2RQQA

Structure of c-terminal region of cdt1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GPLGSMTRCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVDLAGLTARLAHHVHAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and mutagenesis studies of the C-terminal region of licensing factor Cdt1 enable the identification of key residues for binding to replicative helicase Mcm proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
molecule keywords DNA replication factor Cdt1
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1420 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rqqA01
2RQQA 2KLOA 3A4CA
chains in the Genus database with same CATH superfamily
1IJWC 3K4BA 3HRSA 1Z9CA 3C3WA 5F0CA 1WKMA 2RC4A 2H6CA 1QGPA 3CC7I 3KYCB 5HVQC 1YFHA 3M8JA 2V9VA 4XKWA 5HS7A 3HZJA 2MD5A 3GFMA 4BEHA 3AG1H 1SFEA 1V4RA 1V5GA 4A5NA 1ZRDA 2IS2A 4GO1A 4OIRF 1FIPA 1DGWY 3HRTA 4PFPA 5ICEA 4BDYA 1S7OA 5D5UB 3G6EI 1SD5A 3BLYA 3IH4A 2DMTA 4D5FA 2XV4S 4IXAA 4QLCU 2ZXHA 2M0CA 5J8FA 5EGOA 3KP3A 1ZGAA 1KU2A 1S7AA 1GDTA 2UV1A 1RKTA 4PSWA 3KZZA 2E1MB 1TWGJ 3AFHA 5A2QZ 3GW2A 2WBMA 2CV1A 2LP0A 2CUJA 1EV7A 1YTYA 1KU7A 3FHZA 3ZMDA 2DMQA 2FA5A 3OIOA 2KDZA 5HS9A 2CS3A 4IRHA 2NAZA 4UV9A 1XMXA 4EJUA 2ECCA 3GBGA 3AKZA 2LMDA 5CVUA 3DU5A 3C2GA 4OIOF 1IF1A 2V1UA 3DEWA 2R5ZB 3S2HJ 1UMQA 2R5ZA 3WTYC 4B4CA 2CUFA 2KHMA 3FZVA 3S2WA 3IRQA 3KPHA 1XPXA 1JXSA 1YIJI 4LD5A 4WX9A 4HYEA 1KQ0A 4OAYA 4I76A 4WXCA 3L2QA 2H09A 5ERIA 4YFNF 1DP7P 2ZJQF 2HOEA 3MWMA 3H5NA 3IC7A 2B9SA 3C7JA 3CCUI 2LY1A 1UJ8A 1AKHB 2OBPA 3LSRA 1SD4A 2YR2A 1QZZA 3EYYA 4M3GA 1RRJA 3BG6A 3J7AO 5ED4A 3ELKA 2E71A 3OS1A 2YS9A 3O3KA 3CMAI 3BDDA 1GV5A 1KGSA 2LR8A 2HOAA 2IEKA 4F91B 2MSYA 1W0UA 2Z5UA 1G3YA 1YS7A 4KN4X 3ZPLA 4BY1J 3P9CA 2V1XA 2Y48A 3LMMA 5H20A 4DBQA 5K1YA 1XCVA 5L3GA 4KN7X 2F5DA 2L02A 2WWYA 2HDCA 2Z99A 2HQNA 2PJRB 1PP8F 3OYKA 5DTDA 1IRXA 4RGUA 3IV5A 3VODA 1LDKB 4YELA 2LF8A 2GLOA 1APLC 5K5QA 1LVAA 1WI3A 3SDGA 5L3EA 3ROUA 2VJ5A 4W1UA 2V9PA 2GAUA 4PJ0C 2D5VA 5LFAA 1S9HA 5HLTA 1I3AA 2CJJA 3FXRA 2VIXA 2PI0A 3K4JA 2EPFA 1X4OA 2M0MA 2GA2A 3H92A 3U1DA 2EFQA 4B47A 3NEUA 1AOYA 2E36A 3VSKA 2KIFA 4IRGA 2W85A 1KQ9A 3AG2H 4BAYA 1TNSA 1B9NA 1ON1A 4ANJA 1KU9A 4GRIA 4IHSA 4Y3OA 2AS5F 3OR2C 2RDPA 3X2QH 1Y1WJ 4YEJA 5IT9K 1ZG3A 4BJ5C 4F92B 3PL8A 1ZR2A 3LWFA 2KRCA 1FJLA 4UHTA 4H0EA 2EZIA 3P5JA 3HM5A 4EGYA 1X1BA 3ZGKA 4MFDA 3BG5A 3O6BB 4A3CJ 1YITI 5CYVA 2QQAA 3CTAA 2E1OA 2RN7A 5AIQA 4IQJA 3V8JA 4ENNA 1ETKA 2EZLA 3WTXC 4A3JJ 4DW6A 4ZH4F 1QQIA 5H6QA 5D5WB 3LA2A 3V4GA 2HGCA 4HF2A 1X1CA 3I3LA 3O8GA 2X85A 4N9HA 2EINH 2XKPA 3FK7A 4CYCB 2M34A 3OOUA 3GFLA 2RGVA 2EQRA 3U2RA 4MTEA 1J0RA 2P6SA 5D6FA 2O8XA 3GF2A 2VASA 3H5RA 3W3CA 1U78A 1VF9A 1FNNA 4GXOA 1SVLA 2BOLA 1HOMA 3PNTA 4HSRA 2OTJI 1LFBA 3I64A 4L0YB 3UKGA 4EJOA 4EM0B 2K4JA 4ON0A 3T0YA 3ZN0A 1WJFA 4CH7A 2I8DA 1V54H 2GBYA 3ZN1A 4G7ZF 4E7IA 5J8CA 3CDLA 3Q9SA 3CP2A 3QPLA 4XRSG 5FKMA 2LRDA 3I53A 1BR4A 4PK4A 1G3SA 4JOMA 4BJTA 4BL0B 2YX4A 3LSHA 4NC8A 4KIGA 2L5QA 1MNMC 4C9YA 3BG7A 1EH8A 4N9IA 4CZZA 3JRIA 3M4OJ 4XLEA 3GYHX 2PMZA 1RPWA 3MAJA 3OY9A 1V5EA 5E3NA 5BPDA 3KIOA 2LG4A 3A0BC 2AO9A 1X3UA 5EF6A 3JRBA 1ZAOA 5CPRB 1JJ6C 2YSRA 2ICWG 1IG7A 2E5NA 2WB1N 5GTHC 5JR3A 4UVCA 5BPIA 4WCGA 1ORKA 3FXQA 2XPUA 1FBUA 4XKBA 1D1BA 3RKQA 1ZRCA 2W7NA 1OCPA 3PSIA 2VODA 2Y0MA 1TT5B 2EH3A 4A3KJ 1XMKA 4Q48A 1SD6A 1IUFA 3B6AA 4U7DA 1YI2I 3IAS2 2F5VA 2IT0A 1HKQA 4A0XA 3E1SA 1W0TA 4BHPA 1GT0C 1K79A 3RZOJ 3VOEA 2R92J 2K9NA 3QU6A 5FRMA 3BR0A 1T95A 1BBYA 1OCCH 2DW4A 3KP6A 4IHVA 5E8GA 1FZPB 2M8GX 2CSOA 1OCRH 4ESBA 1Q1HA 2QBYA 1LEAA 2QQ9A 5FLXK 2IGMA 2XGXA 3S3OA 1OISA 4V2GA 5LGUA 2ZJRF 5CJ9A 4YIIA 3RQIA 1LPQA 5F6FA 2K5CA 5LEKA 1NK2P 1WJ5A 2M87A 4N4OB 3QYFA 5TRDA 1M1EB 5IOZA 3L2RA 2EJRA 4WK8F 4C2UA 3SHFA 1VTNC 1A6QA 4I0BA 3IH3A 4E7LA 2ZFUA 3CUQA 3BTLA 2DO7A 3RJPA 2GIVA 3W2WA 3EUKL 4XLHA 1BJAA 3FXKA 2EK5A 2L3DA 1Y8RB 3L2UA 1GXQA 1IV8A 1UB9A 3HSFA 2K27A 3WGIA 4DOZA 3HRUA 4EMSA 1MZBA 1X1DA 3OYJA 4CZCA 2RNJA 2KLOA 1MNEA 3HHGA 1K7AA 3OL3A 1R36A 3IP4B 3F72A 2VOOA 4G6DA 1MBEA 2BY2A 3PM1A 1ZELA 4C3HJ 1HCRA 2WAFA 4BYYA 1ULYA 2VPLA 4Y13A 2HPMA 3G1MA 2D2WA 4A6DA 4LIUA 2D1VA 2DJIA 1P9QC 3F3XA 5GPCA 1I6HJ 1PVEA 3TEDA 1O4XA 1T39A 2WV1A 1ZN2A 2MGQA 2XF5A 4I99C 5FROA 2Z9OA 2JVGA 1WJDA 2X1DA 3PUBA 3H3ZA 3W2VA 1FTTA 4D5CA 5HS8A 3H3UA 1NHAA 2NRAC 2XDVA 1YX5A 3CJTB 3FBIB 4HF1A 4GDFA 2VI6A 4B44A 4AYBA 3CJRB 2VQLA 3V42A 4QWQA 2Y9ZA 2A05A 2XGCA 3Q0UA 2XVCA 2E19A 2W57A 5C3EJ 1SAUA 2BE5F 5GAGJ 4HA8A 4IKFA 2ZSIB 1YE9A 1QBJA 4CUGA 4X6AJ 1MBFA 4HX8A 2QA4I 1T38A 2F4OB 4A0ZA 3TDUC 5KCMA 3JRCA 4GFBA 5EG0A 4YFXF 4A2UA 2FNAA 1I1GA 3Q9VA 4V19K 3HGGA 5EZHA 1VQNI 4II3A 1XSVA 4CCLA 2MC4A 4LG0B 2IXSA 3BQYA 4MHGA 4YRVA 3HBLA 2EV0A 3LA3A 3KE2A 3TBIA 4A3IJ 3TOAA 1XSXA 1MJBA 2OJED 2R0QC 1E17A 1K6YA 3M9AA 4BU2A 1ETXA 5JI6A 4E4HA 3TP3A 1HC8A 4LB5A 2R7TA 2NVQJ 2HQAA 2VBYA 1XGMA 3DP7A 2CFXA 1LE8B 4HQMA 3C2HA 2L9NA 1VQ7I 2XPWA 3T5XA 2EWNA 3GFIA 2XUBA 2X9DA 3MD2A 4KT6A 1JGSA 3VWBA 5AONA 2XRLA 1F36A 4MO7A 1R1VA 5BMZA 1IXRC 2W4SA 2WAQA 4EATA 1YW9A 3FISA 5LHHA 3GTQJ 4XK4A 1LEBA 1R4MB 1LQ1A 2N8GA 1A6IA 4UV8A 4BBSJ 3UNGC 3JRDA 4U0VA 1BC7C 3IWFA 4OINF 4LK1F 2M8EA 3J80Z 4MIMA 1FBSA 3BWGA 3IAM2 1B6AA 1SANA 2KJCA 2Y69H 3HSRA 3IRRA 2DA5A 3E6BA 2CV2A 3H5AA 4ZTJA 1BA5A 3G3ZA 2QSGX 4LG0A 4P1WA 1FY7A 4PUSA 3ERMA 3QPTA 3EDPA 3O2PE 4DYCA 3QWLA 2VXDA 4BNCA 4KITB 2HKXA 1KA8A 3K7AJ 3RZDJ 2VBXA 5JVTA 3FXUA 2LDUA 4M71A 2IGKA 2K3PA 4L9NA 4RLFA 3FKJA 1JT6A 5F1JA 3FHNA 3LSTA 3VPRA 2HS5A 3A4CA 3FXMA 4AIJA 2WTEA 1RI7A 1XDSA 4U0WA 1U0JA 1G3TA 1XC5A 3LSIA 1ZLKA 2F5EA 4XOPA 3D1NI 3GVAA 3C2BA 5IOYA 1T2KA 1OR7C 5FO5A 2XAGA 4FT8A 3HOWJ 4EV0A 4M9XA 2ELHA 1S72I 3A01A 1POGA 1CGPA 2FBIA 5FGMA 2KP6A 2R7ZJ 1LDDA 3ZQHA 5E3LA 1Z6TA 4ESFA 4I6ZA 4KIFA 1Z91A 3HRMA 5CVIA 4LGWA 1P92A 3DKWA 3FM5A 3KX2A 4XQFA 1BIAA 2R7OA 4UUSA 4DBRA 1VQ5I 2NVYJ 3Q0WA 3QYEA 5AIPA 3AG3H 3HYIA 3RDIA 4CA0A 3S15J 1Z05A 3CLQA 1Z7LA 1TC3C 2CH0A 2FMLA 2ID6A 5M3MJ 4CCOA 5ILUA 3OYGA 1ERDA 5J6XA 3E3VA 4HV6A 3ZXSA 3OV8A 4BGDA 5ICFA 4XKCA 5CVRA 2PJPA 4MQ9F 2PQ8A 1P7IA 2M4GA 4HRIA 1LE8A 1QPIA 1X1PA 4HOBA 3I58A 3U1KA 3BPXA 5B66C 2ISZA 3AL0C 2BXZA 3I59A 5EDNA 4A12A 2ELKA 1ETOA 4HZFA 2E35A 4QIWN 4XICA 3N4MA 1F43A 5DS9A 2KIUA 1SFUA 2EV5A 3LOCA 2HR3A 1X58A 2F6CA 4U7BA 3TO7A 2WY7Q 2DODA 3EETA 3PQJA 3TMOA 4E6KG 3SJMA 1MJAA 3CZ6A 1CF7B 4D9JA 1R1TA 2DFHA 4KMUX 2VQHA 2R5YA 3N97A 3JTHA 3K10A 1YRNB 5LRRA 1D8JA 3GUDA 3F6OA 4L9JA 3ZMUA 1DDNA 1EF4A 3RKYA 1GVJA 2DYSH 1U2WA 1X3ZB 2OZUA 5E17F 4ENKA 3ESWB 1D1CA 2HFHA 3S17J 5DEQA 4P96A 1HW5A 2DA6A 4CCNA 5E8IA 4KA4A 3E97A 2QCOA 1ZK8A 5FFZA 3JRHA 2CWEA 1KYWA 3LSMA 1JUSA 1Y0NA 3L7WA 1UHSA 3RQ4A 2BGCA 2QEXI 3GMEA 2EIJH 2PMZN 4M72A 2FMYA 4DIQA 2TCTA 4IZZA 4AIKA 1FPQA 1T56A 2ECBA 4ZDLA 3KYLA 1AU7A 3M1CA 4LFUA 4S0HB 4XLCA 2M2EA 2H27A 5DDGA 3CCMI 2LKXA 2G7UA 4XLFA 1FYKA 4UXNA 1X1AA 1F9NA 3S14J 4XKVA 3E7LA 1W7PA 4ZDPA 2IAIA 3KLNA 1BW6A 3G73A 2XF6A 2M7BA 2KZVA 1W5TA 2RNGA 2R7UA 5LHGA 3I4MJ 1HW2A 3ABLH 2LD5A 2A6TA 3HPHA 5J4YA 2R7DA 3WGGA 2D45A 2K85A 4YIRX 2CQKA 3HOUJ 3UR3C 1JI8A 5GTIC 3E6MA 1V3FA 3BROA 3CESA 1IUYA 4BDZA 1OMIA 2DFFA 2RAEA 2BV6A 5IY5H 3A02A 1X2MA 4MLOA 2WC2A 4G94A 3ZQIA 3C18A 3F8NA 1BI2A 2NS7A 4A0YA 2OA4A 2KZGA 3CF2A 2VXZA 1S29A 4IO9F 1PP7U 2E1CA 1U6GA 3TOBA 5F64A 1FYLA 2P7VB 2ZJPF 1U8BA 4KJZA 3TW7A 3G71I 1U9NA 3K1MA 2VONA 3KP4A 4HX4A 1YOVB 5TISC 1FOWA 1R49A 3HKZA 3GLXA 