2RQEA

Solution structure of the silkworm bgrp/gnbp3 n-terminal domain reveals the mechanism for b-1,3-glucan specific recognition
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
102
structure length
102
Chain Sequence
YEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the silkworm betaGRP/GNBP3 N-terminal domain reveals the mechanism for beta-1,3-glucan-specific recognition.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Sugar binding protein
molecule keywords Beta-1,3-glucan-binding protein
total genus 7
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rqeA00
3IE4A 2RQEA 2KHAA 3AQYA 3AQXA 3AQZA
chains in the Genus database with same CATH superfamily
3BUPA 2IH9A 2P48B 1A6ZA 2ZONA 3K81A 5DYOA 4S0SD 1YJDH 3PL6D 4DSYA 1N6UA 2ICES 4PWIA 1ZVYA 1YECH 3PNWA 2LFGA 1YMMA 5AZEL 1GZQB 3B4NA 2P49B 4NP9A 5IHZA 1A4JA 1SZNA 5KOMC 5C0BE 3FT0A 4Z7VA 5AALA 3S2CA 5JHDA 1BF5A 3Q6GH 4OBSA 4RMVA 4JB9L 4LKXA 1LEGA 3H0TA 3MV8A 3QJSB 4WGWB 2CO6B 4N2MA 5L2JA 2QDWA 4AI7A 4XP4H 2A83B 5I5RA 1CTMA 4PREA 4I48B 1KPUB 1Y07A 3NCXA 3A67L 4JY5H 4IU3B 2IFGA 3BH9B 3PHOB 4ZXBD 3NSYA 1CDIA 4BFRA 5GS2H 4ZO6A 4HH9A 4DTGH 4A2HA 1RFDL 1NDMB 4OCYH 4XPFL 1OAXH 3IRPX 2XKUA 3KLHC 1U8HA 3JV6B 1BAGA 3DJTA 2V2WB 2E9IA 4ONFL 3ATBA 3E6FB 3MRJB 1F3DH 1NBZA 3WE6A 2XXGA 1KT2A 2A2QT 1SYVB 1XF4A 2WBKA 5AG8A 4FI6A 4POZD 3T8XA 3AB0C 4OF6A 2YGPA 4K3JH 5EOQL 3TV3H 1GR7A 3NP3A 1F4WL 4G71B 2W8CA 3NSXA 1DVFA 1WFJA 4GAJL 2FE0A 1HC1A 2V2WA 1HWGB 4PRIB 2HRHA 1ND0A 4OJYA 1A6WH 4I7ZC 4DKTA 1JGEA 3ESOA 4B9FA 2NUTB 2SEBA 4M7KL 4WFED 4EF3A 5I18H 3UTOA 3UMTA 3X13A 1QLRA 5CFHA 4FQJH 4EI5C 1C08B 4JZOA 3UTTE 1P69B 4DK5A 1UB5B 4OFYD 3RVTC 1DUZA 4ZW5A 1OAKL 3GPEA 1NIFA 3QDMB 8FABA 2PCPA 2X0WA 3U9PL 3AS2A 4MCYA 4HG4K 2DQDL 4JO3H 4LVNB 3IMTA 4L2LA 1J05B 2A6IA 4PCKA 2E27L 4HLEA 4D2NA 4AIXA 3FO1A 5L88H 5IFJB 1JV5A 4XNUH 3SJVE 3CUPB 5B4MD 4UOZA 4O4YH 4MJIB 3UCRA 3W11D 4PRPB 1L5GA 4GAFB 3FRPA 3MRQA 3EDEA 3UTPE 1BVNP 1WAPA 1F41A 1FVDB 3QG7L 1OO2A 2DM7A 3NK4A 1T04B 2E8YA 2P8LB 2X4SB 5DU7A 4F7EA 3N1MC 2X4OA 1OGAD 3GPSA 4RGNE 5F7EH 5D7IE 2W91A 5F9OL 4C54A 3SO3C 4NQCB 5C0GA 1EO8L 5CNHA 2J8OA 4R96A 1A3RL 1NDGB 4WFHD 4XBGA 1LYQA 3MJ7B 1EH9A 4I8DA 1MDTA 3EUUA 5DD0L 3QNYA 4Z6AT 1ACXA 3V6OC 4GO6B 3C75A 4E9WA 2AFNA 4YHYC 2H3NA 5DQ9A 4DPBX 5IREA 2ICEA 3C60B 1DBML 5F72S 5HJ3B 2OSWA 3U9UB 1F6AB 1KB3A 3HC4L 4XBGB 2R0KL 3DOHA 3EJUA 2WTOA 3BVTA 3MJ9A 2AQSA 5F7KC 2W0PA 5I16B 1DHKA 2J8UF 2XVBA 3QNYB 5B1BB 2VUOA 2EKJA 2ADJA 5FECB 3MO1B 3RWCB 3CVCA 5A2FA 3EO9H 3P77A 1DJZA 5E99L 3RTLA 4HIJB 4X5QA 4YDJA 2QVMA 4R2GB 3ZE2F 3H3KA 1HHJB 3OJDB 4XXDA 3MFFA 4H8PA 4G8GE 1ZV5A 2EVGA 1AO7B 4J1UA 1J8HA 1L9OA 4G6KH 4NRYA 3II2A 4HAKA 3V4VB 4LSRH 3V6OA 4OZ4B 4OTXH 3QCUL 1AGFB 2HRLA 4FG0A 2Z93A 3QI9D 2VE6B 3WKNA 4OCNC 4MRCA 5T1DH 4H5SB 2O6DA 1NWPA 4F27A 4IJ3C 3ZZSA 4RFEB 1GCFA 4I2XE 1EWHA 3H9ZA 1AGEB 2X6MA 4J27A 1UM5H 2DOCA 3MV9D 2IGTA 1TF4A 1S7QA 5CZVH 4F8QA 1A4CA 5E1AB 4PBVC 4YHZL 4J6IA 2V5RA 4MQ7A 4QRPA 3WY2A 5I6MA 3VFMA 4KQ3H 1H0DB 1W9XA 3O0RH 3ZBMA 3HEIB 3TCLB 3D0VA 4XX1E 3QUYD 2E3VA 1AZRA 2Q7YA 3CX5J 3BISA 1YMMD 3FT3A 3L1EA 4RETB 2ICCA 2J25A 4P9HL 3GQFA 2AMUA 4BZ2L 2FYVA 1BSIA 3DOSB 4JQIL 4ANVA 2WXIA 1N8OE 1S78C 5AKRA 4B97A 4UTBL 4Y19E 4TLTA 5FPIA 1S9KC 3NFNB 2LLLA 4KFZC 4JDTH 4WJ5B 3ZL2A 4Z3EA 2LV4A 2BS71 3N55A 4P5TA 4PV8A 3VWJD 2EXWC 4U1KB 2BRRL 4M7JH 5DMKB 2DQHH 3DYPA 2K6WA 3G08A 1KXQE 2H6PB 4PP2A 3B5GA 3C2SA 5D7JC 1DE4B 5DEGB 4P2OA 5FGCE 5DGRA 3PWPE 5KAQF 2VQTA 3OD3A 1KIPA 3ABZA 3NZ8A 4JZJA 4NFBA 3U9PH 1DUYB 2Y07H 4KU1A 3OHMB 1R3JA 5B21A 2FIKB 4I18B 3U4EA 1AKPA 1NAMB 5HPMA 1QI5A 5DC2A 1EA9C 1ZA3B 4LHUG 1JD7A 3CG8A 2CWRA 1ZIBA 2F19H 4WNQA 5A6MA 5ADPL 3BQUB 3G5XB 2XA8H 3UC0H 4IRJB 4Z8FL 4F9LA 2XWZA 3GMPB 1NAMH 4W9DC 1I31A 3WJMA 4G6AC 3BZEA 3CC5B 4LCUA 4PJ9D 3TURA 4BXSV 3IVKB 3KWUA 5FDYA 1IGJB 2HT3D 5IF0A 2YSSB 3C8HA 3VX0A 4D0CB 2ATAA 3MCYA 5ALCH 5D1QB 2G2NA 4BK5C 5GHWH 1UZGA 2CKBB 4U1LB 1D9KA 4JFTA 4MJJA 5BZDA 5I19H 3MNDA 4PVMA 5SX5K 3BPCB 2Q8BH 4LFHD 2VDPH 1FA4A 4F15B 4R7DA 1XGPA 4X6BB 1G6RA 5HHMD 2Y5TB 3FKUS 3WIHA 2GSIB 1J0IA 3B2PA 1HX0A 2TRHA 1HOCA 5FEBA 3Q6GL 5ABDE 5J11C 5DJAA 3PWPD 3LXBA 1NGPL 3CE1A 5JIIA 1ZRUA 1XL6A 1M7DA 5EFIB 1G6RB 1YEKH 1K4DA 4IRZA 3LKQB 1V8HA 1A0QL 2GEEA 4AJ0A 1Q94B 1YJDL 1HOCB 2OQJB 2MMXA 4P59H 2MPAH 1G6VK 1XVSA 4JFPA 4AC4A 1TZHB 4PS4H 4HF5L 3KYOA 5TQ2H 3WEXA 1CI5A 1MF2H 1EV2E 1CL7L 2GJPA 4K3EL 1RZJH 4JJ5B 2NSXA 3UPCA 1SJXA 4GP4B 4X7SL 5BRZD 5TE7H 3RVXC 3L48A 2XJKA 3OHXB 2EIKB 3HG1B 4NZUH 3S9DB 4HV8B 5DT1H 4WEBH 3VRIB 1AXIB 2P45B 1G7IB 4H0GA 4RIRB 1LO5B 5IW6B 1DZBA 3VFPA 1CFQA 2E74C 3K4DA 3ARRA 1R5WA 4C56E 1R0AL 5FF6A 1TG8A 4S2SA 4DEWA 1WCQA 4ADJA 4G43A 3X12B 1N68A 3CLWA 4HA1A 4HWEL 1M2VB 4NQDA 4YHPA 2PXYA 4OM0L 3AAZB 5KYNA 1FN4A 5LGHH 4XGZB 5J89A 5DMGD 2R2EA 3ZQXA 4AYGA 3BZ4B 5FF6B 1IGCL 3PXLA 3SGJA 1VCBC 2WIIB 1WDAA 3OXRA 2Z64C 4NKMB 3SBWA 3IB4A 1ZHNB 4XE5B 3UX9B 1KFAH 3AAZA 1UCTA 4FA7B 2BMKA 1V3KA 2QPEB 3TO4C 3VI4E 1TYJA 4FYRA 3L6FA 3FH5A 1NUGA 1RJCA 1PVHA 1RVFL 4HLZG 4NKMA 1L9TA 3OB0H 3OXRB 43CAA 4BFJA 