2RQEA

Solution structure of the silkworm bgrp/gnbp3 n-terminal domain reveals the mechanism for b-1,3-glucan specific recognition
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
102
structure length
102
Chain Sequence
YEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
publication title Solution structure of the silkworm betaGRP/GNBP3 N-terminal domain reveals the mechanism for beta-1,3-glucan-specific recognition.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Sugar binding protein
total genus 7
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rqeA00
2RQEA 2KHAA 3AQXA 3IE4A 3AQYA 3AQZA
chains in the Genus database with same CATH superfamily
2EDWA 1UD4A 2J8HA 1BQ5A 4ODVH 5DZ9A 5T3ZL 1BLNA 4Z0BH 1CFVL 5D9SB 3LQZA 4JHWH 5A2JH 4XP9L 4UTBH 1JJUA 2AK4B 4N2NA 4H1LH 3B37A 4G6AD 3QHZL 3U1PA 1S46A 2BSRB 2DQ6A 2NYYD 1KB9J 3ROLB 2JSFA 3LPGA 2F15A 4IEFB 5FUCE 4K4KA 3MTXA 4F2EA 1TYEB 4OTXL 1T5XB 5EZIH 4Y2DC 3BUTA 4EIBA 4G72B 4ICXA 2XVKA 1L9RA 1ED3B 2WQ8A 4FQ2H 2YLHA 4C4KO 4PJIB 2ENPA 1CLYH 2BC4B 3L3IA 4ZXBA 1RUAL 3D2UD 4LCUB 3PWUA 3DUUB 1XCTA 1BFOB 4P2OC 2DL9A 4ZO8A 4AYFA 1XGRA 4RWYH 3UYOD 4WDIA 5EIQA 4G7YL 1WK0A 3W0WD 3V79C 5KW9L 4CBZA 2X3CA 1F11A 1UVQA 3IRPX 3F85A 4ZRGA 3C2SA 3P69A 3BKML 5IQ7L 5FS5A 5FW6A 1E28A 2FD6L 25C8H 1QO3A 3KPRE 4MD5A 2EEDA 2NDGA 4IRZL 2YR3A 3WO4C 3GM0A 4JRXB 1QFWL 4OD2A 4F80A 1XGTB 3P73A 4Z7OB 2VWEC 5ENWA 3K81A 5DTFB 1N19A 2TAAA 3BQVA 3EDEA 4WEUD 6TAAA 1LP9F 4ONFL 4DGIL 4FQXA 1I82A 4ZQKA 3VCLB 5BZWA 3ARQA 2H32A 4K73A 4W6WB 4PJFE 1JDDA 1I3RB 3MOQA 1BZEA 4PLKC 1C16A 5DFVD 4PGCB 3D6GA 3GKZA 4S10A 1QEWA 4H2AA 4NKMB 2MCG1 1OTTD 2Z65C 3VFWA 1RD6A 2NXZC 1AGDA 1XCXA 3IF1B 4IGBA 4JY4A 5DDHB 1QLRB 4GIOA 2B16A 5I73B 4R4NC 3AU0A 5IQOA 3VD0A 3SDCD 2XTJC 3LAFA 1WWAX 4QRRA 2VJXA 4HBCL 3E2HC 1NBVH 3O0RH 3ZXAC 3D07A 5JXEC 4ZS6D 1A1NB 2VLKB 2YD3A 4JFEB 2YPLD 4P23A 4XB3A 1TSHA 2J8OA 3QUXD 3B9KC 2FNWA 1PLCA 3JT0A 4XZUA 2PPFA 4NNYA 1JRHI 2D73A 1MCPL 4Y5XC 2LQRA 3S37H 4PGBB 4TOYL 2AEOA 2X4UB 4XVSL 3KYKL 4MQ7B 2J88L 2W07B 4J12A 2NR6C 4YDIL 1QLEH 4L0PB 3US9A 3VMNA 2XVGA 2Y06L 2IMNA 2HTKC 1N68A 1JF6A 2X10A 4O4YH 2O93L 2HWZH 4EDWL 2WQRA 2BIOA 3KLLA 4LSSH 1U93A 4UOQA 5ABAA 1ZDQA 2IAMD 4IM8A 3FB7A 1LMKA 3UP1A 2FT8A 4XPFH 4LU5H 3CZNA 2OR7A 2DQDL 3QDJA 4DPBX 1EZVY 5E00A 1CS6A 1KGWA 2WKOA 1J5DA 4WHCA 1NMAH 4K8RL 2GFBA 2XTLA 2ZG3A 3UPRB 4TLSA 3VGAB 3BP5A 3ZDZB 2AQNA 3CSGA 5IF0B 2DKUA 1KIRA 1ROCA 4WWKC 3LEVL 1H8OA 3KGSA 2DM3A 3FNKA 5ILTL 5IMKA 4G8GA 1ZSDB 4PD4K 5CMAA 3EJZC 2F53D 3NBNA 3MV9E 5ALCL 3WKMH 3EGDB 2WYZA 3SGKC 1GMIA 5EIIA 1M3IA 4GIPD 1UWGL 2JB5H 4IOFD 5C0FB 1KNOA 1ND0A 4GMSL 3O3EB 5FYKU 3UIZA 1CFVH 2MPAL 4I88A 5DA0B 2QFRA 2R56L 5B39G 4UT9A 4XP9H 5FM5M 3WHE0 1J5OL 1P0SE 2EC8A 1MRDL 3QHZH 5ABDE 4WK0B 4YVNA 1QASA 2D31A 3QARA 3BGAA 3NPSC 2BVPA 1N8OE 4WFGD 5I8CB 5EU6A 1I8LA 4I3SL 4L1SA 1NFDF 4CSSA 4WW2F 3PDOA 4OTXH 3CSYB 2BSDA 2ESVD 5SX5H 5CCKL 1RJZA 2ITFA 4G7SB 4P9MH 5GGUA 4ZMAT 5FV1L 4CVWA 4KXBA 4KO6A 4QGTA 1ZK9A 1L7TL 4QDGA 4AMWA 1RUAH 3X2QB 1AGCA 3N91A 1OE3A 5GRYA 1U8OA 3FULA 2E86A 4C83A 4E2OA 4M7KL 2HN7A 4JZJC 1P5VA 2G5BB 4TL5A 2G75A 4G7YH 4EN3C 1WD8A 4X8CA 3STZA 1NH6A 4YHIA 4BSWA 3WUWA 1TTAA 5I75C 5KW9H 3MUUA 1E67A 4FFZL 2Y23A 1KOAA 3MGTA 5IQ7H 4JEGB 5AAMC 3DOIA 5CEXA 4B0MM 2YRBA 2F7QA 3P40A 4BFRA 5IB4A 5F89A 4UZGA 3TIDB 1QFWH 1I1AD 1ZVYA 2EIBA 1BEYL 3OQ3B 2FX8L 2H3XC 3JV0A 5GRVL 4HCRA 3NSDA 4DGIH 2GAZB 4ODXB 3FT2A 1K4CB 4U6XB 4GKSB 2GB2A 3KLDA 2MTAA 1PCXA 3DSFH 4QOKA 2DMCA 5E94A 5HY9B 5MENA 5C0RH 4GBXA 2A9NL 5IV2A 3MLWL 5DS8B 2LFEA 3DRQB 2BSEA 1NPJA 3N85L 4I0PA 3W11C 4JGJA 5AVQB 5ETUB 4P5TB 3V8CA 5DEFB 3VGHA 3CAFA 2B77A 5AFAA 2XBTA 1FC1A 2NCMA 3U83A 4F7EA 3F84A 1XAKA 2W0PA 2R0LL 1Z9MA 2CO7B 4KNUA 3NYKA 5E8DL 5I6OA 4HBCH 3GEFA 3BPLB 1QW8A 1F90L 3WIAA 1ZA6A 4KKAD 5AG8A 1Q1JH 1G1KA 3NIGE 5FECB 4MYPA 3O45A 1MY5A 2WQXA 2X4NA 3EOAA 4GNKB 1C5DB 3N55A 4J3OG 2F8OA 3FKUS 2N1KA 1HKLL 4MJ5B 1H6FA 1MCPH 3CFKA 1SEQL 4MQSB 1TFPA 4XXWA 1FI8C 2RD0A 3TASA 3ZE1E 2FJFB 3FSWA 4E5XG 4TOYH 5J89A 4Y2NA 2GJ6E 3DHMA 3EG9B 3KYKH 1G7MA 2J88H 4XVSH 1WYJA 2HVBA 1UZ8B 2XXFA 2LHAA 3L7EB 4RAHA 4YDIH 4AW7A 4OI7A 5AG9A 2ZCKL 1FIEA 2Y06H 1NCCL 5A3IC 4BZYA 2GTWB 3GSOB 4EDWH 4HMEA 2J1ZA 4Q14A 5LWYL 4UOW1 2IXQA 3BIKA 1AG6A 2YAFA 1T0NA 4PRPD 5FB8A 4FYSA 2DLFL 1JXKA 2DQDH 4NRYA 4LCWD 4NWUL 1KV7A 3BZEB 4KXAA 4P57B 4NERA 4MDIB 5D7KD 1S3RA 3UTSD 4YQXH 1KXHA 2YD0A 4GW1B 2BHFA 4NO3B 1N0LA 4Y9EA 5I71C 3IDGA 4E9RA 3IJ8A 2Z7WA 4QRBA 2R2EA 3NVQA 2WOYA 4GSXA 1XXDC 3V5HB 2QZQA 4X9IA 4DF9A 5HHQA 2Y9RT 3LMJH 4Q9QH 2DKMA 5DI8A 5ILTH 3QO1B 1DVZA 4FLSA 1JYVA 3APFA 4OM1L 1YO4A 4AQ1A 4UM9B 4J3OH 4Y4FB 3SY0B 5I0YA 2VSMB 2XWZA 4PG2C 5ALCH 3DX8A 1CK0L 2NW3B 5L6YL 1KELL 1UWGH 4K7PL 2HB0A 3SQBB 3TO2A 1ZAGA 2JF1A 3IGAA 4GMSH 3T3PB 3V0FA 4BFFA 2QMJA 2CJUH 2Y2WA 4ZPVB 3QJTB 1HHKB 1NWPA 2R56H 4JFFB 4NQTA 5E9AA 1IM9D 4ZAKA 3AREB 1J5OH 4JY5H 4H0HB 5DD6B 2OTPA 4MJIB 5EC1A 4X6FB 4LEOA 3DX6A 5LBGA 2OX5A 1PZUB 3F7LA 3U1QA 3L4VA 1KCBA 2QADB 3SHSA 5EO1A 3B2DC 1NEZG 2O5NA 1NBZB 1QFUL 3P9MB 3GBDA 2NY0B 