2RQKA

Nmr solution structure of mesoderm development (mesd) - closed conformation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
141
structure length
109
Chain Sequence
GDIRDYNDADMARLLEQWEKDDDIEEGDLLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of MESD45-184 Brings Light into the Mechanism of LDLR Family Folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Mesoderm development candidate 2
total genus 30
structure length 109
sequence length 141
ec nomenclature
pdb deposition date 2009-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rqkA00
3O1LA 3TUJC 3DHXA 3DDNA 2QSWA 2ZHOA 2FGCA 2I9SA 4GO7X 3U7JA 2JHEA 3L7OA 3IXQA 2KO1A 2F8MA 1RWUA 2RE1A 5JJBA 3LOUA 3OFEA 1M0SA 1U8SA 1LK7A 3MTJA 3MWBA 1LK5A 4GO5X 1Y7PA 3TUZC 1PSDA 3DHWC 2P9GA 3LUYA 3OFGA 3TUIC 2RQKA 2LQJA 3ENWA 3AAWB 3OFFA 3K5PA 2H9ZA 3P96A 2LVWA 2P9EA 1YBAA 3HHEA 3KWMA 3OBIA 1SC6A 3AB4B 2PA3A 3MAHA 4NMLA 1YGYA 2DT9A 2CDQA 2QRRA 2JOQA 2NYIA 1KS2A 1ZPVA 5IT0A 4X84A 2J0WA 4PWUA 3S1TA 3AB2B 3UW1A 3OFHA 3N0VA 2DTJA 5IT4A 1UJ6A 3DC2A 3W7BA 3CEDA 2F1FA 1UJ5A 2PC6A 4IO1A 3ENQA 1LKZA 4M8LA 1UJ4A 2J0XA 2QMXA 2P9CA 3NRBA 5T41A 4LUBA 2RQMA 5FIIA 1O8BA 5IS2A 1XTZA 2QMWA 3ENVA 4GMKA 3IBWA 2MDAA
chains in the Genus database with same CATH superfamily
1BGXT 4F67A 1RKJA 4M5DA 4FVMA 5CYJA 2GFFA 4YB1P 3Q23A 5CZVA 1FK9A 1AZSB 2YNHA 4RNNA 4KH0B 3ZNJ1 1VC5A 1FXDA 1MSWD 3DRRA 1RACB 1CC7A 1KVKA 2DB1A 4OZJA 4C7QA 5EWEA 4KBIA 4L76A 1UL3A 4NYZA 2NXCA 3HVWA 3CB4A 3MPUB 4DMZA 4TU8A 2ZH7A 1T02A 2HFZA 2A2CA 5BYRA 1UP1A 3FEXB 2VIHA 1O6XA 2HS3A 1TV6A 1C1BB 2DRAA 1RT3A 2WZ1A 1UKUA 3M2RA 4IH5A 1FFGB 2XY7A 4X64J 2MLZA 4NPOA 2N4DA 3QFWA 3I55S 2HBQB 2PEBA 1RLCL 1VOMA 2JEJA 2UU9F 3PDNA 1AFIA 2EWHA 4BHQA 2H51B 5E3QA 4F26A 5KT7A 1LEOA 3HHLB 2YKMA 4M5JA 2FJDB 3WX4A 1XMBA 2LU2A 3VR1A 5FLXU 1CC8A 3TANA 2CJKA 2QYGA 4X66J 2W9CB 1I3OB 3CPWR 3UCZP 2ADBA 1RTDB 4IRKA 2WSEC 3T5JA 1BC6A 3C66A 1WTFA 4Y6IA 1RT5B 4KGZB 2FLLA 1S79A 5D0RA 4JI8F 4JI0F 2AJQA 1IM6A 2RQKA 3EDQB 1R7IA 4LRFA 5K8NA 1X31C 5BR8F 4C8NA 2YNFB 1SKWA 2E1MC 1NKBA 1NO8A 2BMBA 1S4FA 1WUUA 2FUG9 3M30B 2OPQA 1LWCB 2C2ZB 1TFWA 1Q82T 3RBDA 4O4GB 3CJKB 2PI4A 2KVIA 2FZGB 2XGQA 2DNMA 2PGCA 3NS7B 7FDRA 1NNDA 3VAKA 4RJVA 5EUHA 1RBLA 2A10A 1NCLA 1BWVA 5J2NB 2OEKA 3GIIA 3V4IB 1CJUB 2B56A 3MI7X 2NUHA 2AGOA 2LP4A 2KZZA 3TWZA 1BQXA 2BKPA 4O3QA 1N33J 2ZM6F 3CJ8A 2KFZA 2VD3A 2DT9A 5KFFA 3KK2B 5HJXA 5D4OA 4JI5J 1E6YB 4RWXA 2F8HA 3FSYA 3SCJE 5LMNJ 2IRUA 3I0RA 2IYGA 3O8WA 1YBUA 2YNGA 2CFXA 3EVOA 2R8JA 5DDRC 2CG4A 1NSQA 3CDAA 3TX8A 1YZ6A 4EBCA 1HPZA 1IKVA 1NDLA 4QR1A 4ANEA 4CLLA 1ZETA 1FDDA 1IKWA 1VC0A 1JXVA 2AHOB 2G13A 1RCXB 2BQUA 1URRA 4OL8A 2CPFA 4KIAA 4LIWA 3ZZZA 1ZAVA 2V8GA 2ZHBA 1VIOA 2VPYB 2DH7A 4DUTA 1DJ0A 2K06A 2CG8A 4WP3A 1VI7A 4LSNB 3DMJB 4FXWA 3CWJA 5D15A 3SQGB 2AMCB 5GVQA 5JMNA 1ZA2B 2E66A 3AJ1A 3GIRA 2OI2A 4M5NA 3HCXA 5KOWA 1HHSA 1TFYA 2F5GA 2VKZG 5M2RA 2DITA 4DQQA 1JJCB 3OTOF 1WELA 2DNOA 3TARA 4F36A 1N5TA 2NSCA 2UVRA 3K5MA 3MAQA 3NG8A 4OIXA 1H3DA 1SV5B 1FTRA 2IRYA 5AXMA 5A76A 8AT1B 2FVPA 2IA6A 1UTAA 4AL7A 1U1NA 2QA1A 2BKNA 3R9LA 4RNFA 1C4AA 2I5JA 2A3JA 2V50A 4M5IA 4MK9A 1UPPA 5ETNA 5CD4H 3A3PB 2HHTA 1S1XA 2DH9A 1SV5A 3H8YA 3W62A 2FHKA 4DV0F 2NPIA 3O2IA 3MM5B 2HIYA 5F8IA 1MU2B 4UOCA 4DFPA 2IC3A 2YKMB 1DLOB 1OY9A 1H6KX 1FWKA 4LF4J 1WG4A 1U49A 1J2VA 1ZBTA 1JJHA 1YKWA 1Y10A 3PW2A 2EBGA 3WIUA 4C9DA 5H9EJ 4DR6F 2V68A 1IXKA 5J2MA 3GE9A 4OX7A 4DCJB 3W9JA 2W9CA 3KK1B 1RTDA 1A7GE 5GADI 2DNYA 2F4FA 2XS5A 4A8WA 4DHVA 1YK9A 3HVRA 3VALA 3GYNA 3FBFA 3M8QB 1PYTA 3BDPA 3HK2A 5I3QA 3T1HJ 2QYCA 4OHXA 2FQQB 3LH2S 4IQMA 5J1EA 3J7A1 2GAHC 1OO0B 2LQBA 3M8RA 3DHWC 2YPZA 4QW8A 1XMQJ 3SCLE 1EQ0A 2X3GA 1M5VC 3BM7A 3NGSA 3D68A 2LQJA 3PJXA 4DPWA 4PCQA 4ENOA 3R2DJ 5E3CA 1WEYA 3IP0A 3TOQA 2W4CA 5LSOA 3UNGC 4YR3A 4QR2A 1T9TA 3IBCB 2BOAA 2GCFA 2LVWA 2R7OA 5ETMA 1HBOA 1WD6A 1MN7A 3JXOA 4QWAA 2HQDA 1UA0A 3BR9A 1WC0A 1PBUA 2HZCA 3AD8C 2ZH8A 4LFBJ 3BSOA 1Q4RA 4B9TA 2Q6BA 3MECA 5MLCV 1NK0A 2MLXA 3TAQA 3HI9A 2M3DA 4ECWA 3D66A 4MFBB 5F3ZA 3Q8RB 2R7RA 5HP1B 4EUVA 2EW9A 2MLYA 2JOQA 1YG0A 4H4OB 2COLA 4TQSA 3SYZA 2DPIA 2XMUA 4LF6J 4C8YA 2DNNA 1FHTA 1JNZB 3CCLS 3F41A 1NDPA 3AOCA 3KFWX 3MCSA 2GJ2A 3AB2B 3P5TL 1IKWB 2GVDA 4C11B 1TV6B 4LSLB 2DR7A 1R27B 3L7PA 4QWEA 3BZQA 3N6LA 1S49A 1PAEX 1W2BR 1MG7A 3PO5A 2I2YA 1CJKB 2GVZB 2BJ1A 1Q8BA 1UZHA 2BA9A 2QO3A 3PYEA 4ILRA 5DRKA 5KFDA 2XCAA 4EZ6A 1NDCA 1I94J 1AYEA 3KYLA 5KFJA 1VBKA 1UJ4A 5L1LA 1TL1A 4IH6A 1JB0C 2IVYA 3DLGB 4OZ1A 5ETSA 3OL9A 4W90B 2DY1A 4HEA9 2MKYA 3D6HB 3QZ8A 4NWBA 3VAHA 2FJXA 4TYAA 4OI3A 5ETKA 5HMWA 1X4CA 3PIOQ 1GTHA 4DL4A 4C8ZA 2CNOB 2IIHA 1BE4A 5IS2A 1LWEA 2O5DA 1JLGB 3DN9A 4UTGA 4ECTA 1AUDA 3ZTOA 2EK6A 4KJIA 4HH1A 4ZPAA 2F65A 3E51A 3OT9A 3MMAB 4RW6A 4A8XA 1FEHA 2E7XA 1ZTTA 1IBLJ 1G2EA 4QIFA 2O3DA 3CT9A 4YY3F 3MM9A 4JI4F 3M6WA 2G1DA 1U02A 1RAFB 2ZBCA 5D4LA 5HQ8A 4NI2B 1BQNB 4RW4A 2BE2B 4CLWA 4ZPTR 1PJ5A 4OYBA 2ROEA 2J76E 4Y65A 4NE9C 5HVGA 2E9TA 2WW8A 1T3OA 2IM3A 4DN0A 1JLAA 2VA2A 2MY7A 3DLEB 1G4CA 4XAKA 5J1PA 4OX8A 2XMJA 1X4BA 4IFYB 4UZBA 3IMQJ 3QATA 