3DXAA 4Y5YA 4M1DL 1O0VA 1MFMA 1IC0A 1PG7H 5KYYA 3KPOA 3PDOA 4W9JC 2WQSA 3IDYB 1H8LA 1QOKA 4PRBA 43CAB 1WF5A 3GSRB 1O9VA 3PABA 3B2MA 4JN2A 2LVCA 4AITA 4R7XA 1JG9A 3LPPA 4RBPK 3KLLA 2HT4D 2YBGA 3V4UH 5IP4A 1MNNA 1PZDA 2EYRA 3O2DL 3A4FA 4MVBD 2GY7B 1DBJL 1YPZE 3PL6B 3QUXA 2H26B 4QOKD 2EICA 5I2IA 1F4YH 3KPSB 4YK4C 2Z8SA 5EZLA 4PJEA 5C0CB 3QGVA 3ULVC 4Y2LA 2HMID 4ERSL 1DBJH 1E67A 1YPZF 4EKXA 5IFHL 5JLZB 1RZIA 3BJLA 3I75B 3GRBA 4XRCB 1MFEL 2GI7A 2IANE 1V05A 4PLOB 1TEYA 5MI0C 3GIVB 4GEJA 2A3TA 5IMLB 1E5BA 5MEQB 2D8KA 4BHUA 1AFVH 3RDTD 1M9WA 1BVLB 3GKWH 4U6TA 1OPGH 1CF1A 1FNEB 3GIZL 3NZSA 3AREC 2PCYA 4WW2C 1HH9A 1OE2A 4FL4C 1UD3A 2EKSA 4JKNA 5IW1A 1UD8A 4M1DH 5I1AB 3FO9A 2AAVA 1TZ8A 2VLRD 5E23A 3L5WA 5AAPA 3CX5K 3NPZB 4NT6B 4MD4A 4YZFF 1GC1H 1GYAA 4GSQA 1W72H 4KXZI 4MXQC 5H2BB 5L8LB 1C5BH 3D50A 4N87A 4Q74A 3WUWG 4AQEB 1A66A 1RUQH 3ECBA 4FXGB 3VD2A 5CS7A 2Y1AA 5I1AA 4RFNB 4XZ4A 2DQFA 5D71L 4B9GA 4LQFL 4JW3A 4BE5A 2HSIA 3QI9A 4QJ5B 2CNZA 2P5WB 2DWEA 4O2CA 1H6EA 4RAUA 3TFKC 5DRXB 2BNQA 4QYOA 3B9KD 4A2GA 1SY6A 2WSKA 4LDEB 4QNPE 5L4JA 1UH4A 3HJEA 3OKKB 2OMYA 2QFRA 3QIWD 4F8OA 3QORD 5E2JA 1WTLA 5E8DH 4JJOA 2WKOA 2W0KA 2ZUWA 3CVHB 4Y4FA 3HUJE 3QDHA 1QSFD 4GRWE 4L0ZA 5CP7B 3MNZA 3NYKA 1BD2A 1GHFH 3MV7B 4X2UA 5T5NF 3PIQA 4QLRA 1LK2A 1KBPA 2FR4B 1A1NB 2VAAB 3HZKA 5J5EA 3SQOH 1SDDA 4OGAD 2ZKMX 1H5BC 3KMDA 2CCWA 4I0PA 3FRUB 3MLXL 2IADA 3LRSA 3IFLL 1TVBB 1SHWA 2N7SA 2R15A 4WI4A 4AV0A 3RL1B 2XXFA 4N6QA 3RWDB 4RGMB 3V52L 1MWAA 5FO7B 2ZX8A 3HG2A 5I23A 2MPAL 4MKTA 1ORQB 5TF0A 4GMTH 4N8CH 3NUKA 5IQNA 2F8IA 4XMPH 4TMPA 3EDKA 3NCJL 2WN2A 4GI6A 3UYRH 1LNUA 3GBDA 2IBGA 3UDWC 3WNIA 4ZK8A 3BX7C 5F1KC 3SCMA 2G2RA 5HGHB 2C9QA 1EMTL 2G5UA 3AWGA 2FSEB 3T0WA 4L4VA 1DBBL 3WFHA 1SXCA 4Z7UE 4N2KA 2PCFA 3FB5A 4UNVA 2WJ7A 3ET9F 2G2RB 1JZFA 3N85H 1U8QB 4L4TA 5DD1H 4AH2A 4GW4B 3SIKA 4ZNEA 2VDQB 3GWJA 1BXVA 5AAWC 1E2WA 2V17H 4NQDD 4LESA 4XB7A 1NUNB 4Y5VC 2Q76A 2XXCB 1Z9NA 2NW2B 2MTPA 3D25A 3UTSE 3VXPB 1KZYA 1BQLL 1AMXA 1AZCA 1URZA 4PJ9A 3KWWB 3NN8A 3IFPA 4W81A 4PYGA 1OD7A 5GRUH 1K5NB 4OKDA 4HH9B 1KV7A 3QQXA 2Y22A 3ULVH 3MODH 2Z35A 5E2WL 3GSXB 4QKXB 2R9HC 4JFOB 1JNLH 1DFBH 3KHOA 4OAWB 5DCCA 4B0MB 3DV6B 5IG7A 4U0QB 3DDGA 1E28A 3D52A 1NBVL 2K6YA 3DV4A 5EBGA 3DX0A 2VM3A 3HNVL 1FPTL 1KCUL 1NFIB 5E6ID 4IHOA 1L7TL 4PIRF 2Q1EA 3QE5A 1MLBB 3QDGA 2N7AA 3QPQC 4PJ9C 3FSZA 4DGIL 5TD4A 2BRRH 4M7JL 5L6YH 4F7MB 4QYAA 1JPTH 4K3DL 1G9NH 3EBIA 1T89C 4ZUTA 1MQKH 2NXYB 1TQTA 4L9LA 1L9MA 2TSBA 3SSGA 1QW9A 3QEQD 3NIGF 4DT2A 2O5NA 2DTSA 4MJIA 1CLCA 1QWHA 5CSBA 4FCHA 4KY1H 4MMZA 1KSRA 1RZ8B 3K71B 3NDZE 1HQ4B 4RBPH 2CO2A 3RKDD 3BEWA 1BMWA 4U1SB 1RH8A 1IJNA 2ENSA 4EI0A 3NGBC 4ZFOB 4JY6A 5E9NA 4Z7QF 3WFZA 1CFMA 4ICWA 4J3VA 1I8MA 3G9AB 5E2UH 1MCFA 4PGDA 1S3KL 3IKCB 5F8QC 1Q0XH 1MVFA 2K70A 1QLEB 2NY1B 5INCA 1NA8A 4PY8I 4YSOA 2R0LL 1MIML 3C5XA 5T1KA 4A2EA 1RKRA 1PCXA 4NZRH 3MJ7A 1E8YA 2NOYA 3GLDA 4ZUVA 3O6KL 1W80A 5DQDH 5HGAA 4AMKH 1XH1A 2Z6FA 3UG4A 3ZY7A 4LKCA 4MA1B 1NFDF 1FAIL 1QFWI 3GB7A 2JJTA 5IB1A 4LVOB 2ADIB 1UOWA 1P2CA 3GZQA 5HYJB 3CIAA 3R1GH 4LCWA 5IHHA 3UG5A 3MRRA 5AWNL 2EDOA 1U95B 3MRBA 1XGQA 15C8H 1LJMA 1ECYA 4L5FE 1X5MA 1FH5H 4GBXA 2F7RA 1FFTB 3FBQA 3LH2H 3X1EA 4N0UE 4IRZL 3P0YL 3K6OA 2DMBA 2DJ4A 2F54E 5GGVH 3OC5A 3MRBB 3U46B 4KTEL 5ADOL 4OLYL 5ETUB 3RWIB 1NDMA 3DUSA 3P3TA 4LASL 3VD1A 1QBML 1QRNE 4WGKA 5MERA 1A1OB 2CKNA 2VE6A 3BXNB 1X9LA 3GJEA 5JOPD 3QUXD 4Y16C 3LPGA 2JCCB 3E1ZA 4M93C 3T8XB 2FEDC 4PJFA 1BM3H 3E3QC 4X9HA 2EDYA 3EGDA 4ZMOA 2E46A 1SUJA 4H25B 1J9CT 1GJWA 1YYLL 3UZQA 3BQUD 5F7EL 4HXAL 2XV6B 4GFTB 5KOVC 5A6IA 4JPIB 1G7LA 4Z95L 2XOTA 3QZBA 4LP5A 4JFEA 4P4KB 4P57A 5CEYA 4D8PB 4NHUA 5EEVA 3D0VB 2R1YB 5BZZA 4GB9A 3U48A 2AK4B 5IESL 5DK3A 5IT2L 1AIZA 1EAPB 1EANA 1PD0A 1ID5I 3L5XL 4JRFA 2HT4C 4YDMA 1X7TA 4I1RA 4MVBC 4D8PA 4KPHH 5IB5A 1NMAL 5F6HJ 2OM5A 5BS0A 3L2NA 2WY3B 1WISA 3OWRA 3GJFA 2FK9A 1ZLUH 3DETD 2EO1A 2HMIC 2VLRE 3PWNB 3CHSA 4LVHC 1ZLEA 2HX9A 1EZVX 5E24E 4QHUA 4JX0A 2XIBA 2CG9X 3PFQA 2YAOA 1Z5LA 4HIHA 1T83C 4HK3N 3H4FA 3WTSA 1AKJA 1YUHB 1D2OA 2C9XA 2WAHA 3SE6A 1T04A 4J3XA 1CUOA 3NA9H 4M7KH 4QHLB 1V7ML 4EZKA 1BX2A 4HLJA 2CIKA 2IDFA 2YPKB 2FQEA 2WKLA 1W0VB 4HOXA 1CLOL 2VMDA 5JA9A 3ZL1A 3KWVA 3ROLB 4X8JB 3ZDXE 2VDKB 4K3JL 4QHLA 2HWZH 3FU3A 4XVJL 1T1ZA 3LXUX 5EUOA 1UGKA 4GOSA 4OGYH 3CV5A 1E2ZA 4ONFH 4F58L 3WFCH 5EZPA 1L7IL 3QJHA 4XPFH 4HJ0C 4OCYL 5CWSA 5HJBA 1F6AA 3O41A 1T22A 2F74A 4UDTB 1SNRA 3AROA 2YAPA 4V1DD 2X05A 3MRCB 1NCAL 1CIDA 1IFGA 5CILL 5HI3C 4PR5A 4QXVA 2UZYB 4XP4L 4OLWL 1E4HA 4TUKH 3WHXA 2CKBA 3GXUB 4JB9H 3QEQA 3RTQA 3A6OA 1PG7W 4E2OA 1AGBB 1N0LB 3BIKB 4JFUA 2AABH 5B7MA 4GW5B 4N0UA 5E6ZA 4JR9L 1SF3A 2JB5H 3ZZ1A 1NMBH 3EF7A 2XWJB 1N59A 3CBJB 3GGWA 4MCZB 4MAYA 1JDCA 2XC8A 4FQ2L 2WZ6A 3QQ9C 2X9WA 3T0EC 3VWKA 1AE6H 4N0UB 1JF1A 4A2LA 1X6LA 2AK4D 5MEPA 3TN0A 2WWMD 4L4TD 1OOAA 1I9IH 3LIZL 3WG7B 2ILLA 2X53A 1QKZH 3C9NB 4P46D 3GBEA 1PS3A 4W9KC 1ASPA 2BW4A 4MQ7B 4L3EA 2PWHA 4A2FA 5D72H 1A6VH 1H0DA 1HIMH 4H0LC 2KLSA 3JTTA 1Z9OA 5FHBL 2PP9A 1IC7L 2R29A 5E6RB 2CLZB 2DIAA 2FVNA 3P73B 1KJ3H 4FFWC 