2RQQA

Structure of c-terminal region of cdt1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
b'GPLGSMTRCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVDLAGLTARLAHHVHAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA replication factor Cdt1
publication title Structure and mutagenesis studies of the C-terminal region of licensing factor Cdt1 enable the identification of key residues for binding to replicative helicase Mcm proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1420 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rqqA01
2KLOA 3A4CA 2RQQA
chains in the Genus database with same CATH superfamily
5J47A 1EA3A 1RPWA 3OYCA 1WSUA 4GGGA 3SYTA 1W36C 1K7AA 2R7SA 3NRVA 3GVAA 2P6TA 2LTPA 4IZZA 1FOXA 3S15J 2HU9A 1EH6A 5EG0A 2COMA 2V1NA 4NHJA 2VE9A 5D6FA 2DI3A 3ZQLA 4YIRX 3W2VA 3J7AY 1E3PA 2R7WA 5D8KB 1TT0A 5ILSA 3VEPA 4CYCB 1I1GA 3BWGA 1HCRA 3S17J 1ORKA 2J5PA 1UHMA 4BH9A 3UNGC 3QAHA 1ACIA 4DBQA 4ZYDA 1P7IA 2M87A 1FYMA 3PM1A 3DFGA 1B8IB 2BV6A 4N9HA 1RI7A 1W5TA 3GBGA 1XGMA 2H8RA 2GXAA 5FD5A 3PJRA 5DCFA 4I76A 3S2DJ 3IL2A 1N78A 1MKMA 2KIMA 2K4BA 4BJTA 1FBUA 2EZIA 2MGQA 1ZTRA 1QRYA 3NEUA 2EFOA 2R7QA 1YO5C 4MHGA 2XAFA 1WH5A 1JGSA 2L7KA 4B3AA 3VODA 3CP2A 3L9FA 2ZO4A 2X6XA 4DNCA 1BI3A 2VJ5A 3A4CA 2LK2A 2NVTJ 5F0HA 3WE2A 3J80Z 2JN6A 1OMIA 2WV1A 1X2NA 3H0GJ 4R1HA 3BTCA 4ITVA 5IP6A 1HSTA 2DYSH 2KIFA 2KZGA 5GAGJ 4C2TA 4D5FA 4OIQF 5FFZA 2IS6A 4IXAA 2L9RA 2FX0A 1B9NA 5LD2C 2YU9J 3E5UA 2VPLA 2MA3A 3DPUA 3LSKA 5L3FA 3P9CA 4G7ZF 3CCMI 2HQ5A 2RN7A 2X1DA 4BS9A 2K7LA 2A6EF 1R4MB 3JR9A 3BQZA 3FM5A 3A0BC 1I3QJ 3QYFA 1T56A 1RKWA 3MZHA 3BPVA 3VDXA 3FX3A 2EZLA 2ZSHB 3O6BB 4HSTA 5FD6A 5J6XA 1JGGA 1AHDP 3H5NA 4RMNA 1RESA 2QQ9A 4B3XA 4EM2A 3OOUA 5LEKA 1B8IA 4EGYA 1GDTA 4Y33A 4CCMA 1DUXC 1XSDA 2CH0A 3FXQA 1AU7A 5EEHA 4BHBA 5H20A 2QQ8A 3DPTA 4BUPA 1RNLA 3TW6A 4ZYEA 3F9KA 1U6GA 4PJ0C 3EUKL 3GTMJ 2NVUB 4UVCA 2M30A 4UUSB 