3HSDA 4Y0FA 2F4VJ 1YRUA 3QSIA 1FD8A 2M9KA 4YFUA 2W2MP 2VBWA 5B0AA 1SL2A 3MR2A 1UVJA 4NRTA 1M90T 1YRXA 2VKRA 2E1CA 4KAIA 2QL9B 2HNYB 1D9DA 3M05A 2BDPA 2EI5A 4U6PA 5C7PA 1ZA1B 4FF4A 4RNHA 2AIRB 2D3O1 3KG4A 4UT4A 4B3RJ 1TU0B 4FKYA 3CSKA 1CJVB 3QWUA 1X0PA 3OXLA 1Z4UA 3IWNC 3IM8A 4OV6A 4DPOA 4IG0A 3TZXA 3W2WA 4RU9A 3Q0AA 2O1PA 4MH8A 2MHNA 2RJZA 4X4QA 4KV8B 2BJ3A 4USWA 1AA1B 4X62J 1LWCA 2BANB 5F8NA 3M9MB 1HNZJ 4B9UA 1KDNA 4IO9Q 4NYOA 1ZZFA 3JSRA 4I68A 2CYYA 3DKDA 1X8DA 4HI2A 2HFSA 2GHPA 3AODA 3CD5A 4M5DB 3ZZPA 1JJ2R 2VPZB 2NCKL 5CYQB 4X65F 1K73T 2W7OA 5G0RA 1S6QA 5DGAA 2MHEA 1OYDA 2CPDA 2W4DA 1R0AA 5C42B 1PJ6A 2M2BA 4YUDA 3FMBA 5EHHA 2POKA 4XO0A 4X4UA 4QQBA 4DL5A 2XLJA 2C1EB 3M32A 1RSCA 3W3SA 3HXMA 1NZAA 1EQMA 1Q5YA 2KRBA 3AQPA 4QPTA 4AYBD 1RAAB 2ZBRA 3ETMA 1N48A 1K8AT 2AYGA 3LWLA 2CJBA 1WKJA 2VONA 1OSDA 4RLEA 1D8YA 3DOMA 2ASDA 2HVZA 1U2RA 2MZRA 3QIPB 1SIWB 3GILA 2AYEA 3I32A 2BJEA 2XEXA 3E01B 4PPZA 4CT8A 4DBQA 2OTLS 5HK4A 3G9CA 4I67A 1SQGA 4JYAF 4PG4A 1S1XB 4OHZA 1GTEA 2CQIA 3LO3A 1TELA 2KRRA 3ISZA 3L7UA 3W8PA 2FJWA 3HVAA 1NM2A 5GAHI 2ADCA 1HD0A 1ITPA 4KHMA 2FLPA 5FLXY 1OJ4A 2MZTA 4OYWA 1NK5A 2GC8A 2LQ8A 2Q43A 4WP8A 5B0FA 3QJPA 4IO1A 2HBRB 2AJ4A 1TQLA 4HT7A 4RW8A 3DOKA 5E33A 4Y2MA 5FDLA 3R7SB 4ZN1A 4U95A 4FN5A 4LQ3A 3I82A 1YJWS 4OQJA 1U1QA 2V2VA 2KH9A 4HACB 4JI3F 1HW8A 1IWAA 1VQ6S 4O23A 3DLKB 5L8RC 5D6GA 5A8RB 1N5VA 4C3KA 4TLRA 2CKWA 4ZCMA 1JLQA 4JV5F 1VRTB 2X1AA 4QIGA 3IWXA 2HNDB 1C0UB 3MR3A 2W25A 3BN4A 2Y1IA 4YS2A 4ZIWA 4DDFA 4X65J 3K8WA 2MGZB 3DLBA 1DTTB 4N7TA 4DQIA 2R7TA 3IAS9 2WOMB 3HFZB 3AY0A 4R8UB 3I96A 1HBNA 5DG8A 3SI8A 2AGQA 2F63A 2MYFA 1SQFA 4KGXB 1RT6B 3D6FB 4IH7A 1WC3A 4EMDA 2CQCA 2D3UA 3KLFA 8ATCB 1C1CA 1G6BA 3E3XA 4F4ZA 4NZ7A 2DYAA 2DGOA 2ZOGA 4X62F 2KM8B 2QEXS 4B9LA 2R7SA 3ADAC 2JX2A 3M8ZA 3J81j 2CZ4A 2V4QA 4USMA 1FXRA 1U45A 3IRXA 3OVBA 3KLFB 3R1HA 5HBMA 2C42A 2B4UA 2V67A 2WHOA 2FGCA 1VQPS 1KVIA 2V5HG 3MECB 3PW7A 1WORA 5K14A 5D0GA 3TA2A 3CCVS 1HR0J 4J9QA 2YNIB 3NL0A 1LW2A 2DCUB 5BYSA 1FJGF 4FP9A 2EFPA 5DG7A 2ZVSA 1H7XA 1CEZA 2KKHA 1JK9B 1WWHA 2ZDPA 3BGOP 1XMQF 1WC4A 1S4EA 2CNLB 2DH8A 3FFIB 1UFKA 2F8EX 2LU1A 3HVTB 1SKUB 5HMYA 2KYXA 3K5LA 4EU0A 2MQLA 2Z30B 1X5TA 5C24B 5CZXA 1F60B 2HRUA 1EX8A 1X9WA 1PIEA 2FTRA 1XNQJ 4B9NA 5E41A 3CNQP 5ETRA 2OFHX 1QUPA 4JUZA 3K0JA 2V8HA 1N0UA 3IM9A 3Q83A 3QGPA 2AJFE 4F7VA 1T8EA 4LF6F 4USJC 4EO8A 3CD6S 3D1OA 4LFCJ 1FA0A 1RISA 4QIVA 3DRPA 5F0WA 2CPHA 3DI6B 4XTTA 2B0GA 2P9GA 2RD5C 4WU2A 2BVZA 4B02A 3B82A 1BXNA 1S48A 4Q45A 4X4PA 2D3OR 1SBRA 2HGLA 3GONA 4FYDA 3QZ7A 1QY7A 2LEAA 1IBLF 1X0FA 2GHWA 1S9EA 4R25A 5DQIA 1HYSB 1Q7YT 2H9ZA 3PCOB 2ZUAA 1FE4A 1WHWA 4XK8C 5DO2A 2QTWA 4QU7A 1W2IA 2CQ4A 5GAGU 2YNFA 1RT1B 1LXNA 2MQQA 3PW0A 4ECRA 1ZH5A 2E44A 3RB4A 1SJ1A 1Y4ZB 5CQGA 2RUGA 4PXEA 2HRTA 5B7WA 4RW9A 4P2MA 1RT4A 2PA8D 2WVCA 3RJMB 1S1TA 2J6TA 4DG1B 4DU8A 4AXIA 1XJWB 4Y2CA 3N5BA 3D7SB 2MKKA 4K4YA 2G0CA 1N36J 4EWTA 2QGFB 3P5BP 4AL6A 4JI7J 3D0IE 3G2XA 2PN6A 1XQIA 4HDHA 5CCMA 2XSJA 4K4UA 3CXCR 3QMQA 2ATLA 2FJEB 3QBCA 2OPRB 4LQ9A 3C14B 5CH7B 3KLEA 1UW9A 4F3MA 2KZMA 2NXNA 3NCRA 1EKSA 4OZ2A 1XK8A 3CEDA 3B4MA 4YN3B 4DXLA 5LJ5Y 2GQQA 1NK7A 2VDIA 3HZGA 4NRUA 3QRQA 2RH3A 2G2YA 1RAIB 3KG0A 4F25A 2CQDA 4EGLA 1VRTA 1TKXA 2OJ3A 1BQMA 5L9NA 3M8SA 3E8OA 3I9V9 3K7RA 5LOQA 5HANA 1NPRA 5EDWA 1QVGR 3PG9A 1SJRA 3NOGA 4ILMA 2K8GA 1UVNA 4X4VA 4RW7A 3D6TB 2HNZA 3ULHA 1RAJA 5HMXA 4HHUA 3KLEB 1PYOB 2W9AA 1XTZA 4ELTA 2FC9A 3HHDA 1UW4A 3I31A 5DGBA 2QA4G 4A48A 4U7UD 2YVSA 5KFVA 5LMNF 2B9YA 4DLEA 1HBUB 2PMWA 3D54A 3DXBA 1VC6A 4DR6J 3G8TA 2AF6A 2Z2YB 4U7UK 5HQLA 3IRXB 4CYUB 3QFHA 4TKTA 5KFTA 1WF0A 3PIPQ 3TUJC 1JLEB 3AJ2A 3EMTA 3UN5A 4ZLJA 1T03A 1YJTA 3NNCA 5HI7A 3ZTPA 5HN0A 5A0YA 4A8FA 1RT3B 5AJ3F 2J5AA 2C2MB 2W1BA 2IJRA 2CAJA 4RZRA 4L3KA 3GIJA 4DR7J 1S7HA 2VFVA 2ZD1B 2XMAA 3S01A 3NCPA 3POTB 4UOFA 4CO1A 4IOCQ 2V2KA 2UXBF 1PKUA 2XS7A 1KQGB 2XM3A 4L74A 3ZZOA 3BSCA 2WBRA 3U1MA 2JHEA 2G2OA 2ZDOA 3I0SB 4A8YA 1GMWA 2EC2A 2ZH9A 4PG6A 1YJVA 1RWUA 3UI3A 2ZH2A 4WJBA 2OTJS 1FESA 2FVRA 4J9LA 1TK0A 4PPDA 2NLWA 2UXCF 1Q78A 5AE3A 2ZH3A 3DGPA 2QFJA 1RJJA 3VHQA 1LK5A 3AJDA 1XR5A 3BYRA 3UFCX 2ZH5A 1RUSA 1DTQA 4KB7A 3ETOA 1MWYA 2XWXA 2YQ0A 2LCWA 4ZVPB 4F0KA 4A8KA 2C28A 3NKYA 5T7LB 3N4WA 1IJEB 3MPWA 3N6MA 2QIFA 1S0NA 1IR2A 2XI3A 3FVYA 3JQJA 3CIMA 2HQCA 3MMCB 3TUIC 2GA7A 4WK3A 3VZIA 4AE5A 1XMOF 1R6YA 1HNIB 1UEVA 5K8OA 4B3RF 3ZTRA 2KB2A 2LQ5A 3AOBA 2BM0A 4X64F 3VAIA 5IM0A 1B0TA 4DUYF 1U6FA 1X4AA 4ED6A 4P73A 3TZWA 5F8HA 3KJVA 3NGUA 2FZKB 4O0IA 3PZPA 3MGJA 4DSFA 1X4GA 4LREA 1YVFA 2FJAB 5BJRA 1HQEA 1KLNA 3TVKA 1FD2A 4DPXA 3IRWP 3VAMA 4G65A 4I2PB 4FVCA 1H2TZ 4JI5F 1E6YA 1FKOB 2YY3A 4TN2A 2P5VA 1ZM4A 1JLEA 1RHJB 2PA3A 3TAMA 1HBOB 3LWMA 2CQGA 1NH8A 2AJ2A 4C8KA 4CQ1A 4JB8B 4N56A 3IN5A 3DRRB 2KJVA 3C14A 2GHVC 3OHAA 2AEJA 2KM8C 1NDKA 1Y3KA 4Y2AA 4ZITA 3DYAA 3IC1A 1IUJA 3R2CJ 1DAXA 3QT6A 4MKBA 1N5QA 1HHTP 4Y00A 3M8YA 2DNRA 2VB6A 4C8OA 1LXJA 2GMLA 4OI0A 3M2VB 2ZD1A 3RRKA 3P3DA 3VAJA 4ICLB 3MR5A 5KFXA 2R8IA 4ED5A 3AFGA 3I9ZA 3H7HB 3M1VB 3H40A 4PWDA 4C11A 3T1YF 3V6DB 4JI6J 2XSFA 