2RQEA

Solution structure of the silkworm bgrp/gnbp3 n-terminal domain reveals the mechanism for b-1,3-glucan specific recognition
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
102
structure length
102
Chain Sequence
b'YEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
molecule tags Sugar binding protein
source organism Bombyx mori
publication title Solution structure of the silkworm betaGRP/GNBP3 N-terminal domain reveals the mechanism for beta-1,3-glucan-specific recognition.
pubmed doi rcsb
total genus 7
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rqeA00
3AQZA 2KHAA 2RQEA 3AQXA 3IE4A 3AQYA
chains in the Genus database with same CATH superfamily
3STZB 2NUTB 2PW1A 3S8WA 1QFUH 4GKSB 4G80A 3NTCL 3KPOA 1JNLL 1Q9LA 3EF7A 4ACPA 4LSUH 1NFDA 1O7VA 1VSCA 3S98A 3TM6A 4UTAL 1NEUA 1Y07A 3EIFA 3KPSA 1KYAA 4B0MB 2OMTA 2HT4D 3ZJAA 1MRFL 2EJ1A 2J1ZA 3H6JA 4UDTA 1L9PA 4MDIA 4C4UA 4Y5XA 3P9LB 4GAAA 4K94C 3C5JA 3ULUE 3QEHB 1K8DB 3POCA 4XMLL 2GUOA 4BKTC 5HDQH 4LL9A 4RWHA 4GUQA 4KTDH 5BRZD 2EDDA 1JNHA 4LSTH 2EO9A 5IV2A 3GBNL 1M7IB 3DVGB 4FTDA 3ULUD 2OYPA 1EFXD 5EZIL 2HJKA 3X3FL 4UIKL 2WJ7A 1JDAA 3QIUA 2WXQA 2XTJC 4GG6A 3IDNB 4JDTL 1ML0A 1SVBA 1F4WL 2BW4A 1KCVL 1HKLL 3SGJA 4J3XA 2AEQL 2Y1YA 1K5WA 4PFEA 2ZNXA 3BKYH 2Q86B 4Z77A 1RZGA 3ISWA 4KVCL 3DNKA 4NQDB 4J4PA 4P8QA 3N42F 3DIVA 2DH3A 1NKRA 4WI8A 1E65A 3JWNE 2IAMB 3AREA 3C8HA 4M61B 4N2OA 2OI9B 5F6IC 1CFMA 4KNQA 1LMKA 1SYSA 5TF1L 2BY3A 3D25B 1CFSA 4OBRA 5D2NC 1JV5B 5DLML 3STBA 1T4KA 3DLQR 3ILEA 4C47A 1T0PB 1J48A 4X6CE 5FUZH 1PZCA 4MJ5B 3SYOA 5L7XL 3QZWB 3OMIB 2XQBH 5D7LE 5BUGA 3TBTB 4N2KA 2ZZUT 2WUBL 1TTBA 4LOEA 4Y4FD 1A6VH 1NCNA 3QQNA 4L0YA 1PLAA 2WBJA 4MASA 1TQBB 5G55A 1EHLH 5DWUH 3ARFC 4X80H 3F6IA 1A6PA 1G1YA 2J6EA 2WQXA 3IJHB 3KVDD 4YXKH 1CK0L 5C0EA 1AIFA 1CU4H 1F97A 1S7WA 3PV6B 1OE3A 3D2UB 4G5ZL 4QNPE 2BSBA 5D7KD 4JEGB 3Q2CA 4QWWD 2DI7A 1T20B 1A7NH 3L1FA 5T1DH 3SY0A 3VJ6B 5KTEH 1AXSB 3WEXB 3EGSB 1O5DT 2IVFC 3IFLL 1SJVA 4JL1A 4A04A 2AK1L 1UWXK 1TQUA 1YMMD 1RI8A 3AT0A 1A9EB 4TVPH 2IAMD 5JW3H 1WFUA 3B2PA 1OQOA 3WHE1 2A9ML 3WIHL 3HG4A 3B7TA 1ASQA 2VN5A 3A24A 3GB7A 1UD8A 3HNTH 4B50A 3DMMC 4JO1H 3ECQA 2BMKB 4JFHD 4XI5D 4PJEF 2X7LA 1WBXB 4LZKA 4LF3A 3LQZB 3Q5TA 3RIKA 4U7MA 3C08L 2PUQT 3SDAA 5CEZL 4Q6YA 2H7WA 3X1BA 2JJWA 1BECA 2QVFB 4K8RD 3T8MA 2GJ6E 5D96B 4M6OL 5IB2A 1I3GL 4WSJA 2XZCH 2UY6B 1QR4A 3I50H 1UYWH 2KZKA 1TJMA 4JNXA 2X40A 4I0PA 5F8QC 3UPCA 1O7DC 43CAA 1Z7JA 2JKRM 4YSSA 3QGVA 1UZ8B 2GUYA 1AC0A 1JV2A 2HFEA 4OM1H 3B5HA 1RV6X 3QZOA 5HYJA 5I19H 4OLWH 5JDSB 2NNAA 4K3GA 3IGKA 1EJ8A 2Z91A 3U6RA 5K9OA 3LKNA 4WCYH 4Y1AD 1H6EA 3AM8C 5F72S 4BK5C 1KELH 3IJ9A 3KLKA 2OSXA 5IFJA 4D9LL 3LNDA 1DR9A 1ETB1 3ARED 3EBHA 3MRKB 3NSFA 1BZ7B 4N20A 1E4JA 1JZDC 3SKNB 3BRGC 2D03L 3F58H 4MYPA 1ZDSA 4GRLB 5HVHC 1ZHKA 2VDQH 2MIZA 4FQ1H 3L3GA 3MA9H 4ETYA 1MFEH 2CR3A 4R5VA 4GG8B 4N8VG 5IW3A 1MLCB 5DC0A 4YHMH 3D4ZA 1AJ7L 3PL6B 4M5TA 3PHOB 4X5WA 2YGPA 1OP3K 3BMWA 4OJYA 3ULUF 5GGRA 5AAWA 4FJZA 1QNIA 4JS7A 5AFAA 1W72H 3QQ3A 5GGSA 1T21B 3WEMA 2RACA 1CURA 3NPSC 3T08A 4IOSD 3QUZB 2IQ9H 3P3UA 4ZS6D 3QIBA 1IGJA 1NANH 1W8OA 2W07A 3P2DA 5DHEA 2G3NA 3CNKA 1JGLH 3RVUC 2NTSP 4C54A 5MENE 1QFHA 3FOMB 2Z0BA 1WT5A 2SODB 4FQQB 4UAOB 4MZIA 5FB8B 3U1SL 5HDWA 1HXKA 2WXRA 5IK3A 4APQA 5DZNA 2NZ1A 1OWRM 4U1KA 1KEGL 4XI5C 1BA9A 2DQTL 1LO3H 4FTVA 5IGXH 4LLVB 5DR5H 4R4ND 5DO2C 3S5LG 3V8CA 2W65B 3LKSB 1O9ZA 1JG9A 3N42B 4UT6A 4LSSH 4PWKA 3HZKB 1AQKH 3N44F 5T1JA 2N7BA 4EOWH 3K1DA 4BCZA 2VXTH 3Q8FA 4EI6A 2FR4B 2AQPA 1TZGL 1LWHA 4GPVA 4Z3TA 5EZPA 5CLYA 2O61A 4N8UA 1N5AA 4Y1AA 5D2LF 1D6VL 4Y4FA 3C6SB 2CKBH 4NC1C 4BSVA 5ANHA 1T7WA 5C09B 3KPSD 3CVIH 4LU5L 1RURL 1YEHL 2N4IA 3MFGB 4FYSA 4YGAB 5AZEH 1MCIA 3P77A 5HXMA 1NGXB 3SDCD 4IGBB 4DP5X 5TK4A 5DMIL 4D94A 3VG9B 4GH7B 5DMIH 4PWFA 4IRZA 4YDVB 4YBQC 3WMSA 4AM0A 1D7FA 5IEHA 1TUPA 2WNXA 4NIYE 1TTCA 1LDSA 5EUOE 2PCXA 3U6XS 3TJPA 4I0PC 1AZNA 5EIVA 4OCMC 1CN4A 1UUNA 4LLAA 3B2DC 4NKDA 1FIEA 4R5TA 4WKXA 3PAYA 4IOFC 4AQ1A 3ESMA 2YXWA 3B9AA 3A0OA 2PCPB 4HK3J 1TZGH 4BH7A 1E8XA 1U8PB 1WCBA 2JB5L 1FWXA 3HHSA 4NNXA 4M3HA 5JMOC 4KQ3H 4N2IA 1AANA 3O3EB 3MKGA 4ZMVA 3DPBB 1R24B 3WXVH 1H3XA 3STZA 5EH1A 3RWIA 3FONA 4YEFA 4W9IC 1KBBA 3CLEL 4DIXA 2BHFA 3G6JA 1NC4D 2P5ED 2XN1A 3DMMA 1FFPA 1PQZA 4FQ2H 5JW5A 4XC3H 2P43B 4HA1A 3VGFA 4FA7B 1HHGA 1CBVL 4OI8A 1DL7L 1BZEA 1QNZH 5K39A 2W9EL 3I6SA 4DPRA 3E3QC 4RRPM 3S5ZA 4RGOL 1NC2A 3BPCA 4RGNC 1VF5C 4E9WA 3EYFB 3RILA 4NJAH 3QHFH 4GSDH 1MCFA 3D3VE 4UU9A 2P26A 4XHQA 4HIXH 2DQJH 5DK2B 2C9VA 4BK8A 4DUVA 4MB5A 1AOZA 4M48L 1I9JH 5MHSD 4KUZL 2J2ZA 1V3LA 1HTYA 2HKFH 1JGUH 3ZMRA 3WFEH 4CILA 4E42B 1JZHA 5KSUA 3NJMA 4CKVX 3BSGA 3BVVA 3RWHB 3SZ6A 3UADA 1JNJA 4JJ5B 3AACA 1EMTH 5GS1C 4IM8A 4YHML 1CXIA 3RI5F 3H9SE 1T3FB 4PJIA 5I0ZA 5I16B 4G6AD 3QRFM 1XCWA 4K7PL 1ET5A 1XBDA 4UILH 4KZDL 4HPOL 2EYTB 4LK4A 3BVDB 2WLMA 2CPUA 5F7WC 1C7SA 1F4YL 4U1JB 1OB1A 4FRWA 2XZQL 2G0KA 5HYEA 2VDOH 2WTOA 2Q8AL 1GYWA 1RUML 4Z7WB 3WFBL 3FMGL 1D5BA 2XNAB 2XIIA 3CDZB 4N9GA 4AK2A 5J6GB 1AGEA 1TJIL 2IH8A 2Q1EA 2XIBA 1OGAE 