3PO3J 2M1BA 3H9QA 4CSWA 4O3MA 2YU9J 4WXDA 4I02A 1IXSB 2QQBA 2QYOA 3BZCA 4KISA 2IA2A 3MN2A 2K4BA 4OAZA 1FT9A 2OCEA 3I54A 3HJEA 3QOPA 4UB8C 3JREA 3BTJA 2H6BA 1SFKA 5ICCA 2DQLA 2EBIA 2XB5A 5DM6F 4LOCA 1DP3A 1QNTA 2DMPA 3A03A 4F55A 1T33A 3CCRI 1B8IB 2VOPA 4M9SA 1MNDA 4EGZA 1IN7A 2DMNA 5BNGA 2L4MA 2E7WA 2LBFA 1PUFB 2XKOA 3ZR8X 2GZWA 1USTA 4X1EA 1B72B 2IPQX 3QRFF 5M5YJ 2STTA 3OR1C 4KMFA 5D5XB 1LFPA 2DDAA 2PG4A 2EA2A 1SC7A 2YX7A 4NDLA 4WXHA 1UZCA 3MKLA 5DD4A 3SZTA 3WGHA 4BHCA 5E1ZB 4DYRA 1A04A 2K3FA 3BOQA 1UG2A 5B3SH 1XMAA 1BI0A 2MW8A 1HQCA 2O03A 4HW0A 4JYKA 2F5CA 3JRFA 3K4KA 3MMYB 5LBQA 2FOKA 1D5VA 4WF2A 2BW3B 4AIDA 1QA6A 1TQIA 2JVHA 3KZYA 4CCMA 2L0KA 1OFCX 4EVIA 2RQQA 3W2AA 3SZPA 2A69F 1XGNA 2H1LA 3LSKA 1JKOC 4DNCA 3HTSB 5FKNA 3HIFA 2G0EA 3R6SA 4F93B 1LNWA 5IT3A 4ZJZA 2OQGA 3M8FA 2QVOA 2R5YB 1H8AC 1YRNA 3MCZA 1MBHA 1JHFA 2HI3A 3DKXA 3LQRA 3MZYA 3PNYA 1I3QJ 3RIRA 3WTWC 5M5WJ 5JHFA 3LNQA 3QP5A 4IHXA 3DLLF 1BI3A 3GZ5A 2MD0A 2H1KA 5C4JJ 3RPQA 3JTGA 1A35A 4JX6A 1W7PD 4E7ZA 1OQYA 2IGNA 2A3SA 3HPGA 3SFIA 1ZKGA 1WFXA 2OTLI 1DQUA 2P6TA 2V26A 2NS8A 4IVNA 5JHUA 2DT6A 4CO8A 1IC8A 2IA1A 2AQEA 2K40A 3OYAA 4AUXA 2IA0A 2EZHA 3E6DA 2Y0SN 3DTKA 1L3LA 4E7KA 3AG4H 3CJNA 4FX4A 3BR5A 2XF7A 1YHQI 4IEJA 4PZJA 2DYRH 1XX5A 3PSFA 4KIBA 5J4VA 2PMHA 2CUEA 1RR8C 2JPBA 1QHHD 1OYWA 5K7FA 3OYIA 1BOAA 1Q1VA 4KT5C 2DCEA 1K78A 3KCCA 1OLTA 5EJCA 2DXIA 1NG6A 2PMUA 3SDBA 1O7FA 2K02A 2VJIA 1BN5A 2L4AA 2BY1A 4B09A 2KKOA 3LSGA 1VQ8I 5J1YA 4IX7A 5GP9A 5F0HA 4EJTA 2KISA 3SYTA 2JQ7A 2HTSA 1I27A 2HOTA 1EJ9A 3EPZA 3CCVI 3RSNA 1E3HA 3E0JB 5JFRA 5J1RA 3S3NA 3GO5A 4ASNA 5FLMJ 2AXLA 1X3WB 2E60A 3BR2A 2H8RA 1MBJA 3IL2A 1E0EA 3BR6A 4RMNA 2R7SA 1R4NB 2O8KA 3L9FA 5FKLA 3QPSA 3BJ6A 3BP8A 3SXYA 1YW8A 1WVRA 2WAEA 3B02A 4ETSA 2KRHA 4FE4A 3WTZA 3ABKH 1WRJA 2RKHA 2OD5A 2CG4A 4Y52J 3CCYA 1N75A 1U8RA 1TQPA 2JRTA 2X6OA 1KYZA 1K4TA 2VUMJ 1FOKA 2W82A 1MH4A 3I71A 3ABTA 4E7SA 1HW1A 4U0YA 1YJWI 1Y39A 2JTVA 2B7EA 3WG9A 1E3PA 3R61A 2LBFB 2BVMA 1R58A 2O3FA 1XN7A 1L0OC 3P7NA 3RTRA 1B4AA 4XOTA 1FX7A 1IDYA 1KONA 3A2KA 1RR7A 2V7FA 4L0ZB 4XRFA 4G12A 2W84A 2K86A 3M1EA 1OPCA 1FMWA 4RS8A 2R7RA 3ZQ7A 4MFEA 3FXOA 4AVPA 4A3EJ 3DPTA 1XGOA 2EILH 1W5CC 1XS9A 3T8RA 1FTZA 3K70D 1BI1A 1HLVA 2BHZA 3K4CA 5BQTA 2DN0A 2DQRA 1CQTA 3GTPJ 3VDXA 4HNUA 4ZZDA 1LKXA 2QM3A 4JBAA 2AXTC 3F8CA 3MZ8A 2BVLA 4C30A 1TWAJ 2WY8Q 3W6VA 4MNUA 3OWTA 1N25A 2AHQA 2FNPA 4I0AA 2NYXA 1OKRA 1K83J 1P4WA 4Y4RA 3A0HC 4XNFA 3LSJA 3ZCOA 5D4SA 3GTKJ 2DLLA 1J9IA 5J40A 2L7FP 2ME0A 2IW5A 3WHCA 3DWLE 1T0FA 2A5YB 4OMZA 4BHBA 4EJWA 4E7HA 4Q5SF 4AVZA 1H9GA 1R23A 2DT7B 1MMDA 4L5EA 3ERED 3PO2J 1TP4A 3K69A 3VFZA 2FQ4A 3WU1B 2KL4A 3HUGB 1IXCA 3JAMZ 3QP6A 3CCSI 3NAUA 5HNHA 3ZP5A 2JA7J 5KK1A 1MMSA 4Z6YA 2HXOA 4M3BA 3HHHA 3IKVA 4XL9A 3H3VK 3BC8A 1J75A 2Y0SA 3G1LA 2C6YA 1UCRA 4R1HA 2DTRA 1R5ID 2XAHA 1ZREA 3ZRGA 1HXDA 1BC8C 2X4HA 4AWXB 5LLQA 3KFWX 3JAMK 4NC7A 5EYRA 2FXAA 3ZQCA 3G1OA 4NQWB 2TDXA 2QF7A 3PIPF 3LAPA 5KNLA 2A07F 4OIPF 2XAFA 3K1PA 2M4KA 1JKPC 2CYYA 5JLWA 2IP2A 1R5GA 2VKVA 2W25A 1TWCJ 5BOXA 3J7AY 2HYGD 1UHMA 3G2BA 2HXIA 3MFKA 1VQ6I 2DA1A 2DU9A 3EUAA 5E1XA 3RKWA 1VQPI 2L7ZA 2RREA 1V55H 3SZGA 1JKQC 4G7OF 1I50J 1YIOA 1LB2A 2O61A 5HOOA 1Y0UA 1WHUA 1WSUA 4CDGA 4S04A 2XROA 1PJRA 1G4DA 1HSTA 3L2WA 2JA6J 4Y15A 2FBHA 2F4MB 3D5RC 2HOSA 2ID3A 2NVXJ 4FHTA 3ZMVA 1ZG1A 2CUZA 3LA7A 3HOZJ 4OU0A 2Y30A 3KZIC 2A68F 3QYBA 3JSPA 3HGYA 3CCQI 1D8KA 3EUHC 3SEZA 1S8NA 1D0YA 4DQ2A 3HOVJ 2BZTA 5D4RA 2VN2A 2BEOA 5H6RA 1SVOA 2OUMA 2JZYA 3WE3A 1W36D 3OYEA 2GXGA 4AC0A 1Z1DA 1H0MA 2WAQN 3KP5A 2L7KA 3S3MA 4HPQA 4QPOA 2X0LA 1BIBA 5IYBJ 3WU2C 2B0LA 3FF5A 1J7KA 3VSLA 2EIKH 4ITVA 5DM7F 1K61A 5FKOA 4I98B 4NBQA 4XORA 4IJAA 4IOAF 2Y75A 4W97A 4CCJA 3MZHA 1GVDA 1ONVA 2DAOA 1FMVA 3QU3A 3T1BA 1XB4A 2QZ8A 1O7LA 1FEXA 5L3BA 3DPLC 3ZQQA 4N4NB 2CO5A 4Y33A 3CC2I 1QPMA 1K4SA 1K6OA 1AKHA 1HA8A 5CQGA 2HDDA 3BPVA 1HKTA 5LGTA 2HYJA 3K70C 1LDJA 3REOA 5GADJ 2V1NA 3CC4I 4HLXA 2K9QA 2VB6A 2E1MC 1D0XA 1FSHA 3BTCA 5FLXZ 5H2FC 4BQOA 1W36C 2ZFWA 2E5ZA 3FMRA 3V7SA 1NK3P 3BJAA 4LK0F 2DFIA 1Z3YA 3MVPA 2FF4A 2WA0A 2ZSHB 2IJLA 4RB1A 4BEHB 1IDZA 2DPDA 3CJQB 5DV5A 2O5RA 5E79C 3TO9A 3R60A 2DT5A 3PIOF 1D1AA 2XGDA 2JSPA 3QODA 2GA1A 4UVBA 3J80K 3JSOA 1SAXA 5B5EC 9ANTA 4P9FA 3RYRA 2DA3A 1P2FA 4RB2C 4UB6C 3FM3A 2O7OA 4A3FJ 3IWZA 1ZGJA 3D5LA 2F48A 2ZCWA 2XIGA 3R0JA 3GCMA 1YQAA 5GAEJ 4RDUA 4FTHA 3CMMA 2R3SA 4RAGA 3V8KA 1JGGA 2EIMH 2ZBKA 2FX0A 1HDDC 3S1NJ 1P4XA 4XRMA 5HDGA 1WGXA 1FWZA 3RPUA 1IV6A 4Q4ZF 3CO7C 5DUIA 3L2CA 3GZNB 1O57A 1SFXA 3J81K 2EFOA 2ZXIA 1YX3A 2CU7A 1UAAA 5FJ8J 2XAQA 4XIDA 3I9V2 4RM2A 4HNTA 1G3WA 2ADUA 2JA2A 4HSTA 5FD5A 3TQNA 2KDOA 5CLSA 2CW8A 3G4SI 1IAWA 2J5PA 4G6TB 4M6XA 3E5UA 2ZMEA 1WI9A 5E3MA 1YS6A 2ETHA 1QZYA 4EJVA 1LJ9A 1OYIA 2NVTJ 2KMUA 1B8IA 2VL8A 1ZRFA 3M8EA 2LVSA 1J5YA 1EH7A 1AHDP 2Z2SB 1LVKA 3HDDA 1YYVA 5TJJA 2YUSA 2OU2A 4PFOA 1E2XA 1BR1A 1J09A 2LREA 5A2QK 2JSCA 2NNNA 1QHGA 3FX3A 2JA5J 1MW7A 3PJRA 1SVMA 2DA2A 4DYQA 3DEUA 1I39A 2GQQA 4FE7A 2VKHA 2KFDA 4QSHA 1MKMA 5EEAA 4GYGA 3SFZA 4FQGA 2COMA 1VQLI 2LF7A 2Y9YA 1IZ1A 1WH7A 3OIPA 3IHUA 2V4JC 4ENJA 3RKXA 4D7NA 5DD8A 1PUEE 3TW6A 2QKLB 2DOAA 3ASNH 1UHWA 3OIQA 2QKMB 5K7HA 1JTYA 1C0WA 1XG1A 3SQNA 4GYIA 4RAFA 3FDYA 3L1PA 1X2NA 2GIZA 1VNDA 2OPTA 3DF8A 5GPAA 3ULQB 5HLGA 5IYCJ 1H89C 4BQAA 4RAZA 5FRNA 4JP0A 2WB1A 3DTIA 3C1DA 1SFOJ 1D0ZA 4B1RA 2X48A 4ZYHA 3OYLA 2JWTA 2JK3A 2CRGA 2GXBA 2TRTA 1XSDA 2OCCH 2ZMEB 4C3IJ 2CMPA 2JA8J 3PFYA 2MYSA 5J3LA 5IP6A 1ACIA 1MH3A 2OC6A 2VE9A 3F8MA 4KDPA 2FU4A 3LAJA 3DPUA 4X0GA 2QWWA 4U88A 3QAHA 3MKZA 1Z21A 1FOXA 2MH9A 1A36A 4RB3C 1TBXA 1DGRM 1Y1VJ 3CCEI 1N78A 3FMQA 3JR9A 1U5TB 1IN8A 4PSXA 5C44J 4C2MJ 5KAFC 4G6QA 5F08A 4PGHA 1R00A 2FJ1A 4HV5A 5CQEA 1RC9A 5CVJA 3CO6C 2H8WA 1USSA 2QSFX 1F4KA 2E34A 3PQKA 1ENHA 3M07A 4FISA 4UVAA 1PYVA 1A5JA 1D5YA 2P7CB 1ZHFA 1TT0A 5D6EA 2L9VA 2XB0X 5IYDJ 2FBKA 2JRMA 3VEPA 1VI0A 5HODA 5L3DA 2DJNA 3B73A 2DOFA 2X1CA 3CUQC 1MSFC 3EQLF 1ZGWA 5FLVA 4TV7A 3JRAA 3COAC 4IRIA 2I10A 2ZMEC 5E1WA 5EEGA 2IS6A 3GTJJ 3L09A 2QBYB 4UNOA 5K5RA 4KICA 4XSZF 2LSOA 3F8BA 3GWZA 3GTMJ 2L7MP 1K78B 1ETQA 2K9LA 4L5IA 5F1RA 3S1MJ 2E7XA 3FXLA 2PN6A 4XBFA 4AU7A 4XN0A 5EEHA 3S93A 1WZ2A 4PJJA 1I5ZA 2L2OA 2V6EA 4QTRA 2IS4A 1H9TA 1R7JA 2R7WA 1HDPA 1JTXA 2NOJB 2DA4A 3F22A 2DOEA 3M7GA 2GWRA 3RYPA 5FD6A 3OS2A 2PLYA 3K4NA 2QGUA 3I4PA 4RLQA 1F1ZA 4OIQF 4CCKA 3VYTB 2XHKA 5CVVA 2P8TA 3ZMTA 2M30A 4XLAA 4XLNF 2ZXJA 4HDVA 1EH6A 4KNYA 3CQZJ 1LUJB 1IN6A 3NARA 5EG0B 3Q5FA 3HOXJ 5DCMB 2P0WA 4PJMA 3BZKA 3I4NJ 2M9HA 3OYHA 4AYBN 2NOGA 3K4LA 2VLAA 2M45A 2KT0A 2WV0A 4M3DA 3EUHA 1XD7A 1O3TA 1YG2A 1FP2A 3K0LA 5JLXA 3E5XA 4M74A 5GAHJ 2EFWA 3K1NA 3RCOA 3SEQA 3VB2A 2ZKZA 5KHDA 1YLFA 2F2EA 2LY2A 1W1WE 3I55I 3F6VA 3ML6A 4M6YA 4BQQA 3WTTC 2COBA 1JJ8C 1G59A 1RUNA 1R1UA 1REPC 5D8KB 4D0PA 1U3EM 3DFGA 2XAUA 1J2XA 2Z3YA 1D3YA 1JHHA 3QQAA 1G2HA 4H4KC 5KAIC 1U9OA 4G7HF 4PCQA 3IKTA 4XSXF 4CXFA 5HLIA 3DV8A 2CFOA 1T6SA 1AWCA 3TL4X 3WTUC 2ACJA 3PFIA 3KYDB 3JCUC 4DZJA 3DBHB 2VPRA 4HQEA 2E2HJ 2UXNA 4EM1A 4HX7A 2DK5A 5D8LB 2VE8A 1MBKA 4NC6A 4ZYAA 2UUZA 3HXLA 4B3AA 3CCLI 2PJRA 4KYWA 2XPVA 4BE1A 3TO6A 4A93J 2Q2EA 2W24A 3LL7A 4M9ZA 1FOYA 4Q47A 3ECOA 4A6EA 2CQQA 2VBZA 2VC1A 2QQ8A 1IW7F 1FYMA 4FETA 3DBLB 5CKTA 2PFBA 4EEFG 4NB5A 5ILVA 3AAFA 1UELB 2XAJA 3F0CA 3ASOH 1B72A 1TW2A 4ZDOA 2H94A 2IS1A 1GV2A 4II2A 1O3RA 3FBNB 2LTPA 3FKIJ 4R8HA 4I01A 1VQOI 3NWTA 4LIVA 1XDUA 2I5UA 