EPIA 3OPKA 3QRQA 3QWPA 2PC6A 1RHMB 1RKIA 1HR0J 2M7SA 3C6UA 3A8EA 1WOOA 4B9LA 4XAKA 2ILYA 2RIJA 4P7VA 4XPCA 3QNWB 1G2EA 4ZLPA 3ZNUA 2MYFA 5HVFA 1YITS 2M5YA 2HWIA 2FJBB 4ZJLA 4F4YA 2MQQA 6FDRA 4UQGA 1HPZA 4H54A 4HR2A 1Y5IB 1PYSB 4LR8A 2XHCA 2EFPA 1DFDA 1W26A 2CQHA 3N6NA 3CO9A 2B9WA 3BN7A 3QWUA 4DV5F 4K59A 1GX5A 5J1NA 2BKPA 4PZVA 5J2NB 2UP1A 2DITA 4HHHA 3OTOJ 4X4TA 5B0CA 3G2XA 2CQ4A 3G82A 3MEEB 5SUHA 3ZTOA 2GW8A 1Q79A 4PKDB 4LR9A 4U7UD 3W3SA 4O23A 3NGSA 2DR8A 3UCZP 1HW9A 4EBEA 4NEZA 4CLUA 5H9EK 3RAXA 3LTOA 2GVDA 1XC9A 3SBMA 4RU2A 3PZPA 5J1EA 2BDPA 2Z30B 2C42A 4A47A 2XCAA 3BR9A 1N52B 3MI7X 2FVCA 2DH9A 1N6QA 2E5HA 2R7WA 3SZ2A 3BDEA 4UQTA 1GFWB 2VJVA 2ZOMA 4FF1A 4G6VB 5L1LA 3I32A 4CRJA 4YB7A 1HNZF 1UEVA 1L3UA 1WHVA 3HHKA 2BACA 4WP8A 2QA1A 2RRAA 2M8DB 3R8YA 5LMUF 3QFWA 2BKOA 2EBEA 2IMWP 4IFYB 4ANDA 5J2QB 2UUBF 4K4ZA 1J5EF 3F44A 1HBOB 3FK4A 3LQVA 1T02A 4KFBA 4KGVB 3J7Z5 3EDRB 4Y2IA 4FBUA 2PT0A 2JZ5A 2KJVA 2VKRA 4KGZB 2D41A 5CYJA 1RAGB 4IOCQ 1RBOB 2I1RA 5IC6B 3US5A 4ID5B 5HJYA 3GP9A 4EEYA 3IBWA 4ZHRB 2R2SA 4NXMF 3TEGA 4L3NA 3ISNC 1WSRA 1RTHA 4ZLJA 1I1GA 3CULA 4KKOB 2XBPA 5C42A 4E2FB 1HR0F 2VFVA 2IIHA 4BC7A 4C4WA 2IVMA 2M0GB 5HANA 2GHWA 1FJCA 1XMBA 5F8MA 2F65A 4KO0A 1IWAA 5GAEI 3IR5B 5L38A 3R1HA 4OJGA 2KYXA 1HNIA 3DMJA 3ITHB 5LT5A 3UDEA 3C6TA 1JIHA 4QWBA 1F9HA 1ZM9A 4CLLA 4K4UA 3Q8PB 3J81U 4DSJA 1HWKA 4KJIA 3ENWA 3BV8A 4DF8A 2KFYA 2YNGB 2CZ4A 3TP2A 4AFFA 1JMTA 4C8NA 2DNNA 2QLWA 1R7IA 2NPIA 4WFZA 2AW0A 4TQRA 2Q66A 2VL1A 1KOOA 3PRDA 4NX9A 3I82A 4DUTA 2LYVA 4WU3A 4IUFA 4C9DA 2A18A 3LP0B 5IQ6A 3VHQA 4LSNA 1YKWA 2C2MB 4DU8A 2CPFA 1OYEA 3P5TL 2NSBA 4C3LA 2IJNA 5BYQA 1UZHA 3HT3A 3EX7B 2G2OA 1FEHA 2P8IA 1VC0A 3JSBA 3OBIA 4OYOA 2ZBQA 3BO4A 5GMEA 4ER8A 4HEA9 1AYEA 4J9PA 3PW2A 1HQ2A 2CJBA 5KFQA 3DXSX 1JLAA 1EJ7L 1UFLA 1VK8A 2ZBRA 4AYBD 2VG7B 2VBYA 5A8WA 2DNZA 3JSMB 3RB3A 5ETQA 4ZPBA 2VPZB 4ZVPB 5DQHA 3OSNA 1R0BG 1C4AA 3PTWA 1ZAVA 2CJYB 5IT9Y 4IFVA 4RUAA 2MLZA 2MLYA 2Y0SD 1UVKA 5H9FK 2ASDA 3FFIB 2JFDA 4KGKA 4WJBA 1Q8IA 1PC4A 4BBYA 4TYBA 2QMWA 1H2TZ 1XN9A 1A7GE 2JEGA 3FQLA 1U2CA 3UCGA 3BYPA 1LWCA 2C22A 4DR1J 3O8WA 1PO6A 4JI7J 3CJQA 1TZ0A 1JLGB 4ECRA 5GAHU 1TMJA 1KEKA 3IA0A 4LF8J 4WYWA 2C2OB 4F67A 5KFWA 2RNEA 3C19A 2G1HA 4UOFA 1V6HA 3P96A 3HSJA 5CA5A 2C2DA 4ZIWA 2GAHC 4Y28C 1Q8LA 1S0VA 5B0EA 2O67A 2LEAA 3QO9A 4LVOP 4UUXA 2WOMB 2DXFA 4OI2A 4ZVFA 1HKAA 4CWBA 1D09B 3IGVA 4OZ5A 2IVFB 2CWXA 2CA9A 1IN0A 3MEDB 3D9BA 3E01B 2MZJA 3H5UA 3SMZA 3D28A 5B0FA 2LQJA 2DH8A 5EGYA 2IC3B 4Q7AA 3M8RA 1ITPA 3T41A 1A9NB 2ZZMA 2Q6BA 1X0PA 2VFRA 4J7CA 2F40A 3ZZZA 2UVWA 3M8YA 1X9MA 1YG0A 4ZPAA 4UW2A 3UFCX 3AY0A 3GYGA 3VZIA 4OZ1A 3P5BP 1YJ7A 3WX8A 4D3GA 5K8MA 4F0HA 3GZ7A 3EPGA 2B56A 2H9ZA 3PDNA 4GVBA 1FVSA 1UVJA 4K5RA 1H7XA 4QWCA 1EP4B 4NLQA 2W7AA 5AE1A 2KRRA 2MKYA 2MHNA 2XGQA 3EWGA 2YNFA 2HLTA 3DGPB 4KBIA 2AD9A 5I3PA 1FXLA 3VQSA 2WTFA 4O4GB 2QGFB 2VHGA 3QGGA 4UT4A 1KHVA 3BJYA 3BGUA 5CCMA 4WK1A 3K0JA 2F63A 3M30A 4QQBA 3BN4A 3ETMA 5GAGU 3PY8A 2HGMA 4K4TA 1SKUB 3FCWA 3DDKA 4C11B 4JV1A 3DFEA 