1YPZE 5GS0L 3BO8B 4DGWC 1I3GH 2VH5L 1BVKB 3C60D 1BZ7A 4QRTB 1FG2A 5DZPA 4XH2A 1QWHA 1MI5B 4ALAH 2NY0B 2ZX7A 3KGUA 4L4VA 1C16A 4YE4L 3RVWC 2G2PA 3RFZB 5DQJA 3T77A 2E7HA 1TFHA 4D0CA 5IB3B 4BE6A 5HYJB 5C08B 3GSQB 1FHGA 4OZGF 1KMGA 2NX5D 4LCCB 4NXKA 5EOCL 5DHMC 1E9OB 4A7UA 4JO1L 3FU0A 4OUUA 4AENA 3LXAA 1OZTG 3DECA 1RHHB 3BYTA 4JB9H 4ABQA 5T3ZD 2FBJL 4PJFB 3VWKB 5D5MF 3G04A 1BQSA 1L6ZA 2A9MH 4GT0A 3WIAA 3D9AH 5EU6B 5B22A 2E4TA 1ESOA 3DXAA 1P1ZA 3VXRB 3S9DB 4ZW5A 1YEDA 4GQQA 4ELDA 4NHUA 3CXDL 2NUTA 1PJ9A 1D5MB 1VFAB 3P30L 2OJEB 5KTEL 1YQVL 1NC4B 2D7MA 1MLCA 4PJHA 1T7ZA 3C09C 2VWEE 2GJRA 4XVTH 2IH3A 5BZDB 4HS3A 5MHSE 3IDMA 4K5MA 3QJUB 4PJGA 2E75C 4HWEH 3KLQA 4J8RB 2VMDA 3C5XA 4Y89A 1XF5B 3RDTD 1U4FA 3LKQB 4FEIA 4M7JL 5EZLA 4X80L 2MOQA 1J1OL 2LTQC 3C12A 1UZGA 1N59B 2VGLM 3DX6A 3L3HA 3TFKC 1A6VL 5JHLA 1NUFA 3MROB 1B4RA 4XPTH 1I31A 1HWWA 2D3VA 3HIZA 2XQBL 4UT9H 5L7XH 1XX9C 3FSZA 5GRJH 1T20A 3IWUA 3FFCE 2BDNL 3I3DA 4NNYB 3EGSA 1WC7B 4K5PA 2BHZA 3EOYG 4PJ7E 3VDCA 4XGZB 5CZVL 4LMQI 1I1FB 1M3JA 4Z76B 5GZOC 4A38A 2A74C 3WDHA 3JWNG 5JPMC 5IT2L 1MLBB 1BQLH 2AI0L 1XEDA 3MQIA 4TQEL 1E6OL 2IFFL 4P2QB 1FA4A 1F6AA 3I9GL 5E6IA 2X4OA 5I0VA 4LEXL 2VW6A 4UIMB 1MCEA 3FHEA 3BKYL 3C60C 1L9SA 4BIKA 3C6LD 3O8XB 3CIAA 3PQYD 4BV1A 1S9YA 4EZMA 2Q3XA 3IVKB 4P0DA 1FRGL 4PBDA 4D8OA 1F3RB 1NBZA 2GG1A 3ZTCC 1ODUA 1FZMB 4GJTB 4UIKH 3FTGA 2E7CA 5IQ9A 3UO1L 4HIEB 4W70A 4DP7X 3KPQA 3BUQA 4O2FA 1MZZA 5KW9H 1EUTA 4LSTL 4IJ3C 1H3PH 4CU7A 5CGYD 5A6MA 2WCGA 1W16A 2XVBA 4L4VD 5JLZA 1IM3D 3SBPA 1QR1A 3GMQA 1BWMA 2B1HL 2JCWA 1W8NA 1F86A 3MRQA 3CMOL 4ENEC 5B8CC 3GLEA 3Q1SL 1MRFH 4JQVC 32C2A 4ZOAA 3BQUC 2X0VA 1I1AA 3IDXH 3SKOA 1RIVL 4W6WB 2H32A 3QDJB 4A6YB 1KY7A 4ANWA 3MLXL 3SGDH 3APFA 1WZKA 3GC3A 1JNLH 2JJSC 1SMAA 2VZSA 3ARUA 1E9PB 3U1QA 2BSTB 3RX8A 4KK5C 3FT3B 2ADJA 5FO2A 2MCMA 1KEMH 1E4HA 2R51A 3SOBL 4WI6A 3D0VB 2D0FA 3GXIA 1RPQA 3JTTB 1BFVL 1FVEB 1CXKA 1OCRB 1X6NA 1UASA 4NOBA 5CJOL 3BZEA 2H2PD 1Q1JL 4LLUB 4NOFA 4PJAA 4ZYKB 3TWYA 4I87A 5CWSA 4ZD3H 4HF5H 3TT3L 4JY4A 4ZD3L 1OAZH 4B9PA 1JK8B 4AUJA 5JOPD 2F7PA 4PPTA 1I8IB 1EZLA 1M2OA 4QYAA 1TG8A 1MRCH 2OJZH 4MZ3A 2NY3B 1N67A 1VADA 1HNFA 2CBTA 4G9FE 1M6UA 3TEWA 3TBSB 4GRWE 1AGDB 2Z6FA 2MNJB 1IGTB 2Q7NA 4X4YB 1GYCA 4UANA 3NPSB 5F71A 4GMSL 3QUZC 1XGPB 1OD9A 4OCSL 3BH9B 2YS4A 1L9NA 5AAMA 1S3KH 3LIUA 4LESA 2P24B 1YAIA 5CR8A 5IB5A 3TV3H 1H9DA 5G4MA 4M02A 1CXEA 2O30A 4WI9A 1FE8H 2VJ0A 1KXQA 1ANUA 4JUSA 1RIVH 3K2IA 3QT2A 3IDXL 2CALA 3CSFA 3QJTB 3RDTA 1F5WA 4OGQC 2PO6A 3TCLA 4WHTB 3QQ9C 4F20A 2P8MB 2VN4A 2Z8SA 5LN4A 1LO4L 1X5IA 1ZVSA 3QQDA 3BZFB 5DZJA 4TLKA 1XB3A 3WEOA 3IT8D 2GSIA 5IW6A 1MHPL 4PI2A 4NN6B 1CICC 4GI6A 4QT5A 1ONQB 4TUJB 5DJAB 3AG4B 1ZGLB 1XQ4A 3ME0B 1AXTL 3LPOA 1B90A 2DQIL 4U0RB 1KN2H 1GW6A 2NY3D 4OQTL 5MERA 3DX7B 3GMMA 4R0LB 5HHOD 4UOJA 2D4FA 3OF6A 3SDXB 5EU6D 1FFOA 3UPRA 3SE4A 4DVRL 4Z3GA 4K3DL 1DANT 2ENSA 5I71B 2R29A 3WHXB 4RNRA 1TT6A 3L3IA 3ARZA 1KENL 2Z4TA 4QHLA 1NKOA 4ONFH 5IVZB 2ISDA 2YIHA 2VRKA 4XTRC 3ETBJ 2ZCKH 1SN2A 5E6IB 1XGTA 1C5CH 2H47C 2YEVB 3RQ3A 3CFQA 3MLVL 1BQLL 3ZMEA 5ITBH 3ZTNL 2ERJC 4CW1A 1SJHB 2AK4D 1G9EA 4XNUL 3EYQC 4CGTA 5DD0H 1WQVT 3RX7A 1U42A 1WC7A 3GO1L 2NY4B 5DSCA 3QULB 2I5YL 2BDNH 3EG9A 3RWCA 2J7LA 2AEPH 2DN7A 3ESVF 3HBZA 4GAYA 1S7VA 2OMXB 1DVYA 1JXKA 3RUGE 2QVIA 4AYFB 3HMXA 3QUGA 5B1JC 1OGAB 1N59A 5E8DL 3QFJB 2ENPA 4HGWA 3BW9B 5B3SB 4QRSA 4WI4A 5DD5H 1AGBA 5I1EL 1UA3A 3GHBL 4JR9L 5CP3H 1EFXB 2V6HA 4UM9A 1VERA 2OX5A 2DH2A 3L1GA 3VDAA 2FBRA 3GJFK 3SDXA 5LHDA 4JREB 2DQMA 5JTWA 5TE7L 2OKMA 3P30H 4HX1A 4ODUA 5FOJA 1A22B 4JFYA 4E9TA 3NAAH 2OZ4H 3V0VB 4I0PD 2YD4A 3O9WC 4ZMXA 2Y6SC 4PJFA 3VWKA 2X9WA 5CIPH 1ZT4B 1HYSC 4PRBB 4HCRH 4HU2A 2CDGB 4P5SA 1PU0A 2XTJE 3D51A 3MXVL 4U33A 3V5HA 2CDGA 2J8UF 2P5EE 1UWFA 2HN7A 2NR6A 3JV6B 1J1PH 4G2AA 4H0HB 4C4KT 3CE1A 1LEIA 3FCTB 5MI0C 2XA3A 2NLJA 1EERB 2LU4A 4UT7H 4OI9A 2EZ0D 4N2BA 2Z31B 2VH5H 1JWUB 3SBQA 4UOW1 4JRYB 1A7QH 3CZLA 4LSPH 1ICTA 4GRWF 5MENA 5DK2A 3SBWA 1G9HA 1L7TL 2DL9A 1JYXA 4PH8A 2G60L 3CC5A 3T09A 3Q3GA 5HYSG 2ZUQB 3WFBH 1RUMH 1HN1A 5ACLA 5I0WA 2ZAIA 3CN2A 2ZUWA 4G7SB 1VA9A 4L8DA 5GGVY 4O58H 1G7IA 1WZLA 4IHOB 2H0JA 1B3JA 3S6CA 3RY6A 1J05A 1QSEE 3HI1B 3EOAA 5I24A 4QRUA 5F9AC 4XXWA 3FBKA 2WQAA 1FZJB 3TTYA 1IGFH 3TH2T 2A83A 5J1SC 3WDJA 2XQYA 1DVXA 1XTLA 4EBQL 4XWOC 4WWKD 3MRHA 4ZBJA 3QZPA 3C9NA 2IALB 4Z8FH 1CZ8H 2KI6A 2NX5B 2XV3A 1E4KA 1X5JA 1KPVB 4HALA 1A6ZB 1CXFA 2QBWA 1BP3B 1ZHLB 2VR6A 2VDKB 4HHWA 2XQYK 4GSDL 3QUYA 4NJAL 1GCFA 3WTUA 2DMBA 4HD5A 4WNSA 4Z7VE 3TPKA 3TA4D 4HS6A 4I3SH 3ZYIA 1RHFA 5EF2A 1OTSD 5ICUA 3FYIB 4RFNB 4XGZA 1BM3H 2G2RB 3SPGA 4X4YA 1BD2E 3BWAA 3LRSA 4P2RD 1MNUL 3CFBA 4LP4A 1FVCB 3QIWB 4PV8B 1ZAGA 4GW1A 5HDLA 5ID1B 4WENB 3CFJB 3MJ7A 2P47B 3MUUA 2EO1A 2BVOA 2IGTA 4Z5RB 1BLNA 5CU5A 5GISL 1MJJA 3DVNB 1LK3L 4AY0A 2A6JB 5DMYA 1MCLA 3VFNB 4PJEA 3RVWD 6PAZA 3B9KA 1NIAA 2CIIA 2R1XA 2R2BB 2WAHA 4XXCC 4JY6B 4XXDA 2H9GA 3LKPB 1N5YL 1Q72H 3V0FA 3WTSA 1N70A 1UH4A 3FQRA 3HBGA 3MRHB 5DEFA 5KAQF 3KBEA 3MRIA 1YEGL 3EJJX 2E56A 1RK1B 3RWEB 2BRRL 2Z8WC 3D0LA 1IMHC 4PG2A 