4Q9BA 4H20L 3ULUF 1YEKL 3L16A 1YMME 5E8OB 3TN0B 3QZWB 3O3AB 1L7TH 1Y07A 4MHHI 4QYAA 4BCXA 2YFOA 5CZRA 1JGLL 1UA6L 1GGUA 1GVIA 2XG5A 2VDLL 2FJUB 4M7KH 4NI6A 3H56A 5I5JA 4LLVB 5J57B 1CQYA 5LXGL 5EO9B 4P2QD 2O5XL 4FFZH 1WITA 3BWAA 1XSKA 2LGNA 3NCEB 3TVMB 4U05A 4J8QA 2FGWL 3AGWA 3RY4A 1C12B 3ML9A 1NC4A 2BVEA 2ZPKL 4YSTA 3KWWB 3N04A 2WBXA 5K59E 4AVIA 3I6SA 3S3SA 3CDGA 1BEYH 2JK5A 2VT0A 2FRGP 2HYMA 2X70A 3QEGL 4U6HB 2FLBT 2GJRA 3BVTA 3N44F 2Y36H 4ANWA 5JYLA 3VW3L 5E51A 1Z32X 5C09E 4JJOA 4MDJA 4EI6B 5BS0E 3HLAB 5FO8B 4AMKL 3TH3T 4N5EC 3VXRA 5C0CD 3BAEL 2A9NH 4FA8A 3MLWH 3WN5A 5KOVC 4UDTB 3V6ZA 5I5MA 4LXFA 3EZ8A 2H26A 3N85H 1IMHC 1UT2A 1Z5LB 2ZCHL 4PJ5B 5I76B 1KLUA 4XC1L 3KWTA 3RWDB 5CGMA 2KT6A 5C07D 1AGFB 4AM0A 3BISA 3DMMD 3DX4A 3FU5A 2D7PA 4QXTA 1JVLA 2QKIB 4ENED 2OJEB 1BD2D 1FYTE 2R0LH 3QIBD 2NY1B 1CIDA 2CLRB 5E8DH 2J43A 3HOGA 3MACL 1FA4A 4EI5D 2Z31A 3TXAA 1F90H 4FFYA 2K8QA 1TJGL 1JWUB 5TE7H 4TKWA 4LSDA 3Q8FA 1E42A 2IANE 4XXCA 4FC3E 4JFHE 1W15A 1HYRC 2O6PA 1G7PA 4GFXA 1FFPB 1OGAA 4K9EC 1YYML 3AWFA 1HKLH 3I50L 1SEQH 3MNWB 2EYTA 1AZBA 4IMLB 1KC5H 1LNUA 4UDUA 5DUPL 3S5LA 4DVBA 3LB6D 5KVMC 5GZOD 5ABZA 5BXFB 4C4KT 3QPQD 5G55A 1VFBA 3V0HA 4NQED 2ZCKH 3QEUB 3GRWL 2EC9U 4NBYB 1MJUL 2B0SL 4ACPA 2QPFA 3PWLB 3QEQD 3N3EA 1FP5A 5F97E 4EXKA 1EZUA 1N5AA 5LWYH 2B7DT 4QF1B 2NSQA 3FOMB 3RIFF 3VQMA 2ENJA 2XQYK 2FH8A 3LKQB 4KC3B 4OZ4B 3TBSA 3OPZL 3K2KA 4ZFGL 2OSLA 2ZOLA 4EPSA 3DIDA 3U2SB 5FO2A 5KUKA 1BEXA 3T0EC 4I9XA 4PTUB 1PY4A 4IBLT 2GJJA 1MRCH 5JW4N 1JZ4A 4F5CE 1I3GL 3SKJL 4HS3A 5F0LB 4LOUD 2W9EL 1THAA 2VCOA 1L0QA 4ZOCA 1Z9OA 1WS8A 4NKDA 3B9EA 3FDWA 4FFWD 4WFHD 4NQXA 3K0YA 5DVNA 1EAOA 2Q8BL 3A4AA 2IGFH 1W0VB 2OSYA 4Y5VC 5PCYA 3QDMB 1TZGL 4G7VH 4X0KB 5IHWA 4P59L 5C6PB 1QKZL 4LSPL 2HFEA 4OCRL 1OPOA 1S9XB 3AB0B 5EBWB 3ZMRA 2R69L 5E6ZA 4JW3A 4K3DL 3UG3A 2AK4D 5KSUA 3I02A 4DQAA 1TO4A 1ID2A 1S5HA 4HFUH 1GA2A 2X44D 4G43A 4JN2B 2D2CC 2E9WA 1G1CA 3UZEA 4EKXA 2BVOA 4WNQA 3CSFA 3UDWC 1HL4A 5ANMB 4Y4HA 1JG9A 1QFUH 2VMFA 3BSHA 4LCCC 1KPVA 1QSVA 3GMQB 1LGVA 3WMQA 2BERA 2XFGB 3CVBA 4H20H 2OMWA 2VE6B 1YEKH 1EHLL 2C7UA 4NHUA 5L88H 4NAJA 4B5EA 3TTYA 4M61B 3X1GA 4PGEA 2E4FA 4FJZA 4RMWA 3RY5A 3VXTB 1UA6H 2R23B 2WHVA 3MLTB 4L1LA 2VDLH 4J6RL 2ZAIA 1HHJB 5LXGH 1M7IA 2PXYD 3V0WH 1FE8L 4ZW6A 2ROXA 5JHLL 5LBSL 3T2QA 1YPZA 1CD1A 3BLPX 3JWNH 1OSZB 2FGWH 4EI0A 2WXIA 4FFVC 3H7LA 5F0MB 2V6HA 4GSDL 2ZPKH 3EYSL 1FRGH 2E3VA 4IIQB 3WFHA 1QTYT 2PUQT 2CR6A 4HUVB 2P9RA 1T1YB 1I8UA 1V7NL 1GR7A 3QEGH 3LNGA 2VDRB 3CFEB 3VW3H 2SEBA 5HGBB 4V2CB 1RHHB 2P4AB 3WUZA 2GK0A 4TSAL 4AMKH 3T4YB 3VACA 4JKMA 2JKXA 3TO4A 5HI3D 1OGSA 3A4DA 1RSYA 1TNNA 3BZ4A 4B3VA 3S7GA 2EVGA 2ZCHH 4X7TA 3S96A 3IDJB 4XC1H 3AAZA 3U4BH 2FGZA 1Z5HA 3SGJA 5HDLA 1U21A 3ZTNL 5DSCB 4JS7A 1IGFH 1ZLSL 5F6IC 4HSAC 5I26A 2YK1L 3SD2A 4BSJA 1FL3A 3FCSB 5B39A 1MHPL 4KI5D 1SLUA 3LHPL 1U8IB 5AKVA 4JFED 1HHIA 2VLKD 3UBXB 3KYOA 1M3JA 4JRYE 4X99B 5KVEE 2DEYX 4YPGB 1TJGH 1BIIB 5D2LB 1O75A 3BPNB 4KV5F 3SCMA 1GSKA 1BW8A 1XH3A 5K9KA 5K9JL 2ZQKA 1MKFA 4PG9B 4MWFB 4QLWA 1YYMH 1KYUA 5MP6L 5GSVB 2JFCA 2CIIB 3I50H 3WEXA 2WP3O 4M7ZC 2PF6A 1FH5L 1BA9A 5DUPH 3HI6L 1MJ7H 4MNQE 3SDAC 1INEL 5I9QC 5C0BA 3GMPA 2XN9B 2F58L 3LTVA 3ZRFC 2YZ1A 4C8XA 3KHOA 3PXHA 1PS3A 2PTTB 1CICB 4PP2B 3GRWH 4CVXA 4UNVA 2WSKA 1DSFL 1MJUH 1UB5A 2B0SH 5DZAA 5GISH 4QWWC 2KPWA 5EF3A 3V9CA 2HMIC 3DVFA 2N59A 3N1MC 1GZQB 4HZ1A 1RSFA 3FQXB 4L29B 4OCXL 4Z7WE 4F24A 5CSZB 5ICXA 4ZFGH 2JCCE 5C0EB 4HEMA 4U1MA 1QSFA 4FKKA 2L0DA 5ACMA 1G6VK 2J25A 2XWBB 4WEMB 3PABB 5LG6A 1W72L 2H6UA 3BX7C 2Q86B 1HNFA 1RIVL 4ELMB 4L37A 5BJTA 4FXKC 1UZGA 2W9EH 4I9WD 4LVOB 3W9DA 1FFQA 3HE6C 3CBJB 3V0GA 1JD9A 2YPKB 1BVOA 3JWDC 2A6KB 4X7SL 4YSCA 4DZBB 4X4YB 3MV8A 3WIHH 1TZGH 2GJZA 4GS7B 1I9JL 4P59H 4XXDA 1QKZH 4J39A 4LSPH 4OCRH 3PJNA 4WY7L 5C3TA 1RI8A 1BOYA 2R69H 2QL1A 4R0LC 4K3DH 3EYOB 3RGVA 1X3DA 2HA1A 1P6WA 4OFKA 3QFJA 2H7WA 1SYVB 4HXAL 3ZDWA 2DWDB 2LU4A 1MJJB 3B9DA 3WEOA 4CJ1A 5DXWA 1D5MA 4X6BA 1B0IA 3DHPA 3TJHC 5EN2A 1B0RA 2FSDA 4Y1AA 2IWKA 3VU1A 2F18A 2GEEA 3FTZA 3PWVA 3ZGHA 3DXAA 1DQLL 2DQMA 4OB5L 1IIIA 4QXVA 4P3CL 3MODL 4NQDB 4Y1SA 3O4OC 4HWEH 4JFYA 1PY9A 4E5XA 1EHLH 2FR4A 3VFPB 3VWKC 1A5FL 1QBAA 2NCEA 4X4MA 3EXLA 2WBJA 1L0YA 4S1DD 1VA9A 4IK7A 43C9B 2DWXA 4X9YA 1OGTB 5I6XC 5IMMA 3K1KC 3TNNB 4F9PA 4JHUA 1MCIA 2A6JB 1FE8H 3ARGC 2ZUQC 1LO2H 2EDKA 4JGMA 1J5IA 5JHLH 2JNZA 4GMTL 5K1VA 3NEXA 2Z64C 2J1KA 4YL9A 4MRBA 5KVFE 4GSDH 3Q2LA 4LSVL 4IKNA 1PPIA 2VERN 3OKOB 4LAQH 3U46B 4F2FA 2EEFA 2WLYA 1PD1A 1OAQL 4HK3N 1P2CB 1F3RB 4WGVB 4ZDHA 5DMKA 2KQMA 4RFOL 1QZNA 2M1KA 1HI6A 4TSAH 1BQKA 1FZOA 3QC6X 1NANH 2A5UA 5EPMB 1EO7A 1UWXH 1HE7A 2G9HA 3C6LA 4G1MA 4ICWA 4N90D 3VXSB 1YPZF 3H9HB 4D9LL 4ZFFB 4LF3B 2PLTA 1M6UA 3IM1A 2IF7A 3PV7A 4BELD 1MCHA 4OJFL 4J3UA 4OFPA 4P5TD 2BZDA 4MKTA 3MZGB 4ODWB 3H9SB 4XO8A 1CDHA 3ZTNH 3MBEC 1AYOA 5AVYB 3OXRB 3TCXA 1ZLSH 3Q3GB 1MLBB 2E5EA 2YK1H 3KGRA 4Q74A 1ZHLA 4ETYA 1TCRA 4M5YL 1MHPH 1TTGA 3U30C 5F7AA 1K2DB 2FT6A 3DETC 3QDGA 3Q9QA 4DP4X 4QHKJ 3VDCA 1BV8A 5DHDA 3ZQXA 2BY2A 5F96L 1MHCB 1A4KA 5KJ7E 5T33L 5K9JH 