1U0HA 2FZKB 2VZ9A 3TOQA 4OX8A 3H25A 3SCJE 3SV4A 1X9WA 3M6WA 5DZ6A 2KG1A 3QLHB 4BC9A 1FJGJ 2HQDA 3QT6A 1U1PA 4PRFA 4F04B 2X3DA 4JBCA 3PNIA 4F4WA 4MK8A 2YXLA 4Q43A 3FVYA 5A8RB 3HDSA 1Q4RA 4JI2J 3MCMA 2H5JB 2POKA 5A6WA 1SV5B 4L75A 2YY3A 3QJLA 1KDNA 3R9LA 3DRSA 2Q3PA 2Z0GA 3HVRA 2NXJA 4WBFA 4DR1F 1X4CA 3V4IA 4OZ3A 4DQSA 4JI7F 3AT1B 3HXMA 2MKKA 2WVFA 3RUBL 1C1CA 1HHSA 4LF8F 4CM2A 3DLGA 4IOBA 1UA1A 4LIWA 3OVSA 5KFIA 4MYTA 2LXUA 4KGXB 5FDLB 1E6VA 2BMBA 3HO1A 2LQ9A 2W9CA 2YH1A 1RT2B 4R8UA 4NLTA 2NXNA 1O5JA 1CVJA 1H3DA 4LBPA 1M5PC 3H2UB 2A2CA 3R6GB 1WC3A 3N5FA 1XR7A 3TA1A 5B0DA 3PYFA 2DGXA 2RQCA 2XMUA 5K5MA 1DTTA 3QGHA 3MCOA 2VONA 3THVA 2FLPA 4BWMA 3PW5A 3PHEA 1HNVB 1HBUA 4JI3J 3CC7S 3MAQA 1MMLA 4NYZA 2H3EB 3RGIA 4F4ZA 1HYSB 3HLUA 1NK5A 3B4DA 3Q8QB 3VAHA 2OPQA 3GJTB 4WIQA 1T3OA 4KHRA 4Z7CA 5DS7A 1HI8A 1XR6A 1RB0A 3H40A 2RDIA 2IFXA 5G0RB 5GVQA 1X60A 4OHXA 2ABYA 1OY8A 3SQGB 5DJBA 4F8RA 1R6VA 2V8PA 7FD1A 3V6HA 1I5OB 1KD1T 1PJ5A 4ZVGA 4ZP8A 1MN7A 2K06A 3TRGA 4HTJA 1OJ4A 4ZN3A 2LDIA 1Y10A 1SVDA 1L5UA 1TELA 3RBEA 2KM8B 4GVLA 1YZ6A 5CD4H 4GC6A 1CS4A 2IDEA 4O44A 5GAHI 3RB4A 3G4SS 3CCVS 2GO9A 3IWNC 1FJGF 3IAM9 3L3CA 1F0XA 4AUKA 3DHWC 2VOOA 4MIBA 3BZQA 4QR1A 1IJEB 4QR2A 1VS3A 2WB1D 4DFPA 2VH7A 3HHDA 2N3LA 1IBMJ 1DURA 5ETPA 1RQ0A 4K4XA 2BEFA 1ZTTA 2C1EB 1HFEL 1EETB 1IBKJ 1CC7A 4CO1A 3BGOP 4HT5A 3UI3A 4MKBA 5E2QA 2A2DA 1RU2A 2L41A 4FNIA 3Q0AA 4URSA 1RJJA 4TU7A 2W2OP 3QJPA 5DDOC 3X3UA 3L7PA 5CYQA 3CW2C 1C4CA 4U96A 3W2VA 3SV3A 2HKEA 1RT7B 2VBZA 3UDCA 3CCJS 3SI8A 2XY6A 4USMA 2A6OA 3KHGA 3DLKB 2XULA 3LWMA 2JVOA 1T03B 1K0TA 1NJYA 2WW4A 1OQ3A 2N4DA 2HAFA 1RTIB 3CUNA 2F4FA 1X5TA 2GVZA 3DLJA 4HHUA 3KJVB 1DLOB 1ZZFA 3HVTB 2DNHA 2UV8G 3RRGA 1OY9A 1TQLA 3ZTSA 3M32A 1VQ6S 4WE1B 1S7IA 3NOGA 2K2PA 2C2KB 2GQ2A 2AZ1A 3MD3A 4JI3F 3RZAA 3C15B 2IPOB 1UFKA 3VAFA 4BWJA 1W2IA 1WHYA 3W1YC 3Q8VA 1TUVA 4ILLA 3IM9A 4EBCA 4ECUA 3ET6B 2CQDA 2YKQA 3DOKA 4H4OB 2Y8WA 1VJWA 2GV1A 1CC8A 2H5EA 2WVDA 5GMKa 1VFJA 3K17A 3T5HA 1C1BB 1YJWS 1C0UA 1VBZA 2NYIA 3FBCA 3PR5B 5KOWA 3DI6A 2IM1A 1MMNA 1MMDA 4ITSA 4TKTA 4LRAA 1RTJA 1Z1ZA 1RZMA 3EVWA 2RUGA 3G8SA 5I42A 4LFBJ 1PBUA 2E5GA 3KTQA 3U1LA 1Y5LB 2IYGA 1E6YA 5KT4A 2MY8A 2ZH4A 4HDGA 4IDKA 5IFMA 1IKWA 1W7WA 1S1WA 2V8HA 3CC2S 2XEXA 2DNMA 3ADAC 2WCXA 1CLFA 1BHNA 2YKNA 2DIUA 5B0GA 1UWAA 4DSLA 4EO8A 1JX4A 3LAMA 3HPOA 4F2RA 3SSQA 2KO1A 1IBMF 3OR1B 4Y3CA 2GJFA 1IBKF 4NPOA 3MOZA 3O3LA 3T1AA 3VCDA 4ED4A 1R6YA 3K8VA 3VVUA 2DGWA 1KRPA 5K20B 4WPAA 2RF2A 2HWHA 2DEIA 4X4UA 1X5OA 2BBEA 1OMSA 3PEJA 1MLAA 3ONQA 4HL9A 1LNQA 2BW2A 1IM6A 4QWAA 1RKJA 3MM6A 1OO0B 2Z57B 1V5IB 4ZMMA 3D54A 1U1QA 4V19J 1FX4A 4I2PB 2ZH7A 5DG9A 2EFGA 1R27B 2MEWA 2B4UA 4ICLA 3M6UA 2VPYB 3NS5A 2XM3A 1SC1B 4OI4A 1SPBP 1XK8A 2XB2D 2XI2A 2YVSA 3IO1A 4MK7A 3PCOB 4MTPA 1JLCB 2G9OA 2YTCA 2R7QA 1RWWB 3Q89A 2JJ4D 1NM2A 4V19X 3ICLA 1RT4B 3J81j 2OPSB 1S0NA 5I3UB 3HD1A 1U1KA 4NLWA 1CULB 2ROGA 3BF4A 2LDYA 4ED5A 2ZDPA 2N4CA 4F0MA 1WKLA 3LP1A 4FVMA 4F26A 2ASJA 2A6MA 4A48A 2HHWA 1CJTA 4NCBA 1LXNA 4K5SA 1LXJA 2AV5A 