2BHYA 2CQ7A 1EKEA 3SDBA 1IUYA 3CMYA 1BC7C 5HNHA 4RM2A 2QCOA 3CD6I 4P96A 3H0DA 3CTAA 3U9GA 1B59A 4IHWA 5FKLA 4UHTA 4HOBA 3ZGKA 2B7EA 2RREA 2CSOA 3OL4A 3REOA 1NK2P 2DOFA 3OIOA 4N4NB 4XK4A 4E7HA 3ZMSA 1J5YA 3OWTA 2WC2A 2BE5F 4DIQA 5H6QA 2FU4A 2HOAA 1YLFA 2DK5A 2FNPA 3RYPA 1JKRC 3ZN0A 1U3EM 3I56I 2J5OA 2DMPA 2LF8A 3GUDA 3BR0A 3RPQA 4I0BA 4MNUA 3DEWA 2JA7J 1MMSA 3GTOJ 1DU6A 1IXCA 2VI6A 2RV8A 2CW8A 3IP4B 1D1BA 3BG6A 1S29A 2JRMA 1QVTA 3QP5A 3HOXJ 2XDVA 2LR8A 3ECHA 5EF6A 2QSHX 3S14J 1HKTA 1FT9A 1TP4A 2QM3A 2F6CA 2ICWG 2LC2A 2VB6A 2JK3A 3OY9A 2ZCWA 4M6YA 2XIGA 1PVEA 1T08B 3FXMA 1WJEA 1H89C 5J1UA 2KIQA 1VTNC 1IN4A 2ADUA 3A01A 1Z0XA 3B02A 4BY1J 2HS5A 2OU2A 2XPUA 3L2CA 4ZH4F 5CYVA 3T8RA 2DTZA 2WY7Q 5D5XB 4GRIA 3AG2H 2C6YA 2TDXA 2EFWA 5M5YJ 3P9IA 4XR6A 5AIQA 2EBIA 1DPUA 3CCUI 2DT5A 1R1VA 1K79A 4HQMA 4PSXA 4BQNA 1R58A 1G2HA 3ABKH 5JI6A 1W7PB 1KU3A 2O7OA 4Q5SF 2IPQX 3F6VA 1FMWA 4OAYA 4LB6B 2LY2A 2VE8A 1I39A 4M9SA 1Z9CA 5LGTA 2JRTA 3SZGA 1ULYA 2VJ4A 2EV0A 1VQ9I 3FHZA 4BY7J 1LE8B 1LEAA 3IAM2 1BL0A 1MNMC 4WK8F 3D5SC 4U0YA 1TW2A 3IRQA 2OTJI 1J0RA 1W4MA 1IZ1A 2F2EA 2V9VA 5E3NA 1F9NA 1KONA 2VKVA 5LFAA 1MDMB 2YX4A 4G12A 5FKNA 4XBFA 1XX5A 2PMZA 3E6BA 3RZOJ 3GFLA 3GTPJ 2CUZA 3TO7A 4WX9A 5J40A 3HB9A 1MBKA 2PLYA 2KRFA 5LRSA 4XIDA 2DBBA 2V26A 2ZB9A 4E7ZA 2K86A 2W00A 4GCVA 1VQLI 3L2VA 2LSOA 1JUMA 1XG1A 3V8KA 3GZNB 3ESWB 3CCLI 4XLAA 2WAFA 4ZDLA 1XD7A 2L01A 2QSFX 2EFNA 2E34A 3ASNH 1FC3A 1S6LA 1O57A 4UXNA 4L9NA 3I59B 5HOOA 2LOOA 1VQ8I 1LFUP 3KP5A 1OYYA 5HLIA 2E1MC 3OYGA 1AKHA 5LHGA 4EJWA 2WTEA 5EJCA 4HDUA 5EZGA 3Q9SA 2OF7A 5KAFC 1G3SA 4XKBA 5K5RA 1R36A 2LNBA 2YPRA 3ZMDA 2DPUA 2L5QA 3RYRA 1LJ9A 3JW4A 2RC4A 1TC3C 2VQGA 5J8FA 1SD6A 3KP7A 1USSA 2A07F 3ZQFA 2HPMA 3JCUC 2JPCA 3RQIA 2F4OB 2ISYA 2MC4A 4XN3A 1FX7A 2QEXI 5IYDJ 2F4MB 1UFMA 3RCOA 1OQYA 1MDMA 2V1XA 3OR2C 4JX6A 3BCAA 4QWQA 2F5CA 1RETA 5FRMA 2Y69H 2NS8A 1JTXA 2QKLB 4DGWB 5F64A 5F04A 3CCVI 