2XASA 2YU3A 3S1RJ 3I56I 2DI3A 1Z67A 4MEYF 1Y8QB 2EFPA 4HLYA 2MH2A 2BXYA 2LYCA 2Q2EB 3HG9A 2R7VA 3I5UA 4CICA 3OSFA 2G9WA 3NRVA 1YJ9I 3FMSA 1UG0A 2VQCA 1Z6RA 2CW7A 4B48A 1P4AA 2X6WA 1Y56A 2LLKA 3H36A 3H9GA 4O5VA 4P55A 3H0GJ 1ETWA 4N0BA 2R7XA 3V7CA 1WPKA 5E18F 1DPRA 4DZPA 3OYCA 4ZC3A 4OMYA 1GHCA 1E3OC 4XM3A 4RGXA 3HKZN 2CQ7A 4QPQA 1O3QA 1CF7A 2CGPA 1ETYA 1YO5C 3K6GA 2E2IJ 5IPAA 1QO0D 3ABUA 5LEJA 4Y7NJ 5IT9Z 2JN6A 2Q0OA 4RGSA 1SEUA 3OOPA 1O3SA 1NTCA 2L01A 2X51A 5F27A 1VQMI 5LGNA 3OL4A 5KVRA 3WTVC 2GXAA 1DU6A 1IRGA 2HWVA 3V7RA 5E20A 1RNLA 2VJJA 4UY8I 4CHUA 5J1UA 3V8LA 5HLHA 4L18B 4DJAA 3DEEA 4XN3A 1RIOH 2IGOA 3QPHA 4BUPA 5C4XJ 4JK1X 3K2ZA 4OWRB 1ZARA 2DFEA 2RVCA 3N05A 3A1YA 4HG2A 4F7ZA 2A61A 4ZTFA 2GOMA 4J00A 2BYVE 1JT0A 2HTJA 2DBBA 2FE3A 4JX5A 2W00A 1LFUP 4AM3A 2Y2ZA 2EFNA 2K9MA 3FK6A 5LD2C 1YW7A 4RM3A 3KEYA 1MBGA 1T0FC 1S7EA 2XC7A 2P5LC 3ABMH 1B1BA 1JUMA 1Z77A 2VJ4A 2VKDA 1TLHB 2W1OA 5B1AH 3GZ6A 4C3JJ 1BR2A 4BE0A 4B8XA 4WWCA 3A01B 3PNVA 3ZMZA 3TGNA 5IP7J 3H35A 2VQGA 3R4KA 5JVGF 2OF7A 2NXNB 4ZYEA 1PDNC 3I0TA 3ZQGA 1QU3A 3BG9A 3ECHA 2HDWA 3IH2A 4M3FA 4UUSB 2EV6A 3DXJF 1FBQA 2MG4A 4ESJA 1MDMB 2RV8A 3KP7A 3EYIA 2GM4A 1HKSA 1IRZA 4JQFA 2ME6A 3BTIA 1R22A 1EA3A 4RB0A 1KZHA 4BKXA 3FWEA 4IPAA 4ZYDA 2KIMA 4I7HA 2JJ7A 3MKYB 4IOCF 2ZB9A 4MEXF 4IHYA 3WODF 4RA2A 3GTGJ 1BJZA 2LH9A 2JMWA 3S32A 4B43A 3O8HA 4ENMA 1ZTRA 1FIAA 1B9MA 2NS0A 3WU0A 3F8FA 1IRFA 3QOEA 2IVMA 4E70A 2ELJA 5BS6A 3F9KA 2Q8KA 5HDKA 3CCJI 2HVQA 4JX4A 4XRSA 1GUUA 3LSPA 3DKYA 1BM9A 3KETA 2HVRA 2PX9A 1WJAA 1B59A 2O6GE 2FUG2 1HF0A 2A6EF 1IGNA 4D7MA 4LJZF 3S2DJ 1MIJA 4MTDA 2Z33A 2V79A 3GEZA 1U5TA 3GXOA 4G8XA 1TTYA 1S5LC 2R4GA 1EKEA 2HEOA 4IQ4A 2R93J 1FSEA 1UFMA 4F52A 3KEQA 3CF5F 4CGZA 2MC3A 4IL6C 5L3CA 1PUFA 4EQQA 3AL0B 1DU0A 1Z3XA 4IHTA 2E1NA 2ZNYA 4RAYA 1G8XA 3J81Z 3BT9A 1MGTA 4L9TA 1OCZH 3P9KA 4HNVA 2O9LA 1X4PA 1MD0A 1FLIA 1QZEA 3ZQLA 2HQ5A 1SMYF 5EGOB 3HOYJ 5DYMA 4KUMA 4YFKF 4A3DJ 4M73A 4XMYA 3Q3SA 1A31A 3BJOA 4G9YA 3P9IA 2LNBA 3VYSB 2CQNA 4BXFA 1ON2A 6PAXA 1S3JA 3F23A 2QENA 4M6VA 4ZYGA 2XSJC 2XRNA 1MMAA 1Y6IA 3HSEA 1XGSA 2Y31A 5DCFA 3OYMA 3HTUA 1FP1D 4L9VA 3RI4A 4XONA 2HPIA 1QVTA 3NQOA 1W5SA 3OMYA 3ZQFA 3BZ6A 3HB9A 1R5HA 4CYCA 3OS0A 4AIHA 1H88C 1TWFJ 2QLZA 2VC0A 1ZH5A 1WJBA 2MBFA 3ISPA 5B1BH 2LY9A 2E2JJ 1R71A 4I09A 1WJCA 3CUOA 1VQKI 2WADA 2ZO4A 3B6CA 5E3OA 3CMYA 4HBLA 2HYFA 4O6JA 3F21A 4PDKA 1RZ4A 2DA7A 4RBOA 4PGGA 3WE2A 1N77A 2P5KA 1MJ9A 1TQMA 3U9GA 5FKKA 1Z0XA 1JUPA 4F3QA 2P81A 1X19A 3E6CC 3W6KB 5M5XJ 3DTEA 3NWSA 5F04A 4HEA2 1TL8A 4BE2A 2M7AA 3BCBA 2DDBA 2XSDC 1W7PB 1ZQ3P 1OCTC 2Z16A 2HZTA 4CYDA 2B63J 2V6CA 3TP0A 1TW3A 2UZKA 1BL0A 3CDIA 2FQ3A 2JT1A 3MKWB 3PUFA 5K5OA 2L9SA 2K7LA 4P5OA 4S05A 2JUGA 3GTLJ 4R79A 2FSWA 2HNHA 1QVUA 3HEFA 4FX0A 1VQ4I 3Q0VA 4FASD 2ZJ2A 2LOOA 5TGTA 3OYDA 3LFUA 2STWA 2JUCA 4PJNA 4LLNA 2LC2A 2GOXB 1SMTA 4IF4A 4K2EA 2BHYA 1WQ2A 1OR7A 1ZLJA 1RKWA 2BBYA 2L54A 4DGWB 1JE8A 4OOIA 2MABA 2ESHA 1VQ9I 5HNFA 2LK2A 2QSHX 3GTOJ 2VKEA 1STZA 3DU6A 3JRGA 1F5TA 4BY7J 3BR1A 1IO2A 3MQ0A 1S6LA 3M3YJ 3GX4X 3FXJA 2PEXA 5HDNA 1ETVA 4FCYA 1AA7A 2X6YA 2RQPA 4M3EA 4A3BJ 2CQXA 4A3GJ 3DQVC 4ZZLA 5ILSA 3CLOA 3I59B 5K7ZA 2O0YA 3W6JB 1RESA 1MMNA 2VT2A 2X6XA 4P9UA 3WHBA 1YJNI 2J5OA 1GLNA 5DCMA 1W4MA 2CW0F 3HUGA 4IHWA 1IN4A 1ODDA 2W48A 4A69C 4V2FA 2OAZA 1ZG5A 3FIWA 3BY6A 5IP9J 3TDZC 4BXUA 3IUOA 3KEOA 1BW5A 1V5FA 2FD5A 3LQQA 4I2OA 3S8PA 3BCAA 3DCFA 3GLLA 5ICGA 1I1SA 4Z2YA 1R9TJ 2UXXA 2L9RA 2KPMA 4NNJA 2K9SA 1U5TC 4UUVA 1DPUA 1IN5A 3CMEI 4RGRA 2ISYA 2EZKA 4BS9A 4BXXJ 2XGEA 4LG3A 3S16J 3S1QJ 2FOWA 1T8IA 4A3MJ 3CD6I 3K9TA 2BY0A 2OV7A 4Y17A 3VYRB 2OZ6A 4A5MA 1Z7UA 2MFZA 2DTZA 1T08B 1T98A 1ITYA 1XTAA 1HSJA 1WH5A 4MQVA 2F5FA 5D5VB 3OSGA 2AQFA 2LKSA 3ZOBA 4LMYA 1BOBA 3OYFA 2FRHA 1P7JA 3CUQB 1MMGA 2HZDA 2ZC2A 2KRFA 2KIQA 3DBRB 2EA4A 2NVUB 3CDHA 4NQWA 2DPUA 4HAMA 3D0SA 4KFCA 4GCVA 2MLKA 2DMUA 1RETA 3GFJA 2D1HA 4EM2A 4PJLA 1WWXA 2KJBA 1VFCA 4A3LJ 3ONQA 3MEXA 3BG3A 3H0DA 1JKRC 3H1CA 4XR6A 5FFXA 2BW3A 4B3XA 2Z1DA 1KQ8A 3J7YJ 2VBWA 1KU3A 2OQRA 3L00A 3LFKA 4BJ6C 4LLGF 2UWMA 2R7QA 3OYNA 3VYUB 2JPCA 2Q1ZB 2M3AA 5M3FJ 2KQRA 1SD7A 2HKOA 3E5QA 5LHIA 1MSEC 1TNTA 2G7HA 4UUTA 4AD9A 1R6RA 3DLAA 4ABZA 3WG7H 4E7JA 1NG7A 1OYYA 3K4MA 2V1DA 4GGGA 1XCBA 2M5WA 1OCOH 2HU9A 2V9KA 5DUKA 4MGRA 5EZGA 3H9JA 1FC3A 1OJLA 2DK8A 2MA3A 4HF0A 4LITA 4YIFA 3U21A 3OYBA 1I6XA 2LFBA 3J7ZI 1WCMJ 3KLOA 2EB7A 2LKPA 1GXPA 2HQRA 5J47A 2R7FA 4J01A 2ZXWH 3HC7A 2VT3A 4BBRJ 3WTSC 3BR3A 2BY3A 2NNYA 4NUBA 2HVSA 3JW4A 2ESNA 2PBIA 3BQZA 2CV0A 3K2AA 1DUXC 4XLPF 4J19A 1ZYRF 3TKYA 1ZR4A 1J59A 2MLGA 3ZMSA 3HL2A 2QUFA 1HBXG 3R0AA 5F0FA 3CP8A 3L2VA 2F4IA 3HOTA 3D5SC 1VZ0A 2X1EA 4L5JA 4LB6B 4HDUA 1TZLA 4LLLA 3RPUD 2P5VA 2ZNZA 1QRYA 5L3FA 1WJEA 2P4WA 2IBDA 5LRSA 2FEZA 4C2TA 4BQNA 1P6RA 1RUOA 4BACA 1G6NA 1MDMA 5FB2A 4BH9A 1NH3A 2A5WA 1TWHJ 2A6HF 3T8TA 4U87A 2YPRA 3HOSA 2IRFG 4NHJA 3KP2A 4D1QA 4YG2F
chains in the Genus database with same CATH topology
2LYCA 3K4BA 2Q2EB 3HG9A 2R7VA 3UNGC 3DWLE 4E7HA 4AVZA 5HVQC 2DT7B 1MMDA 3M8JA 4XKWA 1UG0A 2VQCA 4BEHA 3IAM2 1V5GA 2CW7A 4B48A 2X6WA 2KL4A 3HUGB 1Y56A 3H9GA 2IS2A 2CV2A 1DGWY 3H5AA 4PFPA 4ZTJA 5HNHA 4P1WA 4BDYA 4PUSA 2R7XA 3BLYA 4XL9A 3OYCA 4ZC3A 2VXDA 3BC8A 4XM3A 2Y0SA 4KITB 3ZRGA 2ZXHA 4QPQA 2IGKA 2K3PA 3K6GA 4RLFA 3FKJA 3FHNA 2UV1A 4NC7A 4PSWA 3A4CA 2E1MB 3AFHA 2X51A 2CV1A 2WBMA 1U0JA 3LSIA 2CUJA 3OL4A 4XOPA 4NQWB 5KNLA 1OR7C 2M4KA 2VJJA 4DJAA 3DEEA 4XN3A 2IGOA 4BUPA 3J7AY 2KP6A 3G2BA 2CS3A 3EUAA 4OWRB 3GBGA 3A1YA 3N05A 4HG2A 3AKZA 2RREA 3SZGA 3DU5A 3C2GA 4ZTFA 2GOMA 3KX2A 4XQFA 5HOOA 4J00A 2R7OA 2W00A 1PJRA 4DBRA 2K9MA 5LD2C 4CA0A 3QYEA 3L2WA 4RM3A 2KHMA 3KEYA 1Z7LA 2CH0A 1T0FC 3D5RC 4CCOA 2XC7A 1ERDA 3OYGA 4OAYA 3ZXSA 2VJ4A 2VKDA 4BGDA 4XKCA 2CUZA 2W1OA 1BR2A 3L2QA 3QYBA 4BE0A 3PNVA 2M4GA 3EUHC 3H35A 2VQGA 3SEZA 4HRIA 1D0YA 3H5NA 2LY1A 3AL0C 2OUMA 1W36D 1QU3A 3OYEA 2HDWA 3BG6A 3OS1A 2F6CA 2L7KA 4U7BA 3S3MA 2WY7Q 4HPQA 4JQFA 3TMOA 4E6KG 4QPOA 3CZ6A 4D9JA 4F91B 1EA3A 3VSLA 2VQHA 3K10A 4ITVA 3LMMA 4DBQA 3MKYB 4XORA 4CCJA 2LH9A 3S32A 4B43A 2PJRB 1FMVA 3OYKA 1D1CA 1IRXA 4CCNA 1LDKB 3DPLC 3ZQQA 4YELA 4N4NB 3QOEA 4Y33A 2VJ5A 3LSMA 2ELJA 1HA8A 5CQGA 3RQ4A 3F9KA 2HVQA 5LFAA 1S9HA 5HLTA 3K70C 3DKYA 4DIQA 4IZZA 2V1NA 2VIXA 2VB6A 3K4JA 4ZDLA 2E1MC 1D0XA 1X4OA 3KYLA 2HVRA 2M0MA 3M1CA 1WJAA 4XLCA 2FUG2 4XLFA 4B47A 4BQOA 1X1AA 1W36C 4XKVA 3VSKA 2E5ZA 4ZDPA 1Z3YA 2WA0A 2ZSHB 4BEHB 2R4GA 3CJQB 2XF6A 2M7BA 2O5RA 2KZVA 4IQ4A 4ANJA 2RNGA 4GRIA 4F52A 2R7UA 1D1AA 4Y3OA 2JSPA 3QODA 3OR2C 2A6TA 4YEJA 3AL0B 3HPHA 4BJ5C 1Z3XA 1JI8A 3UR3C 4F92B 1G8XA 3PL8A 3CESA 4BDZA 2KRCA 3D5LA 1X4PA 3CMMA 4MLOA 1X1BA 3ZGKA 4XMYA 3CF2A 2VXZA 4IQJA 3VYSB 4KJZA 4BXFA 2ZXIA 2XSJC 1YX3A 3HKZA 1MMAA 1Y6IA 1X1CA 3I3LA 1UAAA 2X85A 3H9QA 4CSWA 3OYMA 3I9V2 4RM2A 4HNTA 4XONA 2HPIA 2JA2A 3OOUA 4HSTA 2KDOA 3OMYA 2CW8A 4KISA 4G6TB 3OS0A 4OAZA 2VASA 3H5RA 1SFKA 1WJBA 3W3CA 2KMUA 1DP3A 2VL8A 1WJCA 4F55A 2WADA 2Z2SB 1LVKA 2BOLA 1MNDA 4PFOA 3PNTA 4HSRA 1BR1A 1J09A 1N77A 2LREA 1QHGA 1MW7A 3PJRA 4F3QA 1X19A 1WJFA 2LBFA 4CH7A 2I8DA 2VKHA 3DTEA 3NWSA 3ZR8X 4E7IA 3CP2A 4HEA2 2LRDA 4BE2A 3OR1C 1BR4A 2M7AA 4PK4A 1LFPA 3OIPA 4JOMA 3BCBA 2V4JC 4BJTA 2QKLB 4BL0B 3LSHA 2Z16A 2DOAA 4NC8A 2L5QA 4C9YA 3BG7A 3OIQA 2QKMB 4XLEA 3FDYA 2PMZA 3MKWB 3OY9A 2L9SA 1V5EA 5FRNA 4P5OA 3K4KA 3MMYB 2JUGA 4R79A 2LG4A 2WB1A 2BW3B 2HNHA 3DTIA 1D0ZA 2JVHA 5CPRB 4CCMA 3OYLA 