1VC6A 3MMAA 4AQYJ 3W62A 5L1IA 1RA6A 1KS2A 2AEMA 2YPYA 2HPUA 4JYAJ 3SSSA 4ZP6A 3ENAA 4E8UA 4K7QA 4YY3J 2P5VA 2Z2MA 3ELHA 2A1BA 1QSYA 1LV5A 2IRXA 4FPIA 3U1MA 4R5PB 2ADBA 5DLFA 3VAGA 3P8BB 1KLNA 2EG1A 4PXDA 3CEDA 2OEJA 1HHQA 2BANA 1VRTA 4LMZA 2DHGA 2CVIA 1U6ZA 4LFBF 5J1PA 4QU6A 3LPYA 4OZLA 4LF4J 2MGZB 2W9BB 1TMMA 1B70B 1Q5VA 3KLEA 4ETZA 2NZCA 2YKOA 4N47A 3W9JA 1TL5A 2H48B 1S97A 5DO2A 3O5TB 2FJEB 2KH9A 2FJAB 1D1UA 2DO0A 4NLYA 3N79A 2JX2A 1AZSB 4EFAC 1S9GB 1FT8A 1NH8A 5ETMA 1S6UA 4M5IA 1GEHA 3DLEB 1HBMA 2DHHA 3MOJB 1Q81T 1UAWA 5B0BA 3IBFB 1H2VZ 3RTVA 4WWSA 4RR5A 1U1MA 5DM7Q 2EFVA 3GFZA 2IY5B 2WSFC 1RCOB 1UPPA 4DFJA 3KK3B 5EHHA 3NS6A 2DHAA 3A1YG 4DLGA 2LEBA 2IA0A 1WACA 3P3DA 4NCAA 1HMVB 3CCSS 1YDLA 4OIXA 4A8KA 2G1DA 3BPDA 3SDEA 1UPMB 5A2QU 2ZBPA 2CZVC 2XMMA 1KTVA 1T9VA 3L7OA 4C8LA 4GKJJ 2EBGA 2EFNA 3KLVA 2ADCA 1RAOA 4MKVA 4AD6A 2AGOA 1OSCA 3K8WA 3KJNB 4X62J 4ES1A 1HW8A 1FVQA 1XBWA 3CIZA 2HBYB 1S79A 1RBAA 2Z2LA 4DUYJ 2YQ0A 2XSFA 3IS9B 2VU5A 4ZPDA 1T3NA 3WHIA 3KYLA 1BUXA 3MM7A 4QWDA 4DCPB 2IA6A 2YQ1A 1DAXA 3KUHA 4OFZA 1RDRA 2C2NA 5F41A 4AQYF 3ILOA 2BZ2A 1FXRA 1UMJA 2N7YA 2Q1LA 2IVYA 2QMXA 2IHR1 1NHKL 2XNQA 2EKNA 1IKYB 1LW0B 4YY3F 4MH8A 4AT1B 1UVNA 3MPDA 2FDNA 3H98A 1PBAA 3O44A 5F8LA 1JXEA 1AROP 2XLIA 1MU2B 1N5YA 2YNHA 2ZDOA 3FEYB 3CE8A 1F9EB 1NDPA 3L4BC 1NPRA 4RW9B 3CJ4A 1N5QA 4E0DA 2OEKA 2QT7A 3UDLA 2QTWA 5KFPA 1JLEA 3AOAA 1CSJA 4LF4F 3NXZA 1OPZA 2E9TA 3HM9A 1D8ZA 2DR6A 4P74A 1UCNA 3JTPA 2OGUA 4HT7A 4JI4J 2ILZA 1M5SA 3OJUA 3CJ3A 1TL3A 1SUQB 1OS5A 2KVQE 2HNDA 3UNGC 2LA4A 1NJWA 2ZUAA 3J7YU 5C2GA 2G0JA 2R42A 2B43A 3WDOA 1RWOB 1TVRB 1WF1A 3IG1B 1S1UA 1FRJA 4CNYA 5AXLA 3BGRA 1U1LA 4MFBB 1N34J 5T7LB 4OV1A 5F9NA 4PWDA 1WSVA 1P27B 3A3PB 3CJ5A 3TARA 2XZWA 4F4AA 1X4HA 5D0RA 1FD2A 2O5DA 2CG4A 4ZVSB 1YQHA 4DL7A 4DV3J 4FZVA 4NZ0A 2X1FA 3QIPB 1Z4UA 2BVZA 2R8JA 3KK2A 2OH2A 1RAJA 3SXLA 1HBNA 2K3KA 3DRRA 1TL7B 3H5XA 1X0FA 3NNCA 5C7PA 5EWGA 4GKJF 2MQ8A 5JUMA 2BX6A 1ICEB 1TKTA 3R5BA 4DN0A 3CD0A 3KHLA 3PV8A 3PXGa 1N0UA 3MM5A 2PEBA 2BW7A 2DNRA 3CNQP 4N7TA 3D2WA 3LGHA 1EAYC 4DUYF 1SQGA 3MAAB 3HHNB 4M94A 2JOQA 3IMQJ 1F3VA 2VOPA 3HVAA 4DSIA 3CDUA 1QAIA 1AXQA 2DGOA 1MWYA 3QT7A 2ZC4A 2V4JA 1FKOA 5D0GA 1NXIA 4KV8A 2RS8A 4OLPA 1FDDA 4DXLA 2FGOA 4DFMA 2GIRA 2ZD1B 3JQKA 2XQCA 1A6LA 1ZBTA 2GMHA 1HNXJ 3NLCA 3H90A 5HBMB 2OIHA 1Z2ZA 2AYBA 1CBKA 1RT1A 3BKUA 4DR7J 2CNLB 1ZAXA 4B17A 3HJFA 2FHJD 4P52A 4CZCA 1ZA1B 2W4PA 1ELOA 2HBRB 3MMJA 3R5DA 2J6TA 2QMUB 4BLGA 1XEZA 2GZOA 5D3GA 4A8SA 2L3MA 3THTA 5ETTA 5HQLA 2MY7A 1J5OB 3OXLA 4PG8A 4JI4F 4LF9J 4TLQA 5CYMB 1TV6A 2QIFA 1Q5YA 2J9EA 2J8AA 3EUNA 2EK1A 1H6KX 3TZZA 2EC2A 4J9NA 3D1QA 2R9LA 1U45A 4UY85 2QYCA 2C3PA 2IYIA 4OJHA 1QUPA 4IRCA 1YBUA 3QZ8A 1T94A 4G1QB 5L46A 4RBUA 2MKCA 3CXCR 1SKSA 3GR1A 5E3RA 1H2UX 2LMIA 1N34F 2OTLS 2IMOA 3OR2B 4V1Ak 3GYNA 2HMIA 3M2UA 3D7SB 1AUSL 4FYYB 3BREA 4ZPCA 5D15A 2W2PP 1SC3B 5EX3A 3S1TA 1UFWA 2OMOA 2VASA 4LSLB 2WB4A 4W4MA 2BRKA 2D74B 1R0AB 3V6DB 2O1PA 5T14A 2X7IA 4B3TJ 2MZSA 5DGAA 2UUWA 2ASLA 2DNYA 3PO5A 4RNHA 