4FXKC 1VPOL 1R33A 4X6DF 4U1JB 2F58L 3Q6FA 1QACA 3TZVA 1HAUA 3RVWC 1EGJH 2GW5A 1BXUA 4NP4L 1HJBC 1QBAA 4JVPA 1XD1A 3PU7A 2E9WA 3LN5A 4YX2H 1S5HB 4QXTB 1QSED 2M2DA 4P9HC 1DJWA 1TCMA 1EX0A 3WFBH 4HUKB 5F88A 4H26B 4R90H 1BMGA 1WG3A 4XWGH 5C0AA 3S5LA 1VESA 5HJGA 1CG9A 2V6HA 1YMMB 3QP3A 5ESAB 5HHPA 3OX8A 4NAQA 2H9GB 1PPIA 2JIXA 4Z7WE 1A6AA 3FSVA 4UYQA 3QDMD 2DKMA 5I1IH 3B3BA 1KTDA 2PW2A 4LHUA 5EZIL 1JWSB 5D7KD 4FXKA 1MCNA 3V9CA 3LKRB 1MCQA 5C0AB 35C8L 3FUNA 4PREB 1AMYA 2GJ6A 4MJID 5EO0B 2M8XA 3H9SD 5IJKC 4MDJA 2YMXH 5DUML 3BWUC 2AK4E 4Z7OE 3AACA 2XUWA 4MWFB 3ILEA 5IWLC 3HUJB 2UUDK 2CM6A 3P3RA 2BK8A 4JFFB 4OF0A 2VDNH 4G8IB 5KBPA 5C09E 3JBG7 5HHNA 3E80A 1NAKH 2FBJH 1KJMB 4UIKL 4YLQT 4IMKA 3UGXA 1KACB 3CHOA 4EIUA 4QTIH 3B7TA 3EYFA 3MAWA 5KS9B 2VDPB 4ELKA 2UX6A 4GS7C 4C55A 3LB6C 4G80A 2AZAA 4WJKB 4QRSB 1AHMA 3STBA 1U8IB 2Q3ZA 2VR8A 3SEPA 2X9ZA 3X13B 2YWZA 4JHZA 2HT2D 2FEEL 3EYFB 2ITCB 2LU7A 2IG2L 1TTFA 3L3HB 1IKOP 1LEKA 3IRZA 4IU2B 5IGXL 1ZTXH 3FMGL 4LCWD 3ULUC 3H9SB 1XF1A 5EFIA 2BY0A 3BGFB 2HKFL 3MRPA 5SWZE 4ZMAT 5SWQB 4IMLA 4BGDA 1MCJA 1VEMA 4JPSA 2CPCA 4OJDH 3NSJA 3U7WH 1DQLH 1ZE3C 2ED8A 1AI1H 1KUMA 4BFFA 3PGFL 2P42B 2XVGA 5ANMB 2AJSH 3WJJC 3DBXB 4K8RL 2H0FA 2M26A 1UVQA 1H3XA 2IXQA 2DEWX 2BS8A 2XWXA 1GH7A 2F5BH 4YSTA 2APVA 2BH0A 1NLBL 1U30A 3VMOA 5F0JB 2EILB 1GOHA 1Y7VA 3DUUB 4XCEA 4BINA 4BZ1L 4K2UH 4ZW8A 1MEXL 5HVFB 5CIPH 4KZDL 4P23C 3B2DC 3GTNA 5AYUH 4FQCL 1FNHA 1I9JH 1R4XA 1FUNA 4JFXB 2K7PA 1E65A 2BSBA 1G7IA 4UV7H 1XTMA 2BC4B 2QV4A 4BDVA 2OCFD 1FH2A 1GZHA 4N3TA 4KHTH 1R5WB 4G9FE 1PBYA 2DJSA 3RTQD 1SVCP 3ES6B 4CJ1A 1WBXB 4FZ8H 3WNMA 2VC2L 5JIHA 2B4CC 3ARDC 1TYRA 2V7NA 1WWBX 2MTAA 4TVPE 1K6QL 3TL5A 2QSCL 1MY5A 3ZTJG 2R2EB 4JHUA 3ZVVA 1ZSDB 2IEPA 2QEJA 1F0LA 1MFCL 2YFOA 1WIOA 5EU4A 2Z65C 3AB0B 3MO1A 3RWCA 2W9EH 3A21A 1JMXA 3MKGA 1BZ8A 3SE9H 1E50A 4LKXB 2IQAA 5D7IF 3U1PA 2AEPL 5DJDA 4NFCA 1FGVH 3APFA 3T6WA 4MLIA 1N64H 1FDLH 3GI9L 1BWWA 3QXUA 2BP8A 1LM8V 3P40A 3NAAL 4FRWA 3F58L 2X89D 1CQKA 2X12A 3JWNE 3ROOA 3DX8A 4MX7A 3UZVB 4X4YA 5JW3H 2MNUA 1HYSC 1F00I 4HWBA 3DHUA 2FL5B 3D85A 1BBDL 2WXGA 1OK8A 1MCIA 1Y6KR 2NDFA 4DFIA 3EJPA 1XQ4A 3FSAA 4KKNA 5AOMA 1FJ1A 4PB9L 1MXDA 2OSYA 3ZDZF 3MHZA 4BGLA 5TJWK 3AQXA 1CYGA 5EZJA 1TZGH 5J9PB 5TF1H 5HDBE 5CD5D 1FZMB 2P24B 5DZNA 1ZHKA 4LPTA 5HYSB 2IANA 3EJRA 5AB1A 5E9DB 1DYZA 2X0UA 4LLUA 3SHSA 4G6ML 4JDVB 4U6VL 5BV7L 1LD9B 4RGND 3MV8D 2XNAB 4YDKL 4DK6A 1XF3B 3U4KA 4V1DA 1E4KA 4NBXB 4UOQA 4O9HH 4PD4K 1XIWD 2JIXD 3MV01 1BVLA 2DQEL 2E7LC 3N1FC 3SDCB 1SVZA 3OLIA 5DWUL 4BKLB 3I3DA 3QJXA 1G84A 1KN2H 3FCBA 5KVFL 4F2ME 1JV5B 2HLAA 1UCBL 5B3JF 2VABB 3Q1SH 2ESVE 4JFOA 2GBTA 4RMSA 2G60L 3IWVA 3V8OA 5JPNB 4PRPA 1L5GB 5DJYA 5AVRB 1KCRH 2NY1D 1BJ1J 1DBKL 3HE7D 3NCFB 4M4RA 2I32A 4XC3H 5D6CA 5GJTL 1RIHL 4NQEB 3DXAE 1RIUH 1RL1A 3FUEA 5F89A 3RQ3A 4O58H 1D6EB 4Y4HC 2AQ3A 2QQNH 4HPOH 4M6NL 4J3UA 5HPMB 3EH5B 1GKOA 2OK0H 4OLXH 2DW5A 3S5LG 2CK0L 1J8HD 1PQZB 4O51A 3JT0A 1JGIA 3ZKMD 3LRMA 1R17A 2CR0A 4JQVC 2ZXBA 1HXMA 3FQXA 1DEEB 1FL5B 4JQIA 5A7EA 1IAKB 1MLCB 4YSEA 4CADA 1PFCA 4HU8A 3DMMA 3PV7A 3BJ91 2YD9A 3PP4L 2EVFA 4Q89A 4QRTA 1CDYA 1QLEL 5KZCB 3N42F 3B6SB 1RSFA 3DGCR 4XN4A 2UZXA 4QRPD 5T3ZH 4YJZL 3N9GL 1VHPA 3FUJA 1EEQA 3N41B 3N40P 3RL1A 2A9ML 5CF3A 3AU1A 3HFFA 4HWUA 4DGYH 1Z0MA 5LGJA 3GSUA 2X2UA 2WGNB 1MWAB 5FO7A 1FZOB 3HI1B 3WSQL 1OF2B 1BHGA 5IFAH 3HKZA 4BFOA 5I0XA 5BZXA 2WBXA 2CCVA 3DIDA 1ZAGA 1NJ9A 4MDIB 5IHZB 3ARFA 2CLVB 2NY2B 5LGJB 1AGFA 1O6VA 3ARZA 5PCYA 2OW7A 5IB3B 3IDYC 2F1AA 4HKBA 5C07B 1T7VA 3OPUA 2VN7A 1QSZA 2DQGH 2XETA 1WBZA 2E7MA 1QD0A 5D7SH 4NENA 4GQRA 4PWEA 5ILTH 5HYJA 1RK0A 2EQDA 1G6RH 1QQDB 1SXZA 3ARFB 4QRUB 3QIBA 2W07A 5CCJA 3MRRB 2BY3A 2B2XH 1HSBA 4HG4J 1TZHA 3U7YH 4PY8J 4GQZA 3T0VA 3ILDA 3W9EB 4KJQC 1TTRA 3L3JB 1UADC 4HC1H 3V55A 3ZE2E 1QLEH 3E6HB 5CZXD 3APNA 1IFRA 2J71A 2WB7A 1SYVA 1XF4B 1IMHC 4PLJC 1GJIA 2EC9T 1J1XL 4EN2A 3FK3A 5E5LA 3L3JA 3EJCA 1FL3B 4TQHA 1REIA 3UJJL 3FT4A 1FSKB 4S1RL 2Q87A 3VFUB 1J0HA 4MS6A 2YD0A 1I82A 5CKGA 1BAFL 4K94H 1FNSL 1IFHH 1Q9OA 4IRJC 4KKAC 1OLLA 1JPEA 2MQ0A 5MHSE 2IOIA 1G7MA 5JUEL 1FAKT 2XSKA 4WFEE 3A0OA 2Y0SA 4LLVB 5FFGA 1C08A 2MQCA 4JZOB 3FT4B 2X89A 5JDSB 1TQSA 3UBXG 4UF7C 2KPNA 1CGVA 2BHUA 3H7LA 4X50A 4FQIL 3O6FA 3KPMB 5G4NA 4XC3L 2ADGA 3M07A 1ZA3A 5K5YA 3Q8AA 1KCRL 3WBDA 5C09B 4TSAH 1N2RB 1UD2A 4IIQC 4B95C 3BAEH 4YPGB 1JI1A 2Z92A 4WNQB 2XI9A 4YEEA 3DXAB 1NDTA 4Y5YB 5IB5B 4ZX6A 4IGBC 4IRJA 4FI8A 1T0PB 2EABA 3U2JA 2A9AA 1OB1A 3FQWA 2R7EA 5IQLA 3WJMB 5KANI 3H54A 3OMZA 4QRRB 4F37F 5HGBB 3OG4B 1Z5LB 1JPSL 5EORH 4YDKH 4JQXA 4UQ2A 2AQRA 1EGJA 4MBOA 5GS2D 1KCLA 43C9A 3R06B 1MH5B 1MHCB 2HJFA 1HESA 3D2UD 5SWZB 5BQDA 4QRRA 1K9TA 1R24A 4A66A 5TF1L 3VFWA 5TDNB 4CSPA 4B53A 3R7QA 4MSWA 5DK0B 1UA6L 3VTAA 4GY4A 4IIQA 4LAQL 4WW1B 1RUMH 2X4PA 1DSFH 3SKMA 5IVNA 2HPOA 4FULA 4KQ4H 3WTUA 2QHRL 4TUOA 3V4PA 2IC2A 3SKNB 5D7LE 4M7ZC 2P28B 4G7VH 4X6EB 4G42B 1KIQB 1S78D 5FYLD 5KYUB 4OIIH 3FN3A 4LU5L 1AGCA 4AYFB 2VLKB 1EHLL 4A67A 2Q86A 4BV1A 5JW3L 3NABH 1TEGA 4Q97A 2A77L 4G5ZH 1XF2A 4PR5B 1X5HA 2C7UA 3LEVH 