4FASD 2LOOA 5TGTA 3OYDA 2E5NA 2RQQA 3LFUA 4PJNA 3W2AA 2LC2A 2CMPA 2GOXB 3PFYA 3LSKA 2MYSA 4XKBA 1D1BA 2OC6A 2W7NA 3PSIA 4F93B 3DPUA 4X0GA 4DGWB 3MKZA 2MABA 1Z21A 4ZJZA 5HNFA 3DU6A 1DGRM 1N78A 3IAS2 2F5VA 4PSXA 3E1SA 3DKXA 3PNYA 1AA7A 5FRMA 1T95A 2X6YA 3DQVC 5JHFA 5CQEA 2MD0A 2X6XA 1MMNA 4E7ZA 2IGNA 2IGMA 1GLNA 3S3OA 3HPGA 1WFXA 1DQUA 1PYVA 2K5CA 2V26A 1WJ5A 2DT6A 4N4OB 3QYFA 1TT0A 2AQEA 3L2RA 3IUOA 4C2UA 3OYAA 1V5FA 3S8PA 3DTKA 3BCAA 4E7LA 2ZFUA 4E7KA 2X1CA 2XF7A 2KPMA 4NNJA 3W2WA 3EUKL 4XLHA 2IS6A 4BS9A 3PSFA 4LG3A 3L2UA 4DOZA 1X1DA 1QHHD 3OYJA 2K9LA 4CZCA 2KLOA 3OYIA 1MNEA 2OV7A 2DCEA 3VYRB 3OL3A 1OLTA 3IP4B 4AU7A 2DXIA 1NG6A 4XN0A 2MFZA 3SDBA 3S93A 1ZELA 2L2OA 4PJJA 2VJIA 2V6EA 2AQFA 2WAFA 3LSGA 2IS4A 4IX7A 1BOBA 3OYFA 2VPLA 1MMGA 2HPMA 2HZDA 2R7WA 2NOJB 3SYTA 3EPZA 3OS2A 3K4NA 4LIUA 3RSNA 3E0JB 4RLQA 2DJIA 3S3NA 1P9QC 4CCKA 3VYTB 4XLAA 2E60A 4PJLA 3ONQA 1E0EA 2XF5A 4RMNA 3H0DA 4XR6A 2P0WA 5FROA 4PJMA 2R7SA 2BW3A 3OYHA 2JVGA 1WJDA 2X1DA 3PUBA 4B3XA 3W2VA 2Z1DA 3K4LA 2VLAA 2XDVA 1YX5A 3FBIB 4B44A 4AYBA 2WAEA 3CJRB 2VQLA 3V42A 2KRHA 4BJ6C 2UWMA 3RCOA 2R7QA 3SEQA 3OYNA 3VYUB 5KHDA 2Q1ZB 2M3AA 2KQRA 1N75A 2LY2A 2W82A 1SAUA 4BQQA 1R6RA 4IKFA 3DLAA 2ZSIB 4E7SA 1G59A 1YE9A 4CUGA 4E7JA 1NG7A 3K4MA 5KCMA 2LBFB 2BVMA 2XAUA 2HU9A 2V9KA 4H4KC 3H9JA 3RTRA 4LITA 4II3A 3U21A 4XOTA 2CFOA 3OYBA 1KONA 4CCLA 3A2KA 2MC4A 2IXSA 2V7FA 3TL4X 4YRVA 4J01A 3HC7A 3TBIA 1FMWA 2R7RA 1K6YA 4NUBA 4BU2A 2HVSA 2CV0A 3DPTA 4E4HA 2R7TA 3K70D 4ZYAA 2HQAA 2UUZA 3HXLA 3HL2A 2PJRA 4BE1A 3L2VA 3CP8A 3HOTA 2F4IA 3D5SC 3LL7A 1VZ0A 3K4CA 3C2HA 2X1EA 2L9NA 3VDXA 1TZLA 4FETA 4HNUA 3MD2A 1LKXA 3RPUD 4KT6A 3VWBA 5CKTA 1WJEA 2BVLA 4C30A 1UELB 2WY8Q 4C2TA 3OWTA 4ZDOA 4BQNA 2W4SA 4BACA 2WAQA 2IS1A 4EATA 4II2A 4Y4RA 3FBNB 2A5WA 3ZCOA 4XNFA 3NWTA 4LIVA 4U87A 3HOSA 4D1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQQ A;  2KLO A;  3A4C A; 
#chains in the Genus database with same CATH topology
 1IJW C;  3K4B A;  3HRS A;  1Z9C A;  3C3W A;  5F0C A;  1WKM A;  2RC4 A;  2H6C A;  1QGP A;  3CC7 I;  3KYC B;  5HVQ C;  1YFH A;  3M8J A;  2V9V A;  4XKW A;  5HS7 A;  3HZJ A;  2MD5 A;  3GFM A;  4BEH A;  3AG1 H;  1SFE A;  1V4R A;  1V5G A;  4A5N A;  1ZRD A;  2IS2 A;  4GO1 A;  4OIR F;  1FIP A;  1DGW Y;  3HRT A;  4PFP A;  5ICE A;  4BDY A;  1S7O A;  5D5U B;  3G6E I;  1SD5 A;  3BLY A;  3IH4 A;  2DMT A;  4D5F A;  2XV4 S;  4IXA A;  4QLC U;  2ZXH A;  2M0C A;  5J8F A;  5EGO A;  3KP3 A;  1ZGA A;  1KU2 A;  1S7A A;  1GDT A;  2UV1 A;  1RKT A;  4PSW A;  3KZZ A;  2E1M B;  1TWG J;  3AFH A;  5A2Q Z;  3GW2 A;  2WBM A;  2CV1 A;  2LP0 A;  2CUJ A;  1EV7 A;  1YTY A;  1KU7 A;  3FHZ A;  3ZMD A;  2DMQ A;  2FA5 A;  3OIO A;  2KDZ A;  5HS9 A;  2CS3 A;  4IRH A;  2NAZ A;  4UV9 A;  1XMX A;  4EJU A;  2ECC A;  3GBG A;  3AKZ A;  2LMD A;  5CVU A;  3DU5 A;  3C2G A;  4OIO F;  1IF1 A;  2V1U A;  3DEW A;  2R5Z B;  3S2H J;  1UMQ A;  2R5Z A;  3WTY C;  4B4C A;  2CUF A;  2KHM A;  3FZV A;  3S2W A;  3IRQ A;  3KPH A;  1XPX A;  1JXS A;  1YIJ I;  4LD5 A;  4WX9 A;  4HYE A;  1KQ0 A;  4OAY A;  4I76 A;  4WXC A;  3L2Q A;  2H09 A;  5ERI A;  4YFN F;  1DP7 P;  2ZJQ F;  2HOE A;  3MWM A;  3H5N A;  3IC7 A;  2B9S A;  3C7J A;  3CCU I;  2LY1 A;  1UJ8 A;  1AKH B;  2OBP A;  3LSR A;  1SD4 A;  2YR2 A;  1QZZ A;  3EYY A;  4M3G A;  1RRJ A;  3BG6 A;  3J7A O;  5ED4 A;  3ELK A;  2E71 A;  3OS1 A;  2YS9 A;  3O3K A;  3CMA I;  3BDD A;  1GV5 A;  1KGS A;  2LR8 A;  2HOA A;  2IEK A;  4F91 B;  2MSY A;  1W0U A;  2Z5U A;  1G3Y A;  1YS7 A;  4KN4 X;  3ZPL A;  4BY1 J;  3P9C A;  2V1X A;  2Y48 A;  3LMM A;  5H20 A;  4DBQ A;  5K1Y A;  1XCV A;  5L3G A;  4KN7 X;  2F5D A;  2L02 A;  2WWY A;  2HDC A;  2Z99 A;  2HQN A;  2PJR B;  1PP8 F;  3OYK A;  5DTD A;  1IRX A;  4RGU A;  3IV5 A;  3VOD A;  1LDK B;  4YEL A;  2LF8 A;  2GLO A;  1APL C;  5K5Q A;  1LVA A;  1WI3 A;  3SDG A;  5L3E A;  3ROU A;  2VJ5 A;  4W1U A;  2V9P A;  2GAU A;  4PJ0 C;  2D5V A;  5LFA A;  1S9H A;  5HLT A;  1I3A A;  2CJJ A;  3FXR A;  2VIX A;  2PI0 A;  3K4J A;  2EPF A;  1X4O A;  2M0M A;  2GA2 A;  3H92 A;  3U1D A;  2EFQ A;  4B47 A;  3NEU A;  1AOY A;  2E36 A;  3VSK A;  2KIF A;  4IRG A;  2W85 A;  1KQ9 A;  3AG2 H;  4BAY A;  1TNS A;  1B9N A;  1ON1 A;  4ANJ A;  1KU9 A;  4GRI A;  4IHS A;  4Y3O A;  2AS5 F;  3OR2 C;  2RDP A;  3X2Q H;  1Y1W J;  4YEJ A;  5IT9 K;  1ZG3 A;  4BJ5 C;  4F92 B;  3PL8 A;  1ZR2 A;  3LWF A;  2KRC A;  1FJL A;  4UHT A;  4H0E A;  2EZI A;  3P5J A;  3HM5 A;  4EGY A;  1X1B A;  3ZGK A;  4MFD A;  3BG5 A;  3O6B B;  4A3C J;  1YIT I;  5CYV A;  2QQA A;  3CTA A;  2E1O A;  2RN7 A;  5AIQ A;  4IQJ A;  3V8J A;  4ENN A;  1ETK A;  2EZL A;  3WTX C;  4A3J J;  4DW6 A;  4ZH4 F;  1QQI A;  5H6Q A;  5D5W B;  3LA2 A;  3V4G A;  2HGC A;  4HF2 A;  1X1C A;  3I3L A;  3O8G A;  2X85 A;  4N9H A;  2EIN H;  2XKP A;  3FK7 A;  4CYC B;  2M34 A;  3OOU A;  3GFL A;  2RGV A;  2EQR A;  3U2R A;  4MTE A;  1J0R A;  2P6S A;  5D6F A;  2O8X A;  3GF2 A;  2VAS A;  3H5R A;  3W3C A;  1U78 A;  1VF9 A;  1FNN A;  4GXO A;  1SVL A;  2BOL A;  1HOM A;  3PNT A;  4HSR A;  2OTJ I;  1LFB A;  3I64 A;  4L0Y B;  3UKG A;  4EJO A;  4EM0 B;  2K4J A;  4ON0 A;  3T0Y A;  3ZN0 A;  1WJF A;  4CH7 A;  2I8D A;  1V54 H;  2GBY A;  3ZN1 A;  4G7Z F;  4E7I A;  5J8C A;  3CDL A;  3Q9S A;  3CP2 A;  3QPL A;  4XRS G;  5FKM A;  2LRD A;  3I53 A;  1BR4 A;  4PK4 A;  1G3S A;  4JOM A;  4BJT A;  4BL0 B;  2YX4 A;  3LSH A;  4NC8 A;  4KIG A;  2L5Q A;  1MNM C;  4C9Y A;  3BG7 A;  1EH8 A;  4N9I A;  4CZZ A;  3JRI A;  3M4O J;  4XLE A;  3GYH X;  2PMZ A;  1RPW A;  3MAJ A;  3OY9 A;  1V5E A;  5E3N A;  5BPD A;  3KIO A;  2LG4 A;  3A0B C;  2AO9 A;  1X3U A;  5EF6 A;  3JRB A;  1ZAO A;  5CPR B;  1JJ6 C;  2YSR A;  2ICW G;  1IG7 A;  2E5N A;  2WB1 N;  5GTH C;  5JR3 A;  4UVC A;  5BPI A;  4WCG A;  1ORK A;  3FXQ A;  2XPU A;  1FBU A;  4XKB A;  1D1B A;  3RKQ A;  1ZRC A;  2W7N A;  1OCP A;  3PSI A;  2VOD A;  2Y0M A;  1TT5 B;  2EH3 A;  4A3K J;  1XMK A;  4Q48 A;  1SD6 A;  1IUF A;  3B6A A;  4U7D A;  1YI2 I;  3IAS 2;  2F5V A;  2IT0 A;  1HKQ A;  4A0X A;  3E1S A;  1W0T A;  4BHP A;  1GT0 C;  1K79 A;  3RZO J;  3VOE A;  2R92 J;  2K9N A;  3QU6 A;  5FRM A;  3BR0 A;  1T95 A;  1BBY A;  1OCC H;  2DW4 A;  3KP6 A;  4IHV A;  5E8G A;  1FZP B;  2M8G X;  2CSO A;  1OCR H;  4ESB A;  1Q1H A;  2QBY A;  1LEA A;  2QQ9 A;  5FLX K;  2IGM A;  2XGX A;  3S3O A;  1OIS A;  4V2G A;  5LGU A;  2ZJR F;  5CJ9 A;  4YII A;  3RQI A;  1LPQ A;  5F6F A;  2K5C A;  5LEK A;  1NK2 P;  1WJ5 A;  2M87 A;  4N4O B;  3QYF A;  5TRD A;  1M1E B;  5IOZ A;  3L2R A;  2EJR A;  4WK8 F;  4C2U A;  3SHF A;  1VTN C;  1A6Q A;  4I0B A;  3IH3 A;  4E7L A;  2ZFU A;  3CUQ A;  3BTL A;  2DO7 A;  3RJP A;  2GIV A;  3W2W A;  3EUK L;  4XLH A;  1BJA A;  3FXK A;  2EK5 A;  2L3D A;  1Y8R B;  3L2U A;  1GXQ A;  1IV8 A;  1UB9 A;  3HSF A;  2K27 A;  3WGI A;  4DOZ A;  3HRU A;  4EMS A;  1MZB A;  1X1D A;  3OYJ A;  4CZC A;  2RNJ A;  2KLO A;  1MNE A;  3HHG A;  1K7A A;  3OL3 A;  1R36 A;  3IP4 B;  3F72 A;  2VOO A;  4G6D A;  1MBE A;  2BY2 A;  3PM1 A;  1ZEL A;  4C3H J;  1HCR A;  2WAF A;  4BYY A;  1ULY A;  2VPL A;  4Y13 A;  2HPM A;  3G1M A;  2D2W A;  4A6D A;  4LIU A;  2D1V A;  2DJI A;  1P9Q C;  3F3X A;  5GPC A;  1I6H J;  1PVE A;  3TED A;  1O4X A;  1T39 A;  2WV1 A;  1ZN2 A;  2MGQ A;  2XF5 A;  4I99 C;  5FRO A;  2Z9O A;  2JVG A;  1WJD A;  2X1D A;  3PUB A;  3H3Z A;  3W2V A;  1FTT A;  4D5C A;  5HS8 A;  3H3U