1QSSA 1VK3A 2ALYB 1N48A 3TJ8A 3J7AN 1CJUB 2CUYA 5BXIA 1LFPA 4LQ3A 1JWWA 2IAJB 1JJHA 4IR1A 5DDRC 2E1PA 4MKYA 3UDVA 1N54B 3I0RA 1UP1A 2J0SD 1Q95G 5DQGA 1TK0A 5ETVA 2R8HA 2HG4A 2RDDA 4FYWB 4I6YA 2DNGA 2JEJA 4EO6A 3HT0A 2CPYA 1WTFA 1RISA 1YSJA 2E9ZA 1RLCL 2KKHA 1WC4A 3IRXB 4C8ZA 4DUZJ 1HNXF 4I69A 5EWEA 2XNRA 2CNNB 1X4AA 3KMSA 1L3VA 1VRQC 3M7VA 5JMNA 2J9CA 1N4LA 4DR7F 2HWTA 2G0CA 4DQIA 3NMAA 1QTNB 3SYZA 3MEGB 3TZXA 5DLGA 1TK5A 1G1XA 1SC4B 3FDSA 4WKRA 4LQ9A 2XHWA 3KHHA 5HLFB 4L73A 3FSIA 4TY8B 1QE1B 1UW4A 3RJMB 1XQIA 4YMEA 2XLKA 2XI3A 4W92B 1S1XB 4LF9F 3Q23A 2UUTA 4A8OA 3NKYA 1R8CA 2H4WB 4ZITA 4IQXA 3Q8SB 2F4VJ 1C0TB 3M6VA 2WOMA 3KK1A 4DPWA 1LEOA 1BWVA 3KDNA 3KLIB 4EK2A 3UVJA 4QU7A 2RVJA 1T0TV 4USWA 2VICA 3DU6A 1S4FA 2CJAA 4CH7A 1FRMA 1DTQA 2J5AA 4WZQA 3AOBA 1RBLA 1SH0A 4IOAQ 4IRKA 5E0OA 4TY9A 3T5LA 2HGNA 1OWXA 1S6QB 4QWEA 1I3OB 2CVEA 3BGLA 4Q5VA 2R3VA 1ZPWX 2W9AA 1MG7A 2C3UA 2FJWA 2OSQA 4LRBA 1RTDA 1RHKB 4OHYA 3CIMA 1T11A 4UZCA 1D3WA 2KHCA 4B3TF 3NAHA 4K50A 3N9UC 1S99A 3GE9A 3KOAA 3TZWA 4Y00A 1JLQB 3QAUA 3OFFA 1JXVA 1MWZA 3HP6A 2MJUA 3CJKB 3JAMY 4CO3A 1BXNA 2RHSB 2HNZB 4URGA 4ZLLA 2Z58B 2G4BA 3CMAS 5KFYA 3L9ZA 1ULRA 3HFVA 4FXWA 1WUUA 3W64A 3MMCB 1IKVB 3TWZA 2DPIA 2RKIB 4MJKA 7FDRA 1WF0A 1NBEB 2UUCJ 3DDNA 4CLWA 2P9CA 4HH0A 3K59A 5KG5A 1XERA 3MZIA 4F25A 1F2HA 4DUZF 4RJVA 3C14B 2VJUA 2HVIA 1FNXH 4OZJA 1KWMA 4H4KC 4DQQA 4DV7J 3EZ5A 2KN4A 2M8HA 4PG5A 1HQEA 2CPXA 4DR3F 2JL9A 2MHEA 3HKWA 4RWWA 4QPXA 3HI9A 2W8KA 3NCQA 2M9KA 5D4PA 2R8GA 4EUVA 3NBPA 3RB0A 1RYRA 4Y6IA 3OFGA 3W9HA 4LRCA 1OY6A 2DNKA 4XO0A 1PIEA 3M8PB 2F4VF 1CJKB 5KG1A 2KM8C 4HI2A 2QV6A 1SKRA 3X1LB 1KC8T 3KXDA 1BD6A 3HMJG 2X3GA 4YHHJ 1YZ7A 2U1AA 1RT5B 3DOLA 2HVHA 4DV4J 3MM9A 3PRVA 1N8RT 3FBFA 3JYTB 3RG6A 4M5LA 3CCTA 3KLHA 4B9NA 1WC1A 1K9MT 3M8ZA 2D69A 4F4XA 3G96A 2EEYA 2QSWA 1LW2B 3AA8A 2E29A 3LP2A 2CKWA 3M05A 5L8RC 3NAIA 1HHTP 1IVZA 2HBZB 4CLKA 2WONA 3N0VA 1B7FA 2IRYA 1VRUB 2DR9A 1NKBA 2RJZA 5B7WA 4F2SA 2FZCB 4DSKA 3U27A 4L3KA 4HH1A 4KIAA 1XTZA 2XMTA 4FKYA 4ATNA 2BKNA 5IT0A 2AP6A 2KTQA 3U7JA 1LWEB 1ZPVA 1M1HA 2QYGA 3UO0A 3GFHA 3E3XA 5DQIA 2B8PA 3PYGA 3M2RB 3ILJA 1K1QA 1WI8A 2Q6CA 4IG0A 3N5BA 2HQIA 2MZ1A 1QTMA 1XNRJ 3TX8A 3CDEA 1IXKA 2RDJA 4IO9Q 4F7VA 3C6UB 4EU0A 4QJVA 3TR5A 3QZ7A 3MHYA 4RW4A 3KDOA 2J0WA 5HN0A 5M2RA 2VFUA 4GO7X 3Q24A 4DV0J 2UUCF 1KN6A 1SJQA 1UWBA 2MJNA 3QSIA 1R3NA 2XS2A 5F8JA 3VQTA 1WG1A 2W24A 3OUYA 3EZUA 4USJC 1HPZB 1BQMA 2XYHB 3FCVA 1S9FA 3OJSA 1XNQJ 2GGPA 3BO2A 3JTOA 1Q7LB 1VQ9S 3TVKA 2B9XA 3AH6A 3GR0A 1GMWD 2AGQA 4OYXA 4LBHA 3W9IA 4FYXB 2ALZA 2P9EA 4GRSA 3VGSA 3CD7A 1FJEB 2ZH8A 1IKXA 3GFXA 1SXLA 1P1LA 4OHWA 3QRPA 3UD5A 3CJRA 5LSOA 3G82B 1S48A 3BEGB 2M88A 3KJFB 2FTRA 1S1TA 4LBIA 1F5BA 2BE7D 1R0CB 1ZZNA 1KTQA 4BDPA 2ZWOA 2JFKA 2RILA 1NB7A 2RUSA 3QGPA 3NS7B 2MZTA 3BS9A 4USUA 2ZH9A 4YN3B 2GVDB 1M5OC 4X84A 5J1EB 4KH1B 1GXUA 3HKZD 2KYZA 3KWMA 4YHHF 2KFNA 2I9SA 1N6QB 4DV4F 5LOQA 4WP9A 2HGLA 2MPUA 3CCWA 1X4BA 2GMJA 2JH3A 1K44A 1URRA 3AODA 1EKRA 2OPPA 1NPPA 2HZAA 2NLWA 4WXWA 