4KROC 2AEIT 2E7LA 1F13A 1HHKB 3IDJA 4BGLA 2MCAA 1SBSH 2VAAA 4UI2A 3MJWA 5L2JB 2L7EA 4N0UB 1IL1A 3QI9C 2FX9L 1P4IL 4LCWA 2CKBL 3PPSA 4Z78B 4RMUA 1RUQL 1CE1H 3IDIB 3MRJB 3SKMB 2WO4A 2VYRE 2DDQH 2QZQA 5C0BB 3KWUA 3KM1A 4PJBF 2NY6B 4MLIA 3FSAA 1O6SB 3FB6B 2A77H 1DDTA 1HI6A 4NSKB 2AV1A 4YQXL 1GJUA 4GG8A 3S96B 3O4OB 1KUMA 3Q8BA 3EZ8A 1I8KA 2VE6A 3V79C 1HZHH 4JCWA 5JPNC 3LKOA 4ERSH 4V1DA 4P2CG 4Z7QF 3S36H 5D70L 1UQSB 2XN0A 1AR1B 3NQKA 1P1VA 1S7UB 2FGWH 4LT7A 5D7LB 4Y5VB 4TOYH 4IOIB 3OKEB 3HI5H 1T0NA 1XEUA 3KPRB 1BXUA 1W0YT 3BQVA 4X6FA 3RB5A 4GBXB 3KBPA 1JGLL 2FWSA 1CTOA 1OGAA 1NOAA 1Z3GH 1WWAX 4U1LA 2IQ9L 4GYBA 3CH8A 4XP1H 4U3SA 4CMHB 1MIEL 1D5ZA 1UXWB 4NCC2 1W72L 1AYRA 5T3ZL 2VDPB 4QHPA 3WV0A 2Z31C 4M1GL 2K7PA 4J6RH 1T2QL 3SDCB 4AV4A 3FQ2A 4JJ5A 1L0QA 4RSVA 1A9BA 5CLXA 3T3PE 4MFHA 1UWYA 2Q6WA 5E1IA 4HGMA 2ARJA 3X11B 4LPUA 3DO7A 4TSCL 2KZ1B 2XWXA 1FFNA 2P9RA 1VEMA 1YJDH 5EFIB 2DKMA 2NPLX 4XWOD 5IFJB 4HC1A 1R0AH 1HZLA 1U3HD 4RX4D 1QSED 5KVFE 2CRMA 1QUNA 4N0RA 4EUPG 3HLAA 3SQBA 3ARDA 4DO5A 2JV6A 1NLDH 4GO6B 2DWXA 4H26A 4F15C 4NZDA 2OTWA 5HYQB 3IDMB 1Z1WA 4AYFA 3K2UL 4TNWK 4YK4C 3K5SA 4RQQA 3PXLA 1VGKA 3DMMB 1ORSB 4Y9GA 1UYWL 5E4EB 4RMSA 2Q8BL 1XR9A 2G3ZA 3SDDB 2ED6A 5A1AA 5EEWA 4ZMNA 3IJEB 2X0UA 4HW6A 1IJ9A 2WXHA 2NRDA 3S3SA 1Q1PA 3SE9L 3TEXA 4BD4A 3WY4A 4KKBD 3G08A 2MHAA 3QCUL 2R0ZL 4U6VL 2FEDC 5CEZH 3ZKND 2ZF9A 2VM4A 3PWPB 1NCCL 3FFCA 5KBDA 1GYAA 3P4OB 1XD1A 4OCYH 4QHUB 3U4EA 4AQAA 4P49A 4ICXA 1M42A 1Z9MA 2YXMA 4NFDA 3VXTB 3IB4A 3WLBA 2BS8A 2QJDA 4C56D 5EEUA 1PD0A 1QYGL 4OF8A 5H94B 3MLRL 2FQGA 4JHAL 4TVPL 5TFSL 3RIFF 3WCYA 1A02N 5DUBB 4FYQA 3KMDA 3NSJA 5HJDA 1U8CB 1MXGA 3APNA 1MVYA 4A7TA 4G8GE 4WUUE 2XWTA 7PCYA 5B3JF 1MCSA 5AD0A 1LO5B 3RKPA 4O00A 1HHHB 4FQXC 3EJYD 5IQMA 1DBJL 2XNAA 3DPBA 3LHAA 2ADFH 3H55A 4LHUG 4ZFFB 1WZ1H 2EXSA 1DVFD 3DWTA 4YXKL 2HMIC 4XCNB 1A7OL 3KLDA 4OFQA 4X9HA 1F4XL 3UERA 4I18C 5BCAA 4KDVA 3RHWF 5BVPL 3HAEA 4HUWA 4UWQB 4IRJA 2CJTA 1AC6A 4N8CL 3CXHK 2J6WA 3BVTA 4NRXA 5KVDH 3HNSH 1RULL 1TPXC 4MJ5A 4J4PD 4JK0D 1NGWA 2WQ8A 3NABH 2OTUB 3IWVA 3IJYB 4NC2B 4APQB 1JYVA 5DLMH 4YSAA 4WV1C 1FNSL 3AC0A 4N86A 2VDNB 3EDFA 3T4YA 3ZO9A 3ZE2F 4MNHB 2YJQA 4LLMA 4KX8A 3MCKB 3MLWH 4JFEB 2CRZA 4L1LA 3SCMD 4AH2B 4RX4A 2CMRL 3F6LA 4U1IB 2KKQA 3MRLB 4MGXA 4PY7A 4KAQL 1KYFA 4XPFH 5KOVC 2CKBB 3QO1A 5C1MB 3ULVF 3OXRB 3MGOB 4R7VA 3ZQWA 1WIUA 3RVVC 1KCVH 1CLCA 4XNZB 3DA0A 3O4LA 1HHHA 3NIDB 4FXGC 3OX8B 4D9RE 5AD0B 4LQFH 1V7MH 1JK9B 1FFTB 3PJSA 5AG8A 3CFNA 4CADB 1AP2B 3OC5A 4P5TD 3PREA 4NWTH 2JTDA 2F0CA 1M3IA 3DETD 1A4JB 2WVVB 2J44A 3L5WA 4JMNA 4KTDL 4J3BA 4B27A 3MNVA 1FL3A 3K2KA 2EDNA 2IXQB 1B0GA 4L3EA 3BPLC 5IIEB 1M05B 2JB6A 4CUCA 1HE8A 5I73B 3M1CA 1U3YA 2Z35A 3QH3B 2BK8A 3HHRB 4FYTA 4HETA 2C4FT 1NGWB 2DB8A 2WOBA 3ZL1A 4HFWB 3GKZA 4M7LT 4J3SA 3SO3B 2VZVA 3T3PF 5C0JA 4YSQA 1ZKAA 4LKXA 1U21A 2B4CC 2Y7OA 3ARWA 1BAFL 3X12A 1XF2B 4PRHA 4NM8L 3I75B 5BXFB 5L9DH 4QTHA 3BE1L 1X9RA 4HHAA 1VCAA 4EO5A 1WAAE 2A6DB 2DMGA 1CWVA 3SYPA 4NQCA 1U3ZA 4AVKA 1UTDA 1FFPB 2UZYB 1NCWL 3WFCH 4IKKA 4ZAKC 4PVBA 4MA1C 4OB5H 5D4JA 1RD6A 4DTGH 1U8NB 2WJ5A 3U1PA 4HJIA 4XE5B 3HMXL 2B1OA 3MYJA 1NDGA 3UYPB 5JHLH 4ZTOH 2I25N 4PTTA 3VRIB 3WUWA 1D5RA 2X6MA 3UC0H 4J8RA 2Q2LA 3NZSA 1SHXA 2QDWA 3VXSB 3F3HA 4L2LA 2D8KA 2W0FA 4FTVB 4GOSA 3QUYC 4TLUA 1VZHA 2Z92B 1EDYA 3FN3A 3HJ0A 1U92A 4JRXE 1GGCL 4OLEA 4RFEB 4LLWA 3KZ8A 4BELD 3B1TA 2FYYA 2ZUSA 1II4E 2DYSB 3SDDA 1UM4L 5IQOA 3V5DA 4FYRA 4NNYA 5LBSA 3NVQA 2EDHA 4M8VA 1J0KA 3QS2A 5AW7B 1VGEL 2EDWA 4JM2F 1NM9A 3QNZB 4JRWA 4KRPC 4XXWC 3BYYA 3ARDB 3AWFA 4S0TD 3VSVA 1I1YA 1SOKA 4JQIL 3GB7B 5IREA 3ZDYB 3MUGA 2ZUTA 5LXGH 2WLJA 4AMKH 9PCYA 1PKQB 2DLFH 2GY7B 2IXQA 5JHBA 2ROXA 4ZDHA 2F7RA 3EDKA 4L9LA 1NLBL 2X1QA 5T33L 2NY7L 3X2QB 3TGXA 3FB7B 1YYLH 2VSKB 2WXGA 3TIEB 5INDB 2ZP0T 3FB7A 1I8MA 5AB2A 2HT4C 5AOZA 1UB5A 4UOW0 3DOHA 3SBWC 3GS7A 4OVUA 1C12A 3NUKA 2J4WH 2IGLA 3LXBA 4OGXH 1YEIH 5C0IA 4JPVH 3SDXE 1ZHBA 3TT1H 1CJYA 1XF4B 3DI2B 3P4NB 3PDDA 3G3LA 1H6UA 1IM9B 1JV2B 4HT1L 1SFDA 1FORH 2HCZX 4LDLB 4N8VB 4FMKA 4KMQA 2CBMA 4BZ2L 5KYXB 1DFXA 5D6DA 4NUPA 1L9QA 1GZHC 1TQWA 5DS8B 3PWNB 4RIRA 5D7IB 5EMYA 3UIZA 1I1RA 1UWEL 2FYYB 5ICYA 2ICES 4M6AA 2EYRA 2YSTA 3I6LE 1ZVYA 3IGLA 4NUJB 2C1PB 1SRDA 4LFHG 1TEGA 3U0WL 5CAYB 2A9CA 5IR1B 3OQ3B 1ZHKB 5CNHA 2DBJA 2PWEA 2DAVA 4UQAA 3CDGA 1FC1A 1CYXA 2NXZB 4EI5C 3ECWA 1HIML 2ZYHA 2AQ2A 1T1WB 2WWOA 4NQVB 1YEJL 2GSGA 5KBPA 2NY6D 3F62A 1J9SA 3MREB 2AJSL 1QI3A 3S5LB 3W57A 5GZNA 4MTMA 4APXB 5J8OA 3KYNA 4ILDA 4X7SL 3EFOA 2XT1B 4RZCA 3QUMH 5IB4A 1NINA 3FTWA 3PWPE 5DJ2A 2GQHA 2V5MA 5C0DA 1TLMA 3AS1A 4HLZG 4KDTA 1FLRL 1WPCA 4HWZA 4MD5A 1TOXA 1EZUA 3G5VA 4HLJA 1NDTA 3ZTJG 4OLVL 4CGUB 3MYZA 5TTRA 3GJFB 3KWTA 4P2OB 5E24E 3NCJH 2BP8B 4DN4L 1EXUA 2BVEA 3ABLB 1FJ1B 4KMTL 3BH4A 4JFFD 1QSEA 3D50A 2VKWA 2A4EA 4RDBA 3V4UL 3FUEA 3GXFA 2FECL 5LGJA 1F45A 1IGIL 2XTLA 2ZCHL 1JPGA 4NO2B 2R0KL 4KK5D 1JHKL 2ZX5A 2QHLA 2DQHH 5IBLC 1QSFD 2YGNA 5GZND 2R1WB 4V1DD 4XBEL 2J5LB 3VWJA 4HZLA 4ATTA 3AAZA 1YY8B 3AMLA 5K1NA 3GSRA 4E0RB 2VXSH 1PLBA 4GXFA 1AD9B 3PHQB 5I74C 