4HOZA 2NX5E 1NEZA 2XV6B 1QSEE 3K6FA 1XD1A 4D8PB 3KWXA 1DUYB 3CSTA 3BGFC 2FQEA 3C6SA 3HE7A 4H25A 5C92A 4IRSC 1FH5H 1MVUA 4HAKA 3HI6H 4YDKL 1E6JL 3L3KA 1UOVA 5E4EB 3T0DA 2BNRB 2HPTA 2GTZB 3MA7B 5E9DE 3PNWB 1ZHNA 5KS9E 1KXVC 2X1WL 1JHTB 1JRHL 2XZAL 3G3LA 2YBRA 4U1NA 3RUGA 2AC0A 2ZTBA 1Z9SB 4RBPK 1D2PA 3HZMA 3OKLA 2JV6A 2VR9A 2VLJB 3JTSB 3FONB 2CO6A 2UX7A 1D6VL 5EZLA 1QG3A 3LX9A 1CL7I 4LL1A 1KGCE 2CH8A 4A39A 5GS0C 2FAUA 3QEHB 5D5ME 1A4JA 2IAAC 5A6IA 4N2BA 2OMVB 3V4VB 2X4SB 3HRZC 2F9BT 3AMKA 4QRUB 2D4FA 5TD4A 4FLRA 4KO5A 3W0WA 3V10A 1DN0B 1W72H 3EH4B 4AM0Q 5D1QC 3KPSE 5C0JB 1U92B 1QMUA 4R96B 4HG4K 1YMHA 5IHLB 1X5AA 1Z9NA 3ZHFA 4KZDH 4YHPB 4HYTB 1FGVL 4UM9D 1NZRA 4X7SH 4CMMA 4XP6L 4XMVA 4DERA 4Y4FD 2ICEA 3IFOB 4FZEL 2VKWA 2P24A 1T1WB 3BMVA 1YA5A 4NRZA 1XB3A 4WY7H 1CVSC 5IT2L 1VEPA 4Y16D 4X7DC 5E8PB 3ARED 4WO4B 4HIJB 3GBML 4MJID 4F7KA 5ACZB 5JIIA 2NW2A 4Z76B 4PJ8C 3LNHA 2OXGA 2NXYC 2QADD 1WWCA 4AGOA 2B3IA 2NY0D 5LKNA 5IB3A 1SEBB 1DQLH 3IMRA 3MX0B 4OB5H 5ITFB 5SX4I 8FABB 3DOHA 3P30L 2A77L 2WXMA 2WIIB 1OCZB 4P3CH 3TN0D 3MRBB 4JM2A 1QFWM 4WKZA 3LYRA 3EF4A 3QJRB 3W5NA 1A5FH 5IJVB 4L4VE 5GZNC 5ECGA 4XGZA 4W68A 2I9TB 1JZJA 4HK3J 2QQKL 3C12A 5CJOH 1OE1A 1WIPA 2HKAA 2VN5A 4PJHB 4CN4A 3W1ZA 3TCLB 3HUJB 1E50A 1H3PL 5IB5A 1NM9A 1Q9KB 3TVMD 1QTSA 3OWEA 1P84K 3LKSA 1XGUB 4C47A 3MPCA 1A8ZA 4GMTH 4J3OF 4JMXA 1JNJA 5DZPA 2Z3FA 5DYOB 1TKWA 4W4OC 2FSEA 2P3YA 4KRPB 1UA7A 2V7HA 4JG9A 5IEKB 3N1PC 2HCZX 1EFQA 3H7BA 4EBQH 5CJXC 1H3GA 1G4RA 1OAQH 2IAMA 4AT6A 5A1AA 3UEZA 1FJ1B 3WO4B 2WCSA 1U8MB 4RFOH 5A2IH 1OARL 1R3KA 1VZGA 3K74B 5BRZD 2YHGA 4D9LH 4FQHB 3FK3A 1LDSA 3KDPB 4PJ5D 3PE9A 2GBTA 1DANU 4N5UA 3HIZA 5IJCC 1FVDB 1EANA 2G4GA 1L4IA 4OJFH 3KPLA 1SJMA 1SJHB 2FJHA 4PJEA 3CN2A 4M02A 4TMPA 3B9AA 4CJ0A 1COBA 5F0PB 5FGRA 2DWEA 1S8DB 3LQAC 3MRPB 4M5YH 2OMYA 2AEPH 4G9FB 3T04D 1JHLL 1E4WH 2EDYA 1HL9A 4KKCD 5ICZB 3MFFB 2F53A 3EYQC 4OF0A 2NXZB 4OKVB 4XTRD 5F96H 4HW6A 3NA9H 4AIZA 3D18B 5T33H 1JPGB 5CS7A 5GGQL 1INQA 1NUFA 1L5GA 3IJEB 1G7JB 2XTJB 2MWCA 5CN3A 2AQ2A 2OL3B 3E2HB 4HH9A 4L9LA 3OSVA 5TJWK 1T89C 4YDLC 1OD7A 4M5ZH 4YDKH 5IZ7A 1OCWL 1E6JH 4ZK8A 3MNZA 1NGYB 3X14B 3EH3B 2F5BL 4ZSOB 1UD8A 3I6LE 3FB8B 1JRHH 4HKZB 4LPVA 3PWPA 1A6UH 2V0AA 4F57H 5JNYA 4Y5XB 4YWGL 2GSGB 1XT5A 2ESVA 2XN0A 3CUPB 3DTXB 5FUZL 4DAGL 1GTFA 3ISRA 4KKLD 1AFVL 1IL1B 2J6EL 1MFCL 4Y19E 1D6VH 1VJSA 1KWKA 1IFRA 3QORC 4K55A 1UT9A 4KO7A 2FWUA 4PIRF 4TUJA 5SWSE 3B5GA 4H8VA 1E3FA 1AC6A 1OCRB 1ZHBB 5IOKA 4WSJA 4FNTA 3LRGA 5DZJA 3NJFA 3WFEL 2VIRB 1JVKA 2VXUL 5F93C 5FCUL 4G42B 2F7OA 5JO5B 3G5XA 2P46B 1SDYA 3ISWA 1RLBA 2ZXBA 5CLXA 3IPBA 1CBVL 4WU5B 1NMCC 5T1DL 3QUML 3O2WL 4TXVB 1DFBL 1IEHA 4BSVB 4JPIB 3SPVB 1I1AA 2L8AA 3N9GL 3QDMD 4L8BB 4YAQB 4YDMA 4XVTL 3AQZA 1WF5A 4E41E 4FZEH 4BUHA 1G87A 4YFLF 3ZDYB 2VDMB 4KXDA 4I5BB 2CQVA 4AVJA 2BIHA 3HB3B 4BDVA 4HS8H 1GY2A 5IT2H 3I6KA 3FF8A 3QDAA 5I16A 3QZLA 3L4UA 4Q6YA 2AQSA 5I6PA 4ADJA 4Y9FA 2E7CA 4PR5B 4XBEL 3OKMB 1GC1L 3A6OA 3D0VB 4RFEA 2Y7NA 2BVQA 2GJPA 4FQ1L 4MCYB 3SBPA 3WIHA 4P9HC 3LVTA 3GUTB 1J18A 3B7TA 4M00A 4UBDD 4Z7NB 2A77H 4XVOA 1QHOA 2XX0A 3PDGA 3N1FC 4HPOL 4JJ5B 4JHBA 1KMGA 3TBWB 1FC2D 4I1RA 2WWNA 1D5ZB 3ME0A 2FECI 1MZYA 1G6RL 2QQKH 1I1RA 1GSMA 3K6DA 4UYQA 3WHE1 3GBLA 4MX7A 1LO5A 3ESNA 5D7IA 4LEXH 3L81A 4R8WH 4UQ9A 4NLHA 1H3PH 5KVEL 1XB8A 3NFPB 4BA8A 2BS8A 2V37A 4U6YB 1JK9B 3IMUA 3NMEA 4XNZC 3BP7B 3WN6A 4HJ1A 2GITB 4MNGE 3ZMNA 3GSQB 2FIRT 4N28A 1BFSA 2PCFA 1R24A 1XL4A 3SBWC 4JZJB 1V7MH 2W88A 4JM2F 3WLBA 4WWNA 4BYHA 1BXUA 1JWSB 4I4WA 3RNKA 1LM8V 4JNXA 2Q2LA 1EDHA 3OJMB 1G7HA 1TTCA 2VMEA 2YEVB 4DUWA 4DW2L 3KYNB 2XBDA 3WFDL 3IS0X 2K6WA 2FL5A 1GS6X 1SYSA 4PRPA 2D9CA 3FHQA 1N9PA 1UB6B 4LHUB 1OARH 3P0YH 4QY8B 3T6ZA 3U9UB 3BWZA 5HHME 3KMDA 4QMEA 5DJ0B 1I7ZB 3ECUA 3F7KA 5IFJA 3UTSA 4AE1A 5ESQA 1LLAA 3Q2NA 1QHPA 3T1FA 4GSQA 2W5PA 3IGFA 1DVFA 3CSBA 2L7QA 1R17A 3V6BR 4NT6B 5B21A 4V1DE 4F9LC 1OF0A 1S7UA 5DHVB 1IAOB 1NTDA 5JW4R 5HYJB 1NGXA 3HBZA 5F88A 1JHLH 2ZUTA 3RPIB 3B2VL 5AW9B 3MFGB 1GJIA 4MXVF 5DK3A 3L7FA 3WLWD 5GGQH 3P3RA 3SQRA 2X40A 3BUBA 4XHQA 1GOHA 3NG5A 4HJJH 4KJPD 1KBPA 1AGEA 3ZT6A 1KIUB 3K6SA 3ETBF 3OPUA 1HINL 4PJ6A 3MV01 1URLA 4PJEF 4OVVA 1E9OA 2VLRB 1HHHB 2IH9A 3H2WA 1CICD 4JO8A 1FBIH 3AWEA 2ITDB 2BO0A 3EH1A 3QJVB 4KQ4L 4L8DA 2CRZA 4PY8J 1DUZA 3DO7A 2CJTA 5IESL 4YDJA 5HJ3B 5DMYA 2GI7A 5AW2B 2NUPA 4DAGH 5FUZH 3T77A 3DVNA 1Q9OA 1CB4A 2J6EH 1WZKA 2VDKL 4WTQA 5JR1H 2OAAA 3OR7B 3VRLE 4FHBD 1FVCB 1OKEA 3IMSA 3D69A 3MV9A 3IWUA 4HIIB 4DZ8B 1SBBA 3LD8C 1CGUA 4NEHB 1AQDA 1KB9K 2HRLA 4P4RB 3CN4A 4FGMA 1CYGA 4L3CB 2VXUH 5FCUH 3DOSA 4W9FC 3WFEH 4BV1A 1M9WA 4PJCE 5FGCE 1X7SA 2WLIA 1EQWA 3E0GA 1D6EA 2IFFL 4U1IB 4XWOC 5H8DA 4D94A 1CBVH 4AYEC 1CIUA 5T1DH 3QUMH 3O2WH 4KMQA 1DFBH 3EOYG 3ASOB 1HOCA 4JRLA 4KRLB 4L1DA 4MHHG 3GB7A 4ZODA 1AI1L 5A16B 3N9GH 5I71B 5DJ8A 1UFGA 2IPKA 4BQ9A 4N8VG 2K1MA 1FZKB 1QACA 2VL5B 1JPFA 2AXHA 3B5TA 1CE1L 2Y5QA 4NSKA 5D1ZB 5KVFL 4PBWD 5DJYA 1ZHKB 3MKGA 5AOKA 3G04B 5AALA 4LCYA 2DRUA 4MA7L 3LVEA 3CHXA 5I82A 1WAEA 5DVOA 2FBRA 4LPCA 2V4LA 2ZUVA 5EMYA 3BWUC 