3NGTA 2CJQA 1RA7A 2ZZNA 4DU7A 1VQYA 2PMWA 4DL0C 4JI8J 1TKXA 3ENVA 4B3SJ 4DPUA 4NLGA 1IQZA 4FS1A 2MQPA 1CJVA 1FNMA 3TANA 1N56A 4TVAB 1QY7A 4KFBB 4CLZA 2E7WA 3ZFVA 2IJRA 4Y0FA 4DS4A 2OP5A 1VBXA 5FLXU 1R8BA 2XMKA 4CO0A 4QIFA 4NWBA 5IV4A 4LREA 4YUDA 3JS9A 5HK4A 5KFOA 4ECQA 2CJXB 4F02A 3DYAA 2F9JA 4P2XA 2PMHA 1RTHB 3EXYA 5C42B 4A8YA 5EDWA 5C5JA 3I31A 4NE9C 4Q0BA 4ZP9A 1FKPA 4R0EA 2DK2A 4PR6A 1UVMA 4J37A 4J5OA 4RO0A 3D0GE 3HULA 4KO0B 3EGWB 1KP6A 3UN3A 3KNAA 4DV0F 3B4MA 4OL8A 5A8KA 3MEKA 1HNIB 3DMJB 4ZKAA 3GWCA 4NA3A 1W2BR 2DHSA 1RWNB 3C6TB 3NRBA 2OO4A 1TKZA 1U7LA 3C8YA 1XNQF 2FJXA 5KFKA 5KT7A 1RU1A 5GAEU 2ZHBA 3L7UA 2BJ3A 4DR5J 2HK2A 5BYSA 3PFOA 4KQZA 2HLUA 2WBRA 4MYUA 1WTBA 2WAQD 5F3TA 2MTLA 1X31C 2DGTA 4N77A 2K1RA 1IQTA 2RHQB 4PXBA 2FPHX 4PQUA 4QYZJ 5HMWA 1VBYA 3GTYX 3KFWX 5DG7A 2WZ1A 1REGX 4RBTA 4KSEB 4USKA 4U7CA 2MLXA 1UVLA 3CWJA 3P45B 1NRKA 4NEYA 1GTEA 2UV8A 3OXFA 2V68A 4LSNB 1T95A 4B9SA 2J7KA 2CNKB 1VOMA 2R8KA 3VF0B 2JLGA 3NOCA 1VQSA 2NUHA 2R7VA 2ZNZA 4RW7A 1HARA 2V8VA 4HYKA 5LMUJ 1CEZA 3PW7A 5IZHA 4MKAA 3CGIA 2JNJA 3QFHA 1UKUA 4QOTA 3BSNA 3TNVA 5BJRA 3GIRA 1JLAB 2QFIA 3G9CA 2FC9A 3MPUB 3FRZA 2HEKA 5J2PA 1IBCB 2AWZA 5A8WB 3J81Y 2C28A 3LPEA 8RUCA 3TI0A 4JI8F 3FBBA 4B3SF 2LQ5A 4RNNA 2R7XA 2G2YA 1YJ9S 2AU0A 3IGNA 1PJ6A 4DG1A 2D3OR 4IFVB 1LOUA 4OHZA 2ZJRQ 4M5MA 3W2WA 4LF6J 3SQOP 3CCZA 3ULHA 1LWCB 3M8QA 1REVA 5H1SV 1DY3A 2MQMA 1BLUA 3VGTA 3I4HX 1UVIA 3PJXA 1HLWA 3GCWP 4OZNA 5HJXA 1Y0HA 3PYDA 2JWNA 3AXMA 3FSXA 2PMZD 3VAJA 3GB0A 3GONA 3DLBA 2OHDA 4JB8B 3VAMA 2AIRB 2J6SA 3OHBA 1AT1B 3MTKA 4OI3A 1WG4A 1JLFA 4DL5A 4O3QA 1JB0C 5I4MA 3QO9B 4ETXA 4PG7A 3CCQS 3HHLA 1G6BA 4LF7F 2HHPA 3A3OB 4ES3A 1VDHA 1S59A 2B8QA 3WBZA 2HW3A 3RB6A 1X4DA 2YWFA 3MF5A 3SEOA 3NWRA 2E1AA 3V81A 4ZCMA 2GFFA 1N5SA 4DR5F 1B0TA 1KQGB 1JK9B 2AHOB 1Y00A 4J9RA 4HLBA 3Q8RB 2QLFB 3CT9A 3DRYA 2PDAA 5KFZA 4GVBB 5IQQA 3MUMP 4ELUA 3EJMA 4C0HA 4RUBA 2V69A 4ZJQA 4KR0B 2RRNA 2C2EA 1U1RA 4ALZA 2YNFB 3DM2A 1GT8A 4I64A 4JOUA 3Q22A 3K5NA 1KOHA 2H51B 3M30B 4CI0B 1LWXA 1WDDA 2KVIA 2F5GA 1OSDA 5IM0A 1U0HB 2KZZA 1TUWA 4OZ2A 2JSXA 5DM6Q 3GIMA 1X9SA 4FF4A 2XMWA 2FD2A 1S5ZA 5LMNJ 2DEJA 5GMDA 2OAUA 4WK3A 2GNKA 5KG3A 2APOA 1Q78A 3OFHA 1QAXA 1U26A 3O6QA 1X4GA 3NGRA 3MR7A 2LQ8A 2UU9J 1JKHA 2FQQB 2PN6A 2PGCA 2KXFA 1FF2A 4PWUA 3I5AA 2NXCA 5DZ7A 3VGVA 3U1NA 4LF6F 2V4QA 4DS5A 1YIJS 3HD2A 1WJ9A 2I8EA 4PG4A 3DRSB 4F3QA 4NMXA 3H2LA 2AJ2A 3RBDA 5A0YA 3V4IB 2DCUB 3VV2B 2RB7A 4ZJOA 2OELA 4NRUA 2FB0A 4DBQA 4LFAF 1C1CB 2Y9HA 3HHEA 2IBKA 4DL4A 1M5HA 3DLGB 3RW7A 3CCMS 1AFIA 3AD9C 3QMQA 5GADU 1FE0A 5L9NA 1WKJA 2V9KA 1Z2LA 1EKSA 2MKSA 1E6VB 2H1YA 2W9CB 9RUBA 1AFJA 2N7CA 4R8UB 5HP1A 1UL3A 1FDAA 1H98A 2LEPA 3MAHA 1RWVB 1M1GA 4X4VA 1BY9A 4OJ1A 4OX6A 4LF5J 3TJ9A 1DTTB 1TAUA 2OPRA 1FRXA 2HBQB 1VIOA 4A8FA 1S0OA 1HL6A 1X5SA 1VIXA 1KQKA 4D3HA 3DOMA 4JI0J 1PYOB 1KFDA 3K2YA 3JXOA 1HBUB 4IR9A 4I4BA 2EFOA 1SQFA 3DLLQ 4IRDA 2XGPA 2LP4A 1Y9OA 2EG2A 1Q82T 4KPYA 5ETKA 1G7CB 2P6SA 4KY3A 1S9EA 2OPQB 1TAQA 1NK4A 3MURP 2J76E 3LA0A 2DRAA 2Z8QA 