3AGWA 4AYFA 2WVUA 4NPJA 3V6OE 3V4VA 2CGZA 3D69A 1OCWL 1BA9A 3RTQB 3KYMB 4JL1A 1ET8A 3CIQA 4EDXA 1P7KB 5D8JL 1AGBA 2E7BA 2CDEA 1H8NA 1LWRA 1RUAL 2IBZX 4RMRA 3VA6A 1QWUA 5KTEL 2N56A 2IBZY 1NGZB 3IU4L 3QEQE 4L0PB 4NQXA 3IAPA 4RDQG 5E7FA 4KH9A 4APQA 4J4PC 2AHIA 1K6QH 4G7QB 4S0HA 3M1OA 2IBBA 2XYBA 3U2SB 1IAOB 2YGOA 4ZPTA 4J6RL 4XNYH 4Z1PA 1S5IL 5MENB 2YPLD 2R39A 2OLDA 4PJ7E 4WCYH 3IAGC 1JJUA 5BXFB 4JY4A 3K6DA 4XE0A 3GBMH 3H3BC 5EHFA 1Z3RA 2ATKA 1ERNA 3TCLA 2D7TH 2ZUVA 2ZP8A 5F9WC 3D34A 1IGML 3MUGA 4WU5A 3VFNA 5JIDA 1OP3K 3VSUA 4YQXH 2YKLL 1IM3B 2G75A 5F2FA 4IS6A 2RB8A 3DGGB 5LBSH 4X8CA 4QXGL 2NLJA 1JF5A 7FABH 2MCPH 4UT9L 4HUUA 5TK4A 1JZDC 1P9MA 4X7FC 4X7TA 2DMKA 3D4GA 4PGCB 4L1TA 4OFKA 4OZHE 3UOAB 1E8WA 4J3SA 2ETWA 5D2NA 3CMGA 3P2DA 4YAQB 4WUUA 1TTUA 1GGBH 3HE7A 3ZO9A 1MJ7H 4QHUB 4CN4A 2PN5A 3EJZC 4PBXA 4PJXB 5L4MA 2VLRA 3V10A 3MC0A 4AQ1C 1J87A 1QLFB 5IBTL 4KMTL 5D2NB 5I6XB 4Q9QH 2O5YL 3Q2LA 1TJHH 2EUXA 1KCSL 1YEDA 2X4UB 3AQYA 1XH0A 4K5LA 1T0OA 4PRID 1BQHB 2LU5A 4QTIL 3TVMB 1KNOB 1SBSH 3Q5TA 1NAKL 4GW4A 4XRCA 3M45A 5J4MA 5DMYA 4HSQA 4F24A 3D8MA 3QIUB 5DYFA 4WIQA 5B39G 3WO4B 1Y6MR 2VO8A 2OMWB 1JGDA 1WS8A 4ZO9A 4HT1L 3CVIL 1EJOH 3OMNB 3UPRA 1WFTA 2A9CA 4UAHA 4K23L 1CFTA 3CK0L 5GJSH 3Q8EA 2Z35B 2ZYHA 5D1QD 2YK1H 3ISRA 1E40A 1QG3A 4I9WD 1PYWB 3WLBA 4JS7A 2DWSA 3OV6A 1DO6A 1BPLB 4URTB 3ZGIA 5DMGC 2E6QA 4PB0H 4N5ED 4I0PD 5EBMB 1I1CA 3JTSA 3G5YB 3H3PH 4XWOD 1UJ3C 1INDH 1OIOA 1HINL 2CJUH 2JCCF 1JWMB 2J1KA 3BDYH 1JNHB 5EBLA 1OGTB 2JCCE 1M1XB 4LSTL 5BUGA 3QIBD 1NBQA 2MOGA 2VJXA 3LXAA 5EWIH 3N42B 2VDLB 2VDMH 4M5YH 4OI8A 2KS0A 1D6VL 1MAJA 1NCUA 4JM2C 4LK4A 3SCMD 1UOKA 1KYOK 4BK5A 4LHQB 3OKYA 1E6JL 5FIEA 1RZ8A 4LSSL 1KDIA 4Y19B 3JV0A 2DLIA 5GRVL 3VFPB 1MZYA 4DZBA 2UXGA 5D72L 1RMFH 1HKFA 4S2SB 2DBLL 3BVVA 3S5ZA 1KJ2B 1W0WA 5I24A 4JY6B 4E9YA 2KC0A 4LP8A 3QDJD 1UKTA 3HI5L 1AO7D 2ADYA 4KNQA 1KF9B 3D06A 1NCOA 2ZZUT 1NM4A 5I1GL 1TQBB 5JR1L 4WTWA 5E8NB 3SYQA 1M05B 1Y18A 2XIIA 4PTTB 5HHOD 5HHXH 2ARJB 2DL2A 1BGXL 2JB6B 3EYOA 3WV0A 3LKSA 2QVKA 5DLML 4YHYB 4MJIE 3QIWA 5FXCH 1VCAA 1YAZA 2X1OA 5HGAB 5I5JA 4I87A 5EU7C 3K5SA 2YPVH 3MV9B 4DPRA 4RSYA 3U7AA 3MV8B 6FABL 4OZHB 1MI5D 4JFQB 2AABL 3LCYA 5FYKL 4POUB 2DYPA 3EYOB 4I18C 2MJWA 1EHNA 1ZLSH 5J6HA 2ENYA 4G59C 4P5SA 1FNGA 4JUSA 5LCVL 4FXKB 1H9DA 3EO1B 2IWFA 5E8OA 1IEAA 5CUSL 5E2TH 4AQ1B 4KKAD 5C0ND 4U1MA 2PR4H 4M3KB 4PY7A 4MZRA 1QPKA 3O3DB 4GI8A 4G9DB 3H9HB 1FNGB 4PJ9B 4MDJB 3EFFA 2W38A 4X42A 5SWSE 3F6LA 3DUSB 3FSOA 3DBSA 1DVXA 3WNKA 2CKBL 4E42A 5ALBH 2CBOA 4JL2A 4LRIA 1JGUL 3CXHJ 5EZLB 3H9HA 2BLFA 4QRRD 1DN2A 3PGCB 2PYED 1A9BB 5GIRB 3T71A 1RZIB 3I75A 3QQ3B 5EDSA 5F3HB 3QFDA 2HRPL 4RH4A 5B1AB 4LSQL 4RZKA 3QULA 4DO6A 2OI9C 4CC0A 2J43A 3MA9H 3K8LA 4FZEL 4QAWA 4ALAL 3BP5A 2XBZA 1QBLL 5AVUB 3W39A 8FABB 1YQ2A 1RIVH 2PCPB 1UM6H 4ODWA 4Y1AE 3ZDYF 3EJJX 1KTKE 4NAMA 2VH5H 1DQQA 2UXFA 2J20A 2YWYA 1R3HA 1XCXA 4AIEA 3N41F 4JREB 3ALPA 2BVQB 3CFKA 4ZMQA 3SE3C 2J21A 4E41D 1HHHA 1G7HA 4K4KA 4KKQA 4NWTL 4LRIC 3MRQB 1NEZG 1OP5H 5HYJE 2OMUA 2V9RA 3BPOB 1Q9WA 4S10A 2C34A 3HG4A 4E36A 4X7DC 1UVQB 2HLEB 2OSLA 5IT2H 2BCKA 4KUZL 4DHLA 4JRYA 3GBNL 1Q9WB 3L9BA 1FFQA 1MRFH 4I5BA 3DUUA 1IT9L 1M7IB 3II1A 5AW1B 3LHPL 4NQEA 4HZLA 5TE4L 4Y0GA 3S35L 1KJVA 4FNLH 3TASA 1RY7B 4DF9A 2G2PA 3L95A 3CVHA 3HRPA 4JFXA 2UV3A 3T4YA 3BKYH 1P7QA 1QRNB 3K2KA 4RWYH 2OA9A 1Q90A 1CICD 1BM3L 3CFTA 4LOEA 5IEKA 2OW6A 3NDYE 1T1YB 2KH2B 4L9DA 4B9JA 3SBWC 3KYKH 1E5YA 3C5ZB 4NYLB 1Q4NX 4ZUSB 2C3HA 4YSCA 3VNZA 3CFUA 2XTLA 4QCIA 4S1DD 4GQ9H 3QJHB 1MLCA 6PAZA 1J86A 3P1VA 2E7HA 2WBWB 3HUJF 1T22B 4HIJA 2V33A 4GUQA 3K6SA 3QJFA 2IMNA 2I85A 4XXDB 1FCCA 4IRSD 4XO8A 2UVFA 1NCCH 2GHZA 4RZCA 1QEXA 3LIZA 4HEME 4JFED 4WUKH 3WHXB 2QFPA 4D0DB 2J88L 2CHXA 4YR6B 1UFGA 4FNPA 4TUUA 5DHVH 3N1GC 2VN6A 4OBRA 4UU9A 3VFOA 4XO4A 3BZDA 2VNCA 3R1GL 4RZCB 4HIXH 3ROOB 5CU9A 1P7BA 3DHPA 2XWBA 4Q52A 5FLUA 1G1OA 1TCRB 1BECA 4TVPL 4G3YH 4LPCA 2FL5A 3CDZA 3KPSE 2AI0H 1YJDC 1N5YL 4Z7WB 2WD0A 5EC1B 2M1KA 4XP6L 5I8CA 4I1PA 3O4LB 1MIMH 2R0LH 3BWAA 3V0AC 5TK2A 3BHBB 1II4E 4H8VA 4HMEA 1IGFL 3CBKB 1PJ9A 1XR9A 1S3KH 3BH8B 3JWDC 3KCPA 4QJ4B 4ZX3A 2NW2A 4PH8A 1CDBA 2BSEA 1HSBB 1G7QB 3WDJA 4WFFD 5HTSA 1OW0A 1IQDB 1WPCA 3MJWA 2BHFA 3BHBA 1BZ7A 3KXFD 4JFEB 4LLUB 4P4KA 4XI5C 3AREA 5LB1A 1SLUA 4MB5A 3WFEH 2VMFA 3K6FA 2QL1A 1I1YB 3B7RL 3QG6A 3U82B 4PJEE 4DUXA 2I5YH 3FH7A 3PP3K 2CLZA 2YD2A 3IDXL 3P73A 4QR7A 3LZQA 3SPCA 1MCOL 2VISA 3RWHB 3IAQA 3G08B 4UINH 4KK5C 1JK9B 5IK3B 1U92A 3NJMA 3P9WB 2FGWL 4MB1A 4R5VA 3W2DH 2D2CC 2NY0C 3QZOA 4HKXB 3G5ZB 4CKVX 2R29H 4W9EC 1NAMA 1CF8H 5C08A 4NJAH 3QXVA 5KSBA 4XMKH 1CG9B 2EEBA 1NCHA 5ESAA 4R0LA 3FB6B 4IBLT 3BQUA 2EE6A 2Y1ZA 1UZ8B 1AXSA 1LK3L 2HT3C 3MV7E 1IL1B 5FA4B 3VFRB 3AG4B 2PW1A 4EXKA 4WO0A 1DFBL 4EZJA 4JRXA 5EUOB 4E9XA 4NC1C 1G1CA 1AD9A 2VR9A 5DQJB 4DZ8A 5LDUA 2HA1A 4I0PC 5SX5H 2EUVA 3Q2WA 5DS2A 3V6ZB 4IHBA 1H19A 4MWFA 2R7EB 3H9YA 4ICXA 5HGBA 3V0DA 5D4HA 1PLAA 2ZOLA 5EDXA 2Q2LA 4LPXA 5JPMB 1QABA 1EVUA 4ZAKD 3VRLE 4L4JA 5MHSD 1AKJD 1S7UA 1IUZA 2CMRH 2VYRE 4YE0A 4JLRB 5JOPE 1TTGA 1PY4A 1IZJA 