3QJJA 3T6JA 4ZVFA 3VF0B 4KGKA 1NK4A 2BKOA 1WG5A 2WB4A 3HSJA 2ZVIA 5K20B 2LKZA 1RI7A 4CM0A 3TUPA 4O44A 3H98A 3PVXA 2UUAF 2ZNZA 2HG4A 2VF3A 3QWPA 2I6WA 5C5JA 4JV5J 3ET6A 4B3TJ 2HVHA 2CPZA 2P6TA 2MMYA 4ZMMA 3MUTP 4MKYA 2MB0B 1CQMA 3CJRA 4KE5A 1WC1A 3G8QA 3Q8YA 4UOHA 4YB7A 5CYQA 2HVEA 1B64A 4XPCA 4ID5A 3LGHA 4N41A 1PYSB 3GG1A 1ZS6A 1QAXA 1RADB 1V3RA 2QSFA 2OSQA 1U24A 2DXEA 1XWLA 2YKQA 3DLJA 3MR7A 1NH7A 3R6LB 4OYPA 1VK8A 1KEKA 2UUBF 1EAYC 3G96A 2BEFA 1KC8T 5EX0A 5HATA 2WONA 1SIZA 1IKYA 4H4OA 1HNXJ 5I42A 1FWLA 1J5EF 1T9VA 1WDTA 4OHWA 3CIZA 1AROP 1C1BA 2ZBQA 4DN9A 4DR3F 5EN1A 3CJSA 5SUHA 3A8IA 3AHPA 2EFGA 1I94F 1VISA 4F8RA 2RRAA 4C4WA 1FDAA 3TQ1A 2KXNB 2DHHA 3FDSA 1RT1A 3I0SA 2B9WA 1HQUB 4YDXA 5HMZA 2VOPA 2KL8A 2QMUB 4LFAJ 2ZITA 5IC6B 5J2NA 1VR6A 3LW5C 4OHYA 1K9MT 3H20A 4G1QB 4KH1B 5L1JA 4DL2A 3F56A 3BKFA 4I0WA 2FVQA 4KPYA 4ZPVR 3QT5A 2DIVA 1F2GA 4K5SA 2IRXA 1JWWA 2R8GA 2YXLA 3NAIA 4X4RA 2OIHA 1YJRA 1LWFA 2LDYA 3QGHA 3PTWA 4ZVHA 3GFZA 3R97A 2DIUA 4H4MB 3CD7A 4HACA 4OYIA 5B0BA 3K5NA 1JMTA 3UDLA 4LF9J 3HO1A 1DTQB 1CLFA 1DFDA 1UWBB 3C46A 1R8PA 4WFYA 2NPFA 3EPGA 2HW3A 2NZCA 3MMJA 1KD1T 5A8KA 4KGMA 5F41A 4IOAQ 5KFSA 4V1Ak 2AP6A 3FCVA 1SJ3P 1U1PA 2UV8A 4PRFA 3G87A 3HDSA 3KHGA 3WC2A 3A3OB 2IA0A 2M4MA 2ZKUA 1CQNA 1PJ7A 2CZVC 4RPFA 4DPYA 2DD8S 1HBNB 2EBEA 3MM9B 2CJ9A 4GC6A 3D1HA 1H98A 2NQPA 3K2YA 2AKWB 5B08A 2ZC4A 4G6VB 1ZAWA 3EGWB 3HJFA 3OFFA 4RR5A 3GIMA 3FBBA 3PNIA 1MNEA 2PMHA 3QQCD 4O3NA 1JXLA 4K0KF 2HHSA 4WZQA 2B7BB 3GFHA 1DQAA 2K1RB 3KHRA 5C2GA 4I7FB 1WTBA 2XS2A 3AH6A 2WW4A 3R6GB 4ELVA 2LXUA 1R0CB 3JS9A 3LP1A 2FC8A 2K3IA 1JKHB 4ZVOB 1RT2B 4A8MP 2M8HA 2X3DA 1Q81T 4P71A 5JUMA 2GIQA 3CE8A 3SBMA 2UP1A 2B9XA 2R8HA 2HHUA 1T9UA 2VFSA 4U67Q 3R1LA 2WONB 1VQSA 3TAPA 4NA1A 2DGWA 3FQLA 4JI3J 1YGYA 4DUZJ 3IGNA 2HNYA 2IBOA 2CDQA 2XWYA 4P75A 3U1LA 2UUCJ 4BDPA 4PUOA 4HKQA 3OJUA 1PO6A 4ZP7A 4M63A 3PYDA 3J80U 2MJNA 4BWJA 3BJYA 2MZJA 4DV1J 3PW4A 1R8BA 4OX9J 1IQTA 2QE5A 2V9WA 3FMWA 3MZIA 2DGXA 4CNYA 1SJ4P 4JI0J 2IY5B 5K9FA 3T5LA 2F9DA 3ITHB 1D9FA 2D3ZA 1Y5NB 3Q2TC 3DC2A 2GQ2A 3FKBA 3FRYA 3KDOA 2F1FA 2PC6A 3NNAA 3CJ2A 3U1NA 2CPIA 2MKCA 3A1YG 2WTFA 4MYUA 1KOHA 1W7WA 2AYMA 2OLWA 5AXLA 2GS8A 3HM9A 2AYBA 4ZHRB 5KFOA 3PR5B 4E0DA 3UCUP 1EETB 3QPIA 3ZFVA 4V19X 3NRBA 4CIOA 4B9SA 4B3OB 3G82A 3MM6B 1NZ8A 2C2DA 2VFUA 2EC0A 1HHQA 5GAGI 4F04B 3AXKA 1RBAA 2CQ1A 4OZLA 3CMAS 3C6TB 3WHIA 3MMAA 1GX5A 2B51A 5KFQA 1F0XA 1CJTA 1NSPA 1B7YB 1TL7B 2BZ2A 2VPXB 1R8CA 4NYPA 4TY8A 5KFLA 3MPVA 2I5JB 2ZH6A 1BHNA 1AZSA 2XZWA 2YNHB 3GJSB 4L73A 5T7LA 2B5JA 3T41A 1UCNA 1FX2A 3IWLA 3UQSA 5SZTA 2JLFA 1RA6A 4PR6A 4B3MJ 1Q1KA 2HAIA 3FZBA 5D78A 1G7CB 3KNAA 4QIEA 4X4TA 4I6YA 2VBZA 1S59A 1CPZA 2HGMA 1FRLA 3DLLQ 1S1VA 1EP4B 2M88A 4DV2F 1VBYA 2X1FA 3KJFB 5E5NA 2GO8A 2XSJB 2BJ8A 3DDNA 2ZEJA 1HNZF 1Q95G 3RB3A 1FNOA 4DV6F 3I5AA 1WC5A 3LANA 2OSRA 2Z0GA 3BB5A 1UVIA 4JI2F 2HS4A 4FYYB 4EO6A 3PRBA 1Y5IB 1TR0A 2KVQE 2L3MA 4DV4J 3Q24A 4DI6A 2DNKA 2XMMA 2Y0BB 3A8KA 3CD0A 4OLOA 4NLWA 3PEJA 3CVKA 3L7OA 2VBXA 1FWPA 4Q44A 3SXLA 5KG2A 3G4SS 1U47A 1PILA 2JDJA 4KO0B 2L48A 1S12A 3NP5A 2EG2A 1X4HA 2FDNA 4DS4A 1HWKA 2J7KA 2MSTA 3BO3A 1RTJA 1S6UA 3BV8A 3FSIA 3IR5B 1TK8A 4ETZA 1LK7A 2NUUG 3EM1A 1OQ6A 2R42A 4PXDA 3MM7A 1N36F 1R8HA 4F0HA 4RU2A 2J9EA 2NXUA 3HKZD 5C24A 3UD3P 1HNXF 1Y7PA 3N9UC 5HSPA 4JI1J 3QO9B 1VK3A 3GLJA 4R8UA 1VLOA 4ZA1A 4L72B 3G86A 2RQCA 5JVGQ 1T7PA 3IR6B 5IWAF 2KFNA 4CLFA 4DL0C 3DRXA 1VQ8S 3RG6A 2G0IA 3AAWB 1HL6A 4Y3CA 4ZP8A 1T9WA 3KDNA 4G3IA 3KHHA 3OQ2A 3CJTA 1S6OA 2XMWA 2MQMA 3M2UB 4YR2A 4AQYF 1T05B 5THWA 1FKPA 2P6SA 4PG5A 3B78A 4QW9A 3JSYA 2B5JB 3GR0A 2RF2B 5F8GA 4TVAB 3M2RB 2LMIA 3BBCA 4RNOA 1XEZA 2YNIA 1KQKA 4CH1A 3MR6A 1QSLA 2E5HA 3OBIA 2V0NA 1HNVB 1T11A 2QLXA 1UWAA 2RNEA 2FD2A 2EKYA 3DXSX 4NLDA 4PWWA 2VHGA 4RW4B 3KUHA 3NOCA 5GMKa 1RE1B 5DG9A 3FNNA 2ERRA 2VOOA 2Q79A 3T1YJ 3EZOA 2IJFA 1T9YA 4Q43A 2GVDB 2JL9A 4LSLA 5C2CA 1WHXA 1CG2A 1KS2A 4ZVTB 5I42B 4OJ3A 3W2VB 2ZE2B 4I2QB 1W26A 1FDNA 1VQKS 2W24A 2XG8A 1LFWA 4AXJA 3TRGA 2CIMA 3D5MA 5LSLA 1L3SA 2N7YA 2VC1A 2DKOB 3KUEA 3DDIA 1MU2A 5C25B 2QJ3A 4A8OA 5A6PA 4WYLA 4DV4F 1A9NB 2WCXA 1WKKA 3UN2A 3NLCA 3N28A 2QLJB 3TEGA 1FT8A 3ZTSA 1IBKF 4NXNF 2Y9HA 1GXUA 1RTZA 2QMXA 3BGRB 2PFFB 2HWIA 3R7BB 2P9CA 4DX8H 4KR0B 1JJ4A 1WEXA 2BR0A 3SFGA 4RW8B 7FD1A 5KFEA 1NLKL 4F4WA 2EKNA 5DM7Q 2AJ0A 3IO1A 2FY8A 1S9EB 3OL8A 2YKAA 3SIPB 2GW8A 4NZ0A 3M8PB 1S0OA 3K5OA 3D0GE 2M70A 2VQFJ 4ZP6A 3WDOA 1L5UA 4B3MF 2DHSA 2G0JA 4LRAA 1FFWB 3LP2B 4YDDB 1HWUA 5KT2A 3R5AA 2EK1A 3TYTA 5LXRA 4MK7A 3SDEB 4D3HA 1F9HA 2IDLA 2VJVA 2PEHA 1S1VB 1S1UB 4OLPA 3VQTA 2XY5A 1FKAF 4KV8A 3IBWA 4OYOA 5KFPA 1QSSA 4LSNA 1ICEB 2YBVA 4K2JA 4JV1A 3IG1B 4RKUC 3VAFA 1FKOA 3VAGA 3BO2A 4URQU 1R6VA 2RS8A 1WSRA 4EFAC 5F8LA 2A6MA 3HHNB 4B3OA 1X5SA 3RGIA 3OV7A 1KTQA 2V69A 4C2MA 2EPIA 1B99A 3HD1A 2PI5A 1KVJA 4QIWD 1TVRB 1N6QB 3C15A 1CVJA 1N34F 2UUBJ 5JVHQ 2J9DA 1QM9A 3TEHB 4NX9A 5J2MB 1IKVB 1H74A 4MTPA 5KT6A 1U0HB 5I3PA 2HZVA 4LF7F 1UVLA 2DEIA 4LR7A 1RT2A 5ETOA 1HMVA 3GYXB 2DRBA 1YLXA 4W4MA 2VFTA 4F0MA 3LGNA 1LQ9A 2J9DE 3KLGA 4PG8A 5HP1A 2KXFA 