4P73A 4C97A 3FEZA 2B0GA 1K1SA 5KFCA 4FF3A 1NDCA 4ILMA 3N6MA 3GG1A 4FDFA 1CQNA 4K4VA 4WP3A 2XWYA 4C7QA 2DGUA 2UXDJ 2BA9A 4QCLA 1CS4B 4O44B 1UJ4A 3MMBA 2JC0A 4JP8A 5LMNF 3GJSB 2VODA 5EUHA 3D4JA 1WC5A 3A3NB 1U8SA 2ZH5A 1FRIA 2X1BA 3W8GA 3H8YA 2UU9F 2QG9B 2VA3A 4HKQA 4C3MA 4TYAA 2LFVA 2VFSA 4X4NA 1Q86T 2CZ9A 2I6WA 4J90A 1Q8BA 2W2NP 5I3QA 1FJ7A 2QA4S 4IH6A 4DPXA 5CYQB 2B4OA 3W2VB 3MR5A 2ZKUA 4DCJB 2J9DA 2B7CB 2XS7A 3HSZA 3CD6S 3D1HA 2QLXA 2C2ZB 1UJ5A 2UUAJ 2B9EA 5KFBA 3M6XA 4OMFG 2RQKA 1M5VC 2GVZB 2MSSA 2KFZA 1VQOS 2FZGB 2HVZA 1YTYA 4LF5F 2Y1RI 1B64A 3M1VA 1SIZA 2BJDA 3THPA 3LOUA 3T6JA 2PE8A 3M32B 3BBBA 3DRXA 4EYHB 4JI0F 3JSRA 5ETLA 1T05A 5D6GA 3NNHA 5MAOA 2DKOB 4PWWA 4YB5A 1GXLA 4WXOA 1VR6A 1NK7A 2YWHA 3CJSA 4DV2J 2VF3A 2E1CA 1VJQA 2EWHA 1APSA 3DOKB 4RW8A 2ZC3A 4NLXA 3MR3A 2FLLA 4OYZA 1KBRA 2YKMA 1C0UB 2XS5A 5E3CA 2HK3A 2HSEB 3DI6B 2H54B 3TO8A 2BJEA 4M8LA 4N56A 4P2SA 1RTJB 2M3DA 5F8IA 2UXDF 2CXEA 2ZHOA 3BBFA 5I42B 4ECSA 1ACMB 5E3AA 4OYWA 1E6YB 3QATA 1VMBA 1Y4ZB 4IDKB 4OX9J 3H5YA 1IKWB 3ETOA 8ATCB 2GCFA 3BQ2A 2JDJA 3P49B 1S1WB 2RSQA 2ZHAA 5GADI 1PGZA 2YKNB 1UZDA 3OTDA 3G6VA 5D4OA 1UW9A 2DR5A 4LFCJ 3PYEA 4L72B 4TNOA 3RW6A 4RBVA 2E5JA 4OI6A 1RWXB 3TX0A 3AD8C 3H59A 1NHVA 1SC6A 4K8RA 2E1RA 2AJ4A 1HQUA 2GO8A 4C8KA 1NJIT 9ATCB 2RF2B 1CPZA 4OJ3A 1TK8A 4KT0C 4FYVB 3MM6B 4O3NA 2HHXA 3A8IA 1HI1A 4TN2A 3N28A 3LH2S 5KFNA 4PAAA 4H4MA 2UUAF 2V4RA 4CTAA 1K73T 1TL1A 2ERRA 1NPKA 1FFSB 1NKCA 2LU1A 4ICLB 1MW7A 2CRLA 3MM8A 2XZDB 3PW4A 1RHRB 1S6PA 3QT8A 3D6FB 3MECA 5IT4A 1ZETA 3H20A 4I6WA 2CPZA 1Y3JA 2BE2A 4CYUA 5RUBA 1RT6A 3W5YA 1RE1B 2GIQA 7AT1B 3EXCX 3TVZA 3FRYA 1S1VA 5FD1A 2HRUA 4DDFA 4DV2F 4B9UA 1CJTB 2CQGA 3AJ1A 2LXIA 3UW1A 1FWLA 3MMAB 3CPWR 4OYPA 5LM7E 2QO3A 2DNOA 3DXBA 1TKDA 1FFWB 2PO4A 1OPIA 5THWA 3HSGA 2B5JA 2AX0A 2DXEA 4DPOA 3R6LB 2OI2A 2BANB 1VRTB 2CNOB 3PHTA 1FWKA 2DGSA 2OLWA 2CQ2A 2KT5A 2GJ2A 3GJRB 3NGKA 4RWXA 1NO8A 3KLEB 3PKYA 5E33A 1WC6A 2WBMA 4OX9F 1PAUB 3PEHA 1RWKB 5J2MA 2DVIA 1H0HB 4PUOA 3RR7A 1IUJA 4DSEA 4LFCF 5DRKA 4QPTA 4EYIB 2M4MA 2HNYA 4HHJA 2VG5A 2FHKA 4DPTA 1HBMB 1SI9A 4IG3A 3FMBA 1GXTA 2N82B 2RH3A 5KFXA 2G0IA 1TL4A 1JLBA 3PFEA 2EC0A 1UTAA 2O3DA 3W65A 2R8IA 3BQ1A 2CIMA 5F8GA 3GIIA 3POTA 3UWTA 3ZTRA 5C25A 1RAHB 2B7BB 2VG6A 2DCLA 3PR4A 1RAFB 4ED1A 3SDEB 4IQMA 3AOCA 3M8PA 3GILA 3HFZB 1GNKA 3H0PA 4R0JA 4ECVA 1GK8A 2MZQA 4WIIA 1MWQA 3Q2TC 2HFSA 3ZZUA 3FGVA 4KHPJ 1Q53A 3EGNA 4X4OA 2I0XA 8AT1B 3TW0A 4WYLA 3IRWP 1OYDA 1X4EA 5LJ3Y 4TU9A 4I2QA 2XSJA 3J80U 3FSYA 4U9RA 4U8YA 3MM7B 3KHRA 1NDLA 3I4PA 2BUNA 3OHAA 1I6JA 2XCPA 2CFXA 2KB2A 3FKBA 3HHLC 2GS8A 1WHXA 2HS3A 2VBWA 3T6BA 1Q16B 2J0QD 2DHXA 2ZVIA 1RUSA 1NSQA 3ZZTA 4ZVHA 2ZJQQ 4AL5A 2VDIA 3CSKA 2AX1A 1N5YB 4U8VA 2YNHB 3UPFA 2QZ8A 3DC2A 4OYAA 4NZ7A 2H65B 1YRTA 1DRZA 3C2PA 4NCGA 5A2QY 5K14A 5D4NA 3R5CA 3ZZOA 2GJIA 4CT9A 3GU0A 3BPSP 3JSYA 3VTIA 2DTJA 1JLEB 2B6AA 2F1FA 3BR8A 5HVGA 1RHQB 1X4FA 3DKDA 3PVXA 3D3BJ 5ITHA 3UR0A 3MDFA 4PQAA 2HIQA 4O0NA 2RU3A 1QUVA 1MROA 2ZE2A 4MT1A 4JI1J 2H4YB 3GYXB 2OD6A 4OLOA 