4DGVH 1Y18A 3Q0HA 3SE3C 5IWLA 4BFIA 1OD7A 2MQ3A 1RVFL 4Z7VA 5F0PB 1GGIL 1NGZB 3MLTB 4LP8A 3QEQD 4K8RC 4GG6F 2X70A 5KUKA 1JPTL 5JO5A 4MJHA 5F1KC 2A1WH 3BAJA 1G7QB 4XVSH 4DO4A 3C2AH 3K72B 1MI5D 5BO0D 1L5GA 1WBZA 2W5PA 1S7QA 3TO4B 2LGNA 2XCMC 3QJFB 2YFOA 3FQXA 5E2UL 1IBBA 3ILPA 1DZ0A 4FCHA 5GSRB 1OSYA 5PCYA 3VRLF 4B9KC 4Y16C 2XBZA 4PWEA 4R7NA 1QBMH 4HZ1A 2JIXA 3C8KB 4G43B 5DVMA 1HX0A 1XIWC 3JTSA 3EYUH 3P11H 1FZJA 3S34L 5FW6A 4IS6B 1QSFA 3G5ZA 4EIBA 3MODH 1DJSA 3FT0A 2WBWB 1EJOH 3H1ZA 4NQDD 1R5IA 4WTXA 1OAKH 4DP1X 5DUMH 2YBGA 1E8YA 2XG4B 2ZIDA 3O3AA 2R39A 4G6AC 3LZLA 4RBPK 4OKVA 4QF1B 4ANXA 3HB3C 2Z7UA 3CN3A 4K2UL 1T0NB 2ZKHH 5E4IA 5LAXA 2WBJD 4PHXA 4N2LA 5ID0A 5TE6L 4FQXB 4L05A 2CK0L 1JCVA 1UM5L 3BP4A 4QXGL 1ITCA 3T2NL 2APFA 3CDYA 3GSUA 3LQAC 3MDJA 1SDDA 4GMTH 4JO2H 5JIIA 3BJ91 2P7TA 4LVOB 4DP4X 2K8MA 1A14L 1ETJA 1E5UI 1JRHL 2JKWA 3O41B 4IIQC 1EFXA 3V6OC 4UM9B 2D2CC 3CFDA 3BP5A 4WVRA 4DW2H 2B1AL 2W95A 3LN4A 5I1LB 1T0MB 4PJFF 1XMEB 3VXTA 1JN6A 4I9WE 4YVNA 3OAWA 2RIKA 3I6KB 5C0RH 2GJ6D 4R2GD 2VLKA 5SWZE 3HKFA 4ODWB 3FRPG 1P6AB 3G5ZB 4IBTA 5IM7A 3HW7A 3INUL 4IEFA 4WEMB 5DRNA 4XPBH 1NL0L 1BCIA 15C8L 2YAPA 4QYOA 4ACTA 3LNEA 3RWDA 4JBSA 4OZHE 3NA4A 1I8MB 1E28B 4PBXA 2JIXD 1GGTA 2VLLA 3RU8H 2K0RA 2AF2A 1E7UA 5JORA 2D2OA 3L13A 1MCWW 2CGRH 5F9OL 2VSDA 5H37G 3SE3A 2EIDA 4FQXA 1UGKA 4Z7OB 2PKDA 3FT9A 2N1TE 3ZL2A 1E27B 4EKJA 3G5YA 4L8BB 1S5HB 2OPCA 2EDLA 4BCXA 1SBBA 5PAZA 4MQXD 3T4AB 3QDAA 1N8ZA 3ZGHA 1A6WH 2XOTA 4HGKC 2CO1A 2BNQE 1OK0A 3QHTC 4EDXA 2OXGB 5DJXB 4LHJB 4ZTPH 4X4XA 3BSZA 3ZTEA 2F8OA 3KL0A 2GEQA 2W88A 4H8HA 4NZUL 1I7RB 3AWEA 1JGEA 3U9PH 5JHDB 2OMUB 3DOSA 1IBFA 3IN2A 3FUNA 1P5VA 1FGVH 5FR3A 2VLRA 3GM8A 3BEVB 3QWRA 4HKXA 1FBIH 1O0VA 1ZPLA 5LBGA 4OD3L 3PP3K 1FLTX 3UJJH 5BS0A 1RFDH 3NCBB 1GIGH 2FB4H 4BH8A 4Z7IA 1CDJA 1U3HB 5M7QA 3NFPB 2UVFA 4C55A 1BEYL 2A74A 4N3UA 1ETZB 4X5XB 1XZ0A 2CRYA 5I1CL 2X5PA 5JW4M 4PRDB 2X89D 4L4VE 2ZYRA 4ORGB 4JVPA 7PAZA 5DJDB 3EKCA 4HXBH 5IBLD 1XZWA 3L4CA 4ODSH 4B9YA 3LYRA 4A1RA 4BFIB 4WUKL 3VX0A 1OTUC 3CN4A 1F1DA 3FJTA 2WKOF 4PR5B 3REVA 5DQ9A 2VXVL 1FFOB 1H15B 2XG5B 1QFWH 4FS0A 3H7LA 1DUYB 2PTUA 1N0LA 3V0DA 3MOBL 3Q6GL 4EKXA 5L4FA 3LSOB 1U8JA 3Q8AA 5D72L 5GRUH 1I9IH 1EAQA 3QDMA 3QEUA 4P2QE 1MAMH 4OSUH 3SKJL 1J10A 3HG5A 4F7CA 5F93C 3TO2A 2NZ9C 3DXAE 4M5ZL 2WBXA 4U0QB 5E9DD 2K3HA 3V6FB 3FN0H 1QEWB 2WTRB 1AR1C 1FUNA 1N26A 2DLTA 1YO4A 1IC5H 4ELKB 3OR7B 1HWHB 3FSWA 4PRIE 2OQJB 3GSVB 1RSFA 5FO8A 5AQ0A 2A6IB 4B41A 3QDGA 3OSVA 1NTDA 3VFSA 2K9UA 3BKML 3WJJC 2DQDH 2VTFA 1TO4A 4JKWA 4QXTA 3NDZE 3TN0B 4LVHC 1YEEH 3FCTA 5LNGA 2B08A 4QXTB 3DVFA 4NQCD 4YDIL 1S8DA 3ULVE 4XP6L 1ID2A 2R8SH 1WIOA 3EO1B 1HJCA 1AP2A 1F1AA 1BX2A 3QZLA 1UH2A 1G1CA 1F6FB 2QQLH 4PJ9D 2D9CA 2R4RL 4I3RH 4AI7A 1XV8A 3S97C 3VA2C 1IARB 5INCA 4AIZA 3K6SB 2VUKA 5D7SH 1EDHA 4QRRE 3PFQA 2FNWA 4PRPB 4PJ7A 3QJVB 1JOIA 1QO3B 5FWQA 2FIKA 3OZLA 4OTXH 2W9DL 3AT9A 3P0VL 3DARA 4PV8A 5DTFB 1T7YA 3D69B 3MA7B 3NSDA 4BQCA 1XSKA 3GSWB 1N4XL 1KYOJ 5JOPE 1DQTA 4WJG3 1JUFA 3VXSE 1D5IH 3N1MC 2PF6A 4O9HL 1RZKC 4ZW6A 3QA3B 5IQ9B 4OGAD 4R7NB 4XWGH 3VXUD 2QVTA 4M7LH 3PGDB 5ICXA 3QPQC 5ETUA 1O7SA 1DQVA 4FERA 2E27H 3ZRSA 3IFNH 2A6IA 5EZJA 1A6ZA 4G7YL 4J3OF 1P4BH 3TCTA 4YDNA 4N22A 4V2BA 4XVUD 1WD8A 4QWWC 5FHBL 3QIWD 3A4EA 5CZXD 1PS3A 4Q6IC 1FH5H 4XB3A 3ZDYE 2YLKA 4KGJA 4KVNH 2LU7A 4OIIH 3CDFA 4ODTH 5ELIA 2LAGB 3SDDD 1DEEA 4P4KC 3SYQA 4AUYA 3MV8D 1ITBB 4BZ1L 2CHDA 4N0CD 5E2VH 3FU9A 4HKZB 3Q06A 1KJ2H 5EU7C 1NMAL 5CILH 1T83A 3BVXA 4LASH 2X42A 3T9WA 3TX4A 1T2XA 1MPAH 4YWGH 1A7PH 4LAQH 2FGZA 3NQIA 3SQRA 4KJYA 2PWDA 5EWIL 3IN0A 3PWVB 3IVKA 1SHSA 4XVJH 1FN4B 4Y7OC 3PABA 4YHNB 5HGHB 4DGYL 1KJ3L 1QAWA 1MWAH 4Y19B 2D0HA 4HC1L 3FAXA 1BZDA 5E94A 3NIDE 2YQ2A 4GFTB 1T0OA 1N64L 1AAJA 1SYVA 2EEDA 3H0TB 1EFQA 2NY1D 3MN8A 4XC1H 4BWUA 2OMBA 2ADIB 4LBAA 5JXED 4J39A 4QYOB 2YKLH 3U7AA 3WMPA 4X6DB 3MLSH 1RERA 4LOFA 1D9KA 1TQVA 4NP9A 1TR7A 1JZ3A 1WFIA 3NESA 5FCUH 5BOJA 3BCFA 3NA9L 4MJIB 4HUVA 1IIKA 2VR7A 2YPKB 5F1SA 4TUOA 3K6FA 5FOBB 2QSCL 3GEFA 1A4KB 1Q9OB 4JG1L 1T0MA 3BGFC 2OL3A 2X53A 4FCAA 1X5FA 5C0CB 4U31A 1X7SA 3E1F1 12E8L 4FLOA 2FX8H 1MREL 2R2EB 3BQUD 3VXMD 4DOHB 2YZ1A 5E2WL 1GTFA 4CC4C 3QUKB 1FP5A 3CU1A 4G70B 4ZMOA 5FFGA 3D6GA 4WWID 2Y22A 1ZTXH 2WXIA 5TDPA 4ANKA 4Y19D 4K94L 4GEIA 4TQPA 5E99L 4M8UA 3VXRA 5JPNB 5AVQB 2FEDD 2NNFA 3WN5B 2IDCA 3EO9H 3VFGL 3H2WA 4G8IA 3NP3A 3OB0H 2X4PA 3HI6L 2NUPB 1I75A 4CDHA 1HEHC 4MAUH 1WWCA 1FIGL 2EO7A 4FKHA 3L4UA 4I9XA 4JM2A 4XB8A 2OMYA 1ZA3A 3MV8E 3UBFA 3KCPA 5DU7A 5IHUH 4LNRB 1MH5A 1MCWM 5BRQA 3T2LA 3QDJE 3WN6A 2YMXH 5D9SB 3MV11 1M2VA 1HSAA 4WJ5A 3T77B 5L2KB 3WUWG 4UDUA 4HUCA 4KHTL 2ICWA 1FGNH 1DSFL 4IRJC 3TLRA 4M5YL 4ETQA 4AEFA 3TJEH 4N2FA 1F8TL 2WNKA 2Z92A 4O2EB 5FIEA 3V6ZA 5I23A 4OZ4A 4IRZL 1CG9A 4KKBC 5C08E 2QV2A 5J11B 3O0LA 1E40A 2XN9E 4DSYA 3AB0B 4JCMA 3WJMA 1BBDH 3GIZH 4PJ5A 3GSXB 1PZBA 2R0WH 1EXGA 3NIDF 4NSKA 3OX8A 1IEAB 1CDGA 2NQCA 1XFPA 3QUZD 2XWCA 2R9HD 1JNNH 4ZUTB 1FNLA 3T3MB 3DJZA 4P46A 1I1YB 2VXQL 4TUKL 4WFED 5HDOA 3T0VA 4BE5A 3E8UH 5DVPA 4DP6X 4U3CA 4BRJA 