4L3NA 1RQ0A 2UUWA 1N32J 4NCGA 3OFEA 1U8SA 4ECQA 1J5OB 4JYAJ 1DQ8A 1KLMB 4L6V3 1APSA 4ELUA 2EEYA 3PJ9A 2E5LF 2YKPA 3W9HA 4KHPJ 3QIDA 3MMBA 2QZ8A 3W8GA 3HHLA 1P9QC 2KT3A 1YBTA 4AUKA 1YITS 3OD2A 2XGPA 3LALA 3JAMU 2ACYA 2MKJA 4K4ZA 3TW0A 3T3FA 1R0AB 4KY3A 4P10A 3I56S 4TLQA 1RWPB 3K89A 3KJNB 3GWCA 4ZHRA 3K17A 1QDUB 3RBEA 1FXLA 1IKYB 3M8PA 3P96A 4YB6A 4ED7A 4K0KJ 2EFVA 1VLYA 4J9UE 4O3OA 3OTOJ 5J1EB 2R2TA 2MQOA 3DGVA 4DSKA 1TL3B 1U6ZA 4QWCA 2D69A 2CADA 2W9BA 4O3PA 1DZ5A 1H0HB 1NK8A 3MM5A 3QRPA 4MKAA 4ZVRB 4WK1A 2WVDA 1ZOTA 2ILYA 4ILLA 4PKDB 4ZLLA 3BO4A 4J9OA 2OHDA 3C3LA 2FHMA 1QVFR 3CJKA 4M5KA 1YJ7A 2MPUA 1C1CB 3EGZA 3FBEA 3BF4A 1VRUB 3MAHA 4URGA 3IG1A 4CZCA 1IN0A 1C2PA 2VICA 2RHQB 3JSBA 3G71S 4ES3A 4WCEQ 4NXNJ 3MEEB 3K58A 2VPWB 1SH0A 5IT0A 3SFUA 1I5OB 5D8HB 2XNRA 5B09A 3L09A 3DGPB 3GZ7A 2B6AB 3ILLA 5AXNA 3HFVA 2UVVA 3HKWA 3FEYB 4I4BA 4NA2A 2H1YA 2U2FA 1ZM3A 2DXDA 2DTJA 1WF2A 1M5SA 4U9RA 3AA8A 1CS4A 2P8IA 4M5GA 4OZ3A 1N54B 3B54A 4ZJLA 5ADZA 4ZJQA 2YWFA 2VFRA 3ENQA 4KYZA 1YQHA 1NB2A 4H54A 4USUA 3CCMS 2GMJA 1KKHA 2VG7A 3MXHP 2HNDA 1YWXA 3MEGA 1HA1A 1HFEL 1CULB 1VGYA 2DHGA 5A8WA 3CCRS 1VQ9S 2ZZMA 4ERDA 3IAM9 4Q0BA 4NZ6A 3TO8A 2A18A 2MKSA 1CJKA 2APOA 2GVZA 4KPCA 4C0HA 2DHAA 4WZMA 1KN6A 3GFYA 4F50A 1SB6A 3PRVA 3TVYA 2OPQB 4KC5A 1YX2A 4LRDA 3LA0A 4QZVB 1EP4A 4TQRA 3DFEA 1XNRF 3MM7B 2IVMA 4USKA 2ZHAA 3KOAA 7AT1B 4K5RA 3LP1B 1VQLS 2CJYB 3SQGA 4BC9A 2IFXA 1S99A 3BREA 3HX9A 4GMKA 1R3NA 4OZ0A 2DCLA 4UF4A 5L1IA 4M5MA 4IFVA 3RR8A 2XY6A 4F2SA 3KK2A 2OD6A 2YWHA 3EICA 3G6VA 1CJTB 2G9OA 4F02A 1R43A 3ISND 3THVA 1VMBA 2IMOA 4RL1A 4YHHF 1MW7A 1TP7A 3ZTQA 3QRRA 2D7SA 1YJNS 4LF7J 1P9YA 2LXFA 2CA9A 2VC0A 5C42A 4DR2J 2RF2A 4USHA 1S6QB 5IOLA 1HPZB 1TL3A 3UDVA 3MOZA 9ATCB 4TU7A 1RT4B 4WIQA 3CO0P 4UQGA 2ZH4A 1TTHB 2R2UA 2A6OA 2BQ3A 2QG9B 4DX5A 2B43A 4J9SA 1OIAA 2VBYA 3M1VA 2W2OP 4OJGA 2IC3B 3IFEA 1VQNS 4YMEA 2KO1A 4OMFG 2RU3A 4CO0A 4DL6A 2FJVA 1Q53A 2E9RX 3NMAA 1T9XA 3HD2A 4CLSA 1A6LA 5HAOA 3KLVA 2R7XA 2V4JA 2GGPB 3BS9A 2IM2A 2EFOA 2HHVA 3TX0A 4WFXA 5KG0A 4G1QA 1F9FA 2CPJA 1P6TA 1KFSA 1U7LA 2MSSA 3GP9A 2PSZA 4ID5B 4J5OA 5L46A 3DRYA 3RRHA 1AUSL 2YX4A 2QLFB 2VH7A 3BYPA 3W9IA 2CUYA 2FLOA 3EDRB 1XC9A 2VA3A 3HMJG 4Q8FA 3PKMA 3N6NA 1KQFB 4N77A 1X4DA 3DDKA 2G2ZA 5ETVA 2DBBA 3L9ZA 4NLVA 4RBTA 4ZVGA 4DUYJ 2UVUA 3RR7A 5A8KB 1V3SA 2GJIA 2H48B 4CLZA 5D4NA 8RUCA 1U4BA 4DFKA 4DSLA 2R3VA 4Q0BB 3VVUA 2I38A 2RKIA 4CTAB 3KK3B 2XYPB 1D3WA 1MWQA 3DOLB 1MROB 1HWJA 2V4RA 4JI2J 1IR0A 1WEZA 2ALYB 4IG3B 4ZDNA 5LXYA 3HP6A 3ILJA 4CH7A 4JOUA 4F4AA 1REVA 4FZVA 3IA0A 3IS9A 1URNA 3PX0A 1R89A 1IM4A 2P2CB 1SKRA 2YWGA 2UXCJ 1PC4A 1RT6A 1VYAA 4QCLA 2CXEA 2B6AA 2H3EB 1WKLA 3OXFA 4Z7CA 4NCBA 2E5GA 2QRRA 2BE7D 2HMIA 2HHPA 2NYIA 3A8JA 1N5YB 4A8SA 2Z58B 3JB9k 4X84A 3BH6B 3ILOA 2FHJD 4H4MA 4WFNQ 2DHXA 4IG0B 4PWDB 1EARA 1ROFA 4Q7AA 2GV1A 3H2VE 4HDGA 4U8VA 3J81Y 1J5EJ 3CCZA 5IT9Y 4PZVA 4KKOB 4PQUA 5IZHA 2RDJA 4NEYA 2A0FB 4M1KA 2DGUA 2HPUA 2RRBA 4IDKA 4MT1A 2F3JA 2HBZB 4WFZA 2RHSB 2YKNA 2N82B 1SJQA 2XO7A 2RVJA 1BLUA 4YEAA 1PAUB 2Y1RI 3DCAA 5L1KA 1JIHA 2Z8QA 1XNRJ 1VRQC 5IWAJ 1RAEB 1NXIA 2QLBB 4IDKB 2W8LA 1RGVA 2FPHX 1V3ZA 2QN6B 4OYZA 1RHRB 4DOZA 1VQ4S 3EX7B 4P74A 2BBEA 1LOUA 4LUBA 1HLWA 4P2XA 4ZCKA 5GADU 5KFBA 2XB2D 1UZDA 4DEZA 1S77D 2ZNYA 2DR5A 4N76A 1O8BA 5ITHA 4OV1A 1K47A 3GG0A 4X4NA 4ZVSB 3JQMA 4ES2A 3AXMA 3UD5A 5HL7Q 2E7WA 4XIUA 1T03B 3CCTA 4CYUA 3UD4P 1TKZA 3C6TA 2YX7A 5LMUJ 1F3FA 3M6VA 1JLFA 1RYRA 2GJFA 1X60A 2V63A 4DR5J 3FQKA 1NHKL 3L95X 4Q8EA 1FCAA 1FEEA 3PJWA 2HKEA 1HYSA 1IR1A 4IR9A 1D0EA 4C0BA 2J7WA 4P7VA 2K7JA 1OPIA 1GMWD 4CLPA 3OVSA 2FY1A 4DR4F 1F5CA 1EZZB 2HLUA 2LYVA 3KUGA 2ILZA 4X4SA 2NYHA 4IG3A 2HFVA 2JNJA 3W64A 4LBIA 2H54B 4Q5VA 4DSEA 2ZHOA 4FYVB 1MWZA 1RHUB 3ITHA 4LJMA 4O4GA 3CDUA 4ZCLA 4EI2A 1SCJB 5RUBA 2CWKA 3ENAA 4UUXA 3W65A 5IQ6A 3VQSA 3MFHA 1VHIA 2GAGC 1YRTA 4GO7X 4FBTA 3U7JA 4WF9Q 2LEBA 3EXCX 1KFDA 1TL1B 1X4FA 3D9BA 3HHLD 1HQUA 2KT2A 3LAKA 4J90A 4N8NA 4RUBA 3PACA 5JJBA 4LF8F 2CQHA 1RWWB 4NASA 4NLTA 4O4RA 1MMDA 4UUWA 1HW9A 1U1RA 2K2PA 4H4KC 4RX6A 2CVIA 3AT1B 1LW2B 3WBZA 4WKRA 4NLRA 3KLIB 2E5IA 2WRMA 3R7NB 5KG5A 3OSPA 4Y2KA 4HTIA 2XYGB 1QTMA 3MMCA 4LF9F 4ZLPA 1AW0A 4F3OA 3SDEA 4WFBQ 2XC9A 4FF3A 2HHQA 1QTNB 2ZZTA 2K1RA 2QT7A 3DM2A 3M8QA 2BJ7A 3LUYA 4BC7A 2MZ1A 2XCPA 3EZ5A 1CJVA 2HHHF 4TXSA 5HVFA 1VQ7S 4OYXA 4B3SF 5ETLA 2FVSA 3GCXP 3KG1A 1TKXB 1FRIA 5KG7A 5KT4A 3AQOA 2BM1A 2XZTB 1NJWA 2W9BB 1FFSB 1NHVA 1BWEA 2QL5B 3DM2B 2YQ3A 4QYRA 1Y00A 3M4XA 2YWEA 3UO0A 2HYIB 5BXIA 1VRUA 4MIBA 3R8YA 1RTIA 3D2WA 3BQ2A 1M5OC 4C97A 1RCOB 2PT0A 1YBAA 1FVQA 1JLAB 1RHQB 2F9JA 3MAAA 3OUYA 1N6QA 1FRMA 3MEDB 4FXDA 3QGIA 4Q2LA 1RKIA 2LFVA 2HBYB 3FC9A 5E0OA 3I4HX 1QAJA 4Z2XA 3P8BB 4AL5A 3H5SA 4BCAA 1FRXA 4IFVB 1FERA 2ZUGA 3MHYA 4OJ1A 5ETTA 1QD1A 1CS4B 4I56A 2AT1B 4GC7A 2GX8A 3R5GA 1FK9B 1L3VA 1NHUA 3MUVP 2HZAA 5A0YB 1N88A 2PO4A 4BLGA 2QA4S 5EWGA 1FJGJ 2NXJA 1ULRA 3OFHA 3N0VA 1X4EA 3GTYX 5E3RA 5AT1B 3UW1A 2HVIA 1BUXA 1SH3A 2L9WA 4UOGA 4LF2A 4NEZA 3NBPB 1N52B 4KRWA 3VCDA 4OI2A 3G82B 1F9EB 3MM6A 2QA2A 4NLYA 2ZOMA 3GCWP 1HNWJ 