A;  1NHA A;  2NRA C;  2XDV A;  1YX5 A;  3CJT B;  3FBI B;  4HF1 A;  4GDF A;  2VI6 A;  4B44 A;  4AYB A;  3CJR B;  2VQL A;  3V42 A;  4QWQ A;  2Y9Z A;  2A05 A;  2XGC A;  3Q0U A;  2XVC A;  2E19 A;  2W57 A;  5C3E J;  1SAU A;  2BE5 F;  5GAG J;  4HA8 A;  4IKF A;  2ZSI B;  1YE9 A;  1QBJ A;  4CUG A;  4X6A J;  1MBF A;  4HX8 A;  2QA4 I;  1T38 A;  2F4O B;  4A0Z A;  3TDU C;  5KCM A;  3JRC A;  4GFB A;  5EG0 A;  4YFX F;  4A2U A;  2FNA A;  1I1G A;  3Q9V A;  4V19 K;  3HGG A;  5EZH A;  1VQN I;  4II3 A;  1XSV A;  4CCL A;  2MC4 A;  4LG0 B;  2IXS A;  3BQY A;  4MHG A;  4YRV A;  3HBL A;  2EV0 A;  3LA3 A;  3KE2 A;  3TBI A;  4A3I J;  3TOA A;  1XSX A;  1MJB A;  2OJE D;  2R0Q C;  1E17 A;  1K6Y A;  3M9A A;  4BU2 A;  1ETX A;  5JI6 A;  4E4H A;  3TP3 A;  1HC8 A;  4LB5 A;  2R7T A;  2NVQ J;  2HQA A;  2VBY A;  1XGM A;  3DP7 A;  2CFX A;  1LE8 B;  4HQM A;  3C2H A;  2L9N A;  1VQ7 I;  2XPW A;  3T5X A;  2EWN A;  3GFI A;  2XUB A;  2X9D A;  3MD2 A;  4KT6 A;  1JGS A;  3VWB A;  5AON A;  2XRL A;  1F36 A;  4MO7 A;  1R1V A;  5BMZ A;  1IXR C;  2W4S A;  2WAQ A;  4EAT A;  1YW9 A;  3FIS A;  5LHH A;  3GTQ J;  4XK4 A;  1LEB A;  1R4M B;  1LQ1 A;  2N8G A;  1A6I A;  4UV8 A;  4BBS J;  3UNG C;  3JRD A;  4U0V A;  1BC7 C;  3IWF A;  4OIN F;  4LK1 F;  2M8E A;  3J80 Z;  4MIM A;  1FBS A;  3BWG A;  3IAM 2;  1B6A A;  1SAN A;  2KJC A;  2Y69 H;  3HSR A;  3IRR A;  2DA5 A;  3E6B A;  2CV2 A;  3H5A A;  4ZTJ A;  1BA5 A;  3G3Z A;  2QSG X;  4LG0 A;  4P1W A;  1FY7 A;  4PUS A;  3ERM A;  3QPT A;  3EDP A;  3O2P E;  4DYC A;  3QWL A;  2VXD A;  4BNC A;  4KIT B;  2HKX A;  1KA8 A;  3K7A J;  3RZD J;  2VBX A;  5JVT A;  3FXU A;  2LDU A;  4M71 A;  2IGK A;  2K3P A;  4L9N A;  4RLF A;  3FKJ A;  1JT6 A;  5F1J A;  3FHN A;  3LST A;  3VPR A;  2HS5 A;  3A4C A;  3FXM A;  4AIJ A;  2WTE A;  1RI7 A;  1XDS A;  4U0W A;  1U0J A;  1G3T A;  1XC5 A;  3LSI A;  1ZLK A;  2F5E A;  4XOP A;  3D1N I;  3GVA A;  3C2B A;  5IOY A;  1T2K A;  1OR7 C;  5FO5 A;  2XAG A;  4FT8 A;  3HOW J;  4EV0 A;  4M9X A;  2ELH A;  1S72 I;  3A01 A;  1POG A;  1CGP A;  2FBI A;  5FGM A;  2KP6 A;  2R7Z J;  1LDD A;  3ZQH A;  5E3L A;  1Z6T A;  4ESF A;  4I6Z A;  4KIF A;  1Z91 A;  3HRM A;  5CVI A;  4LGW A;  1P92 A;  3DKW A;  3FM5 A;  3KX2 A;  4XQF A;  1BIA A;  2R7O A;  4UUS A;  4DBR A;  1VQ5 I;  2NVY J;  3Q0W A;  3QYE A;  5AIP A;  3AG3 H;  3HYI A;  3RDI A;  4CA0 A;  3S15 J;  1Z05 A;  3CLQ A;  1Z7L A;  1TC3 C;  2CH0 A;  2FML A;  2ID6 A;  5M3M J;  4CCO A;  5ILU A;  3OYG A;  1ERD A;  5J6X A;  3E3V A;  4HV6 A;  3ZXS A;  3OV8 A;  4BGD A;  5ICF A;  4XKC A;  5CVR A;  2PJP A;  4MQ9 F;  2PQ8 A;  1P7I A;  2M4G A;  4HRI A;  1LE8 A;  1QPI A;  1X1P A;  4HOB A;  3I58 A;  3U1K A;  3BPX A;  5B66 C;  2ISZ A;  3AL0 C;  2BXZ A;  3I59 A;  5EDN A;  4A12 A;  2ELK A;  1ETO A;  4HZF A;  2E35 A;  4QIW N;  4XIC A;  3N4M A;  1F43 A;  5DS9 A;  2KIU A;  1SFU A;  2EV5 A;  3LOC A;  2HR3 A;  1X58 A;  2F6C A;  4U7B A;  3TO7 A;  2WY7 Q;  2DOD A;  3EET A;  3PQJ A;  3TMO A;  4E6K G;  3SJM A;  1MJA A;  3CZ6 A;  1CF7 B;  4D9J A;  1R1T A;  2DFH A;  4KMU X;  2VQH A;  2R5Y A;  3N97 A;  3JTH A;  3K10 A;  1YRN B;  5LRR A;  1D8J A;  3GUD A;  3F6O A;  4L9J A;  3ZMU A;  1DDN A;  1EF4 A;  3RKY A;  1GVJ A;  2DYS H;  1U2W A;  1X3Z B;  2OZU A;  5E17 F;  4ENK A;  3ESW B;  1D1C A;  2HFH A;  3S17 J;  5DEQ A;  4P96 A;  1HW5 A;  2DA6 A;  4CCN A;  5E8I A;  4KA4 A;  3E97 A;  2QCO A;  1ZK8 A;  5FFZ A;  3JRH A;  2CWE A;  1KYW A;  3LSM A;  1JUS A;  1Y0N A;  3L7W A;  1UHS A;  3RQ4 A;  2BGC A;  2QEX I;  3GME A;  2EIJ H;  2PMZ N;  4M72 A;  2FMY A;  4DIQ A;  2TCT A;  4IZZ A;  4AIK A;  1FPQ A;  1T56 A;  2ECB A;  4ZDL A;  3KYL A;  1AU7 A;  3M1C A;  4LFU A;  4S0H B;  4XLC A;  2M2E A;  2H27 A;  5DDG A;  3CCM I;  2LKX A;  2G7U A;  4XLF A;  1FYK A;  4UXN A;  1X1A A;  1F9N A;  3S14 J;  4XKV A;  3E7L A;  1W7P A;  4ZDP A;  2IAI A;  3KLN A;  1BW6 A;  3G73 A;  2XF6 A;  2M7B A;  2KZV A;  1W5T A;  2RNG A;  2R7U A;  5LHG A;  3I4M J;  1HW2 A;  3ABL H;  2LD5 A;  2A6T A;  3HPH A;  5J4Y A;  2R7D A;  3WGG A;  2D45 A;  2K85 A;  4YIR X;  2CQK A;  3HOU J;  3UR3 C;  1JI8 A;  5GTI C;  3E6M A;  1V3F A;  3BRO A;  3CES A;  1IUY A;  4BDZ A;  1OMI A;  2DFF A;  2RAE A;  2BV6 A;  5IY5 H;  3A02 A;  1X2M A;  4MLO A;  2WC2 A;  4G94 A;  3ZQI A;  3C18 A;  3F8N A;  1BI2 A;  2NS7 A;  4A0Y A;  2OA4 A;  2KZG A;  3CF2 A;  2VXZ A;  1S29 A;  4IO9 F;  1PP7 U;  2E1C A;  1U6G A;  3TOB A;  5F64 A;  1FYL A;  2P7V B;  2ZJP F;  1U8B A;  4KJZ A;  3TW7 A;  3G71 I;  1U9N A;  3K1M A;  2VON A;  3KP4 A;  4HX4 A;  1YOV B;  5TIS C;  1FOW A;  1R49 A;  3HKZ A;  3GLX A;  3PO3 J;  2M1B A;  3H9Q A;  4CSW A;  4O3M A;  2YU9 J;  4WXD A;  4I02 A;  1IXS B;  2QQB A;  2QYO A;  3BZC A;  4KIS A;  2IA2 A;  3MN2 A;  2K4B A;  4OAZ A;  1FT9 A;  2OCE A;  3I54 A;  3HJE A;  3QOP A;  4UB8 C;  3JRE A;  3BTJ A;  2H6B A;  1SFK A;  5ICC A;  2DQL A;  2EBI A;  2XB5 A;  5DM6 F;  4LOC A;  1DP3 A;  1QNT A;  2DMP A;  3A03 A;  4F55 A;  1T33 A;  3CCR I;  1B8I B;  2VOP A;  4M9S A;  1MND A;  4EGZ A;  1IN7 A;  2DMN A;  5BNG A;  2L4M A;  2E7W A;  2LBF A;  1PUF B;  2XKO A;  3ZR8 X;  2GZW A;  1UST A;  4X1E A;  1B72 B;  2IPQ X;  3QRF F;  5M5Y J;  2STT A;  3OR1 C;  4KMF A;  5D5X B;  1LFP A;  2DDA A;  2PG4 A;  2EA2 A;  1SC7 A;  2YX7 A;  4NDL A;  4WXH A;  1UZC A;  3MKL A;  5DD4 A;  3SZT A;  3WGH A;  4BHC A;  5E1Z B;  4DYR A;  1A04 A;  2K3F A;  3BOQ A;  1UG2 A;  5B3S H;  1XMA A;  1BI0 A;  2MW8 A;  1HQC A;  2O03 A;  4HW0 A;  4JYK A;  2F5C A;  3JRF A;  3K4K A;  3MMY B;  5LBQ A;  2FOK A;  1D5V A;  4WF2 A;  2BW3 B;  4AID A;  1QA6 A;  1TQI A;  2JVH A;  3KZY A;  4CCM A;  2L0K A;  1OFC X;  4EVI A;  2RQQ A;  3W2A A;  3SZP A;  2A69 F;  1XGN A;  2H1L A;  3LSK A;  1JKO C;  4DNC A;  3HTS B;  5FKN A;  3HIF A;  2G0E A;  3R6S A;  4F93 B;  1LNW A;  5IT3 A;  4ZJZ A;  2OQG A;  3M8F A;  2QVO A;  2R5Y B;  1H8A C;  1YRN A;  3MCZ A;  1MBH A;  1JHF A;  2HI3 A;  3DKX A;  3LQR A;  3MZY A;  3PNY A;  1I3Q J;  3RIR A;  3WTW C;  5M5W J;  5JHF A;  3LNQ A;  3QP5 A;  4IHX A;  3DLL F;  1BI3 A;  3GZ5 A;  2MD0 A;  2H1K A;  5C4J J;  3RPQ A;  3JTG A;  1A35 A;  4JX6 A;  1W7P D;  4E7Z A;  1OQY A;  2IGN A;  2A3S A;  3HPG A;  3SFI A;  1ZKG A;  1WFX A;  2OTL I;  1DQU A;  2P6T A;  2V26 A;  2NS8 A;  4IVN A;  5JHU A;  2DT6 A;  4CO8 A;  1IC8 A;  2IA1 A;  2AQE A;  2K40 A;  3OYA A;  4AUX A;  2IA0 A;  2EZH A;  3E6D A;  2Y0S N;  3DTK A;  1L3L A;  4E7K A;  3AG4 H;  3CJN A;  4FX4 A;  3BR5 A;  2XF7 A;  1YHQ I;  4IEJ A;  4PZJ A;  2DYR H;  1XX5 A;  3PSF A;  4KIB A;  5J4V A;  2PMH A;  2CUE A;  1RR8 C;  2JPB A;  1QHH D;  1OYW A;  5K7F A;  3OYI A;  1BOA A;  1Q1V A;  4KT5 C;  2DCE A;  1K78 A;  3KCC A;  1OLT A;  5EJC A;  2DXI A;  1NG6 A;  2PMU A;  3SDB A;  1O7F A;  2K02 A;  2VJI A;  1BN5 A;  2L4A A;  2BY1 A;  4B09 A;  2KKO A;  3LSG A;  1VQ8 I;  5J1Y A;  4IX7 A;  5GP9 A;  5F0H A;  4EJT A;  2KIS A;  3SYT A;  2JQ7 A;  2HTS A;  1I27 A;  2HOT A;  1EJ9 A;  3EPZ A;  3CCV I;  3RSN A;  1E3H A;  3E0J B;  5JFR A;  5J1R A;  3S3N A;  3GO5 A;  4ASN A;  5FLM J;  2AXL A;  1X3W B;  2E60 A;  3BR2 A;  2H8R A;  1MBJ A;  3IL2 A;  1E0E A;  3BR6 A;  4RMN A;  2R7S A;  1R4N B;  2O8K A;  3L9F A;  5FKL A;  3QPS A;  3BJ6 A;  3BP8 A;  3SXY A;  1YW8 A;  1WVR A;  2WAE A;  3B02 A;  4ETS A;  2KRH A;  4FE4 A;  3WTZ A;  3ABK H;  1WRJ A;  2RKH A;  2OD5 A;  2CG4 A;  4Y52 J;  3CCY A;  1N75 A;  1U8R A;  1TQP