2B20A 5EOTB 1KWKA 3S2CA 5DHXB 3RURA 2BOLA 1Q4NX 1G7PA 1KBPA 5KVGH 2Q20A 5L6YH 5IW6B 4KKLC 3AQYA 5D1QA 5EBLB 5IJKA 4PWGA 2XDHA 1R5VA 4KNUA 3BZFA 4S1QL 3L5XL 5HJ3A 4P3CH 3UTQA 3V5KB 1A1NB 3WD5L 4PRHB 4OF0A 4YUEL 4N85A 2R1XB 4WI2A 1FO0A 4TYUA 1TJXA 5KSUB 1FO0B 2DRUA 3CCHA 5HY9A 4CW1B 5A2JH 2J2ZB 2FH8A 1HAWA 4NNPL 3EH1A 3GJFA 2GJZB 1OWWA 5DJZB 4ZS7L 4U0RC 2R7EB 2A9DA 2B7DT 5KANG 2AKRA 2ENYA 2G5BB 2WINB 3EFDH 3P3SA 1FVCA 4KXZH 5ISZE 1KGCE 4RAUB 4K9EH 4KTEL 1J1XH 1LDPH 2WGXA 3BPOB 2L8AA 1SQMA 2GVYA 6FABH 1NDMB 5K9KB 4KV5E 2YGQA 4D8PA 2EDJA 2IANB 4JDZB 4B96A 2O61B 4NKOA 5T5FL 5E5RB 1R3KA 4Z3HA 1ORQA 1NCDL 4GQ9H 1X4YA 2GJ6A 3ESNA 4DJMA 3OXRA 1AE6L 4GUOA 3RZCD 1MJUL 1UHVA 2BVQB 3I3BA 5CCHE 5CXPA 3JXAA 4KXAA 3QAZC 2IDFA 5HI5D 4KXBA 5KYWB 4WI0A 4I18B 3PXJA 3KYOB 3K3QA 4MA8L 5E2TL 4AEHH 3PDOB 5F6HJ 4UTBL 3FO0H 5DYOB 2IGFH 4U6XB 4Q74A 5LBSH 5E0QA 1A2YB 4YHIA 2APXA 2WVVA 4TQHA 3BKCH 1CO1A 2EP6A 4U3SB 1VENA 2MOGA 3DHJA 3V4VH 1IGCH 3VWKD 1PL3A 1XO8A 3BFQG 2ESVB 2UZIL 3FUIA 2LAAA 1KBGL 1YMMA 4YN3A 3C5ZB 3B3BA 1R3HA 3EO0A 3L7EB 3DROA 4GW4A 4YPGB 5D93C 4F7EB 1KJMB 2CU9A 1Y6NR 4QMEA 5JXEC 4NQXB 3JYBA 3N2JA 1QRNA 4ZX3A 4GS7B 1QBLL 2Y4SA 5JNYB 5DC2A 1CDIA 3X3GH 2XWDA 1P53A 1NOFA 2VLJB 4AJVA 4NQSB 4OF5A 1BVLA 1I8UA 2WN2A 3BH8A 3MRMA 3QIUC 4KWUA 2F53B 3QC5X 1KFAL 4X7CC 2DTSA 3T1FA 1CCZA 2AABH 4LXFA 3RJDA 4G6FD 5FB8A 3JWDH 3TVMA 4G59C 2K6WA 2NYYD 3V0HA 3VXMB 2BZCA 4TUOB 1D5ZB 1OT2A 4QRPA 4GFXA 3O8XA 4N2CA 3CSYB 2Y7QB 4LVHB 4OJDH 1KV7A 3DX1A 5J56B 2VAAB 3V4VB 4ZPVA 4ORZC 1GKOA 3WIIL 1RUPL 2WZPA 2VXUH 2GK2A 3FB5B 4Z6AT 5CN2A 3O4LD 4KJQD 4G6JH 4OCRL 3S7GA 1DJXA 4YHLH 3PDOA 1IT9L 5JXAL 4H0IA 2FL5B 1DBMH 1I1FA 4F33B 4Z76A 1OPOA 3IMRA 5EEVA 2ADGB 5DZAA 1SF5A 4LQ1A 1ECZA 3I85A 1C8PA 4Y8AA 4CC1A 2WYTA 3PV7A 4UT9A 3Q2NA 5KVFH 3FCGA 3ZGIA 3CH1B 4W9FC 4FQPA 1CF8L 4FQIH 4M93B 2NY3C 1QFWI 1HOCB 2B59A 2H4EA 3KAAA 4XMVA 1Q9KB 3S3PA 4B3VA 3DX9B 5K9OB 3DV6A 3QNYA 4OGAC 1OAYH 4IRSC 2QMKA 1KN4H 4O2CB 3MNWA 3RAJL 2IMNA 2YPKA 1VACB 1IBDA 3QEGH 5BZDA 4PRIB 3VG0L 5T3XE 5CLWA 2XHNA 3ZHKA 2HUEA 1XH3B 4G42A 4F2MB 3GUFA 1I7UA 2JE8A 4YDLB 1QQDA 1F00I 1Q90A 4GKOA 4XNXL 4CU6A 1AYOA 4BZYA 1C1EL 4DKTA 1N18A 2HXAA 5MEOB 3FK3A 5C3IA 5F1IB 5ACZB 1UCBL 3KR3L 5F1NA 4YNYA 1XGRA 3CBJB 1OZUA 3ATBA 2Q87A 4PW9A 1N19A 2AQNA 3ELAT 1ZA6A 4JVUA 1WEJL 4Y16B 5K1VA 4HQQH 4JKPH 1BG1A 3GKWL 1NMBH 4YHPB 3VFNA 2FJFA 1WJ3A 2R4SH 3T6VA 3H42H 4XNMB 3OJDB 4FEMA 4L23A 4UUJA 3KPRA 5D1XE 1MJJB 3DVNA 5ANME 5BQ7A 4N0FA 2H0PA 3BPOC 4AYEC 2PO6D 5FYLE 4YDVA 2H0FA 2B59B 4Z7NE 1RU9L 2XV2A 4L1BA 4ZS6C 3BKJH 3VAEA 3RPIB 1NICA 5I66A 3US0A 3J8F7 5C0ND 1FV1A 5T1KB 2BFGA 2VIRB 3MBEC 4G6KH 1AR1D 1JHTB 4F9LA 2PCFA 5EIIB 1V5JA 4R90H 2IIJA 4K7FA 5GIRA 1VEOA 3FUFA 3H2QA 4JDEA 4JHWL 3W82A 3NFNB 3UEQA 3PAVA 2EDBA 2JELH 4AEIH 2HH0H 3CAFA 3OHXA 3IDIA 4LOVA 2A38A 2F9BT 4PJIE 5FHAL 4K23L 3SE8L 1CIUA 3VFRB 3RFZC 1QLEL 4BCYA 1T1XA 5KS9E 1OAJA 4XOAA 2R69L 5EBWB 3NN8A 4XP5H 4H88L 2Z35B 2ICEC 1FG9C 1R9FA 5T1KD 2H1PH 1AZBA 1TTGA 2YSSB 5DEZA 2A9AA 2EKJA 3FKUS 4FFYL 2V7HA 1UQSA 3LCYA 3UYRH 3VWKC 1HEJC 4MMZA 3ARBB 4UV7L 2N56A 1OAUH 3O6FC 4RMTA 2EVFA 1S78C 4QJ3B 3O9WA 3VGGA 4XAWH 1QA9B 3TVMC 4LRNH 1MFMA 4C8XA 2FO1A 4N1CA 4DPAX 3KLLA 3JTBA 1CLZH 4HJUA 1A8JH 2VDPL 4L18A 1QZ1A 3TPUA 2H1LM 3MV9D 4MRBA 2NMSA 1T5KA 4GG6B 4PREB 1F41A 4JAMB 3W0WE 1JZ7A 5FA3B 1JVLA 2VDKH 3QPXH 5I75C 3U9UB 5E95B 4TNGA 1E0OB 3ZKMC 4WFGE 1JXDA 3B5GA 3B7SA 3NCWA 2X9ZA 4XX5A 5DURD 3TWCL 4CMMA 3JTTA 2XG5A 4ONGH 2VIRA 3O6KH 4R7DB 1KC5L 2XY2A 4PR5A 1J9QA 1T5XB 2OJ1A 1MFCH 5ABAA 2DF3A 1GVIA 2HUHA 3F64A 5DD6A 1R46A 5AVTB 3STLB 3UTTD 4HMEA 1IBGH 3IAGC 3GLDA 3HC4H 2QKIC 1YA5A 1ZD6A 4F5CA 4LFHD 2LV4A 4UCFA 2ODIA 4NRZB 1A4AA 2L7QA 5BQ7B 1MJ8L 4LLQB 4WHCA 5C0BD 1CFQB 3H9SA 1EGJH 2ZXEB 4M9OA 3RBSA 3K6IA 3V6FA 4M03A 1U36A 3FTXA 4ZMTA 4I0PB 1NGQL 4JZJB 4I0KA 4PJHE 4MNGE 3L95B 1O7DE 1TVDA 4PLOB 5FYJH 4KPHL 2VL5B 1W91A 4GUPB 4P5MB 1T80A 1MF2H 4OD2A 5CZRA 4HJSA 3S8GB 5I8KH 1JFHA 5E94B 3ARXA 5BRZA 3RP1A 2FZ3B 3QAQA 5HGAA 4IRSB 1JS4A 4NC0B 1IKFL 2PYFB 1NH6A 2BP0A 1OSZB 2BXYA 3DTUB 5JIKA 2VR4A 1ZLUH 3T65B 2CPCA 4JFXB 5IFHH 4YK4B 4KI5E 2ZWNA 3BW9A 1MFNA 1PF3A 2ZG2A 2YO3A 4URTB 5HHXH 2EUZA 1CFNB 1HDMB 1E4XI 2BERA 1OK8A 2E9BA 3GXNA 4LIQE 3O0RH 2Z4QA 2ALWA 3K1KC 1MRDH 1CC3A 3L9RA 2IOMA 3LN5B 4WSKA 2PO6C 5DVNA 3SY0B 1QKZL 3GJEA 3VJ6A 2Q6WB 5TDOA 3GMRA 1AFVH 5F89B 3CBKB 4L4TA 1GY1A 1PLGL 1TJHL 2L0DA 4NBZB 3NOIA 1IAIH 1XGZA 2VLKB 3PG2A 5C0AA 1ZLEA 1IZJA 1Z9LA 2O5ZL 2QKIA 3APCA 4NUGH 5E6UB 5AAMC 5EZJB 2AJXL 2N3JA 2WLYA 1L0XA 1LLAA 3QUZA 2VLJE 1IFHH 2ARJQ 1WUNT 1XR8A 2HFTA 5HGBB 4Q2ZB 1K5NB 1KLGA 1N68A 4WDIB 5DHDA 4UQEA 3M7FB 4HDIA 5HHMB 2X05A 3CLFH 4PY8J 4YO0B 5F7FA 3ATFA 4PGDB 1DSYA 3WL9A 3IBOA 3UBXG 4Y9EA 4DGIL 1UM6L 3DX7A 3BDYH 3GMMB 4LPVA 1ZJAA 4BXSV 3MRDB 4A2EA 1TCRB 1RKRA 1NEZG 4GXUN 3WE1A 3FF7A 2IQAB 4ZFOA 5DJ8A 3BZDA 3WY2A 3GTVA 4QGYA 5ILTH 1OHQA 3NEEA 3MRCA 4XNYL 4Q9QH 1OOAA 2AV1B 2HT3C 2V7NA 4P23C 3B7YA 4WK4B 1VJSA 4F7EA 3T6XA 4F57H 2F8VA 4C56B 3MFFA 1MY7A 4A7QA 4Z78A 1FAKT 4APQC 2GK0B 3MFFB 1FNGA 5AUMA 