3Q89A 4J9MA 5H1SV 5IFMA 5JXSA 4A46A 2MQPA 1M5KC 2V4JB 2E1AA 1TMJA 4PEOA 2DR8A 1HIYA 2R7QA 3I5CA 4JI6F 3M2UA 1YDLA 4DU7A 5KFAA 2O66A 3OW2R 1FVSA 4BS2A 3V6HA 1M1GA 4DS5A 4ECSA 3EXYA 1D9AA 3H25A 3DLGA 2IPOB 4C8LA 3NEKA 3OR2A 2RILA 2JZ5A 1KNZA 3DOKB 2V2QA 1UFLA 3NXZA 5FDLB 1IBMF 3NWRA 5E3AA 4DF4A 4P7TA 3W63A 3M32B 5J2QA 2G1HA 1BQMB 1KONA 3S6EA 2ACMA 3R5BA 2QMWA 3Q8QB 1WG1A 4CP5A 2BE2A 1U09A 1IBKJ 1K1SA 5GMDA 4OI6A 1RLDA 3H42A 1KHVA 3KHLA 2R9LA 3OR1B 1Z2LA 3A8EA 4I64A 3HHLC 2RT3A 4PG7A 4C3MA 3PKYA 3KMSA 1U1LA 4UY85 1B4SA 1Z2ZA 4FDFA 4RW6B 4KGVB 5D0EA 4TU9A 1QAYA 4DV6J 3PO4A 1DTTA 2RRNA 3TA0A 2C2EA 1LWXA 1UAWA 1RTHA 1V9OA 3US5A 4CI0B 4CT9A 4P2FA 5KFKA 1JQGA 4DV2J 5D3GA 1JKHA 3FJ2A 3H5XA 3FBCA 4ITSA 2EG1A 2W7AA 3RUBL 3AOAA 2NZ4A 4RUCA 4ZS6A 4DR3J 4HHHA 1S9GB 3M9NB 4DWIA 1TAUA 2JVRA 2RDDA 1JLBB 2KN4A 5CYMB 1JLCB 2FYXA 3BH7B 1Y3JA 4R0EA 3BKTA 3UNYA 1CBKA 1U8WA 3EWGA 3V6JA 2QFIA 4YY3J 3D3CJ 5KFMA 1YI2S 4PXBA 3HJVA 2D1CA 3I4PA 1VS3A 4OFZA 1KHWA 3VWSA 1ZM2A 1XMOJ 2OH2A 2RMLA 2ZC3A 3Q8SB 4F4YA 2XMKA 4LVOP 2MEWA 3CJ3A 4FS1A 2L9DA 2W2PP 3Q86A 4AQYJ 2HQIA 2WK4A 1U0HA 4NXMJ 3MEGB 1W25A 3R3TA 3TP2A 2WVBA 5KFUA 5HVHA 2J6UA 1AXQA 4LMZA 2PMZD 1F5AA 1F2HA 3MTJA 2HQGA 5IC4B 4NLXA 2DISA 1RWNB 5A6WA 3UDEA 4IUFA 3D4JA 3UR3C 2VDHA 3OTDA 5IQQA 4DR7F 3R27A 1WNEA 3ZZRA 2BUNA 2PDAA 4KTQA 1QE1A 1U0SA 3C16A 5E3PA 3PHTA 1QJHA 3PYGA 3FEZA 1PC5A 3O3LA 3QLHB 1RWXB 3AD7C 5KFCA 3KK3A 4DR1F 5D0HA 4DFJA 1SL1A 5HROB 2R7VA 3VGVA 2Z4PA 4P2SA 1KP6A 3N79A 5HO4A 2CZ9A 1U6BA 1YJUA 3T9NA 3LP0A 2F40A 2GIFA 4FKXA 2UUTA 4KFBA 4GRSA 3ET6B 4HHJA 4USTA 1UPMB 1ZAXA 3J7YU 4LRCA 2BW7A 2KHCA 1HNVA 1TKZB 2XYHB 2DGSA 1TUVA 2X7IA 3W1YC 4J37A 1OQ3A 1FDBA 2PFDA 3UCGA 4DQSA 3CDEA 3MM8A 1JLGA 2YPYA 5J2PA 2W7PA 3JTNA 1RXOB 2KJWA 4ZPWR 5KFHA 2R2SA 2MQ8A 2V2ZA 2AX1A 3KWMA 3KMQA 3IBFB 4ECZA 3LF0A 1DRZA 1T95A 4ED1A 1SC6A 2DNGA 2X51A 3QT7A 4R5PA 3H59A 5AE2A 3V81A 5DQHA 4M5LA 3RB0A 2Z57B 3NCQA 4EZ9A 2RUSA 2CJXB 1ZPVA 2W01A 3Q8VA 4YB5A 5FD1A 1XN9A 1IBCB 4CLUA 4RW9B 3MDFA 4MYTA 3RTVA 2J0WA 2Y0SD 3X3UA 3LAMA 2QLWA 5DQGA 5F8MA 2N3LA 3GJRB 1ZM9A 4GVLA 3TAMB 3OSNA 2DEJA 3C6UB 3CGIA 2ABYA 2V94A 5DS7A 2YH0A 2D9PA 1YSJA 3C8YA 4RNMA 1GXTA 2Y8WA 3AD9C 2HWHA 5IT9U 4K50A 6FD1A 1H2UX 2VUGA 2DR6A 2J0XA 2FHOB 1IWGA 1EKRA 2KU7A 2V6AA 3MPDA 2YTCA 3OR2B 4NLPA 3W5ZA 1S0MA 1Q8IA 4DPUA 4LBHA 1M5PC 2EXUA 5K5MA 5IM0B 2CPEA 2AEMA 3GQCA 3P49B 1SPBP 2K3KA 2DY9A 4I1TA 4KT0C 4CH0S 2CNKB 2JLEA 4A4JA 4ETXA 2KXHA 2ZH1A 2C2KB 4ZPCA 1S57A 4CO3A 2GQCA 2KG0A 4C48A 1VQ5S 4QPXA 1M1HA 1NEEA 1RB0A 2DGQA 3R5JB 4NI2A 4RW7B 5BR8J 4HVZA 2MJUA 3HPOA 3JSMB 4JI7F 4WE1A 1TKTA 2H4WB 2BABA 2CQ2A 2IYIA 4R0JA 4JI8J 1HD1A 2CPXA 1ACMB 1R31A 1RAHB 1IQZA 1WC6A 2FB0A 2RSQA 3B4DA 3HZEA 3CJ4A 3I0RB 2UV8G 4UZCA 1X5OA 2XHCA 5KFZA 4ATNA 2FGOA 1OPZA 2OO4A 1U26A 1KQSR 1B3TA 2Y3YA 5K14B 2BRLA 4HR2A 4DUZF 1LFPA 3R5DA 2M52A 4ID8A 3Q22A 1M5HA 3PX6A 4DL7A 1T05A 3ICLA 1N5YA 3F0NA 4O3SA 1GEHA 3BSNA 2AW0A 2ZJPQ 2V8DA 3MEKA 2OPSB 4NLQA 3PRDA 2LA6A 5E2QA 3MM8B 4K4WA 1NKEA 2RQ4A 4GVBA 4ZOSA 5KTQA 1HI1A 4HH0A 1WI8A 5EGYA 3IXQA 4M94A 4DV7J 3Q2SC 2GZOA 3PFOA 3NGDA 1U48A 1S97A 1VQOS 3RW7A 4C98A 1DQ9A 2V9KA 4TYBA 4B3TF 1FX4A 3KLGB 5IV4A 4ES1A 4JI4J 3QJLA 2OFGX 2ROPA 3VGUA 3GMGA 1CSJA 3D28A 4WIIA 4DX7A 3PM9A 3WZ0A 2HNZB 2AU0A 4ZP9A 3EVWA 1XNQF 4IQXA 2ZWPA 1OY6A 3PFEA 3HT0A 3CCJS 4QU6A 4IRDA 2ASLA 2LXIA 1FKPB 1E6VB 1BMQB 2DRDA 1PSDA 2O01C 2DPJA 2XTJP 2Y1LB 4G1PA 3GJTB 2J8AA 4NLUA 5CCLA 2L41A 2I0XA 3H2UB 2JLGA 4J9RA 1EHWA 3K5PA 4ECVA 3V5RA 1X5PA 1KTVA 2GNKA 3PYFA 4D3GA 4CRJA 2D9OA 2NREA 3TR5A 2E5LJ 5A8RA 3L3CA 2Z2MA 3CTRA 5K8MA 4DV7F 1TZ0A 3CC7S 4OI4A 4LR8A 5KFRA 5AXKA 2HQFA 3OL6A 4WPAA 2OEJA 4LRBA 3M30A 1P27B 1EIYB 4NLSA 1KRPA 3T1HF 2B9EA 2Z2ZA 2E5JA 1H2VZ 4QYZJ 5DZ7A 2WSFC 2DXFA 2C3OA 1KWMA 2B3TB 2XMVA 1WOPA 5KT5A 2N7CA 3KLHB 4NMLA 3UPFA 3KJVB 2QC3A 2U1AA 2W8KA 4NLGA 4W92B 5EX3A 3DU6A 1YTYA 3CJ0A 1S1TB 5LMUF 1GT8A 2H4YB 1UEUA 3FCHA 2XI2A 2GGPA 3BN7A 3PXGa 4OZ5A 1UEKA 4M95A 2YH1A 1WACA 4DV1F 1HQ2A 2C3MA 3CC4S 2Q3PA 1XERA 3JTPA 1OMSA 2HFUA 2M7SA 4LVNP 5CAAA 3W7BA 3MUMP 4PUOB 2HHWA 2UXBJ 1S72S 4FNHA 1NAQA 2JWNA 5J1NA 5EWFA 2EVZA 2DNZA 3ZO7A 2J0SD 1U2FA 5H9FJ 4ZVEA 1ZZNA 4J9PA 4K8RA 3RZAA 2HHHJ 1RU2A 1N5SA 3K8VA 4PQAA 2DNHA 1X7VA 1RWMB 2NR0A 2NS1B 3JTOA 5T41A 3U27A 3D0HE 3WC0A 3DRSB 5DZ6A 2HWTA 3N5FA 4O0NA 2YX1A 2ZFHA 4FPRA 4W98A 4HT5A 4DQPA 1S1UA 1XIQA 4FYXB 3HULA 3T9ZA 1BQNA 4RWWA 4CO4A 2HLTA 3O6QA 3V4IA 1QAIA 4K7QA 5IV3A 3G6ES 2MY8A 2MZQA 1GH8A 1B70B 1I1GA 2W2NP 2R8KA 3TVZA 3T19A 3QO9A 2CQBA 4K59A 2H5IB 2UXDJ 3J7ZT 3UR0A 4TY9A 2JC0A 2VV5A 3BQ1A 3LP0B 2BV3A 3I6PA 3A13A 2JRSA 5AJ3J 3T5KA 2YWWA 3DHXA 1O51A 4ECYA 4FYWB 2B7CB 3CO9A 2CQPA 4URSA 4F4XA 1Z1ZA 1OY8A 1VIXA 1HMVB 3EJMA 4IOBA 1NK9A 3BDEA 3OTCA 3JQKA 3J7Z5 2QV6A 2XULA 2KG1A 2M5YA 1PG5B 2FJBB 3HFKA 3PEHA 1NBEB 3UVJB 3W5YA 5J2PB 4DV3J 5DDPC 4LF8J 2B4OA 4AD6A 2HHXA 2W2QP 3CCWA 4RUAA 2OUGA 1GK8A 1U1OA 3KTQA 4PYDA 3NS6A 3MFIA 4WXWA 3QIPA 1Q86T 3TJ9A 3UVJA 2VG5B 2F8MA 2ZJQQ 2RE1A 3MCMA 4ZLNA 4CO2A 1R8AA 1X9MA 3DI6A 3FSXA 1SQEA 2M8DB 3DU5A 1ZTWA 1P1TA 