5IS2A 2HFNA 1TL3B 3ZZ0A 2Y1IA 5E41A 4JV5J 4K4WA 4NRTA 3QRRA 2HNDB 2MSTA 2YWEA 1KLMA 1V5VA 3S01A 4QW9A 1HI0P 3VAIA 2MKJA 1HWIA 1LK7A 2JRSA 2VC0A 3OQ2A 3PIOQ 1S1UB 5KTQA 2KT3A 5DDQC 4B3OA 3WC0A 3BGRB 2L9DA 2VKZG 4DHVA 4N76A 4PWDB 2FYXA 3MD1A 4USHA 1YJTA 3VALA 6AT1B 4NLOA 2YKPA 3RRHA 2HZVA 2V2KA 2DNPA 1HD0A 1C2PA 4CIOA 3MCSA 3M4XA 1WNEA 4QIVA 3KK2B 3K5LA 1HBNB 2WVEA 2NYHA 3DRRB 1WOPA 2K7JA 2NZ4A 3W7BA 3IR7B 2RT3A 4X2BA 5KG7A 3T1HJ 1TKTB 4C8MA 5CQGA 4KHPF 2V63A 4X64J 1M90T 1FFGB 3C16A 3MM5B 2ZFHA 3NMRA 3G6YA 3M2VA 1V3SA 5D0EA 2ZKTA 3H2VE 2R7TA 4KRWA 4NXNJ 4ECZA 3ISZA 3NCPA 4ENOA 3RYLA 5L1JA 4ED7A 2RD5C 2LCWA 4ECTA 4DL2A 1SCJB 1EQ0A 1BQNA 1YHQS 2V4JB 1FKOB 1QLNA 3B6BA 1AUDA 1ROFA 4KV8B 4KTQA 4FYDA 2B4PA 2E66A 4HACA 2HFUA 3R5AA 4ID8A 5A76A 4XTTA 5HROA 3TJAA 3I87A 2ROEA 3UD4P 3I0SA 1QAJA 4M5NA 1LWFA 4M5DA 3H4DA 2PD1A 2DJWA 2QEXS 3HK2A 4CO2A 1RT1B 1FDBA 2NREA 4MIAA 2I2YA 3TAMA 3SSRA 5KFVA 2DPJA 4RW6A 4FNHA 2COLA 1S72S 1U4BA 3S7RA 2V2QA 5IXUA 5D3GB 5C24A 5KT2A 2XYPB 2AJFE 5AT1B 3K58A 4Z2XA 4EMDA 2EI5A 2KG0A 5D78A 5EWFA 4JI1F 2Y8YA 1TV6B 1RLDA 3JQMA 4JUZA 3ZTQA 4NI2A 4PXEA 4FF2A 4DV6J 4MK9A 4RX6A 4JV5F 1XWLA 2FVQA 4B02A 2VUGA 3GV5B 3KLGA 5AXNA 3TYTA 2AKWB 4USVA 3OV7A 1IR0A 3V4MA 2M52A
chains in the Genus database with same CATH topology
5CD4H 4GC6A 4Y2CA 2HGLA 2MPUA 1Y7PA 3CCWA 1X4BA 2UVRA 2GMJA 2JH3A 3KG4A 1URRA 1GTHA 1IBLF 4O44A 2DH7A 2OPPA 3AB2B 1Q7YT 5GAHI 1HQUB 3RB4A 5CXTA 4UOCA 3G4SS 2NLWA 4WXWA 3CCVS 1RT3A 3J7YI 2CJQA 3MPYA 4NLDA 2GO9A 3IWNC 2D9PA 1FJGF 3OTOF 3IAM9 1RA7A 3L3CA 2ZZNA 4NYOA 1XMQF 1F0XA 1VQYA 4AUKA 3DHWC 3BDPA 2VOOA 3UR3C 2RU9A 2L08A 2D7SA 4MIBA 3VR1A 4DL0C 1TKXA 3ENVA 3BZQA 4QR1A 1IJEB 2V94A 1SUQA 4QR2A 4NLGA 1IQZA 4FS1A 1VS3A 2WB1D 1YWXA 2MQPA 4DFPA 2XY7A 2IJFA 2XMVA 2HMIB 2VH7A 3HHDA 2N3LA 3M2UB 1DURA 1RQ0A 4K4XA 3BSAA 3UD3P 4WTYA 1ZTTA 1FNMA 2KHDA 4QZVB 3TANA 5LXYA 1N56A 4CH0S 1HFEL 1EETB 3IWXA 3AQOA 3DRPA 4H4MB 4WCEQ 1CC7A 4CO1A 3I6PA 4HT5A 1N88A 1QY7A 4CTAB 3SCKE 4NYPA 1R31A 4KFBB 2E7WA 3UI3A 4MKBA 1TL1B 3ZFVA 1Y3KA 5E2QA 4Y0FA 4DFKA 2A2DA 3TAQA 3J7ZT 2L41A 1D8YA 4DS4A 2OP5A 1XR5A 4FNIA 3Q0AA 4URSA 1TVRA 1VQKS 1RJJA 1VBXA 4TU7A 1R8BA 2XMKA 2VFTA 4CO0A 4QIFA 3QJPA 3IG1A 5DDOC 4EWTA 3X3UA 3PACA 4NWBA 3L7PA 3MM8B 1VI7A 4I67A 1S6PB 3T1HF 5CYQA 4YUDA 4MFBA 4ZCLA 1C4CA 4DQRA 5DETA 3W2VA 3SV3A 5T7LA 5KFOA 4ECQA 1RT7B 2VBZA 3AAWB 4QIWD 3UDCA 3MECB 3CCJS 4F02A 2ZITA 4GKKF 1X7VA 3DYAA 3SI8A 1M1KT 2FY1A 2F9JA 2XY6A 3HHLD 2I38A 1O8BA 4OX7A 4X64F 2PMHA 1RTHB 2CQBA 4Q45A 3EXYA 3KHGA 3LF0A 1KFSA 3TAPA 4UUWA 5C42B 3DLKB 4A8YA 4I7FA 3RAMA 2V5HG 2XULA 2BE2B 5C5JA 5EDWA 5FIIA 2JVOA 3LWMA 3I31A 1T03B 4Q0BA 2W4DA 4ZDNA 1K0TA 1NJYA 4ZP9A 1NKEA 2HHSA 1OQ3A 1FKPA 3KLFA 1WG5A 3LALA 2N4DA 4ED2A 1RT6B 1WD6A 2GHVC 1Y5NB 2JVRA 4R0EA 2YX4A 2HFZA 4U6PA 3QIPA 1FNOA 2DBBA 2DK2A 4PR6A 1UVMA 4J37A 4J5OA 3AJ2A 4A8XA 2R2TA 1RTIB 3OXGA 3D0GE 2YWGA 3O2IA 2ZH2A 3OSPA 4NXNF 4KO0B 3N6LA 4CCHA 3CUNA 4O3PA 3EGWB 4DJBA 1QVGR 3I0RB 1R8AA 1X5TA 3KNAA 2WSCC 4DV0F 2YNIA 