3SYOA 2NY6B 2Z0UA 1DBBH 4TM9A 4LKCB 1RZGA 5TH2A 1DP0A 4AYDC 2DV6A 2YGVA 2ADIA 4AXWB 4JRYD 3CZLA 1INQA 3SDYH 4MAYB 3QORB 1HZHH 3T2NH 4G42A 2QTEA 2J2ZB 5DHXB 5EC2A 4FXGC 2AZUA 2DY2A 2YGNA 5F7BA 4AXWA 1XHHA 4IQHA 2CNYA 3SGEH 4GMTL 3TA3D 1AD0A 3L45A 3W1ZA 4CU6A 1UXWB 4B5ZA 2BIIA 2MCMA 3IDUA 3RB7A 1P5UB 1CD0A 3FUDA 3QAQA 2MOQA 3OKOA 1E27B 4M1GL 5FO9A 4JHBA 3HG1A 3SBRA 1A6UL 4HFWA 4ES8A 2BFVL 2DYRB 2IDQA 4LHUD 1NCDH 4JN1H 2H1PH 2WZ5A 2OP4H 2J1YA 5EBWA 5CJ5A 1SQ2N 1X9UA 3FXIC 1MWAL 2GIXA 5L9DL 3RVUD 1P6WA 4UQDA 1IGIH 5FCSH 3D30A 3IETB 4NPYA 1JXFA 5E94A 4YLBA 5IIEA 2P8PA 5IJDC 2DKSA 3K8MA 3ZHLA 5E8DL 1MUJB 3MQIA 2G5BB 4JNXA 2YXFA 3ZYZA 4JPKL 1WBXA 1J0KA 4LDOB 1PZBA 2JKNA 5HHOB 3HTLX 4DKEH 2AK4A 3DHMA 3ULUH 5T3ZE 1NANI 3L7EB 3N1QC 4TL5A 3RPKA 5JYMA 5DZ9A 2GJ6E 3OX8B 5CEZL 4LQFH 4XVOA 3IDMA 3SY6A 3QYNA 2ESVD 3I3EA 2WQRA 3VI3F 3G5WA 1ET7A 4XPHH 5EU6E 5G4OA 3DTXB 1FIGL 2GG1A 4HS6A 3PWNA 3IEAA 2JCWA 4ZYKB 3CLFH 1NCBL 3QZWA 5FA3B 4N68A 4DOHE 4YHNB 5FYLH 1DR9A 1W8NA 2BP8B 5CEXA 1ZVSA 3C6EA 4J23A 3MRNB 1LE9B 4RMWA 32C2A 3GKWL 2EE2A 1WFMA 2DD8H 2IQ9L 4F8LA 5K9OA 5T1MB 4XMUA 4HD9A 2IGFL 1WRFA 4POYA 4YHNA 3ZE1B 4TNFA 5C0BB 5D96C 4AZUA 4U1NB 4X9GA 2B3RA 4HFUH 3GS4A 4UNIA 1OK0A 3VE0A 5F1IA 3VGHA 1JVKA 3J8F7 1BOYA 1I8LC 4A2MA 2HXAA 3LRGA 2IH1A 2VOTA 1TEFA 4DUWA 3VXSA 1F4YL 4IOSD 1HCYA 3L4VA 4PSRA 4X9FA 3TH4T 1ZDSA 2EDQA 2Y7OA 3VD9A 4RAVB 5D7EA 3TYFA 1NGWA 3VE0B 1SHMA 1DL7H 2P1YA 4YDVA 3WTXA 4FFWD 1UH3A 4NO5B 3MGTB 5F7YC 3QUHA 2WQAA 4P9ML 5E4EB 5JO5B 3BLPX 4YE4L 3U0PA 3ZTDC 4TNWK 4X5WB 3UPRB 3ZTNH 4KJWC 2JELL 4ADGA 5I17A 3RX5A 2EJ1A 2ZUSA 3P4LA 4NZTH 4TUJA 3WOVA 4TNGA 1GY1A 2B16A 4OF5A 1O7DC 3C6LA 3VW3L 2W9LA 1HFUA 4ZS6C 5IEHA 2WQVA 1F4XH 3BFWA 4PJ8C 3PJSB 1JZ7A 1CLZL 4RAUB 3TBVA 1CVSC 1G7JB 5JIMA 2P4AB 3MUUA 5EULV 4DK3A 5KVDH 1BIIB 3D0LA 3LKNB 4A6YB 1EFXB 3BC9A 3FF8A 4Z0XA 2AITA 4LEOB 4LVNC 4JANA 1QAWA 2X70B 4JHAL 2YOCA 3EHBB 4IEFB 4YDIH 2APSA 4FJYA 4F8PA 3L3GB 4N2IA 1A9EB 4WU7A 1ID2A 3DNKA 2WVVA 2GUYA 4OU3A 2F9BT 4ZTPL 3ARGA 2CALA 4JY4B 3EFDL 4AENA 3LH8A 4JFHE 2QPUA 3BKJL 2BSED 1RHHA 4P46B 3DX4A 5IJCC 2C9AA 4P23B 1L6PA 2ATKB 1BAWA 4OCSH 2IVFC 2PYEB 3FL7A 4MNGA 2OL3A 1SY6L 1NL0H 2WVVB 4PPTA 2UYLA 1M6UA 5KAQG 5IROD 1WJ3A 3MR9B 2X2HA 1QFUL 5JHMA 3RJQB 4BE6A 1S3RA 1CL7H 2HFGH 3SODB 2UZXB 4DZBB 2HVJA 3UYPA 4MQXC 1SM3L 2DWYA 2Y69B 2YRLA 2TAAA 1W0WB 3ARWA 3TO4B 1WSST 1CGTA 5JQ6L 2N1KA 5I1LA 5J3HC 4AYBA 3U36B 1GZPA 2O6CA 2ARJQ 1KGCE 5F88B 2H1LM 1IX2A 3C08H 2P5PA 1TKWB 4L29B 1N6QH 3MLVL 4G72B 5FUZH 1JZ2A 2NNAA 2ZICA 3QC6X 1JVOA 4NUPA 4ABQA 2FQFA 2VM4A 2PCFB 3PUCA 2PPFA 3ILPB 4J3OD 3GXMA 3GMOB 3SE8L 1WCBA 3GDCA 3L4UA 2EDXA 2XY1A 3AT9A 3QUYB 4KAQH 4KI5C 5DZLA 1DVYA 1OGSA 4NENB 5I82A 3UGUA 4DKAA 1CGWA 5EZOL 3GTVA 2VDPL 5IVXF 5C09D 2DMGA 5DLLA 2NCEA 1GGCL 4PJDB 1XWVA 2Y2TA 3ZJAA 1UD4A 2BFGA 4L8SA 2FZ3B 4GRWH 5IZ7A 5L8KB 4KJYA 1AO7E 4Y8DC 1MAKA 2O5ZH 4PJCF 4QEGA 3GSXA 5CJ8A 2OXHA 1MHPL 3WL9B 2ICWA 2ZAIA 3O9WC 3NFPA 4IU3A 4JFVA 3T9WA 2QMJA 3CFIC 4PJDF 1NAML 3FTSA 1DJXA 1B88A 1E9PA 2DQUH 1X5KA 4GLRH 4LCCB 3A3YB 1ROWA 4QDGA 4Y1SA 1ACZA 2WXLA 3CXHK 3WLBB 3MRGA 4O02B 1NBZB 3WE6B 4ETQA 2ENJA 5FK9A 3MRIB 5C2BH 3UAJD 2WUCH 3QDME 1CT8A 3NG5A 3D85D 3UO1H 3W9DB 2CHDA 3TEYA 5HBBA 4LLQA 3O6LL 4GXVL 1NLDL 4N4YB 4WI5A 4ZJ9A 3NEOA 3QULB 3NGBB 1CQYA 5HDBF 4Z3JA 1NTDA 4M4RB 1X5GA 1J0JA 3CN4A 4GRWF 3MACL 5F1NB 4ODTH 1BQKA 1TYEB 3PWVB 4TPRH 4Q14A 4GKNB 4OZFB 1FC2D 3MRDB 4PSPA 1OAQH 1U2YA 2IAND 2QT6A 1Z9LA 1C7TA 3EO0A 5HHVL 4FHJA 3EGSB 2BVQA 2X2JA 4WWKB 2J4WH 2Y6SD 2YAHA 4ZAKC 1N2RA 5CSZA 3ARFD 2GCYA 2OCCB 3M46A 2EDTA 1CS6A 5EEWA 1MCLA 2NY7L 4D3CH 2ZOWA 4Z77B 1U8LB 1CGSL 3CFQA 2J6WA 3BEWB 5AUMB 4CADB 1C9SA 2WYIA 3BMVA 3MZGB 1U3JA 4ZXBB 2D4DA 4P2AA 2X7LB 4OD3L 4AEIH 4EBQH 1ES0A 1ZV2A 3BUYA 5EU3A 4KKLC 1MW0A 1CTOA 3WGUB 4Y9FA 5GGRB 3ZN6A 4KDTA 4JO4H 4I88A 5C3LD 4KKBC 3PAZA 5D7IB 2BP3A 8CGTA 1A8JH 1KPRA 1ES0B 3BUYB 5EU3B 3VUAA 1CXEA 3FCTB 1GA2A 1YQVH 1IKFL 1T7ZA 2CA4A 4C59B 1Y18B 4PTTA 4WI3A 1KEGH 1KXTA 5ITBH 2WYZA 2FJUB 5B8CB 1JNNL 3HRZA 3T5WA 5T1DL 4IBTA 3VVWA 5C07A 5DYOB 5A3IC 4NWUH 3QCUH 2XV2A 5I30L 3RHWF 3KPLA 1SN5A 1OTTD 4IBQA 4QLWA 1MVUA 3HZMA 5EOTA 2XY2A 3MXVH 4OVVA 4HBCL 4DKFL 4B0MM 2V9TA 3KE0A 2FJFB 4ZX4A 3DMMD 4S1SH 5IJKA 3U46A 4I0KA 3ABLB 1GPOH 1WAAA 2R8SL 5DEJA 4BIKA 4NNPL 4J8RB 5E6UB 3ZU8A 1J11A 1O75A 4YIQA 4JFDE 1OM3H 4C4KT 4DP5X 3OB8A 1KULA 4YSQA 3JWNG 3DPBA 1U3HA 3CSTA 3DRQA 2FT6A 2P26A 4WWKD 5JPMC 1P7KA 3GM0A 2VKWA 3GJEB 4P3CL 4XN7A 3QVAA 3V79C 1YEHL 3CH1B 4OLVH 1KXHA 2Q3XA 3CSGA 2KT6A 4FERA 4FA8A 1NCWL 5BJTB 3EGDB 5K33A 4OLVL 3PGCA 4BCYA 3BW9B 2ZKHL 4R4BB 1OM3L 3H42L 5FV1L 1U8JA 5E0FA 3D39E 3ZYIA 3QRBA 3L7FA 1GPOL 1OSYA 5F9OH 3UMNA 4ONOA 1KCBA 4FC3E 3VSQA 3QHFL 3EH1A 4RMTA 1ZLWK 2JJVA 5JTWA 2D31B 3RAJL 2MCAA 1U8JB 5KVDE 4A04A 5I75B 2YLHA 4ZNEE 2HN7A 3RWEB 3BPLC 4AV4A 1ETJA 1CC3A 4BH8A 4R83A 1QVOB 3V5KA 3N04A 3C6LD 1RZQA 4PV9B 4X6DA 3WKQA 1NIDA 4EIGB 5L88L 3QQNA 4XNMA 2F7QA 1UASA 2C1OA 2NXYC 1KMGA 2ZYSA 1BFOA 3M7FB 4JFYB 5I26A 5GZOA 1G0YR 3A22A 3DJZA 4AEHL 3WXWL 1KENL 5TE6H 1Z32X 