1I51B 1SKSA 1N8RT 2ZE2A 4DV3F 1N33F 1XR6A 3F44A 3LTOA 4N8OA 3GIKA 3MWBA 2D74B 3SV3A 2FZCB 4YP3A 5HLFB 4USIA 2B4PA 1HNWF 2CPYA 3RRGA 1WOSA 2H5EA 2HQ3A 1NJIT 1LWFB 1FTCA 3NWGA 2IAJB 3OVAA 3TNVA 2J0QD 4ZN3A 2CRLA 3O5TB 1AT1B 4DR5F 1H38A 2JFDA 1CULA 1WF1A 3WIVA 3MPYA 1GAOA 1VQMS 3VZHA 4GKKJ 3GFXA 3NGRA 3SCIE 1PBAA 3TA1A 3W66A 4QBUA 2HEKA 1OYEA 2X1BA 3DLKA 4UW2A 2IJNA 5LT5A 3T5HA 2BANA 4R5PB 3V81B 2DGTA 1L3KA 5H9FK 4Y28C 2RU9A 1SL0A 1ELOA 3BSAA 4DG1A 5ETQA 2O67A 5IXUA 2HFNA 4DR2F 3V6KA 1BY9A 2LA4A 4HYKA 3SZ2A 2W4PA 3CDWA 4P6QA 4LFCF 3MEEA 4DZDA 3OUYB 5B0EA 3H4DA 3S8SA 3MCNA 2OPRA 3AB4B 3QGGA 1HI8A 4FPIA 1RTIB 5KG6A 3ZZUA 1VJQA 2OP5A 3GSIA 4ED3A 5GAHU 3UDCA 3BEGB 1MN9A 5GMEA 1FNMA 3C15B 4ED8A 2HGNA 4N47A 1H72C 3NY0A 2UU9J 1LNQA 2DK2A 1K1QA 3H5UA 1F5BA 4USVA 5I4MA 2A2DA 3M7VA 2OPSA 4B9VA 3H4BA 1WDDA 2VU5A 4B9MA 4GKJJ 1QE1B 4AFFA 2MQNA 3ZZ0A 2K7KA 4DSIA 4O44B 2WAQD 2DO0A 2YNGB 4J9KA 4MAKA 1HR0F 2DJWA 3DRSA 4EEYA 4I2QA 4ZPDA 4M8LA 4Q2MA 2LLZA 1JX4A 2OEMA 5E7OB 4IRCA 4U7CA 2FVCA 4RBVA 3H5YA 1GQEA 2H5JB 2IM1A 4L75A 4ANDA 5LM7E 1B0VA 3CJQA 3GV7B 2AQ4A 6FDRA 1N56A 1TKTB 2DNLA 2BRKA 1FI4A 2KDOA 4HLBA 4I69A 4I7FA 1FJCA 1RZMA 4JV0A 3B6BA 4DPTA 1QUVA 5T14A 2ASYA 1VDHA 3BR8A 3MMBB 3VGTA 4I6WA 3OJSA 4NCAA 5A2QU 4ZK7M 3GV5B 1UA1A 3EZUA 3MAAB 1FRJA 1O0PA 4OYMA 4H4KA 3LPYA 1L3TA 1SC3B 6AT1B 4OI1A 4A8QA 1N34J 1IBMJ 2GMHA 1D09B 2MDAA 4ED4A 2OMLA 2ROGA 2WSCC 3DOMB 5LL6d 1Q79A 3O1LA 3W61A 4QYZK 1TL7A 4TY8B 2VG6A 4LT6A 5J2QB 1T0TV 1X9SA 2F4VF 3BBBA 4LFBF 3GR1A 2Z56B 3MCOA 1Y11A 3SQOP 2JJ4D 5KT3A 1Q8LA 2PE8A 1D8ZA 2QSWA 4WE1B 3W2VA 2AZ3A 5KG3A 2VG5A 4MK8A 5LJ3Y 3GB0A 3K59A 3OTBA 5H9EK 1TL5A 3QAEA 1M1KT 4J7CA 3J80Y 2Y8YA 4LBPA 5DJBA 4QWBA 4FF1A 2R7UA 1N4LA 2I9SA 3WQPA 1SC4B 3ZC4A 3OXGA 3D1QA 2BW2A 1T94A 1U25A 2A1BA 3FK4A 3IR7B 1RAOA 2BACA 3LGMA 3RU0A 1DLOA 3THPA 3UE2A 3I87A 4GKJF 5HBMB 1UFWA 3ISNC 1JLCA 3LOUA 3DRPB 3EYZA 1S9GA 1NRKA 3A4TA 1E6VA 5F9NA 5I3UB 2ZBPA 3SSRA 2HS0A 4KHRA 1RWKB 3W5XA 2OKQA 4ECUA 4ECXA 1LWEB 4XDCA 2C22A 3EE3A 1WHVA 1GX6A 2MKHA 3CULA 1GMVA 2E7VA 2ZWOA 1VFJA 1NK6A 3M2VA 1DY3A 5K8PA 3HF5A 3GU0A 4DF8A 2WOMA 4WTYA 5KFWA 3KLIA 1B0PA 3JSMA 2JH3A 5DDOC 3PY8A 1NUEA 3T6BA 5A8WB 3OFGA 2DNQA 2CVEA 1AB8A 3X1LB 1VHFA 2KI2A 1LW0B 1AFJA 3ENWA 1NJZA 1FJEB 1A0OB 1NU4A 5M2PA 1S6PA 3IS9B 1H73A 9RUBA 3SSQA 1OS5A 3EGVA 3GYGA 3MEDA 4B08A 3OLBA 4DV5J 5HROA 4LF4F 3QT8A 3G6XA 1DHMA 2BXJA 5D3GB 1YIJS 2C2NA 4EK2A 1MMLA 3QLHA 4B3SJ 5F8JA 1RTHB 4IFYA 4UY8T 4WWSA 2EFNA 1UVMA 1UVKA 3DLEA 3LPEA 1S76D 5CD4A 5KFGA 3FZ2A 2CJQA 3VTIA 1H7WA 1TMMA 3C19A 2XQCA 3CF5Q 2OAUA 3AA9A 3TI0A 1HBUA 2AEFA 4OZNA 2BYCA 4P9SA 3RYLA 2B4VA 4E8UA 5CHCB 3HHKA 2HK2A 4U96A 2CNNB 3ZXWA 3TZYA 2VZ9A 4LR9A 3J7YI 1JXEA 4ICLA 3ZZYA 3J81U 1REGX 1V5VA 4ZPBA 2SXLA 3WX8A 1NPKA 2DO4A 3ELHA 3RBXA 1RT7A 4OJHA 1V5IB 1RTJB 1S1WB 1T3NA 1S10A 2XLIA 3V6DA 3M6XA 4DCOB 3KLHA 1RAGB 4B17A 5DLFA 4Z7YA 4DQRA 2JC1A 1UJ6A 2RB7A 3UN3A 4YOEA 3DMJA 2OD4A 2V8VA 1Y0HA 2OPPB 1IKXB 3P45B 4NOHA 4KQZA 2XO6A 2LEPA 2V34A 3PX4A 1RBOB 2JSXA 2OGUA 1HBMB 3NGTA 1U2CA 4K4TA 3D67A 5B0CA 1U1KA 4G1IA 1QSYA 2C3YA 2WVEA 2ZKTA 3QAUA 1DBDA 4LIRA 1NPPA 1VBXA 1NB7A 4C8MA 4Z37A 4HI1A 2LQ9A 3H2LA 5FIIA 3CUNA 4DLGA 2MKIA 3VGSA 3CCES 1GNKA 5F0UA 3CCSS 3PR4A 3BKUA 1LV5A 2IAJA 1F1BB 1TL4A 4MMOA 1RT5A 3UWTA 5DLGA 2FLNA 2HAFA 1PCAA 4DJBA 2MXYA 4C6AA 2C3PA 5KG4A 2ZM6J 4M5HA 4OYAA 2OELA 3SEOA 1Y9OA 4CLKA 1C0TB 2VODA 2BJDA 1XR7A 1HNIA 1VQYA 4DR1J 3ILIA 4C0OC 3K57A 1HARA 1KBRA 1N0VC 2HIQA 1RWOB 2J6SA 3H90A 3H0PA 3MURP 3J7AN 2XBPA 1Q16B 4X66F 2YQ1A 3C6UA 2I1RA 5AE1A 1SVDA 4U8YA 5HJYA 4ZKAA 4NXMF 1VCTA 4J9NA 2IVFB 1F6TA 4JP8A 4RBUA 1N32F 2HURA 2VL1A 4ZJOA 1UWBA 3EUNA 3KJQB 1D1UA 3GSDA 1G1XA 4PYAA 3JYTA 4NMXA 1KR4A 2ATCB 3GPAA 1JLBA 2RIJA 5CYMA 4C3LA 3G8SA 4ZIVA 1GXLA 2L9NA 3RAXA 1GFWB 3POTA 3M6UA 1K0VA 2MTLA 4P52A 4ER8A 1FO1A 5CABA 1NJXA 4Y34A 4QR0A 2G4BA 3B8HA 2YKOA 2BE9B 3MD1A 2KT5A 1S1WA 1K0TA 1F3VA 2RS2A 3EPIA 4GO5X 4OX6A 4LSZB 4NLOA 1Y5LB 1RYSA 3PV8A 3NGKA 2I8EA 3SSSA 1DURA 3HVTA 4BBYA 3CW2C 4WTOB 5KFYA 1RABB 4WBFA 2DNPA 4QJVA 5MAOA 3QYYA 4PXCA 4KFBB 2MZSA 3HLUA 3Q8PB 1TUWA 1SC1B 3PHEA 3SV4A 2OMOA 1HKAA 1REVB 4FF2A 1SUQB 1U1MA 5FJ4A 4CCHA 1FE0A 2GO9A 1EB0A 3CDBA 3S7RA 4WP9A 4NA3A 2JEFA 5L9XA 4X2BA 3R5CA 4S0MA 3OTEA 1Q8KA 2LDIA 2J8SA 4QWDA 3BGUA 2R2RA 3O44A 4HTJA 3QNWB 5GAEU 3RB6A 5L38A 2E29A 4GVBB 1TK5A 4LF5F 4A47A 3NAHA 1BD6A 3L4BC 1JLFB 1FRHA 1JNRB 1RHMB 2AD9A 3ZNUA 3TJ8A 2CQ0A 1HWIA 3FFIA 5CXTA 3OR1A 1J5OA 4YHHJ 2L08A 1C0TA 1DARA 1P1LA 2VG6B 4CO5A 4DCPB 5L39A 4CWBA 1CJUA 1PGZA 1WSVA 5GAEI 3S1TA 2JVOA 2WBMA 2OPPA 1IKXA 1WJ9A 4PABA 2KYZA 2E1PA 2WVFA 1UMJA 3E01A 4MKVA 3RAQA 5IT4A 4ANCA 2E1RA 5HQMA 2J7UA 2RDIA 4BWMA 2BOPA 2DVIA 1FF2A 1NMEB 1XBWA 2LECA 1UJ5A 4K4VA 3SCKE 2Y1JA 2HFOA 3TQEA 2XNQA 3OLAA 4WYWA 3LQVA 5KG1A 3V4MA 1IVZA 4K2XA 1R0BG 4HL9A 4F3QA 1YHQS 3DLHA 5DDQC 3KK1A 4JI1F 4KKOA 1L3UA 4PQUB 3N01A 5LSRA 4CM2A 4NL5A 2F7VA 4EYIB 2VG7B 2RQMA 2IM0A 3BGRA 4FXVA 4MIAA 2N3OA 2WB1D 1HQEB 3V2UC 3OPKA 1ZPWX 5B0GA 4K4XA 1QLNA 2Q66A 1V6HA 5D77A 1RK8A 3ENVA 3G6YA 4GKKF 4FBUA 