3SBQA 4UZUA 1F4AA 5E5UB 1AQMA 1GC1H 2A9CA 3BLKA 2ZXQA 4HKJA 4NZRL 4FQ1H 3TFKC 4NQDD 4S0SD 4N0UA 4A66A 3DMMA 2UXVA 3HS0C 1BD2A 1XO8A 4AGLA 1NWOA 2FEEI 1A9VA 1SLVA 1J8HE 1JV2B 4EI5A 5LQBH 4HPOH 3BUYB 2VWEE 3ZHDA 2IV9A 5C3IA 3QA3A 5I30H 1G6RH 1SOXA 1AQKL 4ZAKC 1FSKB 1M71A 1JE6A 2YD2A 3ROOA 3TZVA 5L0QC 2J8UB 5KVEH 5DC9B 1VLXA 4D7BA 4AH2A 1YYCA 3LZPA 2XVBA 3DURA 1B2YA 2ENYA 3ZE0F 5GZOA 4NDMB 2JKSA 1JWMB 3BWSA 4NQEA 2IALB 3R4RA 1U6AH 1DJIA 3PGFH 3GD1C 3JYBA 3QEQA 4PJBB 4ZUWB 1I4FB 4A6YL 1F3JA 2AF2A 5LGJA 4TNVK 1EV2E 4DW2H 1PBYA 3WFDH 1BJ8A 5D7IF 4ZMZA 1T7ZA 3VXSD 2LLLA 3D06A 2IGTA 4Z95L 2N7BA 4J8RA 5F1NA 1ZLWK 3RX9A 2VW7A 3U0TA 4TTDD 1EEYB 3EZJB 1GTNA 1U58B 4HWZB 3H9SD 4XT1C 4NM4L 3JV6A 5HGDB 1CF1A 2BIQA 2PPCA 4H8WL 3UZQA 5D2NB 2EIJB 4HIHA 1BIHA 2WW8A 3M8OH 3CFJB 4ZBJA 1FNAA 3IFNL 5DRXA 5IEHA 3TT3L 3HC3L 3HZYA 3B2VH 2VZ1A 3HHMA 4C55A 3O4LE 4LCIL 5KSAC 4Q52A 3CFDA 1ZS8A 5AW5B 1PG7L 5DRNB 3G6JA 3VXME 1T04B 2FK9A 3O6KL 3QVAA 5FFOA 4G8FA 5D7KE 2QVMA 1RIHL 5F7LB 3VXNB 3KGUA 5E5MB 3RY6A 4N24A 3IKCB 3RWJB 2BNRD 4MMXA 1UD6A 5D7LB 4LMQI 1KYFA 1MOEA 5E1IA 1KENL 3JV4A 3UACA 1T4KB 1ECZA 5I6NA 1OW0C 4MBOA 2JKLA 3GUFA 1DTUA 2CE6A 2VLJD 2Z31C 4AIOA 1XGQB 5IESH 5KYXA 3TNMB 1E9PA 2J55A 5D4IA 4C56B 5CGYC 5KSBE 4XXCC 3K72A 4XNXL 4NCC1 2X89D 4KVPA 3OR6A 1KUMA 4NZTL 5JW4Q 3ZZLA 2VSCA 2RA1A 2ZE0A 2MFNA 3D9AL 1BFOA 3MO1B 4OCLC 4GRWE 3P4MB 5AYTA 3CG8A 4LHQB 1G94A 5D55A 4EZKA 4G8EB 1USZA 3SDYL 1L6ZA 1S7QB 4PSRA 2G2RA 5HYFA 1D5IL 4BCYA 2PXYA 2X4RB 2NUTA 3VDBA 3CLWA 1FQ9C 1FPTL 2WAHA 3L1FA 2FB4L 4Y0GA 3L5JA 2X1PA 3L3OC 4XBPB 1YUHB 5C0IA 1PX4A 3E6HA 1L9PA 4QNPF 4KROC 1OCCB 2K6ZA 1KIPA 4FTDA 3VI4E 4J3TA 3QIUC 5AZEL 2F8VA 1E90A 1CE1H 1ZT4A 3EFOB 5EU5B 5KN5B 5KVFH 2VR8A 1YMMA 4WO4D 3IJ7A 5LAPA 4MA7H 3NA4A 2ZXGA 2Y24A 4OCYL 2V5RA 1KY7A 1NDTA 3QPXL 5C8JA 4NKMA 2X87A 4P2QE 1SBSL 3C5JA 3C60B 3MRJB 2HG5A 5JHAA 1TEGA 3FC8A 3LN4A 4FG2A 5GXBB 4PEEA 5CLWA 4ANVA 4NXKA 3OC5A 4M1GL 3LS4L 3D85D 4PJXE 4MA8L 5EZJB 1PZ5A 2C4FU 5HHVL 3LXBA 1DEDA 2MCAA 1IBYA 1Z9PA 2PWHA 4G8IA 2X1XR 4JFUA 1FFTB 2VLKA 3NZ8A 4M03A 2KZBA 4PTTB 4U3SB 1SLXA 4CGUB 2GEQA 1KSRA 1J1PL 3AC0A 3STLA 1Q0EA 1L6PA 2WSDA 5B7EA 4LCCB 5BS0A 3VAEA 4FMVA 4LIQE 1IGYA 5FOBB 4X9GA 1Z7JA 3DIFB 4UT7L 4A2DA 3NZHL 1NBYB 1BXXA 4Q6IB 3GJFK 3TGXA 1BBDH 2VDNL 5SX5K 1IO4C 3K4DA 4HU8A 1F5WA 5JHDB 3MLPA 2X4QA 3WXWH 1LTXA 3ARPA 2XWCA 3O9WC 4K23L 4NC1E 4OJYA 4KRPD 5C07E 1TTRA 1H3XA 1GS7A 2R2BB 2DJ4A 1DBJL 1USQA 5TDNA 3F64A 3KPNA 4G6ML 5DC4B 3BVNA 1MCQA 1FYTA 1H0DB 2OA9A 5HJDA 4WUUB 3EJQA 4W9GC 1EGJL 4BGLA 3LRSB 3MUY1 3GSRB 3HTLX 1F18A 4Z95H 1XZ0B 4NFBA 4ZUSA 2I24N 3UPRA 1MDTA 1UGNA 2NMSA 4N2HA 1R5VB 1Z5YD 3D08A 1OAJA 3GMLB 3UADA 3WIFB 5JHBA 4JBSA 4R4BB 1RUKL 4NM4H 2D3JA 4PWEA 4PLKD 5J11C 4OQTA 3LS5H 1VPOH 4KTYA 5CIPA 3TEXA 3ARDC 4G9FD 4I18A 4NHCH 1ZSDA 4PRIE 4GQRA 1FF5A 1WIUA 5MI0B 5AD0A 2E6QA 1P5UC 2NXZD 3OKEB 3OMAB 1W8NA 2VDPL 3TT3H 2JI3A 3PJSB 2JB6B 4OLZL 1RZKL 3NIGF 4MCNA 5CEYB 4R4ND 3CPUA 3NSCA 1ILUA 5F6IB 2JJUA 2XTJD 3LKPA 3MRIB 2BZ7A 4XHJD 1GGTA 1PG7H 1TNMA 4K94L 2DM4A 5JXED 3KGTA 3CLEL 3UBXG 1MHHA 2V2XB 2BY1A 4ABVA 4JG0L 3SGJC 3ATDA 4V11A 1TJHL 2QGCA 5CD3A 2BPBA 3GF8A 2C7FA 4OJEH 1IGCL 4XPHL 1F86A 5HVFB 1KENH 3TBTA 3WAKA 5TQ0L 4QT5A 1TQBB 4F5CA 1FV1A 1KJVA 5JW5B 1UC6A 3UCRA 1C8QA 2Z92A 4MA1C 1LWRA 1HQRA 3A4EA 2NR6D 4BK5A 2EXYC 3SDAB 1KBWA 5I9QB 1RUQL 3MRQB 1HL5A 4JE0A 4NZTH 4ZFOL 3G6JF 2HTKD 4GPVA 4PB9L 3D9AH 2WKLA 4FNUA 4OU3A 5JUEH 4M56A 3BZFB 2FTAA 5TGBB 3SDYH 1CMOA 3EJYC 2F0CA 3PL6A 1EHKB 1D5IH 2DQJL 3MOAL 1F00I 3QUZA 1LEIA 2JVUA 5HJGA 1CL7L 2XICA 3DYMA 1NKRA 4LP4A 4X6CA 2WTOA 4FNLL 3SKNB 1FPTH 5IIEB 4JLRA 5CR1A 1Y1UA 3CFCH 3TIDA 5IKCB 2Y07H 3D39D 5I28A 2P5WB 5AOIA 3GWJA 1YN6B 3PG2A 4O58H 4PV8B 4ODXA 3HG1E 5CLZA 4U6XA 1MLCA 5CLTA 2EDBA 1Q4NX 5JIDA 2EO7A 1B3JA 4FL4B 1TYRA 2MOVA 1IARB 4E9QA 5CILL 5IBUB 2WM0A 2H1PL 2FDBP 4F93B 4K7PY 5E6IC 1RP8A 3DUHA 3WTXA 2W91A 3I9GL 3IJYB 4NENA 4OCYH 3NJNA 1ACCA 1YEHL 4U4IA 4O02A 4Z7UB 2Z7ZA 3RWCA 3QPXH 4GQQA 3PP4H 4HUWB 3JWOH 4HOXA 5MHSD 2L7EA 5DEFA 4LMQE 1PFCA 4JRXE 2RALA 2WLMA 3VUAA 4A37A 4NKIL 4M1GH 4CU6A 4Z7OE 2R9HC 1BZ9B 2Q7NA 4MA8H 1QLFA 3D25B 2ZKXA 1M1XB 4QHMA 5HHVH 1A7QH 3F2LA 3S0PA 2ATKB 3WI9A 1NDMA 2HFGH 5FECA 3FO0H 2C9QA 2DDQL 3CXHJ 4KHXL 1KCWA 3US0A 4YSSA 4MKMA 4HULB 2ICWI 5B1JA 4PJGE 3UABA 1AIFB 1UM5L 4XMPL 1G0YR 1QBMH 2IOMA 1HC1A 4GI6A 3D12B 2VDQB 4B9GA 3ES6A 5TF1L 3VYPA 1EEZB 3IDMA 4UT7H 3RB7A 3VWKB 3KDMB 2VDNH 3MROA 3L7EA 1GOFA 1E2VA 1KJ2B 4V2BA 1VCAA 4K23H 5I6XB 3SGDI 2EDMA 1WS7A 5K59F 5T1JA 1DBJH 2XZQL 3EBAA 1R5IB 3WOVA 1JZ2A 5AW3B 1NFIA 2R1YA 4KI5E 3ULVE 1TVHB 4U2YA 1G6RA 4G6MH 4JFEE 3RPBA 3GZPA 1E5CA 4LLDB 5E70A 3U6XS 5HYSB 1GZHC 1EGJH 1UOLA 2XRAH 4JRYA 1S7SA 4LHUD 3TYFA 2ZWSA 5T1KA 4F9PC 3NT0A 1VSCA 2C1OB 4MDIA 1HAUA 2GBVA 4YZFE 4JG1H 1ZPLA 2PP8A 4NO3A 1BBJB 1I1YA 3CFBA 3NCYP 4N8VA 5EF0A 1LP9B 2DM2A 2OCCB 1S7VA 3MJ9L 4PJ9A 3K6IA 4G1EA 5D70H 1VFAB 1VENA 5J1AB 1RUKH 4WW1B 3F8UB 5GRVK 4N8CH 1Y0LA 5HYJD 4ETQB 1A0QH 3VFNB 2R59A 1CYXA 1SMDA 5DT1H 1BQHG 3GRBA 4I13B 2PR4L 3U9PH 1NIAA 1F6AA 