3F7YB 1CD1B 3SDAB 1OAKH 3HPJA 3AUVA 5KSAD 2LHAA 4JFFD 4XP9L 5I1JH 1UD5A 1UD6A 4FQJL 5AVSB 1J8KA 4FQHB 1XEUA 5L7XL 2YD3A 3VGAB 4GXUN 2YZ1A 4OD3H 4AEIL 1U93B 3QFJB 2UWEE 3P0VL 4GAJH 1I53A 1KJ2H 1E4KC 2F53D 3MBEC 1IAKA 4EOWL 1FFPB 5I6NA 4R96B 4D3CL 3RIAF 3RZCC 1MJ8H 1EJ8A 2QQLL 2VDLL 4QF1B 1X6NA 1QATA 2BXYA 1YUKB 5FW6A 3L13A 3BPLB 3N43B 3UL4A 3SKNA 4LSUL 5GGTH 1VZGA 1TT6A 5HHVH 3BIAX 4Y4KB 2ZYRA 4YBQC 3VTTA 5JDJA 1FRGH 4IRJD 5H94A 3HE6A 2DQJH 2B08A 4UT7L 4D0CA 2OR7A 4X4ZA 3EJSA 2KHAA 1TQUA 2HKHH 2UY6B 5CINH 3JZYA 3SE4A 1CICB 3KJ4B 3GRWH 2BZDA 1N3NA 5AVQB 3CFDA 4JLRA 3VA2C 2CLVA 2FJGA 3SDCC 3B5TA 2XTJB 5DFTA 4XN5A 3KJ6L 3WIFB 5AW7B 1BOGB 2XVKA 5IJVA 4YHIB 2I9LB 5BO1L 4WW2F 2QPFA 4CL7A 2AJXL 1J8HB 1FL6B 2XWEA 4WJG3 4QRUA 2FJGB 5FCUH 5GRWA 1F2XK 3DX7B 4PVNA 4QAMB 4FJZA 2AXGB 1QI3A 3QQ4A 4OI9A 2VLLB 1DLFL 4HIIB 4XPGL 4IGBD 4J5VA 5EC1A 1MHPH 4PI0A 1ZJAA 1UATA 3BE1L 3SDDB 2O5ZL 4M5TA 4R26L 3IE9A 1NPUA 4B9YA 4DGVH 1U4EA 3JTTB 5D1ZC 5CCKL 5EZOH 3AQDA 1IEBA 2F8XC 3DGGA 1B9KA 1FF5A 3K4ZA 3ZUCA 3TZVB 2FNBA 4PJ5D 1E6OL 1GKEA 4PJGA 5FOJA 4OFQA 4NS0A 4X6DE 4J3OC 5BZWB 3SE8H 3MTRA 4Z7NF 1HI6A 1NICA 4OB5L 4Y1TA 1SPDA 1E9QB 3BSZA 25C8H 1R3IH 4LCIH 4TQPA 4DAGL 2HUHA 5T3ZD 3L54A 3NFNA 2J8UA 1PF3A 3QSKB 5CSGA 2VLJB 5AL8A 1HI6B 2XN1A 4W4OC 1CU4H 1D5IH 2XN9A 2LW3A 1K2DA 5TQ0L 3EDDA 4AEFA 4WFGD 5E8EA 4J2QA 3L4ZA 4NQDB 2YARA 3SDAC 1IM9A 3L3KA 4NO2A 1AP2B 3D39A 4AQZA 5KSBB 3BUDA 2FWSA 1EEYA 4QXUH 4Y89A 4MCNA 1H3GA 2CJTA 1ULVA 5C2UB 4FLHA 1K2DB 3HLAA 4GKZB 3RI5F 2OMZA 5IM7B 3UERA 3FN0H 4MASA 4ELDA 4ZFGH 2CA3A 3D39B 5KVEH 1AH1A 2BY2A 3Q9QA 2Y24A 4HHGA 5I1EH 5HPOA 4XP5H 3GNMH 4TNVF 5L2JB 1B2YA 2MKWA 5I1KH 3QR0A 3EFDH 3QCVL 3UBXB 2DM4A 4JFZH 2DYSB 1YO4A 3PAUA 5I5MA 3OZKA 4OIFA 4TRPL 1JGDB 3BH9A 3PHOA 1K3ZA 2NYYD 3CU1A 5DC0A 5FYJE 5KUMA 5HHNB 1MH5A 2FSDA 4N0FB 4QRAA 1F1GA 1D5XB 4YDIL 4I77H 5CJOL 1ETB1 3G9VA 3JYCA 3WN5B 1R24B 3QJOA 1W6LA 4W9CC 3NACL 3WMPA 1S9WB 4KNTA 4PMEA 4N8VA 4F91B 4Z7UB 3LDBB 5H35B 1AIFA 4G80B 2VO5A 2Y6SC 4P2QA 5CZRA 3MLSL 5FUOL 1IZKA 1F4XL 3U6RA 5LAXA 3VDAA 5C07E 3QNXA 4AKPA 3ZE0B 3C5SB 5E00B 1F90H 2NY5C 4OY9A 2DLFH 1KCKA 2D03H 4RWHA 4XZUB 4WWPA 4AT6B 1AR2A 1A4BA 4BFKA 1DFXA 5GGSB 3FFOA 4LEEA 4TXVB 1PIGA 1WWCA 1BYOA 3TPUA 3GEFA 5F9JA 1F13A 4GAGH 5FR3A 2VM9A 3BZFB 2H47C 3GDBA 4OIBA 4M48L 5DJCB 2ZKWA 1PLGL 3UAEA 2D7QA 2WO3B 5IFJA 4RLDA 4NKDA 5D7JD 1NEUA 1U3HD 2DYPD 5H2BA 1HEZB 4ZRGA 5B7EA 1FO0L 5B1KA 1G7JA 2QGEA 4PV1C 2J1XA 4GRWB 5LXVA 3DRTA 2YC1A 2WQWA 3D0LB 2DQTH 2VMEA 3SDXF 4R7VA 3GC3A 3VB8A 3DHJA 1U3YA 3DSFH 2Y72A 4WHTA 5EO1B 3SOBL 3ZL4L 2BJML 4M6OH 4LE8A 2IPKB 2Y1YA 5ABAA 4DP0X 1DSYA 1O6SA 1ACCA 1YRKA 3S5YA 1URLA 3FJTA 1Q8MA 3EOTH 2JB6A 4ZUWB 1HDMA 1TUPA 1SN0A 2PXYB 3TTSA 3TVMC 1IM3D 3ARDB 5GRJL 3HHSB 1UT9A 3K91A 2DF3A 2DWTA 3I2CL 1W91A 2ZKXA 2DYPB 5BQ7A 2XQYG 3GRGA 3L9YA 3PFUA 1OANA 3RNQB 3JVGC 4IGBA 3MUJA 4AQAB 3CPLB 3PGDA 4LMQI 4OGXL 5I6KA 4OLEA 2YHGA 1YDPB 3HHSA 4HWBL 4LMQE 3O3BA 5BMFH 2F8OA 2AKRA 4M9PA 3ISWA 3O8XA 3F7LA 3QZWB 5GZOD 5CJQL 4QY8A 4HSCX 4ZD3H 5I0DA 1X44A 3PNRB 5JHBA 4FE9A 1ONQA 1AO7A 4L29A 4GSDL 4DW2H 2X4UA 5I6LA 3HFML 4D8OA 1PDKA 4X98A 3NRQA 4WLCA 1EZSA 1TLMA 4JKPL 4R4FL 4PJHB 2YD4A 4U1NA 1MCHA 4IK6A 3BPNB 3GMOA 3QO1A 2BNUA 2GUOB 3VMPA 1A9BA 2H1PL 4JN1L 2O1AA 1MCDA 4N90E 1EBPA 2BHZA 1WITA 3QIUA 1DVFB 5HI4C 3DSNA 5HYEA 4M1GH 3LZLA 1Q0YH 4HDIA 1DVFC 2EDNA 4J28A 1JGEB 2FNWA 4DWHA 1QUNB 4ZW7A 4HQQH 5FOBA 1U8KA 4AG4L 3ZE2B 1AZNA 3P11L 1AJ7L 1BIHA 3CHPA 4QRPE 5D2NC 2WZPD 2VXSH 5I6XC 2WW8A 4LARL 5HD8D 3UO8B 1J5HA 3N0AA 3HE7C 5MEQA 2GITA 3T2NL 3QRGH 4XNBA 5JPNA 4F7CA 3W82A 5ISZD 1QA9B 4FP8H 2NY5H 3RNKA 3QUGA 4I3GA 2DH3A 2EKSB 3OAZH 4LSVH 3WNJA 5JHLL 1WFNA 4XAWH 5I66A 2J6EL 1S7RA 1SXNA 3HMXL 2FB4L 5DMIH 3ULSB 3ZDXF 2YFNA 3OL2A 4U6HA 2B1HL 2GJJA 4XMXA 4IKIA 5F97E 4NKIH 2YD6A 4IRSA 1IBBA 4I9XA 3AXIA 4HHAB 1BF8A 4ZMXA 1KELH 1ZD6A 3S3BB 4XVUD 3S6CA 5FYJL 2LLNA 1GS6X 1MLBA 4JKWA 1D5BB 1JPGB 1KC5H 3VGDA 2NQDA 5DO2D 1SQMA 3G6DH 1FGNL 4ENZA 4W68A 1W16A 1MFBH 1U2HA 5AOLA 3MFGB 3HR6A 2YXVA 2KZBA 1TJIH 4LO9A 2ZXAA 5F3FA 1ZE3H 2D3VA 4KTDL 4BQ6A 4N9GB 4X9BA 2WYHA 2H3NB 4HD5A 1ROCA 4L1LA 4X6CF 4PJ5E 5DQ9B 4AVHA 3F5WB 3IGAB 4YSDA 1A3LH 5E08H 2EDRA 2OXGB 2IGLA 1AG0A 2WXFA 4Z5RA 5LG6A 2X7LA 3GSUB 3EF4A 4OZIF 2EYSA 4KVNH 1ASOA 1RULH 2CM5A 2XZAH 3FRUA 3K80A 2EEAA 4ALAC 4Z0BH 2IV9A 4WTZA 5GS0D 2R4RH 4MTMA 1IC1A 4OW6A 5D7IA 3NCBB 4JG1L 3SDDD 3FONB 5DD6A 3L3IA 3W2DL 5HSFA 5LQBL 4AX3A 3EOAA 3FCTA 5D7JA 3SYCA 3X14B 1SEQL 2OYPA 4EVNA 1S9XA 4H8WL 4R7DB 1MZZA 5EN3A 1IM9D 2FHBA 5C9KA 4NM4H 4JM2A 2V9UA 1XB6A 2FD6L 4NUQA 1MNUH 3T09A 3HC3H 4QRRE 2CO1A 1OGAB 1RU9L 3RZCB 1MFAH 1BFVH 3GB7B 3H0TB 4G70B 2FSEA 3WFEL 3A47A 1D5ZA 2AXWA 4PLJD 5BV7B 5EOTB 4DP2X 5TDOA 4WV1A 2A83A 4Z78B 4WQOA 5A43C 4PIBA 1XF5A 2RFXB 1LILA 4F7KA 4ZMYA 4DOHB 3DARA 3MLZH 3VXUE 2R1WA 3D05A 4R84A 4Z78A 5JXAL 1I4FA 3MRJA 2B5IC 1GS7A 1HYRC 4I3SL 1E4XH 4EIBA 4K15A 3MRFB 4PRHD 3QCTH 1EAQA 3NTCH 2R0ZL 2NXZD 3QIWC 4JJHA 4TVPH 4XPBL 3KL0A 4HH8A 1BEYL 1P4IH 5H8DA 1N8ZB 3LTVA 2QVFB 2VJ8A 1HXKA 3IGKA 2AAAA 4GEIA 