1HWLA 1TKDA 3C16B 2BX6A 3IGVA 3MF5A 1O5JA 4IKAA 1S9FA 2XLKA 1C4CA 1RP5A 4K4SA 2KTQA 4CLTA 3BPSP 4J9VA 1VJWA 2AV5A 1TVRA 4DZ6A 3KKFA 2CWXA 2ZBIA 2V8PA 4IYQA 3P6YC 3OL7A 2AGPA 3DYAB 2UVWA 2ZJRQ 2C2RA 2AX0A 2Q1LA 3KNGA 3ZZTA 2IHR1 4DL3A 3NS5A 2ASJA 4F2RA 2X1GA 2FIUA 3CMQA 2JEGA 4V19J 4ALZA 3BGLA 3I5BA 5B0DA 5M2UA 3M9OB 5U47A 2XMTA 2VASA 2J9CA 1FNXH 3FGVA 2VQFF 1G3OA 4EYHB 2Q6CA 3DNCA 1M0SA 3EGNA 4UQTA 3CMES 3RW6A 3W2WB 4ED0A 1KSPA 2N4CA 4RUHA 3TZZA 3CCQS 2AJ1A 2EFQA 4KSEB 2VJUA 1SJFA 1S7IA 3M8WA 1WOOA 3MD3A 3U02A 3VVTA 2XZDB 4TNOA 2B8QA 4YQWA 3HSGA 4FNIA 1SUQA 2R4FA 4ZVUB 3RBZA 4ZCIA 1WHYA 2C2OB 3QSYB 3NMRA 3BBFA 3F73A 1TAQA 5C25A 1ZYQA 3TUZC 2M0GB 5G0RB 1OWXA 2B8PA 2FHJA 1Q0NA 3CJ5A 4E2FB 5KFNA 1MMNA 4CLYA 2QX0A 2UXDF 3NNHA 1EETA 3T1AA 5A2QY 1RA7A 3HT3A 3C2PA 3BGFA 3BPDA 3MTKA 5HLFA 4DV5F 2HSEB 3VV2B 5G4DA 2VQEJ 2BJ9A 3D3BJ 3KXDA 4P72A 5F9LA 4F4KA 2BQRA 4JV2A 3OHBA 1C0UA 4LFAF 1EJ7L 3FRZA 1RU1A 4WKYA 2P9EA 1HI0P 1JLQB 2IDEA 2YWKA 3PW5A 3Q8UA 1YJ9S 4CNZA 4N5SA 4FS2A 2ALZA 2ZOFA 3HHEA 2KFYA 1FRKA 2PD1A 1LW0A 1S5ZA 4LF1A 1FJ7A 3LP2A 1SH2A 2AZ1A 1S6PB 2MGZA 1Q7LB 4DR4J 4E98A 3D6MB 4JBCA 1TUGB 4WU3A 5ETPA 3THTA 1MROA 3HSZA 5KAKA 4X4OA 3SMZA 4QOTA 1S0VA 2E9ZA 3GV8B 4DX6A 4EBEA 3ONQA 1NKCA 4KHPF 2KHDA 3A12A 3FCWA 4DV0J 2H65B 2QL7B 1GMUA 2DR9A 4EBDA 2HVDA 3GJQB 2JFKA 1Q5VA 4RO0A 5F3TA 2AWZA 2DGVA 1VBZA 4I2PA 2PIIA 4CDIA 4O3RA 4AT1B 2IMWP 1SXLA 4PWUA 5I3UA 2ZZNA 4OX9F 1P8GA 1WI6A 1KOOA 4MIWA 2C3UA 2HMIB 4YR0A 3TJAA 3E2EA 4OHVA 3MOJB 5BYQA 4MFBA 1NJYA 3JYTB 2UZAA 2GIRA 2HK3A 4ZVQB 4WXOA 3W60A 4PAAA 2CQ3A 4XDDA 2VQEF 2CDRB 2UUCF 1IJFB 4KO0A 2UUAJ 3A3NB 1RT7B 2HRYA 1LKZA 3FUYA 1RHKB 4J91A 1NSAA 4Y2IA 1RDRA 5KOXA 1SI9A 2CJAA 3P4UB 5DM6Q 1KLMA 5CA5A 5KFIA 4DSJA 4NCGB 2IBKA 4WFAQ 2RKIB 4CTAA 2JEIA 4ED2A 3NBPA 5D4PA 2YKNB 3DOLA 1K44A 4LF5J 2RAQA 4DFMA 4XPEA 1MLAA 3JAMY 3CC2S 1UETA 2NSBA 1RWVB 2XHWA 3EVMA 2NXEA 4IR1A 1HBMA 3CCUS 2Z2LA 4I6AA 5DETA 1J27A 2D41A 3RAMA 1I6JA 3BQ0A 1NSKL 1OSCA 1YZ7A 1B7FA 4MJKA 2R7WA
chains in the Genus database with same CATH topology
1BGXT 4F67A 1RKJA 4M5DA 4FVMA 5CYJA 2GFFA 4YB1P 3Q23A 5CZVA 1FK9A 2YNHA 4RNNA 1VC5A 1FXDA 1MSWD 3DRRA 1CC7A 5EWEA 2DB1A 4OZJA 4C7QA 4KBIA 1UL3A 4NYZA 2ZH7A 3HVWA 3CB4A 4DMZA 4TU8A 1T02A 2HFZA 2A2CA 5BYRA 1UP1A 3FEXB 2HS3A 2DRAA 1TV6A 1C1BB 1RT3A 3M2RA 1UKUA 4IH5A 2XY7A 4NPOA 2N4DA 3I55S 1VOMA 2UU9F 3PDNA 1AFIA 2EWHA 4BHQA 5E3QA 4F26A 5KT7A 3HHLB 2YKMA 2FJDB 3WX4A 1XMBA 2LU2A 3VR1A 1CC8A 3TANA 2CJKA 2W9CB 3UCZP 3CPWR 2ADBA 1RTDB 4IRKA 2WSEC 3T5JA 1BC6A 3C66A 1WTFA 4Y6IA 1RT5B 2FLLA 1S79A 4JI8F 4JI0F 2AJQA 2RQKA 1R7IA 5K8NA 5BR8F 4C8NA 2YNFB 1SKWA 2E1MC 1NKBA 1NO8A 1S4FA 2FUG9 3M30B 2OPQA 1LWCB 1TFWA 1Q82T 3RBDA 4O4GB 3CJKB 2PI4A 2KVIA 2XGQA 2DNMA 2PGCA 3VAKA 7FDRA 1NNDA 2JEJA 5EUHA 2A10A 5J2NB 3V4IB 2AGOA 2B56A 3MI7X 2NUHA 2KZZA 1BQXA 4O3QA 2ZM6F 2KFZA 2VD3A 2DT9A 5KFFA 3KK2B 5D4OA 1E6YB 4RWXA 2F8HA 3FSYA 3SCJE 2IRUA 3I0RA 2IYGA 3O8WA 2YNGA 2CFXA 2R8JA 5DDRC 2CG4A 3CDAA 3TX8A 4EBCA 1HPZA 1IKVA 4QR1A 1ZETA 1FDDA 1IKWA 1VC0A 2G13A 2BQUA 1URRA 4OL8A 2CPFA 4KIAA 4LIWA 3ZZZA 1ZAVA 2V8GA 2ZHBA 1VIOA 2VPYB 2DH7A 1DJ0A 1VI7A 4LSNB 3DMJB 4FXWA 3CWJA 3SQGB 5GVQA 2E66A 3AJ1A 1TFYA 5KOWA 1HHSA 2VKZG 5M2RA 2DITA 4DQQA 3TARA 3OTOF 1WELA 2DNOA 1N5TA 2NSCA 2UVRA 3K5MA 3MAQA 3NG8A 4OIXA 1H3DA 1SV5B 1FTRA 2IRYA 5AXMA 2IA6A 4AL7A 1U1NA 2QA1A 4RNFA 1C4AA 2I5JA 2A3JA 4MK9A 5CD4H 2HHTA 1S1XA 2DH9A 1SV5A 3H8YA 2FHKA 4DV0F 2NPIA 3O2IA 3MM5B 5F8IA 1MU2B 4UOCA 4DFPA 2IC3A 2YKMB 1DLOB 1H6KX 1WG4A 1J2VA 1ZBTA 1JJHA 3PW2A 2EBGA 4C9DA 5H9EJ 4DR6F 1IXKA 5J2MA 3GE9A 4OX7A 2W9CA 3KK1B 1RTDA 1A7GE 5GADI 2DNYA 2XS5A 4A8WA 4DHVA 3HVRA 3VALA 3GYNA 3BDPA 3M8QB 5I3QA 2QYCA 4OHXA 3LH2S 4IQMA 5J1EA 3J7A1 1OO0B 2LQBA 3DHWC 4QW8A 3SCLE 2X3GA 1M5VC 3BM7A 2LQJA 3PJXA 4PCQA 5E3CA 1WEYA 3TOQA 2W4CA 5LSOA 3UNGC 4YR3A 4QR2A 2GCFA 2LVWA 2R7OA 1HBOA 1WD6A 4QWAA 1UA0A 3BR9A 2ZH8A 2HZCA 3BSOA 1Q4RA 4B9TA 2Q6BA 3MECA 5MLCV 1NK0A 3TAQA 3HI9A 2M3DA 4ECWA 4MFBB 5F3ZA 3Q8RB 2R7RA 5HP1B 4EUVA 2EW9A 2DPIA 2JOQA 1YG0A 4H4OB 2COLA 4TQSA 3SYZA 4C8YA 2XMUA 1FHTA 2DNNA 1JNZB 3CCLS 3F41A 3MCSA 3KFWX 2GJ2A 3AB2B 3P5TL 1IKWB 4C11B 1TV6B 4LSLB 2DR7A 1R27B 3L7PA 4QWEA 3BZQA 3N6LA 1S49A 1W2BR 3PO5A 2I2YA 5DRKA 5KFDA 1Q8BA 2QO3A 2BA9A 2XCAA 4ILRA 4EZ6A 3KYLA 5KFJA 5L1LA 1UJ4A 1TL1A 4IH6A 1JB0C 2IVYA 3DLGB 4OZ1A 3OL9A 4W90B 4HEA9 3QZ8A 4NWBA 3VAHA 2FJXA 4TYAA 4OI3A 5HMWA 1X4CA 3PIOQ 1GTHA 4DL4A 4C8ZA 5IS2A 1LWEA 2O5DA 1JLGB 3DN9A 4ECTA 1AUDA 2EK6A 4KJIA 4HH1A 4ZPAA 3E51A 4RW6A 3MMAB 4A8XA 1ZTTA 1FEHA 2E7XA 1G2EA 4QIFA 2O3DA 3CT9A 3MM9A 4JI4F 3M6WA 2G1DA 2ZBCA 5D4LA 5HQ8A 1BQNB 4RW4A 2BE2B 4ZPTR 2ROEA 2J76E 4Y65A 2E9TA 2WW8A 1T3OA 2IM3A 4DN0A 1JLAA 2VA2A 2MY7A 3DLEB 5J1PA 4XAKA 4OX8A 2XMJA 1X4BA 4IFYB 4Y0FA 1YRUA 4YFUA 1FD8A 2M9KA 2VBWA 5B0AA 1SL2A 3MR2A 1UVJA 4NRTA 1M90T 1YRXA 2VKRA 2E1CA 4KAIA 1D9DA 2HNYB 3M05A 2BDPA 2EI5A 4U6PA 4FF4A 4RNHA 3KG4A 3CSKA 3QWUA 1X0PA 3OXLA 1Z4UA 3IWNC 4DPOA 4IG0A 3W2WA 4RU9A 3Q0AA 2O1PA 4MH8A 2MHNA 2RJZA 4X4QA 4KV8B 5F8NA 1LWCA 2BANB 3M9MB 