5L3CA 1SVMA 4HX8A 1ZK8A 1F43A 4HZFA 3U21A 4YRVA 2X6WA 1S9HA 4U0VA 5ICFA 2HOSA 3J7AO 2BGCA 1D0XA 2OA4A 2R7RA 2X6OA 4KITB 2ZXWH 4HNUA 5K7HA 2LY1A 4GYIA 1U9NA 3HXLA 2ECCA 3LA7A 2BY2A 4IEJA 3GCMA 4XNFA 2M34A 3B73A 2LKPA 3HKZN 1X3UA 4JQFA 1P4WA 1TT5B 1I6XA 4I6ZA 2XGEA 2WAQN 3VOEA 5J1YA 3LSIA 1D0YA 3SJMA 3CF2A 3WODF 3HC7A 2ME6A 1ZR2A 1K83J 3LFUA 4UUVA 3G2BA 5FFXA 4HLYA 5ICEA 4P9FA 1X1BA 2DJNA 1POGA 2NAZA 2IVMA 4XONA 3GYHX 4UB8C 2HZDA 5KNLA 1ZAOA 5EYRA 4BXUA 1SFUA 4IRHA 2KPMA 1JTYA 3JRCA 2ZSIB 4EM0B 4N0BA 2NNYA 4RLFA 1Z3XA 1FTZA 2EWNA 3EETA 1DU0A 1QHHD 3TL4X 1MMGA 3RZDJ 2MLKA 1IXRC 3ELKA 1TWGJ 1WJCA 1IGNA 3CO7C 3R0AA 2JA5J 1GLNA 2RDPA 1Z77A 5JLWA 2CQKA 5LHHA 2HR3A 1EH8A 1FOYA 3DLAA 1C0WA 2DQRA 1T39A 5EEGA 4BEHB 3ZXSA 1OCTC 3C18A 3OYEA 3CUQA 3E6DA 3S3OA 1MD0A 3HHGA 3CMEI 1FY7A 2E60A 3BDDA 3BT9A 5FLXZ 1IN8A 4P5OA 4C3IJ 4LIUA 3L1PA 1ZR4A 3HJEA 4PCQA 3G71I 3HL2A 2M8EA 1OCCH 1YW8A 4Y52J 3KFWX 3LA3A 4QTRA 4E7LA 2JSCA 2M2EA 3WGIA 1LDKB 3SXYA 2KL4A 4QLCU 1YX5A 1UZCA 2EIJH 2DK8A 2Y0SN 5J1RA 4PDKA 2Q8KA 3CC4I 1FJLA 1TZLA 2JPBA 4KDPA 1FOKA 5CVIA 3TP3A 3W2WA 3HSEA 4O6JA 2X1CA 2KDOA 2OCEA 3CJNA 3L00A 3KZIC 5EDNA 3BG5A 1U5TC 2HNHA 1QZZA 2K27A 2Z3YA 4JX4A 4AYBA 3TMOA 1TW3A 3HSFA 4KUMA 2L7FP 3AL0C 1ITYA 4X6AJ 4M3DA 2PBIA 3VSLA 3OYBA 1YE9A 2M0CA 1TWFJ 3EUAA 3FHNA 3ZMVA 4J01A 2VOPA 2Q1ZB 1SEUA 2PJRB 2WA0A 2Q2EB 1HSJA 3R60A 4HAMA 3M8FA 4IVNA 1ETYA 4PJJA 4NC8A 5HNFA 1XSXA 4EATA 3FKJA 4N4OB 4RLQA 4P9UA 4RB1A 3J7YJ 2V1UA 4Y17A 4CO8A 3GEZA 3KETA 3F8BA 4PZJA 1LEBA 3CCYA 1TQMA 2RAEA 4C3JJ 1TWCJ 2F5VA 2JUCA 2VASA 3A1YA 3K4LA 4A0XA 1JT0A 3TO9A 4BACA 2NNNA 4A3DJ 1UMQA 3QPHA 4W1UA 2JTVA 4KT6A 3M4OJ 2FA5A 3PIPF 1V5EA 2HI3A 2RVCA 4L18B 1QNTA 3NWTA 5FKKA 1Z67A 2X85A 3KIOA 3LSRA 1RIOH 3TBIA 3VWBA 2F48A 3J80K 5DM6F 4IO9F 3LA2A 3CF5F 4G6QA 4C9YA 2R7UA 1SVOA 2EQRA 4PJLA 3DBLB 1YJNI 3IHUA 1YFHA 5K5OA 2EINH 2ESNA 5HLGA 2CJJA 2R7XA 1OCOH 4BDZA 1R4NB 3F8MA 