1OOWA 2CIKB 1DQQB 5KWYC 2YAHA 1EX0A 1RZFL 3W2DH 3S4SA 2DI9A 2DKUA 3C8KA 2X4PB 5ETUB 4ZMZA 3F7PC 2ICWI 2DW5A 2ZOKB 3KYAA 4X6FB 4FQHB 2QHRH 3WKNA 3SGEI 3VFUB 4DESA 1SUJA 4KH9A 1J5DA 4KRPD 3WNJA 2WGNB 1IKNC 3LY6A 3ZR6A 4MWFA 2HFGH 3FT1A 1WHPA 3G6DH 5CJ8A 2ZYSA 1AGEB 3TBSA 1YEKL 3RWGB 4LL4A 1KCWA 1J5OH 1D7DA 2G4GA 3QDJA 4A6YA 1INEH 4XNZC 5I1KH 7FABH 5HYFA 5ABZA 1FO0L 2AJVL 4HXAL 5JHLL 3WYRA 4J27A 3PWUA 3PFUA 3EHBB 4Y4HD 4YZFF 3NCFB 3FB6A 4GB9A 5DS1A 4WK0B 2R29H 5DD1L 2X4TB 4KQ4L 3NACH 2HLAA 2YWYA 5DO8A 3EFFA 5ES4B 1BVNT 2VSMB 3QIWA 4A2DA 3FAWA 2OTPA 4G5AA 4LEOB 5AOKA 3ZE2B 4Q58C 3GMLA 4MSWB 3C60A 4N2AA 4MMYA 1HL4A 2R7EA 1J8HE 1ZANH 5AZUA 1SJHA 2F74B 2H6OA 3RWHA 1IBHA 4EI5D 3EJUA 3LDBC 4WW1A 1D9KC 3CUPA 1UD6A 1WBZB 2HT3D 1L5GB 3ZL4L 1N6QH 5GZOA 1I7ZB 5CO1A 2GITB 5HGHA 3MJ9L 1DO5A 4PJCA 4ELMA 2X6UA 1FZKB 1SHWA 1HINH 5ERWB 5FLUA 4X6CF 4JDEB 2ZP9A 4OZFA 1PPIA 4X42A 3UTQB 2KMWA 1NSNH 3E9TA 3QCTL 4AOFA 1OSZA 4H1LH 4QXUL 4PJAE 1UD3A 4PMEA 4W9CC 4AYDC 1CLYH 1IGYA 2XN2A 3VXUA 5TPWH 1YECH 4B0MM 4HP5A 1AMYA 2XA8L 2JLLA 2VN7A 4UV4L 1ZGLA 3UCQA 3PGFL 4TVSa 2GABA 3CZFB 1USQA 2H2SD 5DJ0B 3ZLQC 3BVWA 3TEUA 2OZ4A 3GT6A 1XF1A 2OM5A 4QAMB 5DVOA 5K5YA 4M1CC 4L8CB 5FDYA 4JY4B 2WSDA 1DJIA 1NCJA 1PMYA 2P8MA 3A6CL 4HS6B 4NKIL 5E4AA 4ZUTA 1G7JB 3KPPB 5LGHH 5DFTA 1UKSA 3ZBMA 1G6VK 4OCWL 2HJLA 2GPZA 2ZJSL 1OV8A 3F6JA 4FQJL 4R4BA 2ZXAA 4Z95L 1Q0YL 4UIMA 2DM7A 2FHFA 4R96A 4Q6IA 5CU9A 2XXMB 1JNHB 3BQUB 3GMOA 3Q8EA 4HWBA 3L7FA 4OQ1A 4OD1H 3D30A 3HCVA 3KWXA 5D55A 1GTNA 4OFKA 2F74A 2YQGA 3D33A 4G7VL 3R1GH 1RK0A 5FYLL 1MEXL 5D7EA 3THMH 2DM3A 1E4XL 2CJUL 1ADQH 4EIUA 1KB5A 3JWOL 4XP9L 1FAIH 4L5FH 5D9SA 4GIOA 1E90A 4LB8A 2DIEA 4TVPD 5DYFA 4ZPTB 2JKTM 5MI0B 4A7VA 2QPFA 4HUMB 5CCKH 1MKFA 2VO5A 4Z3IA 2PWGA 5HVHB 1C12B 2WNGA 5EB9A 5D71L 3WIFA 3AREC 2I60H 1DN0A 3II2A 4GP4B 1TYRA 1XF5A 3HS0B 4J4PC 3F5WB 3LSOA 1BJMA 5TDPB 2HG5B 5CSBA 3TIEA 1PKQE 2H0EA 2R83A 5EA0L 3Q5YA 5GGQL 4GG6E 1HCVA 4MD4A 4MMZB 2OJEA 3ZSSA 3PPEA 3WU1A 2V5YA 2CQVA 4XPGH 1EK3A 2VZ3A 2AQRA 3GK8L 4QRQB 2WLNA 4DEPC 3SQOL 1UFUA 3MUJA 3BXNA 3E7JA 1CT8A 1ZIAA 2CDFB 2XWJA 1PG7L 5BW7A 2NY5L 4WO4D 5JUEL 2PTTB 1TETL 4XX1E 2UWEF 1NBVH 1Z5YD 2DJUA 2ZOUA 3QRBA 3VXMA 4PJDE 1SEQH 1GC1H 1X5KA 4CRPA 1EVUA 2DQEH 4Z7WE 2BIIA 3PRZA 2CE6A 1TKWA 5D2NE 5HDBB 3ARRA 1U8JB 4Z7QB 2F68X 2O6DA 3L6FB 3K74B 2ZOOA 3GSUB 2B14A 2H32H 4B6ZA 4FNRA 1F02I 4P05A 1ACYH 4JPQA 1N7ML 1KJMA 2OI9C 5CS7A 4NO3A 5F6IB 1AGBB 3PE9A 5BMFH 1R3HB 3EO0B 2HX9A 4NQTA 4AQZA 5ESAA 4ALAC 2XBDA 5EC1A 2BY2A 5GGTL 5KVEL 3WTVA 5K59F 3ZZQA 5JW5B 2BOBB 1ZE3C 3BWZA 1E6JL 3V9FA 4JPWL 4GXVH 2HRPL 1AVAA 5FKAA 3FUHA 4BFKA 2G3XA 3RWCB 3FULA 5DRWA 1FI8C 1YSOA 4ZSOB 2NT1A 1FNEA 4NENA 4GRWH 4FXLA 4Q0XL 3WFDL 2XPYA 4I4WA 1KFGA 1XGUB 5FDWA 3ES6B 1I7UB 4KDWA 4N4YB 2K45A 5KYWA 4NQEE 1G1KA 3APDA 4J28A 4G42B 4F2MA 2LFGA 2XC8A 5IJKC 3Q9PA 4OZIA 5E1AA 4ZTEA 2J8UA 1XH0A 1OE1A 3RVUD 5JO5B 3KGTA 4FTVE 4IBQA 4NT6A 1ULVA 4MD5B 1T5WA 2OK0H 2VQ1B 4YX2L 3N1PC 5C0DB 2VMFA 3MRGB 5F7HA 3FHQA 4P46C 2EIZB 2WZAA 4YC2B 1DO6A 1CFTA 1OM3L 4NQCB 2LQRA 2E8ZA 1EO8H 3NDYE 2BIQA 4F24A 3ULUH 4DKAA 1U8MB 1G0DA 4QHKI 1J9TA 1DQDL 2BVPB 2MNWA 4R97B 1QTPA 4LEBA 2EIBA 4HUNB 3NSXA 3NCYS 5IVXE 5MP6H 1UJ3A 5D1XC 5FS5A 4EI6B 3JZYA 5CWSB 2FR4A 3PAZA 4BYHA 2Y2YA 5F7EH 3O9WB 4R7LA 5D8JL 3A23A 2FD6H 2N01B 1BFSA 2EDMA 2V0AA 4W9GC 4AL8C 4EN2A 1JZEA 2AFNA 5HVFB 1HHIB 1CVSC 4K07A 4XCYA 2Q3ZA 3WFHA 3KJ4C 4Z3JA 2V2XB 2CWRA 2RD0A 4JM2C 5DQJB 3P73B 4M1CD 1MCPL 4Y2OA 5D6CB 4H8QA 4IGBA 3EH5B 1T1XB 5DJ6B 1DBBL 5F3HA 1QFPA 3JUYA 2GEEA 3JT2A 4N24A 5AAWC 3QJFA 2K4AA 3EFOB 4FFZL 4IRJB 4ODVH 5IMKA 4JG0H 4NUMA 3CFTA 3T71A 1HT6A 3C6SA 4X8XA 5EOQH 1TQCB 2F53E 2H32B 2F19L 3A67L 4KU1A 2CAKA 4AE0A 4K3EL 4CC4A 1AO7D 4OLYL 4UTAA 5AVUB 3V4PA 5LCVH 3ZRCC 3CQPA 4DUXA 4XNBA 4HKBB 4EVNB 3N44B 2P5WB 4S1RL 2Q5BA 1CQKA 3BT2L 3D1MC 4KFZC 1UFGA 1WWBX 3P4MA 1A6TB 2AQQA 1FV1B 5AWNL 5T1KA 1QSFB 2GJJA 1R75A 5GHWH 1RQ5A 4Y4KB 2H45A 4W81A 3UTSE 5HVGB 1EAPA 1KGUA 4QJ4B 3P69A 3FTGB 5HI4C 1D7BA 3HC3L 1FZMA 4BH7B 1TZ8A 5I1GH 4D0BA 5C07B 3HRZA 3SJVB 3QEQA 4KZ0A 3VFRA 1KIRB 5BZWA 3UAEA 5ACZA 1A6UH 3GS4A 5SWSA 4UNIA 1NCAL 3SE6A 2VOTA 3MBWB 1OVZA 2WIMA 1LEGA 4Y2DB 2DYPB 4BKLB 4MJ4A 5E08L 2WKOA 2XTJD 3ZT7A 4Y4KD 5ADOL 3T2QA 1RZ7L 1J9RA 2WYIA 2OR9H 2VW7A 1CTNA 3G6JB 3WY1A 3CX5J 4MNGA 2A7BA 3GD1C 4O2CA 3UG4A 4X7DC 5IWLC 4KKAD 4JFZL 3O8XD 4HUUA 4N6QA 4XO9A 1KBKA 1BZ9A 2W0KA 5A7EA 4FFZA 4R2GB 1CGVA 1U8PA 1WCBB 2RBLA 3Q44A 3TOPA 3VWJC 4KRMB 4WFHD 1T6VN 3E2HB 3QWOB 3HE6B 1V7NH 5F0JB 4X83A 1U8LB 2D7TL 5GXBB 2Z9TA 2V3EA 2WC7A 5DFWH 5DQDH 1N0XH 3D5OF 4O02B 4NN5C 2W81C 3DJSA 1CGTA 1U33A 4LSQL 2DYPD 2ITCA 1AS7A 4TPRL 1SF3A 2DY2A 5C0FA 4ADGA 4JY5L 3VACA 2DIAA 5FKAB 1CL7H 1JWMB 2NZIA 1HQRA 1UJTA 1GZPB 1J5HA 4LKXB 4N8VA 3HRZB 1YNKH 5FUOH 1HL5A 2VC2H 3RVTD 1GW0A 1IM9A 3D85B 3OJVC 2LHAA 4YXHH 4ZUUB 2ATAA 1RZJL 4YFLF 3ARBD 5JIQA 2YRPA 4LCYB 2EABA 4X8JA 5SWSD 4AIOA 2Y07H 2FQEA 5FYJD 3IXAA 4HPYL 4I77H 1SQ2N 4TKWA 2FEEL 5FO7A 3KJ6L 3ECVA 3L3KA 3QCVL 4XMKL 1C16B 4NBYB 4MNGB 1C9SA 1JF5A 4N0YH 4PJ5B 5A2IH 