2YGVA 3NSYA 1ONQB 5DJXA 1M9SA 5I6LA 2E6PA 4H26B 1A7OL 1CCZA 1EJOL 2R29A 3ZSSA 1RZKH 3KJ4C 4CNIA 4KK8D 5DMGD 4R2GC 4QYOB 4EZLA 5IP4A 2JCCA 4K94H 4Y16A 3QQ4B 1CT8B 1M7DB 2H2SC 3ZU8A 4OIFA 4DESA 3TM6A 2VLRD 4PRHE 1X5KA 4JFDE 4MJIA 4JG0H 3KPOB 4X6FA 4P04A 1TJHH 4XNUL 2RQEA 2A9ML 1IGCH 2P7TB 1FVEB 4IBZA 4XPHH 1A6ZA 3D87B 3FFOA 5HHOD 2AXFA 4M3KB 2XQBL 4GG6A 4W6XB 5C0AB 1Q9WB 3GM8A 3HHSA 3P9MA 5TQ0H 1U8JB 1NBQA 4BWTA 4MTMA 2Q9OA 4HUNB 3QULA 3FRPG 1PY0A 3U0WL 5E8OA 1X5LA 2HX7A 4ODUB 4JM0A 3WTVA 1OB1B 3B3IB 5A3ID 3D52A 4PB9H 3FO9B 4O5LH 5F7MC 3G6AB 3OXSB 3BOVA 4AIEA 3NJIA 1X9LA 4UF7C 1EH9A 3WHXB 2PO6B 5IFAL 2F5AL 4JPQA 1V05A 2AITA 4WFED 3KS0H 4AUJA 1L7IH 3V52L 3MOAH 2BNQD 1CL7H 1B4JL 2OBGA 1IEBB 2DMBA 2EP6A 4FNLH 1NCNA 1PF3A 3B2UD 2Q3XA 4L0YA 2J71A 3MSPA 3KYMB 4JUTA 3HRZB 2Q6WA 1PKQE 2X42A 3GXMA 3N5AA 3O8XA 4DCQB 3SE8L 3F12A 4Y8DC 3P11L 2NT1A 4DNLA 2HT2D 5D1ZD 4A68A 1VFUA 4MQXC 4X5XB 1MCRA 2DQIH 4EI6A 4FJYA 4HZLB 3HLAA 5LO7A 5FO8A 3GSVB 5CILH 1KFAL 5I1IL 2EE0A 2H1PH 4GP8B 1DQML 2PTVA 4U0QB 3I9GH 1KTCA 4X6CF 4YBQC 5BRZA 4YDNA 1LVEA 4GAYB 1YY8A 2BVUA 5I76A 5SWZB 2F2HA 3L95A 5FYJU 4WI0B 1CXHA 3HNVH 2GCYA 2ZG1A 2OK0H 1N59A 4NKIH 3PHSA 3TS8A 1BM3L 4J2XA 2ICEC 5KBNC 3RTQB 2CGZA 2KQNA 3DGGB 2AI0L 2BP0B 4FI8A 4RNRA 4U1KB 1JWUA 2NXYB 2DDQH 3SJVE 43CAB 4KHXH 1UFUA 5HHPB 2MQCA 3C9NA 3UMTA 4PM1A 1QYGL 1UM5H 4JO4L 1NFDB 4X6DE 4WW2B 4BCZA 1S5IL 4AE0A 1A1MA 1JGIA 3LEXA 4UM8B 1EAQA 1VZHA 2AJYL 3QJFA 4DN3L 1XH1A 1V8HA 4ILDA 1BLNB 2OR9L 4UU9A 2F1BA 5CP7B 1TQVA 4WF7A 5EUKA 1JOIA 3QEUA 4XPTL 4LDLB 4R84A 2EYSB 1XCWA 3GZOA 2XZQH 3B4NA 4N4YB 4BEIA 2NNAA 5I66A 1S7XA 1DQKA 1LMIA 2DQFA 3FH8A 5SV4A 3IE9A 4QXUH 2WYHA 1LK3L 2X0WA 3U2SA 5D6DC 1UOKA 1BECA 4XPBL 3V9EA 2NX5A 3RI5F 1U4EA 3V5DA 4MD0A 2EKJA 3MJ9H 3PWUB 4AEEA 4PJ7E 4N5ED 1SRDA 4G2AA 2XV3A 1JPSH 4W9CC 1XGRB 5HHNA 4AYFB 3DK0A 1MY7A 4WDIB 4Z7VE 3VTTA 2PW2B 3QUYC 1WAAE 1RMFL 4GG8A 1GPOH 3LEYL 1UVQB 4LDEB 1SY6L 2PR4H 5CF3A 1PVHA 2K78A 1E28B 1N6UA 1GJUA 5E9DA 5KS9A 5MEPA 5D93C 4DO6A 4F33A 1QO3B 3QWOA 1A7OH 3RHWF 2DD8H 4OD2B 2WNWA 3P73B 3ZW3A 4RX4D 5ENWB 3JWNC 4F91B 3REVB 3MCLL 3BRFA 1ASPA 4DUXA 4HJGA 1U3HC 5D5MA 3PHOB 2Q3ZA 3AUVA 4FQXB 1ZLVK 4ZQKB 3WTTA 1IBBA 1U4FA 4XNUH 4BUQA 2A9MH 3UTZA 3TFBA 1M4KA 1C16B 2XQBH 5C08B 1TZOA 4G70B 3ZTJG 3AG4B 3MVSA 4C56D 1HJCA 3OLDA 4A2GA 4Y4KA 4YDLB 3U0WH 3VFWB 1AGDB 2WXLA 3T3PF 4X4ZA 4IGBB 3U9WA 3IN0A 4HQQH 3RP1A 4E9LA 3OGOE 2R23A 3GGWA 1AO7B 3MLTA 4L3FA 5J6GA 2B15A 4QRRB 2ED9A 5EIVA 4JFFE 3BZ5A 4W9IC 3LY6A 1H15A 5IFAH 1ZRUA 1F8TL 4GG6F 3V52H 1DQVA 4AYGA 1B4JH 1SUJA 2IDFA 3FSVA 3IPFA 4WWOA 5L7XL 4XZUB 3VFTA 4NNYB 1FNSL 1T7YA 2YAMA 1MEXL 2JQAA 1SXCA 4DGWC 4CL7A 4MZRA 2ZP0T 4LIQL 1K4DA 4X8JA 3SE8H 1AHWC 1AD9A 3P11H 3J27A 2WNGA 4R6UA 5IUCA 2AV7A 2JI2A 3P02A 2HUEA 5JTWA 3FUDA 4F27A 1KFAH 1NMCB 3T4YA 3JT2A 5DVPA 1OWRM 4X80H 1DQMH 1U93B 2H9GA 1T0OA 2YGPA 4LLYA 4Q56A 4K0OA 1RUPL 3FB7B 3VH8G 4FA7B 3Q01A 4TLKA 1YEJL 2FO8A 3CDZA 5JIHA 3IDJA 3GI9L 1D5XB 1ERNA 4NQCD 1XR9A 5E00B 4YXHL 4FN0A 4GO9A 5I1HL 3M1OA 3LKOA 2EDDA 3BP5B 1ACZA 2CMRL 4QHNA 2AI0H 3CX5K 4GRLA 4ACTA 1BIIA 2APFA 3FTSA 4HLZH 2LU5A 4MZ2A 5DJCA 5DK0A 4WI6A 4OLXL 3QJHB 1IQWH 1J0HA 4FEIA 4XVJL 1UJ3A 4MWFA 4H0IA 4XPGL 1QYGH 4G8GB 3A47A 3RVXC 3FQTA 4Z7AA 5B38G 1S5IH 5F9JA 1TSRA 5CMAB 1VKXA 1OV8A 5F8QC 1A6VL 5EIIB 5JHDD 4DN3H 2AJYH 2X9ZA 3J8F7 4H0LC 1KNOB 2VXVL 4POYA 2OR9H 5GGRB 4XPTH 4DT2A 4PP2A 4CADA 3FH7A 2AQPA 1AD0A 2KKQA 1BDYA 5D8JH 1XL6A 2D31B 1AS8A 2BVPB 4WUUD 4FFVD 4L29A 3IMWA 2RIKA 5EU6B 5CSZA 5G5DA 4GW4B 3GZKA 4P5RA 3PDOB 4TUOB 2Q3AA 5CU5A 4Q4IA 1A64A 1RJZB 1LJMA 3IWVA 3IU3A 3S36L 1OY3B 2WUCH 2NY7H 1A3LL 1RURL 5GGUB 4MS8D 4XPBH 1BWWA 2VC2H 1B6DA 1WD9A 4J4PD 4HWBL 2Q20A 1AGCB 4UZSA 2ITCB 5E99L 1IVTA 5DD5L 1U8OB 4N87A 5F7WC 1WZMA 5FKPB 2YZ8A 4E9WA 4C83B 2HN7B 5CJQL 1WE5A 1P5VB 4GRWH 1CZ8L 2G75B 4XMTA 3STZB 4LDOB 4Q8BA 3WUWB 4LHUG 2P49B 3LEYH 1ETA1 2XWRA 4PLJC 3MGTB 5CFHA 1T7VA 1P53A 3F7VA 4M6NH 1YVLA 2DJMA 5FM4A 5CEXB 1NMBH 3NTCL 3U7AA 5IB4B 5E6UB 5F89B 4QAMB 2IQAB 3ARXA 4FCHA 3EYOA 4B9KC 4Y19A 1OSPL 3MCLH 5DURD 2YD1A 3KPMA 4O51A 2GIYA 1DVFC 4XP1L 4QOKB 5B3SB 3QHFH 1XF3B 2IWGA 2PYEB 4GBXB 3FQ1A 4PCSA 4TM9A 5I1CL 5IV2B 2JELL 4KBPA 5KS9F 5LNEA 4KTGA 1IJNA 5HD8D 3SDAD 4I0PB 4PY7A 1EHXA 1J9SA 3S35L 2G0KA 3SKMA 5C3LD 5C71A 4LGSB 4UCFA 2NDFA 2X05A 5DEJA 4RRPA 3GXUB 4F7EB 1BF2A 1PNCA 2JTYA 3BN3B 4ODSL 5D5MF 4E41A 3GMRB 4XB8A 3P4NA 2YGOA 2ZAHA 4Q0XL 1ZA6B 5ISZA 3I85A 1ADQL 4FTVE 2B8OT 3E6FB 2V2TA 3EHBC 4EIGB 1U2YA 1F8TH 1XDTT 1NM4A 3O45B 1AJ7H 1RXLA 1W0YT 2CUMA 3M7FB 2P26A 2X4NB 3EOAB 5ANME 1ET7A 5CFAA 5L7XH 1N4XL 3F3HA 1FNSH 1ZD6A 4DGUA 5I5IA 3QYMA 1MEXH 4TULL 3CFKB 4NGHL 2ZOWA 2EADA 1YYLL 3AU1A 4LIQH 4YLCA 5I2IA 1G7MB 1NGZB 4AGQA 5FXCH 3HBQA 1R5WA 4CU7A 3OF6D 1UUNA 5L4FA 3FPYA 4CVUA 3RX7A 1NFAA 2H0PA 1BQHA 3GKWL 1ZMYA 1F45A 3ULVL 2IXQB 3BIKB 3VG0L 3QHTC 1T0NB 1N3NB 3G08A 5FB8B 1X9RA 4LSTL 3JUYA 1CDUA 4NRYB 2E7DA 5I1EH 3U4AA 3C5ZA 4YXHH 4H13C 5I1HH 1MLBA 1JNLL 3FTYA 4PWHA 4XNBA 1SFDA 3QQ3B 4BA0A 1N0LB 3IDGB 1K2DA 2D3NA 2CMRH 5DA4A 1N7ML 4OLYH 