4W6WB 5EF3A 4G43B 2B59B 5HYQB 4P5TC 4JDEB 5IB2B 3MGOB 2YJLA 1LP9E 4F33B 1GYUA 3L7FB 2ADGB 1BREA 4HWZB 3CLEL 2Y6TE 2V2TA 3RE0A 2Z8VC 1EUTA 5H4ZA 4M43L 2DBJA 2EIZA 1MSPA 2Z92B 3ZQWA 2YBRA 4GBXD 4IOFD 1H6FA 2JJUA 2WQXA 4B41A 1WD8A 5FHAH 1BQRA 4GQ9L 4YGVA 3F7VB 1RERA 1FZKA 3EGSA 5D1ZB 3S36L 5C6TL 4O5LH 1PD1A 4UM9A 2OTPA 4X5RA 1G1KA 3X11B 3FRPB 3LS5H 4TTDD 4L9LB 1FG9C 1YEFH 3D7PA 1BPVA 1JFQL 2HFEA 4JCLA 3ARTA 2ZF8A 2BSDA 2AP2A 1N19A 32C2B 1WIUA 1C8QA 4G6FB 2WOBA 4OM1H 4UMGA 4BUGA 2NTSP 3O81A 4Y2OB 4M56A 1QTYT 2ZCHH 1B4TA 2HFEB 4ODSH 4NHCL 2LVEA 3N06B 5L0QB 5LBSA 2FATL 1AHWC 1B0WA 2EYRB 5DD3L 4G1MB 2QGCA 3EYVB 1W15A 2QR0B 3LN4B 8PAZA 2HB0A 1JWUB 3N2JA 2J44A 2QGBA 5GGSY 2VDQH 1BG9A 2ICEB 3C60A 3U9UA 1MREH 3VU1A 4X99A 4QF1A 3R8BB 1I7RB 4L1HA 3SZ6A 2IFFL 3GSVB 3TU6A 1FVCB 1D7CA 2B7DT 2D73A 3D4YA 3GHEH 4JFHD 4AVJA 5B8CC 3IFOA 4X5WA 1KN4L 1PX8A 3B43A 3PCYA 3UIZA 1U91A 3V4VL 2EACA 1M42A 4P2QE 3D69B 5BOZG 4CVXA 4FXTA 1HH9B 3KPRA 5KYWB 5MP6L 5DFAA 4MXWH 1AHWA 2BIPA 4UBDC 1S9VB 4M61A 4BSVB 2EVHA 1ICTA 3GMLB 5E5RB 3BI9X 3JV5A 4APQB 4JREC 3WTYA 1I8KB 5DVKA 3QPQD 1IAOA 3CZKA 5C7XH 2X09A 2BDNL 1I1AA 3U4BL 4A6YA 4I3RH 1OALA 4QHKJ 3PHQB 3FAXA 2G3ZA 3QA3B 2H6OA 3GXTA 3HB3D 5AW0B 1LO5A 5DFVD 3PAYA 5HGGS 2A74B 4YDNA 4NNXB 1QSEE 3BW9A 5AOIA 1U8PB 2F54B 4QRQB 4PWJA 2PO6C 3NJIA 2ZXWB 3NSDA 5E2TL 1NCJA 4KV5E 4M7LH 1I1YA 2MFNA 1BFSA 1G1YA 4G7YL 4LRNL 2JSFA 4DGWC 3ATDA 1MPAH 1JZEA 4NNXA 3BZ4A 3TF4A 1INEL 3H2WA 3TT1L 4X7TB 1IAIM 1TZIA 3FTGA 2Y1VA 2D31A 1UOVA 1I8IA 4R4ND 1UURA 1KTRL 3I50L 2YPVL 3CN1A 1GOFA 1S2EA 1AR1B 3TO4A 3HBGA 4DP7X 1XSKA 5FA3A 4K0OA 3CU7A 2G30A 1CFSA 1I8UA 2KDYA 1ZVSB 1JRHL 3HB3B 2FCBA 2ITDB 3QUMH 3L3DA 5EA0L 5FV2A 4OD1H 2GAZB 2GC4C 3VI4F 1BQHA 3MRHA 1E0OB 2A9NH 1EZUA 4K7PL 5FA4A 2A38A 3OJMB 4OFYA 12E8L 3MJ9H 4CILA 3QXWA 3OB0K 4P3DB 3B7SA 3CQFA 2WSPA 3VMNA 3KBHE 1E6JH 1I8AA 3B8SA 3IJSA 4MHHG 4ZOBA 2JIXB 4N0YH 5CGTA 4J3OF 2BWQA 3KPSA 2NY3C 1T1XA 5IHUH 3GEWB 5AW3B 3F6JA 2FYYB 1D6VH 2J3SA 2C3XA 4K5NA 4X5XA 1EIBA 4HX1B 3CC5A 4LCUB 3ULVF 3VFGH 2O93L 1KB5A 5BPPA 3B9EA 2GT9B 2E75C 4F57L 4PJFF 4LSTH 1ESOA 1CLYL 1E8ZA 1Z5YD 2H0EA 2LT9A 3AADB 3MRLB 4KVCH 1A25A 4N86A 4RX4D 4NBYB 4Z7QB 1XZ0B 4PYHA 4LOFA 4XVUC 1HINH 2CJUL 2X2IA 3NCMA 1OHQA 5EBMA 1O6TA 1INDL 2W59A 1A14L 1AZUA 1AIFB 4PWHA 4UM9D 4H8HA 1RZGB 5TH2B 4NT6A 3VD4A 1FYHB 3MNWA 2RA1A 1BZEA 2C1PB 4M5SA 2OMVB 1ZIAA 3EH2A 1HHIA 5LWYL 3QHZH 3DV4B 3TTYA 1KTLA 4PHZA 4KO9A 1PSKH 2P9RA 4OSUH 1IGYB 1QHQA 5AKVA 2FO4B 4YHLH 3FPYA 2AW2A 2V5SA 2YUVA 4FFYH 4EZLA 1NFDA 2JE8A 2NTFB 5ENWB 5K59E 4HFWB 5AAWA 4OVUA 5MEPB 3VFGL 2MWCA 1M3IA 3EHBC 1BWMA 1OTUC 3RUGE 4Z77A 3V0JA 1IBGH 1E7UA 4PW4A 2X3AA 4FCAA 1AG6A 5F93C 4Q9CA 2R51A 1A1NA 2VAAA 3HZKB 4XO9A 4ZTOH 3TH3T 1B0GB 1TJHL 4PJIE 5T5FA 4Y2DB 1BLNA 4BQ9A 2WLIB 5L4FA 1XBRA 2IADB 2A9NL 2JJSA 2WXJA 3JWOH 3RWDA 5E4AA 2LTQC 4OD1L 1NOLA 1M2VA 4Y7OC 1JI2A 4QJ3B 3Q6FB 2ZXCA 4K7FB 2IPKA 3PREA 2F08A 2KZWA 1FN4B 3HBPA 4G8FA 2VDRL 1JRHH 3ATAA 3CXDH 2ZWKA 4UT6A 4BFIB 1X3DA 5EO9B 3LQAL 3FTXA 5FYJD 2LABA 3QEGL 1JP5A 1I1AD 1T2XA 2YRBA 5ICXA 4UT9H 3ARGD 3HS8A 3QW9A 1I3GH 2LR4A 5C1MB 3QUYA 1EEYB 2ZUXA 2OFQA 1NWOA 4L05A 1CR9L 2ERJC 3UADA 4CUCA 3NPSC 4YXHH 2C3VB 4L9LC 1INEH 2JJSC 4AQAA 4HPHA 4QHNB 5DRNB 5DSCA 1X5JA 1TQVA 5DRWA 1GAFH 2L04A 3KXFB 4CDGC 5A16B 1WQVT 4HUNB 5AZ2L 4CNIA 3EG9B 5KANG 2AEQH 5ECJE 3HZVA 1OAUH 4NOBA 1TU2B 3QBTB 4RGOL 3MOBL 5GS1C 3UJTL 4J6RH 4RESB 3G6AA 4JRLA 5HVGB 4PGJA 4L3CA 4MZIA 3QQ3A 5KJ7E 4DP4X 2CUHA 1AS7A 3A4DA 3GSWA 4HXBH 4P2OD 5IV2A 2C9SA 2V3EA 3OKLB 1KCVL 3QT2A 2H26A 3QH3A 3WY4A 1N6VA 3VWJB 2H2PD 2P5EA 5D4JA 3U30B 2ROYA 3WEBA 5D8JH 2Z7ZA 3B7UX 4R97C 1P6AB 2XQ0A 5HDOA 3EIFA 5F0MB 5GGQL 4BKTC 1DQQB 3TM6A 3FC8A 2RMNA 4Q9RL 2DTML 4JUTA 5HDBB 3CQQA 1S7XA 4G5ZL 4MXWL 3OMIB 3UZQB 2NSQA 3V5DA 4AT6A 1G0XA 3W56A 3PQYB 1EHLH 5E1IA 4H1LB 2HN7B 4JPQA 3FO1B 3FO9B 2YOAA 4G7VL 4GYBA 1UWGL 1WT5C 2V5YA 5DJZA 5JW4R 2JI1A 1KB5H 1T89A 5BS0B 4KXCA 1R5VA 1PZ5B 1UFUA 3DURB 3TEXA 5JHAA 4LAQH 1DTUA 4FTVA 4W4NA 2X4OB 1D7DA 1KJVB 4F3FA 3D18A 1U8CA 2A6DA 1AQDB 1BQHG 2JNZA 3PWJA 3R0MA 1AKJB 1YUHA 4IK7A 3ARYA 5C0GB 4HK0B 1YEEL 3RFRA 4NHCH 1J9SA 2HRGA 3IDJB 4QXWA 2R69H 3WLWC 3TNNA 3EYUH 3KHQA 4PTUA 4O2EB 1VSCA 4F37K 1OV8A 2K78A 5KN5A 3IPEA 1KBWA 3EGXA 2KUTA 2X44D 1A3QA 3MNVB 4JO1H 4L8CB 2O61A 3ZE0F 3FDWA 3IU3B 4OUOA 4X0KB 3MLYH 3ZIMA 2AJYH 3DX9B 3MXWH 2FRGP 3BP7B 5DJ6A 3DO3A 1MCPH 4ZUVB 3VXME 5A2AA 3BN9D 3ZLQC 3CMOH 1FL5A 4YHKH 4H8UA 4EDWH 5CHNA 3ARSA 4J12A 2O61B 1BZQK 5D9SB 5C6TH 3S36H 2EUWA 1TJXA 1QR1A 3BP7A 5DJ6B 1CE1L 2NY6C 3NH7H 4Z5RB 1XBDA 4PRHB 2XV0A 1U33A 3TO4D 2GTWB 3ARPA 1U95A 3ALWA 3V7MA 2Y36L 5GXBB 5BVPL 4JPWL 4YIQB 3LB6D 1EFXD 1CMOA 2NNAB 2AJZB 2Y3AA 1OB0A 3WCYA 4ETYA 4LCCC 3QC5X 1FE8H 2FTAA 2PTVA 3ILPA 1ZLUK 1A21A 5EUOE 2RQEA 3P9LA 3ZSTA 1N0LA 2PXYD 3BIKA 1YLBB 5EF0A 4Z3GA 5HGHA 4ONHA 3SKJH 3AG2B 3MLPA 2L7EA 4XMLH 2AGJL 3S34H 1JYWA 3QCTL 1CN4A 2AJZA 3PUUA 1WZAA 3ASNB 5C0DB 2RCSH 1WP6A 3LRKA 1C1EH 2QTVA 1ZCRA 4FFTA 4XP1L 5AW6B 3RA7L 1AY1L 3UTSB 2VRKA 4MD0A 2FZ3A 3WU1A 1CFBA 1GRWA 4BCXA 