A;  2JRT A;  2X6O A;  1KYZ A;  1K4T A;  2VUM J;  1FOK A;  2W82 A;  1MH4 A;  3I71 A;  3ABT A;  4E7S A;  1HW1 A;  4U0Y A;  1YJW I;  1Y39 A;  2JTV A;  2B7E A;  3WG9 A;  1E3P A;  3R61 A;  2LBF B;  2BVM A;  1R58 A;  2O3F A;  1XN7 A;  1L0O C;  3P7N A;  3RTR A;  1B4A A;  4XOT A;  1FX7 A;  1IDY A;  1KON A;  3A2K A;  1RR7 A;  2V7F A;  4L0Z B;  4XRF A;  4G12 A;  2W84 A;  2K86 A;  3M1E A;  1OPC A;  1FMW A;  4RS8 A;  2R7R A;  3ZQ7 A;  4MFE A;  3FXO A;  4AVP A;  4A3E J;  3DPT A;  1XGO A;  2EIL H;  1W5C C;  1XS9 A;  3T8R A;  1FTZ A;  3K70 D;  1BI1 A;  1HLV A;  2BHZ A;  3K4C A;  5BQT A;  2DN0 A;  2DQR A;  1CQT A;  3GTP J;  3VDX A;  4HNU A;  4ZZD A;  1LKX A;  2QM3 A;  4JBA A;  2AXT C;  3F8C A;  3MZ8 A;  2BVL A;  4C30 A;  1TWA J;  2WY8 Q;  3W6V A;  4MNU A;  3OWT A;  1N25 A;  2AHQ A;  2FNP A;  4I0A A;  2NYX A;  1OKR A;  1K83 J;  1P4W A;  4Y4R A;  3A0H C;  4XNF A;  3LSJ A;  3ZCO A;  5D4S A;  3GTK J;  2DLL A;  1J9I A;  5J40 A;  2L7F P;  2ME0 A;  2IW5 A;  3WHC A;  3DWL E;  1T0F A;  2A5Y B;  4OMZ A;  4BHB A;  4EJW A;  4E7H A;  4Q5S F;  4AVZ A;  1H9G A;  1R23 A;  2DT7 B;  1MMD A;  4L5E A;  3ERE D;  3PO2 J;  1TP4 A;  3K69 A;  3VFZ A;  2FQ4 A;  3WU1 B;  2KL4 A;  3HUG B;  1IXC A;  3JAM Z;  3QP6 A;  3CCS I;  3NAU A;  5HNH A;  3ZP5 A;  2JA7 J;  5KK1 A;  1MMS A;  4Z6Y A;  2HXO A;  4M3B A;  3HHH A;  3IKV A;  4XL9 A;  3H3V K;  3BC8 A;  1J75 A;  2Y0S A;  3G1L A;  2C6Y A;  1UCR A;  4R1H A;  2DTR A;  1R5I D;  2XAH A;  1ZRE A;  3ZRG A;  1HXD A;  1BC8 C;  2X4H A;  4AWX B;  5LLQ A;  3KFW X;  3JAM K;  4NC7 A;  5EYR A;  2FXA A;  3ZQC A;  3G1O A;  4NQW B;  2TDX A;  2QF7 A;  3PIP F;  3LAP A;  5KNL A;  2A07 F;  4OIP F;  2XAF A;  3K1P A;  2M4K A;  1JKP C;  2CYY A;  5JLW A;  2IP2 A;  1R5G A;  2VKV A;  2W25 A;  1TWC J;  5BOX A;  3J7A Y;  2HYG D;  1UHM A;  3G2B A;  2HXI A;  3MFK A;  1VQ6 I;  2DA1 A;  2DU9 A;  3EUA A;  5E1X A;  3RKW A;  1VQP I;  2L7Z A;  2RRE A;  1V55 H;  3SZG A;  1JKQ C;  4G7O F;  1I50 J;  1YIO A;  1LB2 A;  2O61 A;  5HOO A;  1Y0U A;  1WHU A;  1WSU A;  4CDG A;  4S04 A;  2XRO A;  1PJR A;  1G4D A;  1HST A;  3L2W A;  2JA6 J;  4Y15 A;  2FBH A;  2F4M B;  3D5R C;  2HOS A;  2ID3 A;  2NVX J;  4FHT A;  3ZMV A;  1ZG1 A;  2CUZ A;  3LA7 A;  3HOZ J;  4OU0 A;  2Y30 A;  3KZI C;  2A68 F;  3QYB A;  3JSP A;  3HGY A;  3CCQ I;  1D8K A;  3EUH C;  3SEZ A;  1S8N A;  1D0Y A;  4DQ2 A;  3HOV J;  2BZT A;  5D4R A;  2VN2 A;  2BEO A;  5H6R A;  1SVO A;  2OUM A;  2JZY A;  3WE3 A;  1W36 D;  3OYE A;  2GXG A;  4AC0 A;  1Z1D A;  1H0M A;  2WAQ N;  3KP5 A;  2L7K A;  3S3M A;  4HPQ A;  4QPO A;  2X0L A;  1BIB A;  5IYB J;  3WU2 C;  2B0L A;  3FF5 A;  1J7K A;  3VSL A;  2EIK H;  4ITV A;  5DM7 F;  1K61 A;  5FKO A;  4I98 B;  4NBQ A;  4XOR A;  4IJA A;  4IOA F;  2Y75 A;  4W97 A;  4CCJ A;  3MZH A;  1GVD A;  1ONV A;  2DAO A;  1FMV A;  3QU3 A;  3T1B A;  1XB4 A;  2QZ8 A;  1O7L A;  1FEX A;  5L3B A;  3DPL C;  3ZQQ A;  4N4N B;  2CO5 A;  4Y33 A;  3CC2 I;  1QPM A;  1K4S A;  1K6O A;  1AKH A;  1HA8 A;  5CQG A;  2HDD A;  3BPV A;  1HKT A;  5LGT A;  2HYJ A;  3K70 C;  1LDJ A;  3REO A;  5GAD J;  2V1N A;  3CC4 I;  4HLX A;  2K9Q A;  2VB6 A;  2E1M C;  1D0X A;  1FSH A;  3BTC A;  5FLX Z;  5H2F C;  4BQO A;  1W36 C;  2ZFW A;  2E5Z A;  3FMR A;  3V7S A;  1NK3 P;  3BJA A;  4LK0 F;  2DFI A;  1Z3Y A;  3MVP A;  2FF4 A;  2WA0 A;  2ZSH B;  2IJL A;  4RB1 A;  4BEH B;  1IDZ A;  2DPD A;  3CJQ B;  5DV5 A;  2O5R A;  5E79 C;  3TO9 A;  3R60 A;  2DT5 A;  3PIO F;  1D1A A;  2XGD A;  2JSP A;  3QOD A;  2GA1 A;  4UVB A;  3J80 K;  3JSO A;  1SAX A;  5B5E C;  9ANT A;  4P9F A;  3RYR A;  2DA3 A;  1P2F A;  4RB2 C;  4UB6 C;  3FM3 A;  2O7O A;  4A3F J;  3IWZ A;  1ZGJ A;  3D5L A;  2F48 A;  2ZCW A;  2XIG A;  3R0J A;  3GCM A;  1YQA A;  5GAE J;  4RDU A;  4FTH A;  3CMM A;  2R3S A;  4RAG A;  3V8K A;  1JGG A;  2EIM H;  2ZBK A;  2FX0 A;  1HDD C;  3S1N J;  1P4X A;  4XRM A;  5HDG A;  1WGX A;  1FWZ A;  3RPU A;  1IV6 A;  4Q4Z F;  3CO7 C;  5DUI A;  3L2C A;  3GZN B;  1O57 A;  1SFX A;  3J81 K;  2EFO A;  2ZXI A;  1YX3 A;  2CU7 A;  1UAA A;  5FJ8 J;  2XAQ A;  4XID A;  3I9V 2;  4RM2 A;  4HNT A;  1G3W A;  2ADU A;  2JA2 A;  4HST A;  5FD5 A;  3TQN A;  2KDO A;  5CLS A;  2CW8 A;  3G4S I;  1IAW A;  2J5P A;  4G6T B;  4M6X A;  3E5U A;  2ZME A;  1WI9 A;  5E3M A;  1YS6 A;  2ETH A;  1QZY A;  4EJV A;  1LJ9 A;  1OYI A;  2NVT J;  2KMU A;  1B8I A;  2VL8 A;  1ZRF A;  3M8E A;  2LVS A;  1J5Y A;  1EH7 A;  1AHD P;  2Z2S B;  1LVK A;  3HDD A;  1YYV A;  5TJJ A;  2YUS A;  2OU2 A;  4PFO A;  1E2X A;  1BR1 A;  1J09 A;  2LRE A;  5A2Q K;  2JSC A;  2NNN A;  1QHG A;  3FX3 A;  2JA5 J;  1MW7 A;  3PJR A;  1SVM A;  2DA2 A;  4DYQ A;  3DEU A;  1I39 A;  2GQQ A;  4FE7 A;  2VKH A;  2KFD A;  4QSH A;  1MKM A;  5EEA A;  4GYG A;  3SFZ A;  4FQG A;  2COM A;  1VQL I;  2LF7 A;  2Y9Y A;  1IZ1 A;  1WH7 A;  3OIP A;  3IHU A;  2V4J C;  4ENJ A;  3RKX A;  4D7N A;  5DD8 A;  1PUE E;  3TW6 A;  2QKL B;  2DOA A;  3ASN H;  1UHW A;  3OIQ A;  2QKM B;  5K7H A;  1JTY A;  1C0W A;  1XG1 A;  3SQN A;  4GYI A;  4RAF A;  3FDY A;  3L1P A;  1X2N A;  2GIZ A;  1VND A;  2OPT A;  3DF8 A;  5GPA A;  3ULQ B;  5HLG A;  5IYC J;  1H89 C;  4BQA A;  4RAZ A;  5FRN A;  4JP0 A;  2WB1 A;  3DTI A;  3C1D A;  1SFO J;  1D0Z A;  4B1R A;  2X48 A;  4ZYH A;  3OYL A;  2JWT A;  2JK3 A;  2CRG A;  2GXB A;  2TRT A;  1XSD A;  2OCC H;  2ZME B;  4C3I J;  2CMP A;  2JA8 J;  3PFY A;  2MYS A;  5J3L A;  5IP6 A;  1ACI A;  1MH3 A;  2OC6 A;  2VE9 A;  3F8M A;  4KDP A;  2FU4 A;  3LAJ A;  3DPU A;  4X0G A;  2QWW A;  4U88 A;  3QAH A;  3MKZ A;  1Z21 A;  1FOX A;  2MH9 A;  1A36 A;  4RB3 C;  1TBX A;  1DGR M;  1Y1V J;  3CCE I;  1N78 A;  3FMQ A;  3JR9 A;  1U5T B;  1IN8 A;  4PSX A;  5C44 J;  4C2M J;  5KAF C;  4G6Q A;  5F08 A;  4PGH A;  1R00 A;  2FJ1 A;  4HV5 A;  5CQE A;  1RC9 A;  5CVJ A;  3CO6 C;  2H8W A;  1USS A;  2QSF X;  1F4K A;  2E34 A;  3PQK A;  1ENH A;  3M07 A;  4FIS A;  4UVA A;  1PYV A;  1A5J A;  1D5Y A;  2P7C B;  1ZHF A;  1TT0 A;  5D6E A;  2L9V A;  2XB0 X;  5IYD J;  2FBK A;  2JRM A;  3VEP A;  1VI0 A;  5HOD A;  5L3D A;  2DJN A;  3B73 A;  2DOF A;  2X1C A;  3CUQ C;  1MSF C;  3EQL F;  1ZGW A;  5FLV A;  4TV7 A;  3JRA A;  3COA C;  4IRI A;  2I10 A;  2ZME C;  5E1W A;  5EEG A;  2IS6 A;  3GTJ J;  3L09 A;  2QBY B;  4UNO A;  5K5R A;  4KIC A;  4XSZ F;  2LSO A;  3F8B A;  3GWZ A;  3GTM J;  2L7M P;  1K78 B;  1ETQ A;  2K9L A;  4L5I A;  5F1R A;  3S1M J;  2E7X A;  3FXL A;  2PN6 A;  4XBF A;  4AU7 A;  4XN0 A;  5EEH A;  3S93 A;  1WZ2 A;  4PJJ A;  1I5Z A;  2L2O A;  2V6E A;  4QTR A;  2IS4 A;  1H9T A;  1R7J A;  2R7W A;  1HDP A;  1JTX A;  2NOJ B;  2DA4 A;  3F22 A;  2DOE A;  3M7G A;  2GWR A;  3RYP A;  5FD6 A;  3OS2 A;  2PLY A;  3K4N A;  2QGU A;  3I4P A;  4RLQ A;  1F1Z A;  4OIQ F;  4CCK A;  3VYT B;  2XHK A;  5CVV A;  2P8T A;  3ZMT A;  2M30 A;  4XLA A;  4XLN F;  2ZXJ A;  4HDV A;  1EH6 A;  4KNY A;  3CQZ J;  1LUJ B;  1IN6 A;  3NAR A;  5EG0 B;  3Q5F A;  3HOX J;  5DCM B;  2P0W A;  4PJM A;  3BZK A;  3I4N J;  2M9H A;  3OYH A;  4AYB N;  2NOG A;  3K4L A;  2VLA A;  2M45 A;  2KT0 A;  2WV0 A;  4M3D A;  3EUH A;  1XD7 A;  1O3T A;  1YG2 A;  1FP2 A;  3K0L A;  5JLX A;  3E5X A;  4M74 A;  5GAH J;  2EFW A;  3K1N A;  3RCO A;  3SEQ A;  3VB2 A;  2ZKZ A;  5KHD A;  1YLF A;  2F2E A;  2LY2 A;  1W1W E;  3I55 I;  3F6V A;  3ML6 A;  4M6Y A;  4BQQ A;  3WTT C;  2COB A;  1JJ8 C;  1G59 A;  1RUN A;  1R1U A;  1REP C;  5D8K B;  4D0P