1S1VB 3B4MA 5A8KA 3CC4S 4OL8A 3MEKA 1HNIB 5KFUA 3DLJA 3DMJB 4ZKAA 2NSCA 3GWCA 4NA3A 4X4SA 3MUTP 3KJVB 2DHSA 1W2BR 3C6TB 1YBAA 1DLOB 2F9DA 3NRBA 4ZCIA 5AE2A 4KB7A 2Y1JA 1ZZFA 4WZMA 2OO4A 3HVTB 1TKZA 2DNHA 2UV8G 2VBXA 3V6KA 4ED3A 1U7LA 1WI6A 4U7UK 3C8YA 1XNQF 1NNDA 4Q8EA 2IRUA 2JEIA 2FJXA 5KFKA 4Q2LA 3RRGA 5KT7A 2ACYA 3TQ1A 1SJ4P 1TQLA 5GAEU 2ZHBA 4ZOSA 3RAQA 3M32A 5BYRA 1VQ6S 2NUUG 4WE1B 5K9FA 5BYSA 3CB4A 2MMYA 3PFOA 4KQZA 2HLUA 3OVAA 4M63A 2K2PA 5FJ4A 2WBRA 4I56A 2B5JB 4MYUA 1FE4A 2DISA 1GAOA 2DD8S 1SQEA 2GQ2A 1WTBA 2WAQD 3MD3A 5F3TA 3RZAA 4AL7A 4JI3F 4M95A 3O1LA 3TVKA 2DGTA 1YRUA 3VAFA 4BWJA 1W2IA 4N77A 2K1RA 3OL7A 1WHYA 4USIA 1IQTA 4G1PA 4PXBA 2FPHX 1QM9A 3C3LA 4PQUA 1TUVA 3CCES 4ILLA 4QYZJ 5HMWA 1SJ1A 1VBYA 1NK8A 3KFWX 4EBCA 5DG7A 4ECUA 2ATLA 3LAKA 2CQDA 4KSEB 4RBTA 4HVZA 4U7CA 2W4CA 2YKQA 3HFKA 3DOKA 1URNA 1KQSR 3DU5A 2ZD1A 1UVLA 2A3JA 2FHOB 3CWJA 4H4OB 1VJWA 2GV1A 3MFHA 1NRKA 1CC8A 5LXRA 2H5EA 2MDAA 4GO5X 4ZP7A 1GTEA 2UV8A 4MIWA 3OXFA 2RRBA 4LSNB 5GMKa 4KE5A 1T95A 4XK8C 5LSRA 4B9SA 2J7KA 1VFJA 4FXVA 3T5HA 3I5BA 4P7TA 1C1BB 1YJWS 2NXUA 1YJNS 1C0UA 1F5AA 1VOMA 3FZBA 5HBMA 2M70A 4OQJA 2R8KA 3VF0B 3KK1B 1VBZA 1SH2A 2NYIA 3PR5B 1CQMA 4DV6F 5KOWA 2JLGA 5J2NA 1MSWD 3DI6A 2IM1A 5KFLA 5J2MB 1R8PA 1VQSA 4DN9A 3BO3A 1MMNA 4DEZA 2NUHA 2XY5A 1MMDA 4ITSA 2R7VA 4PUOB 2ZNZA 1S7HA 4TKTA 2HNYB 2EPIA 4RW7A 1RTJA 4OI0A 1HARA 3BQ0A 2V8VA 1ZM3A 3MEEA 1Z1ZA 3FNNA 5B0AA 5HMZA 4HYKA 1VHFA 1CEZA 1ZM2A 3PW7A 5IZHA 2RUGA 3G8SA 5I42A 4MKAA 2VG5B 4DLEA 3CGIA 4PPDA 1UKUA 4QOTA 2E5GA 2WRMA 3KTQA 3U1LA 3BSNA 1Y5LB 4IG3B 2IYGA 3TNVA 1O0PA 5BJRA 3J7A1 2QRRA 3KKFA 1DTQB 1VQLS 1E6YA 2AYEA 2E9RX 1JLAB 5KT4A 4YQWA 2P9GA 3G9CA 1J5OA 2FC9A 2MY8A 3KG0A 2ZH4A 4HDGA 3FRZA 5M2PA 4IDKA 1GQEA 2VQFF 5IFMA 2DNLA 1IKWA 2OSRA 2LXFA 5J2PA 1DBDA 2AWZA 1S1WA 2V8HA 3CC2S 5A8WB 2XEXA 2DNMA 4WFXA 3J81Y 2C28A 5CYMA 3K5MA 3WC2A 1JLBB 1PC5A 2WCXA 1VQMS 1CLFA 1N36F 3TI0A 4JI8F 4YP3A 2YKNA 1RYSA 4B3SF 1WF2A 2LQ5A 2DIUA 5B0GA 4RNNA 2R7XA 4TU8A 1YJ9S 4DSLA 4EO8A 4KHMA 2AU0A 1DHMA 2RMLA 3LAMA 3HPOA 1JX4A 4F2RA 3SSQA 4HDHA 3POTB 3IGNA 2KO1A 4C2MA 4DG1A 2ZUGA 3G86A 5C25B 2D3OR 2WSEC 1IBMF 2JC1A 4IFVB 1LOUA 1K8AT 4OHZA 1DQ8A 5KT6A 4IO1A 4ZPTR 3ZC4A 3OR1B 2ZJRQ 2VG6B 4OZ0A 4Y3CA 2D3ZA 4X66F 1IBKF 4F4KA 1U25A 1I94F 4NPOA 3W2WA 3MOZA 1SB6A 1FHTA 2W8LA 3ZZRA 3CCZA 2P6TA 1RTDB 3ULHA 3O3LA 3T1AA 4L6V3 3VCDA 1R6YA 3K8VA 4DR2F 2DGWA 1KRPA 2HAIA 4G1QA 1LWCB 4AE5A 1FTRA 2FIUA 5H9FJ 2RF2A 2HWHA 3M8QA 1TP7A 1REVA 2Q79A 4X4UA 5H1SV 1X5OA 2BBEA 2MQMA 4I1TA 3VAKA 3PW0A 1U6FA 3PEJA 1VQNS 5DGBA 3ONQA 1BLUA 4HL9A 3I4HX 2BW2A 2OKQA 5AJ3F 1UVIA 3PJXA 2CJKA 4QWAA 1RKJA 4OZNA 3MM6A 1Y0HA 2BYCA 1OO0B 2JWNA 3OR2A 3T9ZA 3GV8B 4TLRA 3FSXA 5K8PA 2PMZD 3VAJA 2FJVA 4O4RA 3GB0A 3GG0A 4B08A 4IFYA 4ZMMA 3DLBA 5J2QA 2AJ1A 5DDPC 5JVHQ 3VAMA 3D54A 1U1QA 4V19J 2J6SA 3OHBA 2MKIA 3TA2A 4P6QA 4I2PB 1GX6A 1FK9A 3MTKA 3K5OA 4OI3A 2X51A 1WG4A 1HBOA 1L3KA 2R4FA 1U49A 2DGQA 5F9LA 1Q1KA 2UXBF 1JLFA 4DL5A 2KT2A 2OD4A 4LSLA 1QVFR 2ZH7A 2RQMA 4O3QA