3MR9A 1IKNA 3TBBA 3KZ8A 1IV8A 1DJYA 2IBBA 3BKCL 2WLZA 4KJWC 5DO8A 1E5ZA 4WHYH 3KWVA 4OLXH 2VH5L 5DI8B 4XVJH 2BOCA 4XPGH 1G84A 1OEZW 3L5HA 2JKJA 1A3RL 3HS0B 4QI3A 4UAOC 3FJTA 3VWKD 1OAKL 3DVGA 3FRPA 3DX8B 1A6VH 4YLBA 5IJKC 4W6YB 3ULSA 1JYWA 2VXVH 3TO2B 2W65A 3IGAB 3KM1A 1YG9A 3MA7A 3MLVL 3PNWA 2F7IA 4ZAKB 3MMEA 3Q1EA 1M05A 1N26A 3WFCL 2NNRA 4R7VA 5FX3A 2YD6A 4LLMA 5L0QB 1OLLA 5EC1B 2IWFA 1NC2A 2WYTA 4V1DA 3DX6B 4OKDA 2OX5B 4PW3A 2J12B 4DPAX 4Y88A 5D2LE 1QX1A 2CBOA 3RBSA 2BK8A 1TIUA 3EDJA 3UTPD 4I1NB 2X89A 4QTFA 3HZ3A 4W70A 3U6RA 1G1YA 2X7LB 4X9FA 1KJMA 3OVUB 3S36H 3GBNL 3TZVC 1RZJL 2LW3A 4U1LB 1J9QA 1HEHC 1A25A 1LDPL 5HDRA 1CXFA 4HWBH 3ABLB 1U92A 4H1LB 5DD5H 2XN9E 2XG5B 5CSGA 5CJQH 3BXNA 4OGAD 1CZ8H 3LIZL 3UMNA 3WDIA 1CBJA 1PZDA 3SE4A 1FNLA 1U95B 3C5SB 3IFOA 4QHPA 2V33A 1ZE3H 5D1XE 1IRAY 2FNBA 3QAZC 1NC4B 3MBED 3NTCH 5EFIA 3UJIL 4NN5C 3S2AA 3NDYE 4P2CG 2X0VA 1MWAL 3F05A 1OSPH 2JK5B 2R2HB 2X70B 2ZX7A 3QJSB 3RIKA 3IAPA 4XI5C 4WCYL 3IVKA 1RAMA 5ACZA 5FUOL 4AGMA 4MDJB 1I3UA 3ARBC 2VM4A 4ZMVA 2BFVL 2PP9A 4XP1H 3AY2A 1ACXA 3VXUE 3RWIB 1SN5A 3VXRB 1KB5L 1LE5A 2NY2B 1E27A 5HTSA 3V6ZB 3EJRA 1WHOA 1ZVSB 4M62L 1ES0A 4N3TA 4PJCA 4TL4A 2ZWYA 1RZFH 2H26B 5CD5C 4IRSD 5FYLE 1DP0A 3PPSA 3ZIMA 2APWA 2XFXB 2WIIA 3D85A 4WHTA 3MRBA 2ARJA 3ZTCC 3S35H 4W9HC 1H8NA 4EUPG 3NZSA 5DQJA 2CRYA 1UD3A 4LSRL 3VFOA 1UM4L 4AM0B 3VD9A 4AK1A 4ODSH 1CF8L 4QXTB 5C1MB 4Y2DA 4MCZA 3EO1A 2Z0UA 2EICA 2PO6D 1NQBA 4JL1A 4OF5A 2Z31B 3X11A 4PH8A 4Q0XH 4PCTA 1ADQH 3VFGL 2P44B 1RLWA 4WJ5A 4F7CA 3P3UA 3WYRA 4UQ3A 4MMXC 3BP4A 5GS0D 2QDVA 4WZ9A 3KXFE 4OGYL 1T2JA 2V2WB 4I48A 1NAMA 1OGAB 1KCSL 4P2OA 2FLMA 3OKNB 2EH7L 5AKTA 5JW3L 1A14L 5IW1B 2D2OA 3LHAA 1XWVA 4G80A 5F7UA 1L6XA 4RMVA 4JFOB 4NGHH 4TULH 2EYTB 4GI9A 4U1SA 5D1QD 4NQDE 4WI5A 3S5LB 1LNUB 2JJVA 3WDJA 4DVBB 3ZIYA 2AHIA 1WUZA 4YHNA 3DI3B 4X5LA 3G5WA 4Y5YA 3ECVA 2DQCL 4HJTA 4P05A 5T3XD 1VFBB 1TEFA 3H42H 1FJ1A 3IN2A 2N56A 1CFNA 5GIRA 3UAAA 4J23A 3NCYS 1W16A 1I85A 3ULVH 2YRLA 5SWZD 3VG0H 3TBSB 3WNJA 3IBOA 4LSTH 3VRJB 2OSLB 2ZOLB 4Z3IA 3CDYA 4GKNA 3BEVA 4M1CC 1TLKA 3VB9A 4QRTA 5DFWH 1JNLH 4YS4A 4POZC 1HQ4A 4PJ8D 4WI8A 3CH1A 3IPEA 4FQJL 2R27A 4JR9L 1N7MH 4HLEA 2NXYD 1OF2A 1JI1A 4HS3B 3KG5A 3BKCH 3MFFA 4YGVB 3AG1B 1KLFB 4NKDB 8PAZA 3FQ2A 2VH5H 4TVPE 4HGKC 4NQXB 4GKLA 3T08A 1G7JA 1O7SA 1XSIA 4R26L 4IS6B 3UAFA 3IGLA 3OB8A 2WOBA 5JXEA 3W39A 2HFEB 3ASWA 4TPRL 3PCYA 3X14A 1WZLA 1KTKE 2NRDA 3B9KA 3ECBB 4HK0A 4HMCA 1U42A 3H9SE 4PU2A 1SNRA 4UQ2A 5B1KA 1TPXB 4DP0X 2J73A 5KSUB 3MLVH 3I02B 3ZYZA 4A2HA 5LN8A 1XTLA 4HKZA 5DO2C 1S5HB 1T5KA 2KDGA 3WFCH 3IU4L 1LK2A 1BZ7B 1Z1WA 4OY9A 3N06B 4G43B 4NFDA 4UQAA 4M3JA 3GS0A 1GRWA 2UYLA 1IL1A 4AWJC 2BVOB 1GHFL 4GKZA 1NA8A 4Y4HB 2PR9A 3O9WB 3RKDC 1KPVB 3MV7E 5J13C 5ITBL 1DE4A 2EVJA 1XV8A 3GBNH 1P4IL 2MH4A 2MKWA 2OMWB 3BQUC 3EIFA 4H8PA 3ILQD 4ABQA 4H2CA 5TE6L 4NHUB 4Q97A 2OSWA 4PGEB 2VIRA 3VXMA 3MZTA 1EEUA 3LDBC 1CDJA 4RRPM 3HG4A 1TETH 1ML0A 3IETA 3OAYH 4GQ9L 3WKQA 2YAOA 4CC0A 1Q1PA 3U79A 4A2LA 1M7IB 2FJSA 4PWIA 3VH8A 3D39A 4QAWA 3T8XA 1CD1B 4HJEA 2BMKA 2RAMA 1W6LA 4WWKA 5GQBA 4BKTC 3QB7C 3UJIH 5J11B 3OAZK 3NQKA 3BH4A 1ZVNA 2HPOA 1DHKA 2G3NA 3WFHB 1INDL 1MWAH 1UXSB 1QTPA 3NIFB 4NXSA 4FQXD 5H37G 4WCYH 4I3RL 3FTWA 3EYQD 1UH3A 5FUOH 2DLEA 4BQ6A 3PNRB 2V3EA 4P99A 2YBGA 3SGKA 5EOCL 4EDXA 4B5ZA 3CC1A 1PGRB 5C08D 2WWKO 4XPAH 3TO4B 1GGCL 3FQ4A 1KB5H 5IR1B 2CPUA 4ZUVB 4M62H 2PWFA 5B38A 1JI2A 3TBVA 3F6IA 3FSOA 5D7JA 3S96B 3QRLA 3CU1A 4IGBD 1BVKA 3WE6A 3GXTA 4JJ5A 3GHEL 1OM3H 4LSRH 1AO7D 1UM4H 2OCJA 3VRLF 4HOMA 3QDHA 1XD0A 3DX2A 4QRRD 1WISA 4UIMB 5AOMA 2JKRM 1CF8H 1FL3B 3SDDC 3V0AC 3HNSL 5FO7A 3VI4A 1ORSB 1KTRL 1HHIB 3RB5A 2Y69B 4O2FA 3KYOB 3NFSL 4MA1B 2J2ZA 3AJ7A 4NUQA 3SCMB 3VFGH 4ODTL 2OJ1A 2W1NA 5IBTL 1XH3B 4UB0H 5K9KB 4N8PA 5JW3H 1A14H 1G0DA 4Z9KB 4EN3A 3OQRA 2AEQL 4ZT1A 4N6RA 4BK5C 4OFIA 3GMPB 5AL8A 1RPQA 1HFUA 2DQCH 4GUCA 3KYNA 1UKTA 2OI9C 2DBJA 2IMMA 3KEHA 2FYYA 1UB5B 1UB6A 4LHUA 4PJHE 3EBIA 2PPAA 5IUSA 4XOBA 5I8KL 4HUXA 1TTUA 4TQ8A 2FVNA 3V0JA 1I7ZA 3QUZC 3CMGA 1BFTA 2Y0SA 5ICXB 4XBGA 2VZ3A 4U1MB 4LNRA 1QSFB 4NOFA 3K3QA 3HRPA 3HG5A 1IC7H 4AQEA 4YX2L 3IJ9A 2UV3A 5AYQA 4DP8X 5IB1A 4JHVA 5IBUG 1YZZA 5E6IB 5ESAA 5HYJA 4JR9H 5DHXB 3AS2A 4L37B 5BJTB 3PY9A 3W9DB 2EINB 2Y1ZA 1Q0XL 4G8GD 3VVWA 3HHRB 3VSVA 4EO5A 4OZIB 2NY6C 4R26H 3GSWA 3MV8B 3N41B 4B7LA 3ULUD 2GJZB 1FZMA 1UWEL 4MB5A 4XXDB 2VUYA 4BH8A 4YK4B 5IVZA 4TPRH 3FYEB 3OHXC 3AROA 4R5XA 2YEQA 1U91B 3BPCA 4OV6F 4ZFZA 2ITEA 1UWYA 3QFJB 5HHOA 3GC3A 4KX7A 4B6ZA 1I8MA 4GUQA 5A2LH 3IU4H 4QUOA 2JQZA 1SN0A 5EU6D 1D5MB 4X6BB 5D71L 5LGYA 1CI3M 5EN2B 4JKKA 1B0RB 1J9CT 4X98A 4Y1AB 4PRIA 4ZMNA 1RZ8A 2G5UA 4XWGL 3PWVB 3DXAB 2YUVA 3SGDH 1U8QA 3FZUC 4DZ8A 4FERA 1IFHL 1MWOA 3R06A 1GC1C 1XVSA 3CVHH 1P4IH 4FQLL 2PW1A 4JFYB 2ZICA 4YHOL 3U2JA 4E5XB 1H9DA 4LSQL 2BVYA 4P4RA 4EZMA 3MRNA 1XEDA 5KBPA 4PJAE 2WBJB 3JWDH 1MCJA 4JQVC 2VXQL 2EDOA 1RPKA 2BNQA 3X1BA 4ZSOE 2IDCA 2XPGB 4GQ9H 5BZXA 3ZQ9A 1RJCA 5AZUA 4J6IA 4RIRA 2RBLA 5A16A 2WVTA 5F1IA 1NPNA 3V95A 1DYZA 1AKPA 3IFPA 1PJWA 1ZGLA 2X12A 1QR4A 