A;  1U3E M;  3DFG A;  2XAU A;  1J2X A;  2Z3Y A;  1D3Y A;  1JHH A;  3QQA A;  1G2H A;  4H4K C;  5KAI C;  1U9O A;  4G7H F;  4PCQ A;  3IKT A;  4XSX F;  4CXF A;  5HLI A;  3DV8 A;  2CFO A;  1T6S A;  1AWC A;  3TL4 X;  3WTU C;  2ACJ A;  3PFI A;  3KYD B;  3JCU C;  4DZJ A;  3DBH B;  2VPR A;  4HQE A;  2E2H J;  2UXN A;  4EM1 A;  4HX7 A;  2DK5 A;  5D8L B;  2VE8 A;  1MBK A;  4NC6 A;  4ZYA A;  2UUZ A;  3HXL A;  4B3A A;  3CCL I;  2PJR A;  4KYW A;  2XPV A;  4BE1 A;  3TO6 A;  4A93 J;  2Q2E A;  2W24 A;  3LL7 A;  4M9Z A;  1FOY A;  4Q47 A;  3ECO A;  4A6E A;  2CQQ A;  2VBZ A;  2VC1 A;  2QQ8 A;  1IW7 F;  1FYM A;  4FET A;  3DBL B;  5CKT A;  2PFB A;  4EEF G;  4NB5 A;  5ILV A;  3AAF A;  1UEL B;  2XAJ A;  3F0C A;  3ASO H;  1B72 A;  1TW2 A;  4ZDO A;  2H94 A;  2IS1 A;  1GV2 A;  4II2 A;  1O3R A;  3FBN B;  2LTP A;  3FKI J;  4R8H A;  4I01 A;  1VQO I;  3NWT A;  4LIV A;  1XDU A;  2I5U A;  2XAS A;  2YU3 A;  3S1R J;  3I56 I;  2DI3 A;  1Z67 A;  4MEY F;  1Y8Q B;  2EFP A;  4HLY A;  2MH2 A;  2BXY A;  2LYC A;  2Q2E B;  3HG9 A;  2R7V A;  3I5U A;  4CIC A;  3OSF A;  2G9W A;  3NRV A;  1YJ9 I;  3FMS A;  1UG0 A;  2VQC A;  1Z6R A;  2CW7 A;  4B48 A;  1P4A A;  2X6W A;  1Y56 A;  2LLK A;  3H36 A;  3H9G A;  4O5V A;  4P55 A;  3H0G J;  1ETW A;  4N0B A;  2R7X A;  3V7C A;  1WPK A;  5E18 F;  1DPR A;  4DZP A;  3OYC A;  4ZC3 A;  4OMY A;  1GHC A;  1E3O C;  4XM3 A;  4RGX A;  3HKZ N;  2CQ7 A;  4QPQ A;  1O3Q A;  1CF7 A;  2CGP A;  1ETY A;  1YO5 C;  3K6G A;  2E2I J;  5IPA A;  1QO0 D;  3ABU A;  5LEJ A;  4Y7N J;  5IT9 Z;  2JN6 A;  2Q0O A;  4RGS A;  1SEU A;  3OOP A;  1O3S A;  1NTC A;  2L01 A;  2X51 A;  5F27 A;  1VQM I;  5LGN A;  3OL4 A;  5KVR A;  3WTV C;  2GXA A;  1DU6 A;  1IRG A;  2HWV A;  3V7R A;  5E20 A;  1RNL A;  2VJJ A;  4UY8 I;  4CHU A;  5J1U A;  3V8L A;  5HLH A;  4L18 B;  4DJA A;  3DEE A;  4XN3 A;  1RIO H;  2IGO A;  3QPH A;  4BUP A;  5C4X J;  4JK1 X;  3K2Z A;  4OWR B;  1ZAR A;  2DFE A;  2RVC A;  3N05 A;  3A1Y A;  4HG2 A;  4F7Z A;  2A61 A;  4ZTF A;  2GOM A;  4J00 A;  2BYV E;  1JT0 A;  2HTJ A;  2DBB A;  2FE3 A;  4JX5 A;  2W00 A;  1LFU P;  4AM3 A;  2Y2Z A;  2EFN A;  2K9M A;  3FK6 A;  5LD2 C;  1YW7 A;  4RM3 A;  3KEY A;  1MBG A;  1T0F C;  1S7E A;  2XC7 A;  2P5L C;  3ABM H;  1B1B A;  1JUM A;  1Z77 A;  2VJ4 A;  2VKD A;  1TLH B;  2W1O A;  5B1A H;  3GZ6 A;  4C3J J;  1BR2 A;  4BE0 A;  4B8X A;  4WWC A;  3A01 B;  3PNV A;  3ZMZ A;  3TGN A;  5IP7 J;  3H35 A;  2VQG A;  3R4K A;  5JVG F;  2OF7 A;  2NXN B;  4ZYE A;  1PDN C;  3I0T A;  3ZQG A;  1QU3 A;  3BG9 A;  3ECH A;  2HDW A;  3IH2 A;  4M3F A;  4UUS B;  2EV6 A;  3DXJ F;  1FBQ A;  2MG4 A;  4ESJ A;  1MDM B;  2RV8 A;  3KP7 A;  3EYI A;  2GM4 A;  1HKS A;  1IRZ A;  4JQF A;  2ME6 A;  3BTI A;  1R22 A;  1EA3 A;  4RB0 A;  1KZH A;  4BKX A;  3FWE A;  4IPA A;  4ZYD A;  2KIM A;  4I7H A;  2JJ7 A;  3MKY B;  4IOC F;  2ZB9 A;  4MEX F;  4IHY A;  3WOD F;  4RA2 A;  3GTG J;  1BJZ A;  2LH9 A;  2JMW A;  3S32 A;  4B43 A;  3O8H A;  4ENM A;  1ZTR A;  1FIA A;  1B9M A;  2NS0 A;  3WU0 A;  3F8F A;  1IRF A;  3QOE A;  2IVM A;  4E70 A;  2ELJ A;  5BS6 A;  3F9K A;  2Q8K A;  5HDK A;  3CCJ I;  2HVQ A;  4JX4 A;  4XRS A;  1GUU A;  3LSP A;  3DKY A;  1BM9 A;  3KET A;  2HVR A;  2PX9 A;  1WJA A;  1B59 A;  2O6G E;  2FUG 2;  1HF0 A;  2A6E F;  1IGN A;  4D7M A;  4LJZ F;  3S2D J;  1MIJ A;  4MTD A;  2Z33 A;  2V79 A;  3GEZ A;  1U5T A;  3GXO A;  4G8X A;  1TTY A;  1S5L C;  2R4G A;  1EKE A;  2HEO A;  4IQ4 A;  2R93 J;  1FSE A;  1UFM A;  4F52 A;  3KEQ A;  3CF5 F;  4CGZ A;  2MC3 A;  4IL6 C;  5L3C A;  1PUF A;  4EQQ A;  3AL0 B;  1DU0 A;  1Z3X A;  4IHT A;  2E1N A;  2ZNY A;  4RAY A;  1G8X A;  3J81 Z;  3BT9 A;  1MGT A;  4L9T A;  1OCZ H;  3P9K A;  4HNV A;  2O9L A;  1X4P A;  1MD0 A;  1FLI A;  1QZE A;  3ZQL A;  2HQ5 A;  1SMY F;  5EGO B;  3HOY J;  5DYM A;  4KUM A;  4YFK F;  4A3D J;  4M73 A;  4XMY A;  3Q3S A;  1A31 A;  3BJO A;  4G9Y A;  3P9I A;  2LNB A;  3VYS B;  2CQN A;  4BXF A;  1ON2 A;  6PAX A;  1S3J A;  3F23 A;  2QEN A;  4M6V A;  4ZYG A;  2XSJ C;  2XRN A;  1MMA A;  1Y6I A;  3HSE A;  1XGS A;  2Y31 A;  5DCF A;  3OYM A;  3HTU A;  1FP1 D;  4L9V A;  3RI4 A;  4XON A;  2HPI A;  1QVT A;  3NQO A;  1W5S A;  3OMY A;  3ZQF A;  3BZ6 A;  3HB9 A;  1R5H A;  4CYC A;  3OS0 A;  4AIH A;  1H88 C;  1TWF J;  2QLZ A;  2VC0 A;  1ZH5 A;  1WJB A;  2MBF A;  3ISP A;  5B1B H;  2LY9 A;  2E2J J;  1R71 A;  4I09 A;  1WJC A;  3CUO A;  1VQK I;  2WAD A;  2ZO4 A;  3B6C A;  5E3O A;  3CMY A;  4HBL A;  2HYF A;  4O6J A;  3F21 A;  4PDK A;  1RZ4 A;  2DA7 A;  4RBO A;  4PGG A;  3WE2 A;  1N77 A;  2P5K A;  1MJ9 A;  1TQM A;  3U9G A;  5FKK A;  1Z0X A;  1JUP A;  4F3Q A;  2P81 A;  1X19 A;  3E6C C;  3W6K B;  5M5X J;  3DTE A;  3NWS A;  5F04 A;  4HEA 2;  1TL8 A;  4BE2 A;  2M7A A;  3BCB A;  2DDB A;  2XSD C;  1W7P B;  1ZQ3 P;  1OCT C;  2Z16 A;  2HZT A;  4CYD A;  2B63 J;  2V6C A;  3TP0 A;  1TW3 A;  2UZK A;  1BL0 A;  3CDI A;  2FQ3 A;  2JT1 A;  3MKW B;  3PUF A;  5K5O A;  2L9S A;  2K7L A;  4P5O A;  4S05 A;  2JUG A;  3GTL J;  4R79 A;  2FSW A;  2HNH A;  1QVU A;  3HEF A;  4FX0 A;  1VQ4 I;  3Q0V A;  4FAS D;  2ZJ2 A;  2LOO A;  5TGT A;  3OYD A;  3LFU A;  2STW A;  2JUC A;  4PJN A;  4LLN A;  2LC2 A;  2GOX B;  1SMT A;  4IF4 A;  4K2E A;  2BHY A;  1WQ2 A;  1OR7 A;  1ZLJ A;  1RKW A;  2BBY A;  2L54 A;  4DGW B;  1JE8 A;  4OOI A;  2MAB A;  2ESH A;  1VQ9 I;  5HNF A;  2LK2 A;  2QSH X;  3GTO J;  2VKE A;  1STZ A;  3DU6 A;  3JRG A;  1F5T A;  4BY7 J;  3BR1 A;  1IO2 A;  3MQ0 A;  1S6L A;  3M3Y J;  3GX4 X;  3FXJ A;  2PEX A;  5HDN A;  1ETV A;  4FCY A;  1AA7 A;  2X6Y A;  2RQP A;  4M3E A;  4A3B J;  2CQX A;  4A3G J;  3DQV C;  4ZZL A;  5ILS A;  3CLO A;  3I59 B;  5K7Z A;  2O0Y A;  3W6J B;  1RES A;  1MMN A;  2VT2 A;  2X6X A;  4P9U A;  3WHB A;  1YJN I;  2J5O A;  1GLN A;  5DCM A;  1W4M A;  2CW0 F;  3HUG A;  4IHW A;  1IN4 A;  1ODD A;  2W48 A;  4A69 C;  4V2F A;  2OAZ A;  1ZG5 A;  3FIW A;  3BY6 A;  5IP9 J;  3TDZ C;  4BXU A;  3IUO A;  3KEO A;  1BW5 A;  1V5F A;  2FD5 A;  3LQQ A;  4I2O A;  3S8P A;  3BCA A;  3DCF A;  3GLL A;  5ICG A;  1I1S A;  4Z2Y A;  1R9T J;  2UXX A;  2L9R A;  2KPM A;  4NNJ A;  2K9S A;  1U5T C;  4UUV A;  1DPU A;  1IN5 A;  3CME I;  4RGR A;  2ISY A;  2EZK A;  4BS9 A;  4BXX J;  2XGE A;  4LG3 A;  3S16 J;  3S1Q J;  2FOW A;  1T8I A;  4A3M J;  3CD6 I;  3K9T A;  2BY0 A;  2OV7 A;  4Y17 A;  3VYR B;  2OZ6 A;  4A5M A;  1Z7U A;  2MFZ A;  2DTZ A;  1T08 B;  1T98 A;  1ITY A;  1XTA A;  1HSJ A;  1WH5 A;  4MQV A;  2F5F A;  5D5V B;  3OSG A;  2AQF A;  2LKS A;  3ZOB A;  4LMY A;  1BOB A;  3OYF A;  2FRH A;  1P7J A;  3CUQ B;  1MMG A;  2HZD A;  2ZC2 A;  2KRF A;  2KIQ A;  3DBR B;  2EA4 A;  2NVU B;  3CDH A;  4NQW A;  2DPU A;  4HAM A;  3D0S A;  4KFC A;  4GCV A;  2MLK A;  2DMU A;  1RET A;  3GFJ A;  2D1H A;  4EM2 A;  4PJL A;  1WWX A;  2KJB A;  1VFC A;  4A3L J;  3ONQ A;  3MEX A;  3BG3 A;  3H0D A;  1JKR C;  3H1C A;  4XR6 A;  5FFX A;  2BW3 A;  4B3X A;  2Z1D A;  1KQ8 A;  3J7Y J;  2VBW A;  1KU3 A;  2OQR A;  3L00 A;  3LFK A;  4BJ6 C;  4LLG F;  2UWM A;  2R7Q A;  3OYN A;  3VYU B;  2JPC A;  2Q1Z B;  2M3A A;  5M3F J;  2KQR A;  1SD7 A;  2HKO A;  3E5Q A;  5LHI A;  1MSE C;  1TNT A;  2G7H A;  4UUT A;  4AD9 A;  1R6R A;  3DLA A;  4ABZ A;  3WG7 H;  4E7J A;  1NG7 A;  1OYY A;  3K4M A;  2V1D A;  4GGG A;  1XCB A;  2M5W A;  1OCO H;  2HU9 A;  2V9K A;  5DUK A;  4MGR A;  5EZG A;  3H9J A;  1FC3 A;  1OJL A;  2DK8 A;  2MA3 A;  4HF0 A;  4LIT A;  4YIF A;  3U21 A;  3OYB A;  1I6X A;  2LFB A;  3J7Z I;  1WCM J;  3KLO A;  2EB7 A;  2LKP A;  1GXP A;  2HQR A;  5J47 A;  2R7F A;  4J01 A;  2ZXW H;  3HC7 A;  2VT3 A;  4BBR J;  3WTS C;  3BR3 A;  2BY3 A;  2NNY A;  4NUB A;  2HVS A;  3JW4 A;  2ESN A;  2PBI A;  3BQZ A;  2CV0 A;  3K2A A;  1DUX C;  4XLP F;  4J19 A;  1ZYR F;  3TKY A;  1ZR4 A;  1J59 A;  2MLG A;  3ZMS A;  3HL2 A;  2QUF A;  1HBX G;  3R0A A;  5F0F A;  3CP8 A;  3L2V A;  2F4I A;  3HOT A;  3D5S C;  1VZ0 A;  2X1E A;  4L5J A;  4LB6 B;  4HDU A;  1TZL A;  4LLL A;  3RPU D;  2P5V A;  2ZNZ A;  1QRY A;  5L3F A;  1WJE A;  2P4W A;  2IBD A;  5LRS A;  2FEZ A;  4C2T A;  4BQN A;  1P6R A;  1RUO A;  4BAC A;  1G6N A;  1MDM A;  5FB2 A;  4BH9 A;  1NH3 A;  2A5W A;  1TWH J;  2A6H F;  3T8T A;  4U87 A;  2YPR A;  3HOS A;  2IRF G;  4NHJ A;  3KP2 A;  4D1Q A;  4YG2 F; 