3SGJC 4JO3L 3WJMB 5BV7H 2G75A 4OIBA 4NZTH 3OAUH 1CR9L 4ICWA 3UCRA 2G75B 4CADA 3JZ7A 3T0XA 2AJUH 3ZHLA 3DVIA 3BPNC 1OHZA 3B8YA 5KYNA 1LO2L 3LIZL 4PGZA 3FT4A 1L4IA 3CGTA 3WS3B 5C3LD 1B3IA 2X4QA 1MFDH 2F58L 2VDMH 2AXFA 1ZV2A 4L1HA 5DUPH 1KSRA 5D2NB 3FN9A 1QPXA 1INDL 2VDQB 5AW6B 3U4KA 2CLRA 4ZPVB 4R4FH 3K0WA 4M62L 3II1A 3QIUD 4GBXC 5IOPB 1CDBA 4LCCA 5I17B 4MMXC 1JAEA 5D6DC 5F3BA 3GNMH 2X44D 1HSBA 3BHBA 4UQ3A 4HIHA 5A2FA 4NYLB 3W0WB 1JTTA 2YKKA 3POHA 2V9TA 4WZ9A 3GRWH 2OTUA 4JVWA 1REIA 4BSJA 5D2LE 2EVHA 1TEFA 1L6XA 3LHPH 4JG9A 4UNVA 4CSZA 1JPSL 4AGLA 1IC4H 5FO7B 4OH2A 2BMKA 1ZV9A 1I8LA 2JQMA 2Y06H 4F7MB 3EYQD 1ZTMA 1I9RH 4WLCA 1WRFA 4P4KD 4GW1B 3RI5K 2YN3A 4XNAA 2HAZA 1JMXA 3HS9A 1JZGA 2HJKB 4YLBA 2V17H 5EF1A 5E9AA 4D8PB 1H5BC 3PHQA 1NDMA 1SEBA 1WE5A 4XCEA 4MXWH 2G2RA 3LH2L 4I85A 4UZSA 6CGTA 5LVEA 5LWYL 1X5LA 1C5BL 4JN2A 3DHPA 1J8RA 1ID5I 3WKPA 3RWIB 1G5AA 1IX2A 1KG0A 2E0PA 4Y4HB 4YFLI 3DGDA 1RZKH 2LW3A 4QY8B 2YN5A 1IZKA 3SDDC 1JWSA 4WI0B 1AY1L 1L9RA 5ICZA 3O3UN 5IMMB 2AJ3A 2MCPH 4BFFA 2YR3A 4NQCE 2VDOB 1SXZA 4ZX6A 3QZWA 2F5AH 3U7YH 1NFAA 1G6RH 4C4KO 1ND0A 2UXVA 3LTVA 3FTUA 3G5VB 4XN1A 2ITDA 4XOEA 5DMGD 4BWTA 4CSTA 1J0JA 4FNLH 4OCLC 1LO0H 3PUUA 4HBCL 4FXKA 1C5BH 3TZVC 4K73A 2EDRA 1JPST 3QXTA 2LTQB 1A6TA 2ZCLL 3LH2H 5LDSA 4MXWL 2IG2H 5CGBA 1WG3A 1URLA 2SEBA 4LLDB 4Y2DA 4BKLA 3NRQA 3ETSA 2PYEE 3O2DH 5D1ZB 2Q86A 4Z77B 3E2HC 3N0PB 3AY2A 1AS8A 3KWWB 4IMLB 5GZOD 3UTZA 2C9QA 4K7PY 5HJGA 3IGAB 2Y06L 1KJ2B 4Y2LA 5IB1A 1OCWH 2BOCA 2CO2A 1UWGH 5CLTA 4FLHA 3SJVA 1XGQB 3VI4A 3CCHB 4W9KC 3DUHA 2V37A 4NAMA 1A0QH 2L04A 1VIWA 5DHVB 5E6YA 5EORH 2D0GA 1DQMH 1KCRH 1WP6A 4LLMB 4GLRH 3LQAH 4K71C 5AKTA 2E86A 3IF1B 3O8XC 5FGBA 4YXLH 4Q4IA 1EO5A 2F54D 5SX4I 1ACZA 5B1AB 4ZZKA 2CIKA 4FULA 3PQYE 3IFOA 1TVBB 1LD9B 4OAWB 4QO1B 4Z23A 5K9JH 1OSEA 3JWOC 1IAMA 1J8HB 1YEWA 2AZAA 4Z0BH 2K78A 3ZE1F 3BN9C 4KX9A 3ZTDC 2JFCA 4LSRH 1G7LA 1S6NA 1AHWB 5KJRH 1NFDB 2VDML 4Y4FB 3ARDD 4LEEA 2FSEB 2KERA 4JZOA 2WO2B 1QUNB 1BM7A 1WHOA 5DFVD 4Q6KA 2WB1A 3OV6A 4MYWB 1D7CA 4FP8H 4X98B 5DJCB 4K55A 4X7EC 4GNKB 4EZJA 3CZUB 5JXEA 1S5IH 1MZYA 3ATAA 2E76C 4WI3A 3VSQA 4U1SA 3WN5C 3OAUL 2YHGA 3HBQA 3ZKXB 4WEBL 3D3VD 3EXLA 4YO0A 3HS0A 5HDRA 1CG9B 5ACMA 1DLHA 4OJFH 1DJYA 3KJ6H 4J3OC 1DN0B 5KBNC 2XIDA 5C7XH 4ETQB 3BUPA 2Y07L 4FMVA 3IJYA 2N7AA 3P9MB 2HB0A 5GS0C 1A4KA 1Q9OA 4HYTB 3WNIA 3RTQC 3QPQD 3VD5A 3WSQH 1SPDA 2ZX8A 4P48A 4UDTB 3C6LA 4LVNB 2VITB 1MH5B 5CGTA 3D85A 2HT2D 3PNRB 5FUOL 4BFOA 1EEZB 1O6TA 3OKNB 4ZG1A 2ORBL 1HL8A 4UQIM 2YWZA 3LVTA 4TF4A 2OXHB 4WWNA 1L0YA 5IBUG 4N1EA 5H4YA 3DRQA 2O6PA 4JY5H 1NFDE 4AIXA 3ZTJH 1XR9B 2BVPA 4FABL 3O2VH 3MJ8A 4M43H 5AKRA 1MW2A 3MLYL 2L4OA 1T1YA 1FYTD 4FNSA 1N0XL 2BJML 3G7TA 3JWNC 5DQDL 3RL1B 3MACL 4OVVA 3GZQA 4MAYD 4XMZA 1QW9A 1R3IH 3HAEH 5DUBA 5TE4H 3TEYA 3HE6A 2J1WA 3ZO0A 4UT6H 3BP6A 2QEJA 3V95A 3RPKA 3DSFH 4NHCH 2J5LC 1E2VA 1QFOA 4HS8H 4MA7L 4RGMB 3OKMA 3EHBD 5KUMA 2RAMA 2FCBA 4K5OA 1CQYA 1NAMH 3D4GA 4KO6A 1CTMA 1MXDA 3NZHL 2B39A 3MMEB 1HCYA 4PSPA 5AZ2H 5LAPA 1Z6JT 5I30L 1HHKA 5ADOH 4HOMA 4F58L 3CTTA 5E08H 2E9IA 3G5XB 3NK3A 3B7RL 4HEPA 1W9XA 3M07A 3OHMB 2JKJA 3IJEA 3FTSA 5IHBA 1B4JL 2Y7NA 1BSIA 3H6AA 4PJXF 3AW5A 4F7KA 1HH6B 5FFOA 3H7BB 5H37A 2TSBA 4I1RA 3VU2A 2APWA 2P46B 5D1QC 3L3IB 1JI2A 1MCQA 5IW1B 1ZTXE 4GKZA 5KYUA 4B9CA 3QVAA 3LB6D 3WNOA 1Z9PA 4YHOL 1MW3A 3DX8A 4N2DA 1AQ8A 3WTWA 1FCGA 4YR6A 3HC3H 2WWKO 1L9MA 3OXSB 2BFVH 5D7LA 5E1HB 4CAGA 1I7TB 3VGDA 1A3RL 2VWEC 5B39G 1YNLH 3SDAD 3T6QC 2E7MA 2OMWB 3S35H 5J06A 1CFSB 1J05B 4AG4L 1TMCB 3GSWA 4PVMA 1FDLH 5DZOA 1Q0XH 2BNRD 2VDLB 3RGVB 4BGDA 3VWJB 2HX7A 2EXWD 4EI5A 3MO1A 4XVUC 3UOAB 1BAGA 1T03L 4HULB 1MJ7H 4LLYB 4GAGL 4XMWA 4E9XA 1BG9A 1EVTC 2QPSA 3L4YA 2GBTA 4YSTA 5LCVL 4BQ6A 4RCAA 3TBBA 4GSRA 2K6ZA 5K59E 1LNUB 4DPCX 1LE9A 4P9HH 3U2JA 2PCYA 3MV9A 4MCMA 3RA7H 4P23B 2ZKMX 4WY7H 4JG0L 4PBVC 1GZHA 4FFZH 2GAZA 4Z7UB 4IHBA 2Z31A 4IDJH 2YSSA 1MQKL 3WS6C 3D4YA 3DIFB 3UTPD 2I69A 4TMPA 3LEVH 4FQHA 1FL5B 2AANA 2YD3A 5LO7A 3WLWC 2ZOKA 1U3JA 2H5UA 3HR5B 1KB5H 1KIUB 5J13B 4UINH 4OF7A 5DRZB 1GAFL 3CD4A 2X3AA 4UYPA 3PYCA 4DP2X 3NIGB 2I9LB 4PS4H 3HUJB 4JN1L 1ES0B 2G0LA 2WZ5A 3CHXA 3WLWD 5CJ5A 1PNCA 3LS5L 5D2LB 5CUSL 1LK2A 5I5IA 3MREA 4R8WH 1RZGB 1UADC 4KGLA 2PPCA 4BKSC 4N28A 5MP6L 5I6MA 2DOCA 2FH6A 5I6XB 5C09E 2F8IA 2P80A 3Q3GB 4L9LC 4AC2A 2Z93A 5EUKB 4EI5B 2J88H 2XJKA 5DCCA 5DWPA 1TCMA 3F83A 3S3DB 3SCMB 1DQLH 3VD1A 4X2UA 1U91B 3VXQA 3QJOA 2MPVA 4LSVL 3IBEA 1CFTB 3KW8A 4PJ8C 4S0SD 4DETA 3QDGD 4JFDB 4U6YA 1Z9OA 4OLXH 2EXWC 3P1VA 3PWNA 1S3RA 2H6PA 4RMRA 2MRYA 1WFTA 3DIFA 1S9YB 3R18A 5B39B 5F7UA 4PG2C 2FECI 3B9KD 1L9TA 3JYCA 3EYSH 2OS7A 5CUSH 5TH2A 5I18L 1U3HA 5B1CA 5ITFB 2GCYA 4RWYH 3E3QE 4MXVE 1JI1A 2K3TA 4PS4L 3HMWH 1XGUA 4LIQL 3M6DA 5GJSH 1YLBB 4YDKH 1GAFH 1J8SA 2XXGA 4IBYA 3B9KC 4Q9CA 3BVUA 5T8IA 3O3BA 3K71A 1XGTB 2XKUA 3NCXA 3NCYP 4JFDD 1A3LL 3QEQE 3DK2A 3DJTA 3RY5A 4L0ZA 4LCWD 1T83C 3KPQB 1X3DA 2EXYC 1U41A 3MRFB 4WY7L 4AX3A 4PGDA 1QWUA 1TENA 3I2CH 4OT1H 4U7SA 1UVQB 1N7MH 3PGCB 4V1DE 1ACYL 5JYLA 1E27A 3RX5A 1VKXA 2ZSVA 4LCIH 1QHOA 