2JTDA 3VNYA 4O2CA 4R4FL 5T1MA 4YN3A 4GT0A 3FMGH 3NCFB 4JQXC 1UYWL 1INDH 4HWBA 5JZ7D 3G04A 1SM3L 2EIKB 4A7SA 5DJAA 3HN5A 4QOKD 3ZHKA 4PG2A 4ZDHB 2NLJA 5DMKB 4P46C 2CKBL 2OPCA 2PYED 1D5RA 2A0LC 4PJDE 4NO0A 1FZOB 5EWIH 1GGCH 1BM7A 3C6LB 3HAEH 2BSED 2G9HB 2EABA 4G1MB 4IMKC 4NCDA 5JMOC 1KCKA 3VFSB 4I0PD 3BYTA 2X28A 3PV6B 4P3DA 2AKRA 3P54A 4RMSA 1K9TA 3BUYA 4WFFD 3ZDYE 3KBHE 4OD1L 2ZYIA 2QQNL 1WEJL 1TCRB 5D7SL 4OSUL 3HNSH 3IFLL 4HUUA 1NCUA 4JAMA 4AG4L 3QDGB 1MG2C 2BDNH 1K85A 1OLZA 3NFSH 3S34L 1N6VA 1HKFA 3WAJA 2OJZL 2XXMB 3LKRA 4DQOL 1SDDA 2JJTC 4ODTH 3QCTL 5C0DA 1CWVA 4PBXA 5I74B 3GDCA 1I8KA 3POCA 4KGJA 1NEZB 2LTQB 4M6MH 1YNKL 2EDFA 2EXSA 1JXGA 3D51A 4NDMA 1KIQA 2E7LC 2EYRA 4F7PA 3N0AA 3C6SB 4GRMA 4OJCA 3HE7B 4H25B 2YXVA 5CGBA 2AEQH 4Z7NE 1MVUB 2EIMB 1QSZA 4ZUWA 3L3KB 1I4FA 2FJGB 2IBZX 1PU0A 1HWGB 4XWOD 1UXMA 1IGJA 3VI4F 3MRFA 1PZ2A 2B1AL 1WV7T 1ZHNB 1HXYA 4JQIL 4IJ3C 2CNZA 1FG2A 2YBRB 4U1NB 5GJTL 3RUGB 1CURA 4HCGA 1MVFA 3FOLA 3W56A 3OKLB 4FDWA 5I8KH 4UTAL 4PJGA 3H9ZA 1RP9A 4ONHB 2CO6B 4R97B 5DJDA 5JDJA 4MJJA 1VACA 4JO2L 2VJ0A 3PGDA 4PCKA 5EOCJ 1A4JB 5SV3A 1WAPA 4XNMA 5C6WH 1DL7L 4BZ2H 2A38A 2VQTA 4BFNA 3O8XC 3W0WB 5F7NC 1GW0A 3DX3A 4FD0A 1IBGL 4JFWA 4NLAA 4IU2A 4XNAA 1IKOP 2YSTA 4CC4C 5E5LA 1YMHB 3MRMA 1QABA 5T3ZE 3TFKD 2W0FA 3HR6A 3LQMA 2ID5A 2H0JA 4OI8A 5E4IA 2YKKA 1UGKA 4GO8A 4P4KC 3DVIA 2ICEB 2P24B 5FFGA 3T8VA 4B60A 5E8EA 5I23A 4HSCX 3FW6A 4NRZB 3L5WB 4EUPA 3RWJA 3T6XA 4U1JA 3KH4A 5E0QA 4Z3JA 2CHXA 5CJ5A 1GZPA 4ZAKD 4GW5A 3MUZ1 1YDPA 2TRYA 1SXZA 4HC1L 3B34A 2NW2B 4OAWA 1GGBL 1ZTXE 4GXFA 4LK4A 5I0WA 1KYOK 4C56A 3QG6A 1URIA 3BAJA 2CR0A 2CDEA 3OX8B 3UX9B 4AYSA 3A6BL 3T3MF 4AEHL 1X5HA 4XWGH 4NQVA 1BSIA 3RE0A 4AYID 5IB3B 4WGWB 1IFHH 3QUKA 5DVMA 3D05A 1MCNA 1JZ6A 3QIWC 3KLHC 3CDCA 3WFZA 2ZSWB 4FQLH 4JM2B 5B3JE 4WKZB 1D7CA 5DYFA 4NM8L 4ESKA 4LT7A 4RDBA 2HT4C 3S97C 3VFMA 1MXDA 1JZ8A 4XGZB 2X4RA 2XLLA 4RBPH 5HI5C 5I18L 1ZANL 2CLZB 2IJ0C 1QFHA 4CMHC 4PRHA 2CPCA 5AW7B 2GHWB 3BCFA 3T0EA 5IB5B 4OCWL 4C4BA 3LKSB 5HYEA 1NC4D 3MOBL 3RWGA 4E42A 4MQTB 4MXQD 1TKWB 3EFOA 3O81A 4R4FH 5KN5A 1ETZA 2YIHA 1AZZC 3CXFA 2CK2A 1JGEA 1UYWH 4OZFG 2IDQA 2KHAA 5LHDA 4HVBA 1SM3H 2PWDA 2AQRA 3H7BB 3NJGA 4OR1A 2MIZA 1PZAA 2NQDA 1IM3A 2IAMB 1IBZA 4Y5VA 5D93B 5HJBA 4AT6B 3IKKA 2X9XA 3BSGA 4WFEE 5E1AA 2CKBH 3VXRD 4PRAA 2NY2D 1IAIL 2HJFA 1NLBL 1NCWL 4OF6A 3MRLB 2VNCA 4NQCA 1BQRA 2EE3A 4FAAB 2VO5A 4LSUH 3V8OA 4NN6C 3W2DH 3KPLB 3HJ0A 1CDGA 4NP4H 3ZLQC 3QR2A 4UNTA 2V9UA 4PTTA 1PKQA 2J4WL 2NT0A 3DNKA 1IVLA 4PJEB 4YFDB 3TWYA 3UDWA 4KXZH 2V5MA 2DWEB 4KI1A 4OD1H 4UWQB 5C9JA 2QQNH 1WEJH 2Z31D 3QZBA 3MA9L 4OSUH 2OMYB 5D7SH 5J12B 3IFLH 4LCCA 3CHPA 4J1UA 4AG4H 4YSUA 4OZHE 1KDIA 1UKSA 3O3BA 3S34H 4H8WC 4MAYC 2OJZH 4DQOH 2P5EE 1KB5A 3DIFA 4P07A 2G4EA 1OGAD 1RHFA 3QCTH 4AIZB 2YA1A 3JYCA 5JHDA 4M7JL 4R90H 4YBLC 1PL3A 1INQB 1YNKH 4TVPL 1L5GB 2EAEA 2CM5A 4X42A 3WXVL 2BWQA 4HH9B 3IJHA 3HN3A 4L9LB 1B9ZA 2H47C 4GEIA 5IBLD 3CXHK 3PU7A 1IKFL 2A73A 3FFCB 3MNZB 3QR0A 3U4EA 2B1AH 4OUUA 1GKOA 4JQIH 2CR3A 3ETTA 2ZNWA 4HG4J 3LRSA 3BP6A 3O2DL 3PWPB 5JNYB 4AGNA 3MLZL 4KKRA 2ESVB 2IQ9L 1EO8L 2E59A 3SJVA 1CN4A 3T0BA 3D0LA 2YUWA 1JV5B 2CD0A 4M93B 4UTAH 3U25A 4X6DA 3LQAH 1UASA 3KE0A 15C8L 4TUJB 5JPNC 5AWNL 4JREC 3U7WL 1DL7H 2XNAA 2G2NA 3N42B 5H37A 2IADB 4DK6A 1SXAA 4JFQA 1LYQA 1IBGH 3EDKA 5C0NC 1UWFA 1TQCC 4PJBE 3ARFC 3OKEA 3D3VA 3G5XB 5INCA 1CDYA 2FATL 5I1AA 1O9ZA 3WY3A 4PJGF 1PD6A 2JKNA 1I1AB 4HS6B 2BIMA 2WWKT 3M6DA 1E3XA 3ISYA 4NB7A 1PG7W 1BWMA 1FNFA 1ZGLM 1H8SA 2QSCL 3ATFA 4BDVB 3BAKA 2E9IA 2GC4C 3V4VL 5I16B 1OSYA 5D2NE 3Q8AA 2NZ1A 4K71C 4XE5B 2E4TA 4HC1H 5IOPB 1JZIA 2HKHL 3BAWA 2DOCA 5AW8B 4Z7VA 2G3ZA 4Y4HD 1WAAA 2YPVH 4U1HA 3ELAT 2K70A 4MNHB 4AEIL 4RFEB 4ZO6A 2QLVB 1AP2A 3O9WD 3A6BH 4RZCA 2CGRL 3MRQA 2BVQB 4AEHH 3GIZL 5K9QI 3K6OA 3QJZA 4S1QH 4U3CA 3ZE0B 3KPRB 3JWOC 1H6TA 3DV4A 4GB9A 1XIWC 3BZFA 3APMA 5FYLH 4CSPA 1ZLUH 2AEWA 4PV9A 4YZFF 5TGBA 2ICWA 5TH2A 2HT3C 4NM8H 1NEPA 4XMZA 4DKEL 3ME0B 5I18H 5D7LE 1ZANH 3B6SA 2L7UA 2O4EA 2R1XA 2Z6FA 4MX7B 3FO1A 5D7IB 5DD1H 4KO9A 1AH1A 4PJFB 4I77H 5I8EA 4IW4C 1U2HA 1Y6NR 1SGKA 4U7KA 4AENA 4XB7A 2F68X 2L04A 3B83A 3MOBH 3CVHA 4RFNB 1VB9A 2IH8A 2NNFA 2PCFB 3E1ZA 1R24B 4FXKA 3ARDD 2BIIA 2EDNA 3HE6A 3WLBB 3VU2A 4I4WB 3OF6A 1BJ1H 3RNKB 1KGYE 3HBGA 1G7HB 1UACL 2W80C 3IJYA 3EO9L 5GGSY 2ZNXA 5AVTB 4Z7UA 4AIXA 2B5IC 4P9HH 3QBTB 2FL5B 3TO4D 1SYSB 3RDTA 2P28B 5E6YA 2VRAA 1NLBH 1NCWH 4R0LA 2EILB 4HPHA 3KHQA 3QWNA 4LKXA 4QIRA 5KYUA 2OV0A 4KK5C 4W9DC 3HVNA 2AERT 3FL7A 5IFJB 5ESQB 3R1GL 3WY4A 2PCXA 4Y89A 3T1FB 3FCTA 4M48H 1T2QL 5IW6A 1DVFB 2J4WH 2VAAA 4XZ4A 4UUJB 2X2HA 2OP4H 5ALBL 1S7UB 1TJIL 1X5GA 3CZSA 2KZ1B 2H5UA 3MA9H 5K93A 4MBRA 1A7RL 5F88B 2E7MA 3TESA 3CIQA 1F1DA 4HAGA 1JGDA 4IRJC 3RJOA 2E9BA 2KLSA 2WTPA 3ZY7A 3KVDD 5M7QA 3PAVA 2EDTA 2PN5A 5AVSB 2Q8AL 2E56A 4M7JH 3L7FB 4HIPA 4G6AC 5DWUL 3VJ6A 4BHUI 1KJ2A 4TVPH 1JYNA 1AC0A 4MAZA 4BK8A 3WXVH 1AGEB 4KPHL 4QHUA 1RZKC 3K6SB 4Z5RA 2BOBA 2E7BA 2BSBA 3AY4C 3ARGA 3HG3A 1E9OB 1Z3RA 1CFQA 2YMXL 3MLRL 2JI1A 4N1HB 1AKJA 1IKFH 4K94C 1HIML 3VI3E 