3BWSA 2PR9A 1BZ7B 1VA9A 5EEYA 5TGBA 2EXYC 4U33A 3Q2NA 2KBGA 1NCNA 4PG2C 3DROB 1OT1A 1AZVA 4C56D 3TWCH 4PGBA 4E9QA 2APBA 1I1FB 1SXBA 4NUGH 2GVYA 1C1EL 4OGZA 4P06A 4F93B 2D0GA 4DN3L 1JUFB 4MJ6B 3B3IA 3R7RA 2X6UA 3J27A 3KYNB 4R97B 2D9QB 2XLLA 2K7QA 5T3XH 3V0WH 5DHVB 1V10A 3QXAA 2DQGL 3FFCB 3PDDA 1K8DB 2GTQA 1FE8L 3MOQA 5MENE 4N28A 4GQPH 2LTQB 3B83A 5IG7B 3B3IB 3RTQC 2DQCH 3CZEA 2O26U 4RISL 4QOKA 5I66B 1OTSC 5B7FA 4Z3FA 3I6GA 4E5XA 3HE6D 2IIJA 3DO7A 1ZTXE 4Y4KC 1ACYH 3BT0A 4AJWA 3DX6A 4MNGE 3HLKA 4PW9A 3T1WA 4ZMZA 2YA1A 4UCFA 4BUHA 5A2LH 4YHKL 3Q2VA 3MREB 4KVNL 1H8SA 2Y5EA 1HL5A 4JHWL 5IHWA 1UTDA 3K4AA 4P5MA 2GYSA 2MHAB 1A3LL 3TN0C 5A2IH 3CFEA 4J3OH 4IDLA 4UZUA 5E08L 2AJYL 2BZ7A 3MXWL 2Y3NA 1GGYA 1JWSA 2AXFA 3IDGB 1FZKB 2IALB 4PS8A 3QORC 4TF4A 3LZNA 4I2XB 5AUMA 1MDAA 2DEYX 2JH2A 4FI7A 4NNYB 4ZMTA 1F8TL 4LIQE 4GG8A 2YSSA 2ZOLB 1P84K 2R69L 3G6DL 3I74A 1JYXA 1N0XH 3C5ZC 2JK5B 1TJGH 1YEEH 1U2CA 5DMJB 3Q8FA 1I1RA 4DN3H 5HHOE 4M6NH 2OMXB 4Y4KA 3V0HA 4P05A 4Q0XL 1T3FA 4YL9A 2XIDA 1WA2X 1T2QL 2O6PA 4MA3B 1HU8A 3Q44A 4O58L 5DA0B 3BPCA 3G6JB 2OKMA 3WHE1 5D7LB 3C5JA 5GJTH 1FQ9C 1AANA 3QUMA 1SOKA 3MRMB 1M4KA 1U6AH 3B2UD 3HHMA 4HJGA 2PP8A 2ADFL 4XBPA 5K9QG 3TGXA 1L0QA 5FDWA 4DIXA 3S88H 2AV7A 2WCGA 3B5HA 1MHEB 1OAZL 3O4LD 3O6FD 4RFOH 5D7LA 1UCBH 4IIQB 5F3BA 2H32H 3QWNA 4TVPD 4ZTEA 1K4DB 3F8UB 4FP8L 1XIWC 3INUL 4DETA 2XYCA 3V4PB 1D7BA 4XNQA 4NO0D 4PJDE 3P30H 3VXSE 4AIZA 4MAYC 1XGQB 2XN9D 3KWXA 1YC7A 1GYWA 1QI4A 3IBEA 1GY2A 1I3RA 1B4JH 1LO4L 4NRXA 3DVGA 3D39D 1A4KA 1ZANL 3ZKNC 3O9WA 2FHCA 4KDTC 1AHWB 1E30A 5I8OH 4M1CC 4ZOEA 1KCVH 4KMQA 2W65A 2XVLA 1GGUA 3SGKA 4Y4HD 3RU8L 1RK1A 1MRCH 1I1AB 4KXAA 4RGOH 5IQOA 3IMSA 3PJLA 2B14A 2AEQL 4E5XG 2OTWA 4JO2L 1EDYA 3HFMH 3TT3L 2X40A 4L4VD 5IVOA 3FO2A 5EU6A 3MU3A 5C0RH 5D1QE 1D7FA 4HMCA 3ZHDA 2VW6A 2A4EA 3CX2A 1KLGB 2BINA 4R8WH 3GI9H 2DWDB 1KLFB 5DZPA 2FJHB 3HMWH 5AAMA 1SJHB 5CM1A 2XQBL 3OKDB 3E8UL 3AFLA 3EW3B 3GSOB 1Y6NR 4CC1A 2BNRE 2C9PA 3OKMB 4GRLB 1KLGA 1E9OB 3IN0A 1NMCB 3NIGE 5T1LA 3QEGH 1E90A 3C8DA 4PRAA 1MFCH 3WS3B 1CFVH 5JHLA 2CR3A 2EDDA 3RPIA 1IB5A 4Y4HB 3PDGA 3GJFB 4GRLA 3OKMA 3LQZA 3HA0A 4PWGA 5JIKA 4XCNA 3V0IA 3WS3A 1ZDQA 5I1CL 4CSTA 4PGCA 4BA0A 2PABA 4MA1C 3FQNA 3PYCA 3OPZH 4HKJA 4N2OA 4YBLC 1VFOA 4UV7L 3NCWA 4OLZH 5KJRH 4L4TE 4MA7L 4XCNB 5E6IA 4A7TA 3LEYL 2HX7A 3IDNA 2GAZA 1S9YB 2VL4A 4UANA 4Z7UA 3BGAA 3RKDC 1IBGL 4EI5D 2JQAA 1FFPA 2CD0A 4PJ7F 2XZQH 4L4VE 4M4PA 4N0CD 1LTXA 2Z7WA 3WIIH 1QFPA 1FNFA 2IDSA 3MGTA 1CD8A 3OAUL 1AOHA 4K8RH 5TDNA 2AJSL 1EUUA 4P2CG 2BVOB 5INDA 3U0PB 2NX5B 3AXLB 3QEUB 2AJ3B 4W93A 1QMUA 4ZODA 1QUNA 4FD0A 4WHYG 5EUOF 2NPLX 4ORGB 3UGEA 3EH4B 2XZQL 2C26A 2K1MA 1KG0B 4FG6D 3GJFH 3VRJA 3NBNA 4PQXA 2NX5A 1RZFL 3MRKA 3OQ3B 2GITB 4AM0Q 2NW3A 1YNTA 4FG2A 1WLHA 1UWEL 2XCMC 1WZKA 3F7PC 5CR8A 4K71C 1OAJA 2ICWI 1HOEA 5KYWA 2X4RB 2CHNA 2G5RA 1AYOA 4K71B 2C7UB 5I1CH 3SD5A 2NW3B 4PCTA 2EC8A 1LDPH 1QYGH 2XZCH 2JTDA 1FG2A 3FHAA 1HL4A 4ZMVA 3JTSB 3G5YA 1J18A 4ZAKB 4YWGL 5IVZA 2VN4A 3MBWB 1DVZA 2VMJA 1CFVL 3NJNA 3VSTA 3QR1A 4UI2A 3WUZA 4JRXE 3NACH 2XX0A 3AY4A 1HNYA 2KQNA 4FMVA 5GS0L 4P23A 3TN0B 3T0DA 4A38A 1FG2B 1CFNA 4CA4A 3T8VA 3E8UH 1BD2B 3MV7A 2E6JA 5KBKA 4ZFFA 3FAWA 1CTNA 2JV6A 3HCVA 3GJFK 4HCIA 1LK2B 3QCVH 1WC7A 1X7QB 4FFVD 4R8WL 3PWPB 1RUPH 2Q9OA 1SDDB 4XMWA 3U0WH 5L2KD 3GNML 5DHMC 2N4IA 2RTTA 1M1SA 2QVIA 2MNJB 35C8H 5C0RL 2OJEA 4U3SA 4K7PH 3RDTB 1OCOB 3TF7C 4GNKB 3RJDA 4AQ8C 3TT3H 1ZTMA 2JXMB 3FPXA 4JO2H 2XRAL 1JHKH 4TVUA 4XH2A 4CSSA 2E7LA 2BIOA 2R4SL 3AC0A 5I1LB 5KVGE 3QUZB 2W0FA 3DVNB 4QIRA 4KMLB 3HNSH 3L81A 1BF2A 1V3MA 1SMAA 2WKGA 2VKXA 2JKTM 1TO4A 2BSSB 1JZ4A 3PQYD 3QQDA 4G2AA 4PEEA 3EOAB 3LMJL 4TQEH 2XWCA 1J1PL 3V6BR 2WXKA 3BKMH 1LO4H 3K1KC 5ISZA 3BT2H 1HKLH 2BSSA 4LCIL 3HE7B 2XZZA 3SN6N 3QQDB 2WNGA 3P30L 4OB5H 2XX1A 3QIWB 1RSYA 1MPAL 3T4AC 1CDUA 1NZRA 4U1IB 3HMXA 3INUH 3LZPA 1E6OH 3GXNA 3DK2A 4DFHA 1ML0A 5TPWL 4M7LL 4YZFE 3PRZA 5CBEB 1OWRM 4PWKA 3PF2A 2ZXGA 3LHAA 3QIBB 3UIYA 5HHQA 2QPSA 5L8JB 4HDIB 3S88L 1ADQL 4UDUB 4N0FA 5E9DA 1JRHI 1U6AL 4K5OA 4OQ1A 3KLSA 3M6DA 2EIJB 3CWGA 1EPFA 1T0NA 3HE6C 5LUMA 3BE1H 1I4FB 4GG6E 3W57A 4I3RL 1LLAA 5H35A 2YQBA 5HHQB 1G9EA 3S35X 3R4RA 1T2QH 1CBJA 2WCPA 3MDJA 4KTYA 2G9HB 4P0DA 3U0TA 1GGIH 3NSCA 1OSZB 1N0XL 4NQSA 3NJHA 1PX4A 1N8ZA 4ZXBC 3WS6C 3B34A 1F8TH 4WY7L 5MP6H 1BV8A 4G7SB 5DO8A 1AHKA 3QRLA 4JRWA 1MI5A 3M17A 2APWA 4F33A 3FTVA 5DEFA 5HXMA 2NQCA 4MFHA 5CILH 3JXAA 3UC2A 3MLWL 2VSCA 2ZAHA 5F89B 3VTMA 4C56B 5DDHB 1JNHA 3CNKA 3O6MH 4H88H 1F4HA 5EIVA 1YYMH 1L7IH 4KKLD 1HWWA 4NN7C 2NX5E 2AXHA 4LSUH 4ZPVB 2NTFA 1CYXA 5FUCC 3R8QA 1G7HB 3ENEA 5HDQH 1HXMB 2QQLH 2VDLH 1J05A 2A6IB 1SOXA 2HWZL 4NJ9H 4XVJH 3SQBB 2I7OA 3AUWB 2DQCL 2GSGA 2IF7A 2YEZA 4O2FA 4CW1A 1ILUA 3V0EA 1VFUA 2XN2A 4EOWH 5EF2A 4ZPVA 3MUHL 2W9DH 1OCRB 3BDBA 5C0CE 4WHTB 5EO1A 1V7MH 3ORJA 2UZIH 3IFNL 3RBSA 1JFQH 2A0LC 1T03H 3C6SB 5F8RC 4XP9H 5SWZA 5I1JL 1E2VA 5DS8A 2UWEB 1LP9F 4N25A 4O5LL 3FFDA 3HKFA 3NRPA 3OC8A 3KPLB 1KXVC 2VDMB 3GXIA 1NMAH 4KPHL 4Y1AA 2DDQH 4A6YL 4NC0B 1T0MB 1XGTA 4L3ED 4B3VA 1R9FA 1AY1H