#chains in the Genus database with same CATH homology
 2LYC A;  3K4B A;  2Q2E B;  3HG9 A;  2R7V A;  3UNG C;  3DWL E;  4E7H A;  4AVZ A;  5HVQ C;  2DT7 B;  1MMD A;  3M8J A;  4XKW A;  1UG0 A;  2VQC A;  4BEH A;  3IAM 2;  1V5G A;  2CW7 A;  4B48 A;  2X6W A;  2KL4 A;  3HUG B;  1Y56 A;  3H9G A;  2IS2 A;  2CV2 A;  1DGW Y;  3H5A A;  4PFP A;  4ZTJ A;  5HNH A;  4P1W A;  4BDY A;  4PUS A;  2R7X A;  3BLY A;  4XL9 A;  3OYC A;  4ZC3 A;  2VXD A;  3BC8 A;  4XM3 A;  2Y0S A;  4KIT B;  3ZRG A;  2ZXH A;  4QPQ A;  2IGK A;  2K3P A;  3K6G A;  4RLF A;  3FKJ A;  3FHN A;  2UV1 A;  4NC7 A;  4PSW A;  3A4C A;  2E1M B;  3AFH A;  2X51 A;  2CV1 A;  2WBM A;  1U0J A;  3LSI A;  2CUJ A;  3OL4 A;  4XOP A;  4NQW B;  5KNL A;  1OR7 C;  2M4K A;  2VJJ A;  4DJA A;  3DEE A;  4XN3 A;  2IGO A;  4BUP A;  3J7A Y;  2KP6 A;  3G2B A;  2CS3 A;  3EUA A;  4OWR B;  3GBG A;  3A1Y A;  3N05 A;  4HG2 A;  3AKZ A;  2RRE A;  3SZG A;  3DU5 A;  3C2G A;  4ZTF A;  2GOM A;  3KX2 A;  4XQF A;  5HOO A;  4J00 A;  2R7O A;  2W00 A;  1PJR A;  4DBR A;  2K9M A;  5LD2 C;  4CA0 A;  3QYE A;  3L2W A;  4RM3 A;  2KHM A;  3KEY A;  1Z7L A;  2CH0 A;  1T0F C;  3D5R C;  4CCO A;  2XC7 A;  1ERD A;  3OYG A;  4OAY A;  3ZXS A;  2VJ4 A;  2VKD A;  4BGD A;  4XKC A;  2CUZ A;  2W1O A;  1BR2 A;  3L2Q A;  3QYB A;  4BE0 A;  3PNV A;  2M4G A;  3EUH C;  3H35 A;  2VQG A;  3SEZ A;  4HRI A;  1D0Y A;  3H5N A;  2LY1 A;  3AL0 C;  2OUM A;  1W36 D;  1QU3 A;  3OYE A;  2HDW A;  3BG6 A;  3OS1 A;  2F6C A;  2L7K A;  4U7B A;  3S3M A;  2WY7 Q;  4HPQ A;  4JQF A;  3TMO A;  4E6K G;  4QPO A;  3CZ6 A;  4D9J A;  4F91 B;  1EA3 A;  3VSL A;  2VQH A;  3K10 A;  4ITV A;  3LMM A;  4DBQ A;  3MKY B;  4XOR A;  4CCJ A;  2LH9 A;  3S32 A;  4B43 A;  2PJR B;  1FMV A;  3OYK A;  1D1C A;  1IRX A;  4CCN A;  1LDK B;  3DPL C;  3ZQQ A;  4YEL A;  4N4N B;  3QOE A;  4Y33 A;  2VJ5 A;  3LSM A;  2ELJ A;  1HA8 A;  5CQG A;  3RQ4 A;  3F9K A;  2HVQ A;  5LFA A;  1S9H A;  5HLT A;  3K70 C;  3DKY A;  4DIQ A;  4IZZ A;  2V1N A;  2VIX A;  2VB6 A;  3K4J A;  4ZDL A;  2E1M C;  1D0X A;  1X4O A;  3KYL A;  2HVR A;  2M0M A;  3M1C A;  1WJA A;  4XLC A;  2FUG 2;  4XLF A;  4B47 A;  4BQO A;  1X1A A;  1W36 C;  4XKV A;  3VSK A;  2E5Z A;  4ZDP A;  1Z3Y A;  2WA0 A;  2ZSH B;  4BEH B;  2R4G A;  3CJQ B;  2XF6 A;  2M7B A;  2O5R A;  2KZV A;  4IQ4 A;  4ANJ A;  2RNG A;  4GRI A;  4F52 A;  2R7U A;  1D1A A;  4Y3O A;  2JSP A;  3QOD A;  3OR2 C;  2A6T A;  4YEJ A;  3AL0 B;  3HPH A;  4BJ5 C;  1Z3X A;  1JI8 A;  3UR3 C;  4F92 B;  1G8X A;  3PL8 A;  3CES A;  4BDZ A;  2KRC A;  3D5L A;  1X4P A;  3CMM A;  4MLO A;  1X1B A;  3ZGK A;  4XMY A;  3CF2 A;  2VXZ A;  4IQJ A;  3VYS B;  4KJZ A;  4BXF A;  2ZXI A;  2XSJ C;  1YX3 A;  3HKZ A;  1MMA A;  1Y6I A;  1X1C A;  3I3L A;  1UAA A;  2X85 A;  3H9Q A;  4CSW A;  3OYM A;  3I9V 2;  4RM2 A;  4HNT A;  4XON A;  2HPI A;  2JA2 A;  3OOU A;  4HST A;  2KDO A;  3OMY A;  2CW8 A;  4KIS A;  4G6T B;  3OS0 A;  4OAZ A;  2VAS A;  3H5R A;  1SFK A;  1WJB A;  3W3C A;  2KMU A;  1DP3 A;  2VL8 A;  1WJC A;  4F55 A;  2WAD A;  2Z2S B;  1LVK A;  2BOL A;  1MND A;  4PFO A;  3PNT A;  4HSR A;  1BR1 A;  1J09 A;  1N77 A;  2LRE A;  1QHG A;  1MW7 A;  3PJR A;  4F3Q A;  1X19 A;  1WJF A;  2LBF A;  4CH7 A;  2I8D A;  2VKH A;  3DTE A;  3NWS A;  3ZR8 X;  4E7I A;  3CP2 A;  4HEA 2;  2LRD A;  4BE2 A;  3OR1 C;  1BR4 A;  2M7A A;  4PK4 A;  1LFP A;  3OIP A;  4JOM A;  3BCB A;  2V4J C;  4BJT A;  2QKL B;  4BL0 B;  3LSH A;  2Z16 A;  2DOA A;  4NC8 A;  2L5Q A;  4C9Y A;  3BG7 A;  3OIQ A;  2QKM B;  4XLE A;  3FDY A;  2PMZ A;  3MKW B;  3OY9 A;  2L9S A;  1V5E A;  5FRN A;  4P5O A;  3K4K A;  3MMY B;  2JUG A;  4R79 A;  2LG4 A;  2WB1 A;  2BW3 B;  2HNH A;  3DTI A;  1D0Z A;  2JVH A;  5CPR B;  4CCM A;  3OYL A;  4FAS D;  2LOO A;  5TGT A;  3OYD A;  2E5N A;  2RQQ A;  3LFU A;  4PJN A;  3W2A A;  2LC2 A;  2CMP A;  2GOX B;  3PFY A;  3LSK A;  2MYS A;  4XKB A;  1D1B A;  2OC6 A;  2W7N A;  3PSI A;  4F93 B;  3DPU A;  4X0G A;  4DGW B;  3MKZ A;  2MAB A;  1Z21 A;  4ZJZ A;  5HNF A;  3DU6 A;  1DGR M;  1N78 A;  3IAS 2;  2F5V A;  4PSX A;  3E1S A;  3DKX A;  3PNY A;  1AA7 A;  5FRM A;  1T95 A;  2X6Y A;  3DQV C;  5JHF A;  5CQE A;  2MD0 A;  2X6X A;  1MMN A;  4E7Z A;  2IGN A;  2IGM A;  1GLN A;  3S3O A;  3HPG A;  1WFX A;  1DQU A;  1PYV A;  2K5C A;  2V26 A;  1WJ5 A;  2DT6 A;  4N4O B;  3QYF A;  1TT0 A;  2AQE A;  3L2R A;  3IUO A;  4C2U A;  3OYA A;  1V5F A;  3S8P A;  3DTK A;  3BCA A;  4E7L A;  2ZFU A;  4E7K A;  2X1C A;  2XF7 A;  2KPM A;  4NNJ A;  3W2W A;  3EUK L;  4XLH A;  2IS6 A;  4BS9 A;  3PSF A;  4LG3 A;  3L2U A;  4DOZ A;  1X1D A;  1QHH D;  3OYJ A;  2K9L A;  4CZC A;  2KLO A;  3OYI A;  1MNE A;  2OV7 A;  2DCE A;  3VYR B;  3OL3 A;  1OLT A;  3IP4 B;  4AU7 A;  2DXI A;  1NG6 A;  4XN0 A;  2MFZ A;  3SDB A;  3S93 A;  1ZEL A;  2L2O A;  4PJJ A;  2VJI A;  2V6E A;  2AQF A;  2WAF A;  3LSG A;  2IS4 A;  4IX7 A;  1BOB A;  3OYF A;  2VPL A;  1MMG A;  2HPM A;  2HZD A;  2R7W A;  2NOJ B;  3SYT A;  3EPZ A;  3OS2 A;  3K4N A;  4LIU A;  3RSN A;  3E0J B;  4RLQ A;  2DJI A;  3S3N A;  1P9Q C;  4CCK A;  3VYT B;  4XLA A;  2E60 A;  4PJL A;  3ONQ A;  1E0E A;  2XF5 A;  4RMN A;  3H0D A;  4XR6 A;  2P0W A;  5FRO A;  4PJM A;  2R7S A;  2BW3 A;  3OYH A;  2JVG A;  1WJD A;  2X1D A;  3PUB A;  4B3X A;  3W2V A;  2Z1D A;  3K4L A;  2VLA A;  2XDV A;  1YX5 A;  3FBI B;  4B44 A;  4AYB A;  2WAE A;  3CJR B;  2VQL A;  3V42 A;  2KRH A;  4BJ6 C;  2UWM A;  3RCO A;  2R7Q A;  3SEQ A;  3OYN A;  3VYU B;  5KHD A;  2Q1Z B;  2M3A A;  2KQR A;  1N75 A;  2LY2 A;  2W82 A;  1SAU A;  4BQQ A;  1R6R A;  4IKF A;  3DLA A;  2ZSI B;  4E7S A;  1G59 A;  1YE9 A;  4CUG A;  4E7J A;  1NG7 A;  3K4M A;  5KCM A;  2LBF B;  2BVM A;  2XAU A;  2HU9 A;  2V9K A;  4H4K C;  3H9J A;  3RTR A;  4LIT A;  4II3 A;  3U21 A;  4XOT A;  2CFO A;  3OYB A;  1KON A;  4CCL A;  3A2K A;  2MC4 A;  2IXS A;  2V7F A;  3TL4 X;  4YRV A;  4J01 A;  3HC7 A;  3TBI A;  1FMW A;  2R7R A;  1K6Y A;  4NUB A;  4BU2 A;  2HVS A;  2CV0 A;  3DPT A;  4E4H A;  2R7T A;  3K70 D;  4ZYA A;  2HQA A;  2UUZ A;  3HXL A;  3HL2 A;  2PJR A;  4BE1 A;  3L2V A;  3CP8 A;  3HOT A;  2F4I A;  3D5S C;  3LL7 A;  1VZ0 A;  3K4C A;  3C2H A;  2X1E A;  2L9N A;  3VDX A;  1TZL A;  4FET A;  4HNU A;  3MD2 A;  1LKX A;  3RPU D;  4KT6 A;  3VWB A;  5CKT A;  1WJE A;  2BVL A;  4C30 A;  1UEL B;  2WY8 Q;  4C2T A;  3OWT A;  4ZDO A;  4BQN A;  2W4S A;  4BAC A;  2WAQ A;  2IS1 A;  4EAT A;  4II2 A;  4Y4R A;  3FBN B;  2A5W A;  3ZCO A;  4XNF A;  3NWT A;  4LIV A;  4U87 A;  3HOS A;  4D1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...