4C54A 2OYMA 3SQOL 4Q89A 1RUML 2QHLA 4L8DB 3DO7B 1KEGL 3S8GB 1XX9C 1IGTA 3HNTL 3FTVA 3O2DH 4YDJB 4CDGC 3MLZH 1BZDA 2C1OA 2IQ9H 3T77B 3DVNB 3A67H 1CFMA 1Q9OB 4AW4A 2I27N 4N2LA 4I0KA 4K2UL 5ELIA 4UYPA 3UPAA 5HYQA 3GO1H 4FX5A 1QSFD 4W9JC 4NBZB 4O9HL 1VFAA 2ENSA 3D69B 3KPPA 3MV9B 3S3CB 15C8H 4AYMC 2C8NA 4MJ6A 5E6ID 4AJVA 5AWNH 3QK0A 3U7WH 1AQDB 4F15B 1AMYA 4EVNA 1Z0NA 3N50A 3EYFA 2OL3L 4OF8A 2EUWA 1OT4A 4N1EA 5I0ZA 1F1AA 3AQYA 2CSPA 4RGOL 4MVBD 3DOSB 1JK8B 3QYNA 2WLIB 1B0WA 1D6EB 2FATH 3GZQA 4KMTL 1EBPA 3M17A 2X6CA 4KMLB 5LVEA 3MBEA 1HOCB 1NANI 2R9HD 4S1RL 3GB7B 3LH2L 3MV8D 5DJ8B 4X6DF 3VGGA 5JA8B 2IPKB 4DEPC 5FYJE 4K5LA 2YWYA 4BZ2A 1JPFB 3VSQA 4NSKB 2QSCH 5DFVC 3TURA 1OP3K 5DJYB 4TYUA 4W9ZA 1E5BA 4W81A 4WU7A 3WJJC 3QFJD 2Y22A 1X5YA 2EIZB 2ZF8A 2JLLA 1G4MA 1OTTC 5CP3A 5FGBC 4ONGL 2Y7QA 3UTQB 4K7FA 2HKHH 2ZZUT 3LN9A 4IRSA 4Y1AD 5L2KA 1JN6B 2O61A 4G59C 2Z7UA 4DKAA 3DXAD 4J3OD 3SDCC 3IMTA 3OJVC 4HKJB 2J3SA 2WVVA 1YY9D 3N0PB 2CLVA 2F54A 3UZVA 5A7BA 4LRIC 3PJLA 1G7QA 3FO9A 1HH6A 1KXVA 5A2FA 1IQDA 3DMMB 4B50A 1FAIH 5EUOE 2UWEA 3QUXC 1BD2B 3MLUL 5JOPE 1L9OA 2EJ1A 3WHXA 2O1AA 3HZVA 3INUL 4TQEL 4DKEH 2VDML 1KJ3L 3IK2A 4WQOA 1AR1C 1ETB1 2ZUSA 4K3EL 1T5WA 5EBMA 4Y7OC 4FS0A 3FN3A 3KYMA 3H3PH 3HRZA 2NQCA 4Z7VF 3ROOB 1WAAF 3MGOA 1FCGA 3TZVB 3ESUF 5FA3B 4AH2B 5FPIA 4XC3H 3ARTA 5D1QA 1G9NL 5FAAA 4OCNC 3DURB 4AXWA 2DH3A 2JJWA 4H1LG 3UJTH 4Y9GA 1DO6A 5SWQA 3PYCA 4NQEB 2ENQA 4IBUA 4PREB 5BOPA 3ENEA 4OV5B 1F3JB 3EO9H 3FPXA 4QR7A 4H5SA 2I60L 2ZKYA 5F9OL 1IEAB 2C5DC 5DMIL 1E5AA 3C6LD 2PYFB 4U1GC 2A4CA 3H3BC 2WBKA 3NIGB 2ZXWB 4J8RB 5F1NB 3UXFA 3U0TB 2H2SD 2P5WE 3SE4C 2EEBA 3Q8EA 1YC7A 4WI2A 1JTOA 3R1GH 3SDXE 4ZS7L 2OFQA 4PJ8A 5FDWB 1JZDC 1HWWA 4U1KA 3JV6B 1T2QH 2FQGA 3E8UL 2UUDK 3UZQB 4L4TE 4HIHB 9CGTA 4JGNA 3CPLA 5ALBH 3QDGD 1TJIH 3C87A 4Z7UF 2KUTA 2FHFA 1A7RH 3H0TB 5DRXB 4IOFC 5IEHB 3HA0A 2V9RA 2FUQA 1CLVA 1OPGL 3PQYE 5GZNA 2BY3A 2X2UA 3GLEA 2Q8AH 1U36A 1ZS8B 3CFDB 5DWUH 2NOYA 1S4IA 5CP7A 1R1CA 3HE7D 3G6JB 4HETA 2B20A 4UT6L 4KPHH 4G8FB 2DI8A 1KEMH 4JKWA 2EYSA 4JPVL 5TPWL 3X1FA 1PX3A 2DLTA 4R7LA 5AAPA 1CTMA 4K3GA 3MLRH 2YMXH 2QPDB 2AABL 4MMXB 1HIMH 1FO0A 4G82A 2X41A 5ID0A 3JV4B 3S3JA 1S7WA 3SQOH 1KTBA 3LZLA 4LVHC 4W4OA 1ECYA 4FG6C 3KAAA 5KYXB 4XOEA 5C97A 3NPZB 1E9PB 3P0VH 4XMLL 4U6VL 1ZTXL 3S5LG 1L9SA 1T2XA 3K72B 4K2UH 3TYGL 2D7QA 4N0RA 4MQXD 5CJXA 1A7BA 3OR6B 1CFBA 4U7MA 1FDLL 3ET9F 2OTWB 4O9HH 1RZ7L 4JCLA 1X9UA 4GKOA 1TOXA 4OZFA 2Z8VC 3WTUA 4LGRB 2PW2A 3IDNA 4K5MA 4YBQD 3U1SH 4KZEL 2XG4A 1MRFL 2HJKA 2G2RB 2XJKA 1E4KC 3VX1A 1OB0A 3CZGA 5KBDA 1ZT1A 2PXYB 4Y5YC 3S3BB 4RGOH 2NUTB 4KY1L 2BRQA 2F19L 2H1LM 1WJ3A 1ZLWH 3TX4A 5DZOA 1I1FA 3CXDL 3SY6A 3MCKA 1KCVL 5I19L 4S1RH 5C0IB 3E6HB 4YHZH 3REVA 2WZ6A 3FT0A 1I85C 2XACC 4JO1L 4QKTA 4X9HA 3V0VA 1H8LA 3PHOA 4U0RB 4L1HA 1KIPB 5EULV 4OIAA 1ZT4B 3R4DA 5BZZA 5I1LA 1YMMB 2YMOA 2AJZA 3ZTDC 3NCCB 5C08A 2Z93A 4EIUA 1OAUL 5BW7C 4ONGH 3ZZSA 4BFOA 5C8JB 5EEZA 1T89A 4L8SC 3C5JB 3ZJAA 3MYJA 2HG5B 4F3FA 3LN4B 1JFQL 1EJ8A 5IK3A 2ZCZA 1GGIH 1FHNA 2OZ4H 2GBAA 4KKAC 1AO7A 2AJVL 3MCYA 4FLQA 5D1XA 2QHRL 2MHAB 4JM2D 2JIXB 1IBHA 4HALA 4PS8A 1PZ5B 1U8CB 3IXTA 3LZOA 4I2XE 4CDHA 2GT9A 2IDTA 3MLUH 4G8IB 5EOTA 1HAWA 1ITBB 1V10A 3HCVA 3NZ8B 1SXNA 4F37K 4TQEH 2VDMH 1KJ3H 3VFUA 1M42A 3STLB 3QORA 1ZJAA 3VSUA 3BUIA 4DN4L 1R47A 1PAZA 1IFGA 4YEEA 5BS0B 5C0AE 2YPVA 5HP5A 3EH2A 1IZJA 1IGYB 3BQUB 3OM3B 4YBHA 5HHXL 3S37X 3T2LA 5F0JB 3VXUA 2YD5A 2XHNA 3MRDA 2AXGB 2ERJB 1G9NH 3JXAA 2X4QB 3BPOB 4NUJA 1UEYA 4LVNC 2UWEF 3EF7A 2AQQA 3I3DA 1G7LA 2OXHA 4ZX4A 3ZVVA 1OQXA 1OM9A 2XVLA 5TDNB 1N5YL 4RGNB 3L17A 3KPNB 3EYUH 1BPLB 1GYCA 1PIGA 4JFZL 2BH0A 3WFBL 3BVNB 1FYTB 1CG9A 4JB9L 2I60H 5F9OH 2APSA 1D5XA 2DS4A 5DMIH 3FTXA 2OMUB 1ORQA 5JORA 1U3HD 2IANB 4ZUSB 1NOAA 2DQGL 4CRPA 4J3BA 4Z3FA 1HX0A 1EXGA 5I5RA 2DQEH 4ZS7H 3JV5A 4A63A 1IC1A 4HJ0C 1CR9H 3E8UH 3C09B 3L2LA 4MMZA 3ZN6A 5CIPB 3QJHA 4N26A 2DYRB 4I18B 5AB0A 1E5UI 1FYHB 3F6LA 1PIFA 2A83A 5AD0B 1OP4A 1OTUC 1D9KC 4AL8L 2Z4QA 3W37A 4RDQF 1OPGH 5T3ZH 3KYAA 3LKPB 4AMXA 2UZYA 3SDDB 3VWJC 5GGRA 1JERA 3FU7B 4KVNL 4UT6H 5D7JC 2BRRL 3NP3A 4JPVH 5TPWH 1MHHB 3FFCD 4F8PA 5DC0A 2K7PA 12E8L 2AABH 5CD3B 1QEXA 3SKOA 2VZUA 5DEZA 4GW4A 3TBTB 2XY2A 3PWPD 4TUOA 1RK0A 4KUZL 3BSZL 1EJFA 3SE9L 2UVEA 3GJFH 4QT5B 3SBWA 1T21B 1FV1B 1KJVB 1ZT7A 1A66A 4F2MA 3HMXL 4CBPA 2Z92B 3EGXA 35C8L 1HQRB 3VA2C 5IJBC 1ZTXH 5C0GA 4KTDL 2EXTA 4YSQA 3TYGH 3O2VL 3UG5A 1NINA 3TCTA 1TF4A 3QFDA 3UTTD 2ITCA 1FDLH 4XAKE 1GH7A 1J9TA 5FKPA 2OI9B 4IDJL 4TLUA 4DFHA 3P2TA 3HKFA 1RZ7H 2BLFA 4PY8I 1REIA 5DHYA 5DLLA 3PL6B 3ZGIA 3VD2A 5DD3L 4E9SA 3BKMH 5A2CA 3QUZB 3VFRA 1LEIB 1NOFA 5F21B 2FD6H 2F19H 4X6CB 4JKLA 3PF2A 5A43C 5J0BA 4IRZH 4JLRB 1PQZA 1LO0L 3AQXA 4NPKA 3ILPA 3QPKA 1IC4L 2IQAA 4F9LA 2ZXAA 3OHMB 5B1CA 1PKOA 4JO1H 4ONFH 3T65A 3M1CA 2ZWLT 4GAGL 4AZ8B 3TJEL 1HZHL 4AJ0A 1YEDB 1MLCB 2BS9A 3KNBB 3ARZA 5E4AA 2YUXA 1XF3A 4YSEA 2PYEA 3RVXD 1JGVL 4LBEA 3RU8L 4M43L 4NENB 4NC1C 1CLOL 1KTJA 4O02B 3RWCB 2Q87A 1PW3A 4PBDA 3FXIC 5C2UB 5CEZE 3L4TA 2X6MA 4ENEC 5IB2A 3HMWL 1HOEA 4KWUA 1KTLA