4IO9Q 4NYOA 1ZZFA 3JSRA 4I68A 2CYYA 1X8DA 4HI2A 2GHPA 3CD5A 4M5DB 3ZZPA 1JJ2R 2VPZB 1K73T 5CYQB 4X65F 2W7OA 5G0RA 1S6QA 5DGAA 2MHEA 2CPDA 2W4DA 1R0AA 5C42B 2M2BA 4YUDA 3FMBA 5EHHA 2POKA 4XO0A 4QQBA 4DL5A 2XLJA 3M32A 3W3SA 3HXMA 1NZAA 2KRBA 3AQPA 4AYBD 1K8AT 4QPTA 1N48A 2AYGA 3LWLA 2CJBA 2VONA 1OSDA 4RLEA 1D8YA 3DOMA 2ASDA 2HVZA 1U2RA 2MZRA 3QIPB 1SIWB 3GILA 2AYEA 3I32A 2BJEA 2XEXA 3E01B 4PPZA 4CT8A 4DBQA 2OTLS 3G9CA 4I67A 4JYAF 4PG4A 1S1XB 4OHZA 1GTEA 2CQIA 3LO3A 1J5EF 2KRRA 3ISZA 2FJWA 3HVAA 5GAHI 2ADCA 1HD0A 4KHMA 2FLPA 5FLXY 2MZTA 1NK5A 2GC8A 2Q43A 5B0FA 3QJPA 4IO1A 4RW8A 2AJ4A 1TQLA 4HT7A 5E33A 3DOKA 5FDLA 4Y2MA 3BQ1A 4X2BA 4FN5A 4LQ3A 3I82A 1YJWS 4OQJA 1U1QA 2KH9A 4JI3F 1HW8A 1VQ6S 4O23A 3DLKB 5L8RC 5D6GA 5A8RB 1N5VA 4C3KA 4TLRA 2CKWA 4ZCMA 1JLQA 1VRTB 2X1AA 4QIGA 3IWXA 2HNDB 1C0UB 3MR3A 2W25A 3BN4A 2Y1IA 4DDFA 3K8WA 2MGZB 3DLBA 1DTTB 4DQIA 2R7TA 3IAS9 2WOMB 3AY0A 4R8UB 3I96A 1HBNA 5DG8A 3SI8A 2AGQA 2MYFA 1RT6B 4IH7A 2CQCA 2D3UA 3KLFA 4F4ZA 1C1CA 1G6BA 3E3XA 4NZ7A 4X62F 2DGOA 2ZOGA 2KM8B 2QEXS 4B9LA 2R7SA 2JX2A 2V4QA 2CZ4A 1U45A 1FXRA 3IRXA 3OVBA 3KLFB 3R1HA 5HBMA 2C42A 2B4UA 2WHOA 2FGCA 1VQPS 1KVIA 2V5HG 3MECB 3PW7A 5K14A 3TA2A 3CCVS 4J9QA 2YNIB 3NL0A 1LW2A 2DCUB 5BYSA 1FJGF 4FP9A 2EFPA 5DG7A 2ZVSA 1H7XA 1CEZA 2KKHA 1JK9B 1WWHA 2ZDPA 1XMQF 3FFIB 3HVTB 2DH8A 2F8EX 2LU1A 5HMYA 2KYXA 3K5LA 4EU0A 2MQLA 1X5TA 5C24B 5CZXA 1F60B 2HRUA 1X9WA 2FTRA 4B9NA 5E41A 3K0JA 2OFHX 1QUPA 4JUZA 2V8HA 1N0UA 3QGPA 2AJFE 1T8EA 4USJC 4EO8A 3CD6S 3D1OA 1FA0A 1RISA 4QIVA 3DRPA 5F0WA 3DI6B 2CPHA 2B0GA 2P9GA 2RD5C 4WU2A 2BVZA 4B02A 3B82A 1S48A 4Q45A 4X4PA 2D3OR 1SBRA 2HGLA 4FYDA 3QZ7A 1QY7A 2LEAA 1IBLF 1X0FA 2GHWA 1S9EA 4R25A 5DQIA 1HYSB 1Q7YT 2H9ZA 4XK8C 5DO2A 1FE4A 1WHWA 4QU7A 1W2IA 2CQ4A 5GAGU 2YNFA 1RT1B 1LXNA 2MQQA 3PW0A 4ECRA 2E44A 3RB4A 1SJ1A 1Y4ZB 5CQGA 2RUGA 4PXEA 5B7WA 4RW9A 1RT4A 2PA8D 1S1TA 2J6TA 4DG1B 4AXIA 4Y2CA 3N5BA 2MKKA 4K4YA 2G0CA 4EWTA 4AL6A 3D0IE 2PN6A 4HDHA 5CCMA 2XSJA 4K4UA 3CXCR 3QMQA 2ATLA 2FJEB 5CH7B 2OPRB 4LQ9A 3KLEA 4F3MA 2KZMA 3NCRA 1XK8A 3CEDA 3B4MA 5LJ5Y 2GQQA 1NK7A 3HZGA 4NRUA 2RH3A 3KG0A 4F25A 2CQDA 4EGLA 1VRTA 1TKXA 2OJ3A 1BQMA 5L9NA 3M8SA 3E8OA 3I9V9 3K7RA 1QVGR 5EDWA 1SJRA 4ILMA 2K8GA 1UVNA 4X4VA 4RW7A 2HNZA 3ULHA 1RAJA 5HMXA 2W9AA 1XTZA 4ELTA 2FC9A 3HHDA 1UW4A 3I31A 5DGBA 2QA4G 4A48A 2YVSA 5KFVA 5LMNF 2B9YA 4DLEA 1HBUB 3D54A 3DXBA 1VC6A 3G8TA 2AF6A 4U7UK 3IRXB 4TKTA 5KFTA 1WF0A 3PIPQ 3TUJC 1JLEB 3AJ2A 1T03A 3NNCA 1YJTA 5HI7A 5HN0A 5A0YA 4A8FA 1RT3B 5AJ3F 2J5AA 3GIJA 4RZRA 1S7HA 2VFVA 2ZD1B 3S01A 3NCPA 3POTB 4CO1A 4IOCQ 2V2KA 2XS7A 1KQGB 3ZZOA 3BSCA 2WBRA 3U1MA 2JHEA 2ZDOA 3I0SB 4A8YA 2ZH9A 4PG6A 1YJVA 1RWUA 3UI3A 2ZH2A 4WJBA 2OTJS 1FESA 4J9LA 1TK0A 4PPDA 2NLWA 2UXCF 1Q78A 5AE3A 2ZH3A 3DGPA 1RJJA 1LK5A 1XR5A 3UFCX 2ZH5A 1VBXA 1DTQA 4KB7A 3ETOA 1MWYA 2XWXA 2C28A 2LCWA 4A8KA 2R7VA 3NKYA 5T7LB 3N4WA 1IJEB 3MPWA 3N6MA 2QIFA 1S0NA 2XI3A 3FVYA 3TUIC 3CIMA 3MMCB 3MOJB 2GA7A 4WK3A 3VZIA 4AE5A 1XMOF 1R6YA 1HNIB 1UEVA 5K8OA 4B3RF 2KB2A 2LQ5A 2BM0A 4X64F 3VAIA 5IM0A 1B0TA 4DUYF 1U6FA 1X4AA 4ED6A 5F8HA 3KJVA 4O0IA 3PZPA 3MGJA 4DSFA 1X4GA 1YVFA 2FJAB 5BJRA 1HQEA 1KLNA 3TVKA 1FD2A 3IRWP 3VAMA 4I2PB 4FVCA 1H2TZ 4JI5F 1E6YA 1FKOB 2YY3A 4TN2A 2P5VA 1ZM4A 1JLEA 2PA3A 3TAMA 1HBOB 3LWMA 2CQGA 1NH8A 4C8KA 4CQ1A 4N56A 3IN5A 3DRRB 2KJVA 3OHAA 2GHVC 2KM8C 1Y3KA 4Y2AA 3DYAA 3IC1A 1IUJA 1DAXA 4MKBA 1N5QA 1HHTP 4Y00A 2DNRA 2VB6A 4C8OA 1LXJA 2GMLA 4OI0A 3M2VB 2ZD1A 3RRKA 3P3DA 3VAJA 4ICLB 3MR5A 5KFXA 2R8IA 4ED5A 3I9ZA 3M1VB 3H40A 4PWDA 4C11A 3T1YF 3V6DB 3QJJA 2XSFA 3T6JA 4ZVFA 3VF0B 4KGKA 1NK4A 1WG5A 2WB4A 2LKZA 1RI7A 4O44A 3H98A 2UUAF 2ZNZA 2HG4A 3QWPA 5C5JA 2HVHA 2CPZA 2P6TA 2MMYA 4ZMMA 3MUTP 4MKYA 2MB0B 1CQMA 4KE5A 5CYQA 3G8QA 4YB7A 1B64A 4XPCA 4ID5A 4N41A 3GG1A 1QAXA 1V3RA 2QSFA 2OSQA 1U24A 2YKQA 1XWLA 3DLJA 4X4UA 1NH7A 1VK8A 1KEKA 3G96A 1KC8T 5EX0A 2WONA 1SIZA 1IKYA 4H4OA 5I42A 4OHWA 3CIZA 1AROP 1C1BA 4DR3F 4DN9A 5EN1A 5SUHA 3AHPA 2EFGA 1I94F 4F8RA 4C4WA 1FDAA 3TQ1A 2KXNB 3FDSA 1RT1A 3I0SA 2B9WA 1HQUB 4YDXA 5HMZA 2VOPA 2ZITA 5J2NA 3LW5C 4OHYA 1K9MT 3H20A 4G1QB 5L1JA 4DL2A 3F56A 2FVQA 4I0WA 4KPYA 4ZPVR 2DIVA 1F2GA 4K5SA 2IRXA 1JWWA 2R8GA 3NAIA 4X4RA 2OIHA 4LF6F 1YJRA 1LWFA 2LDYA 3QGHA 4ZVHA 5HLFA 3GFZA 5B0BA 2DIUA 4H4MB 3CD7A 3K5NA 1CLFA 1JMTA 3UDLA 3HO1A 1DTQB 1DFDA 1UWBB 3C46A 1R8PA 4WFYA 2NPFA 3EPGA 2HW3A 3MMJA 1KD1T 5A8KA 4KGMA 5F41A 4IOAQ 5KFSA 2AP6A 1SJ3P 1U1PA 2UV8A 4PRFA 3HDSA 3KHGA 3WC2A 2IA0A 2M4MA 2ZKUA 1CQNA 4GC6A 2CZVC 4ECYA 2DD8S 1HBNB 2EBEA 3MM9B 2CJ9A 3D1HA 1H98A 2NQPA 3K2YA 5B08A 2ZC4A 4G6VB 1ZAWA 3EGWB 3HJFA 3OFFA 3GIMA 4B3OB 3PNIA 1MNEA 2PMHA 4O3NA 1JXLA 4K0KF 2HHSA 2B7BB 3GFHA 1DQAA 2K1RB 3KHRA 4I7FB 1WTBA 2XS2A 3AH6A 4ELVA 2LXUA 3LP1A 2FC8A 2K3IA 1JKHB 1RT2B 4A8MP 2M8HA 1Q81T 5JUMA 2GIQA 3CE8A 2UP1A 2B9XA 2R8HA 2HHUA 2VFSA 4U67Q 3R1LA 2WONB 1VQSA 3TAPA 4NA1A 2DGWA 3FQLA 1YGYA 3IGNA 2HNYA 2IBOA 2CDQA 2XWYA 4HKQA 3U1LA 4PUOA 4BDPA 3OJUA 1PO6A 4ZP7A 4M63A 2MJNA 4BWJA 3BJYA 2MZJA 3PW4A 1R8BA 1IQTA 2QE5A 2V9WA 3FMWA 3MZIA 2DGXA 4CNYA 1SJ4P