4YDLC 4R9HA 1P6WA 4AJ0A 1IE4A 3ZX1A 3WKML 3LS4H 5B8CB 3TBVA 5I1IL 2VLLB 1JDDA 1PBYA 3PJNA 5T5NG 5D4HA 5JORB 2JJVA 4C58B 3WELA 1TU2B 3VFMA 3GBDA 8FABB 3LZRA 5A7BA 3LXUX 4GUPA 4AG4H 3S35L 3MBXL 2DQEL 1E4KC 1U92B 4RFEA 4WGWB 4PGCB 5SWZA 3QYNA 3L81A 1BVNP 5KS9F 4HUXB 1CDHA 2X2HA 1SEQL 4MJJA 5C6PB 2IPKA 2XWBA 2WWNA 1BYOA 2UZXB 5JUEH 3FT2A 4PJ9B 4KJPC 4PJ8A 4R4NC 5DO2D 4L8DB 1MCOH 4JO4L 4U1GB 4ZUSB 5IEKB 3OKMB 4NQVA 3T65A 1DDHA 5IFAL 5ADPH 1YN6A 1B4JH 2GI0A 4OLZL 1TEYA 4RH4A 4FXGA 2YPVH 1BEXA 1TQCC 1UA7A 5F6HI 3TXAA 4EDWH 5E9DE 3LZFL 2DJ4A 3H2PA 2OMNA 4MD4B 3IMWA 1LP9F 3NRFA 5C86A 1ZRUA 3FXIC 3GLZA 3MV7D 4QT5B 4TUJA 5FM5O 3VWJD 2I85A 5I30H 1FPTH 4ZXBC 2NT0A 3VQ2C 2L7UA 1W72A 2EE0A 1NAML 2VDRL 4A7SA 3N41F 3KPLA 3I75A 2J1KA 4DERA 2QFPA 2Y9RT 1IQWH 4CBPA 3VFVB 2VN6A 3BCDA 2PP8A 2G2NA 2WLHA 4MA7H 4MVBD 4PCSA 1FL6A 4X4KA 4MCZA 5GRVL 5BV7B 1SUHA 3T3PB 2Y23A 3BD5A 1TJGH 3ZR5A 2DIJA 5TE4L 2OL3L 1ACCA 5TQ0L 4A2GA 4XP9H 1KGXA 2BJMH 2G9HA 4ONHB 1MFVA 1Z9SB 1A6AB 3THML 1KB9K 1MEXH 2H2PC 3O6FB 4KKCC 2CM6A 1E4WH 2JB6B 4DNLA 5JZ7C 5CP7B 3C5ZC 4FABH 4W9LC 2L7JA 3OKKA 4J8QA 4NZRL 8CGTA 1BVKA 1KTLB 2NY6C 3RBGA 5C9JA 3ULUC 5AW9B 3L3OA 4Z95H 1IAKB 1KJ2A 3KM2A 1JGVL 2ZJSH 3LRMA 3QUYD 4L9LB 5HI4D 2C7FA 4Y8DC 5E6ID 1ZIBA 4S1DC 1LNUA 1LE9B 3AS0A 4NDMA 1L7IL 1NGZA 2DWDA 4R26H 4ZQKB 3BAXA 2C1OA 3QFJA 1JJUA 1UACH 4E5XB 3KGSA 2RGSA 3AT8A 5CZXC 1YEFL 3OTTA 5EEXA 4O4YH 5C0AE 1LMIA 2QQNL 4G6MH 4UTBA 3PHSA 3SPHA 2BNRA 4RAUA 5ESQB 2XETA 4FQCH 4OIFA 4FKEA 3T4AC 4L9DA 4HZLB 1LD9A 2Y36H 5TF0A 3ZDXF 2ZUYA 3QUXD 1WAEA 3QULA 4MNHA 4BUQA 5B1JA 3V4PL 1T22A 2Q7AA 1E9QA 2BWIA 3U30B 2QQKL 4FHKA 4XCCH 3HFMH 1I8AA 1NSNL 3QS3A 3OR6A 3RZCB 2HVJA 3TCLB 2WY3B 3K46A 3GI8L 4LSRL 3BGMA 4KROD 4G3YL 4FN0A 2CBQA 1JMZA 5B39A 3QYCA 5T3XL 5GJTL 3JWNH 1R1CA 1Z66A 2B8OT 3NH7L 2XFXB 2EVGA 1RH8A 1UENA 3B2XA 5JOFB 3IMVA 3STLA 3SBRA 5DJ0A 1XH3A 5JLZB 1U91A 3H9YA 3VXQB 4RGMC 4M6MH 3E6HA 5J3HD 3KLSA 4M7ZC 3QB7C 3WE6B 2C9PA 4PRAB 3GI9H 4F92B 3TFBA 4NO5B 3O4LE 4MQ7B 1I3RA 2G9KA 3DRTA 3SE4C 2KQMA 2AQ1A 4P5MA 3MAWA 2APTA 2VERN 2VKXA 5E8EA 3DX9A 2ETWA 3WXWH 5GGRY 3LEYL 4Y9BA 3E6FA 2WANA 3L95A 3WNKA 4YSPA 4OM0L 4NCDA 1TZIA 1QA9A 3GM0A 1KXHA 2GITA 4NUJA 1IEBB 1BJ1J 3KHQA 3ZRFC 2NDGA 2HFGL 1L6PA 3G6DL 4PRHD 4DKFL 2EIEA 4AVIA 3ZDZE 1XXDC 4F8OA 3RDTC 1KTRL 4MNQB 5I1HH 2DQUL 1LO0L 1TXKA 4TL4A 4HJJL 3MNVB 1JHLL 5IOPA 1EEYB 4PRHE 4J1UB 3RGHA 1RZFH 1G6RL 1OF0A 3VI4E 2AK4E 2C7UA 2VMEA 3CPLA 3FCUB 3Q9QA 5CN1A 4FZ8H 4DK6A 1JK9A 2JWYA 3QQ3B 4U49A 1YVLA 1QLRA 2COQA 1T6WA 1DJGA 2CDEB 5JPNA 4TULH 4WGKA 3IPBA 3AS3A 4ODXB 4PJDB 5GRZA 3T1FB 2VM9A 5BZZA 3V8OA 1ILSA 1BW8A 1DLFL 4WU5B 3VXRE 3BDXA 2OR8A 1JHLH 3DX3A 3F01A 3L3GB 2D9QB 2B3RA 3MUHL 1TCRA 2VJXA 1WITA 4LLVA 5LWYH 4YVUA 4WFHE 3QQ9D 2CNZA 3CFCL 4PJCE 3D0VA 4X98A 4ELME 1KV3A 3GXMA 4UDUB 1CGSH 3CLFL 1A1OA 4G1MA 4LHUA 2E7LC 3EOBB 2NCMA 3U36A 2UWEB 4OM0H 4PLJC 4KMLB 1I9RL 1XIWA 4Q2ZA 1CYGA 4M7KH 5I8OH 5FGBC 3QXDB 4Y16A 1WZMA 4HWNA 3QXDA 1KTDB 1A9VA 4MA3A 3BAEH 3N1QC 1RJLA 1EEYA 2AXGB 2XN9A 4PJCF 1SN0A 3ARBC 4ELMF 4JM4H 4DN3L 4JFPB 3GI9L 4IU3B 4XXCA 3MRRB 3TVMB 4MNQA 4KOCA 2EEBA 1U4EA 3B6SB 4PVLA 2B2XH 1J0IA 3IF1A 3NZUA 1BYPA 5L0QC 4KNTA 4DF9A 1NJ9B 4WNQB 1HC1A 1H3GA 1XB6A 2LOEA 4DKEH 3BUYA 2R2EA 5E8NA 1X5HA 3VU1A 4L4JA 3LZOA 2YD2A 4Y2DC 3O3DB 3EDDA 3CDCA 2WV3A 2JMRA 1LWJA 4CN1A 4IK6A 3I02B 3NYKA 3TZVB 3EH2A 4JKMA 2HVBA 4KY1L 5CSZA 5JOEA 1VHPA 2NNCA 4HUUB 4LGSB 5IQ7H 1CVRA 2OA9A 1DANU 4BFBD 4FXKC 1NGPH 3OKLA 2XZZA 1B0RB 1RZIB 1RCYA 5E23A 3BPLB 4QHUA 4ZUUA 2Q7YB 3NT0A 3MPCA 4RLDA 4NX0A 3KL5A 3KVPA 4JO8A 2DD8L 4P59H 1P6FA 3L4VA 2WWKT 3EJCA 3FPYA 5AKSA 3L54A 1F6AB 3LDBB 4S10A 1U0QA 3QUXB 1RUAL 4YDJB 3O3EA 1UA6L 5KEZA 3PU7A 4YDJA 5KZCB 2QQNH 2D4DA 4G6ML 5C0FB 1AHKA 3HZVA 1CFVH 1HQ4B 4KPHH 2YOCA 4NGHH 1G9NL 4M1DL 5C09D 1UACL 1T1ZB 2ZPKL 3QE5A 4HCFA 5FYJU 3ZUNC 3V4VA 1HVXA 4WW2A 3LN5A 3MSPA 1V3JA 4KDTC 4JRXA 3FH5A 4YXHL 3TBTA 3UTTE 2BS71 3GDCA 3EBAA 5F9WB 3LPGA 4UU9B 2VC2L 3RY6C 1E5CA 1YNKL 1KIQA 2BXZA 5K69A 1F4HA 1YYCA 3BPCB 3QZWG 5LBVA 2PYED 5CD3A 2UUDK 3CFJA 1G6RB 4X7FC 1NPNA 2IPTH 3DBXB 4ZO6A 1B0GB 4L3EB 2QADD 3EBGA 5I8EA 2Z7WA 3BD4A 1MFCL 2HFFB 3C5SA 1NCBL 1T04A 5JHAA 2QTEA 1DVTA 4J3OG 3K80A 4RGNB 2CO7A 4RFOL 5F44A 3QPXL 3RWJB 3V4PB 1ZEAL 2F6AA 1TJGL 5FA3A 2AAAA 1TNMA 2GJZA 4NJ9H 3K6SA 2GCYB 2FHBA 2LT9A 3OJ2C 3G04B 3FQYA 2FEEI 1OB1B 3BOVA 1M7XA 2O5YH 4JFZH 2XRAH 3WO4B 1P7QA 3VI4F 1IQDA 4ZFZB 5IG7A 1J0ZA 2HKHH 3VGBA 5B4MD 2OR9L 4TRPL 4GBXA 4L3ED 3V6ZB 5EDSA 4PCTA 4KI5D 3RGBA 2JTYA 2H1PL 1R5VB 4FHBD 3TURA 4L4VB 3Q6FA 1DZBA 1FG2B 2R69H 4OLZH 5ESQA 5IFAH 2KH2B 3JSSA 1Z2KA 1QRNE 3LJ3A 2PW2A 1CFBA 4WFEE 4WNJA 3BEWA 4OGYL 3G9AB 4IBZA 3S96A 4WEEA 4CNIB 1UT1A 3GSNL 2ICWJ 1YC7A 5E8EB 1M56B 1F3DJ 4C83B 2JH2A 1H3WM 2GHZA 4GW4B 4MAYB 4X6CA 4YPGA 2UYLA 5FECA 1RIHL 1PLCA 5F88A 2M26A 2JCCF 2K70A 2YLHA 3DO3A 3HUJA 3MLUH 3O6ML 5HD8C 5I15L 2WVTA 1OGPA 4NQEA 1HNYA 4NZ8A 1OAXL 2D31B 3MOQA 4M29A 3U2SB 2VQUA 4LMQE 3GHEH 1PKOA 1Q0EA 1TZAA 1ZMYA 2YPVA 3REWA 3RHWK 5JMRA 4KNSA 1UOKA 4U3XA 3L08A 4NI3A 2C9RA 3P4OA