4IJAA 1FYKA 5H2FC 1EV7A 3P9KA 4ENMA 3AFHA 3OMYA 2BEOA 4OIOF 2VIXA 4F52A 3WTZA 2F5DA 1G59A 3S93A 3ERED 2EA2A 4LK1F 1X58A 1RUNA 2O0YA 2RKHA 2MD0A 4ENJA 4L0ZB 4OINF 1F5TA 1F36A 2PJRA 2Q2EA 2EV6A 3WTUC 1BW6A 2HDCA 3S1RJ 2UXXA 3HTUA 1YJ9I 1GXQA 1QZEA 1O3SA 2L9VA 2X9DA 5IOYA 2NXNB 1H8AC 2DOEA 2PN6A 1ETKA 4NQWB 4AWXB 5KHDA 3WHBA 1HW5A 3CUQC 2EV5A 3SZTA 4M9ZA 5DDGA 4HX7A 2M7BA 3GTLJ 3SEZA 4M6XA 2YX7A 3KP4A 2ZNYA 2X4HA 1UB9A 4OOIA 3MN2A 2X51A 4V2FA 1W5SA 3ZP5A 2ZFWA 3M9AA 3W2AA 2DA7A 3FISA 3OYIA 1KU9A 2DJIA 3KEQA 1A35A 2IAIA 2MG4A 4R79A 3CCJI 1LVKA 4GFBA 4E7KA 5EGOB 3HZJA 3I0TA 1Z91A 3CLQA 3GMEA 4UB6C 1OCRH 2XUBA 4Y15A 4GO1A 1VQKI 1TWHJ 3ABUA 3O2PE 4BE2A 3OOPA 2LY9A 1MBJA 2FMLA 2ZFUA 4HDVA 5CKTA 2MLGA 2LD5A 4NBQA 4A3BJ 1V54H 1XCBA 3K9TA 2Z16A 4BAYA 1SAUA 3BCBA 2GQQA 3LSMA 4PK4A 5KAIC 3KP3A 2OJED 3DF8A 2HXOA 1JT6A 2YS9A 1BIBA 2K40A 1S72I 4B44A 3FF5A 2DN0A 3GFMA 5E1ZB 3GF2A 5LRRA 2R5YB 2D5VA 2M5WA 4E7JA 2O8XA 3GWZA 1H9GA 3BOQA 4LG3A 3U2RA 3LAJA 3ZQHA 2PEXA 3S8PA 3EUHC 3GTGJ 2YU3A 1WJBA 4F91B 2F5FA 1XDSA 3OR1C 5D5UB 2E35A 2XAQA 2HYFA 3BTIA 4U7DA 2DQLA 2AXLA 2NS7A 3K2AA 3OYDA 4L5EA 2I5UA 1ZHFA 1GVJA 2X1EA 1AA7A 5F27A 5EGOA 1YQAA 3D0SA 4A6EA 4XQFA 1FBQA 4ZYAA 3CCSI 4ESJA 3EDPA 2W57A 3M8JA 3J7ZI 2OV7A 1IN6A 1JKPC 2V1DA 2JQ7A 3R61A 3RPUA 4I09A 2DMTA 4ZYGA 2Z2SB 4RGUA 4L0YB 2WAEA 2TRTA 5DYMA 3SQNA 1V3FA 2XGXA 4RAFA 2CW0F 3W6KB 2HDWA 3IV5A 2A5WA 3VPRA 4A3CJ 1BA5A 3COAC 4FISA 3FIWA 3KEYA 2KRHA 4RAGA 3CP8A 3TO6A 2PG4A 2R5YA 1U2WA 5BMZA 2CV1A 2VKDA 3K4KA 2DFFA 1P7JA 2K9MA 2KT0A 4IL6C 3HG9A 2DDAA 2GA2A 3ZN1A 2RQPA 4U88A 3V7CA 3FBNB 2MW8A 1ENHA 2P5LC 1JJ6C 2CFOA 1CF7A 1WVRA 1KU2A 3ZQIA 1FTTA 1I1SA 3WGHA 3T1BA 3IKTA 3FWEA 2H1LA 5JR3A 2RQQA 5BPDA 4A93J 2LF7A 2FMYA 2E1MB 1D8KA 1MMNA 2L7MP 5D5WB 1G6NA 1ZG1A 2P7CB 2QSGX 1ON1A 3AG1H 2MD5A 4WXCA 4HBLA 3WTWC 2MSYA 2KQRA 4E70A 3KZZA 2PX9A 1UG2A 1K4TA 3PSIA 3ZMZA 5CPRB 2KP6A 4LITA 4AVPA 3NAUA 4LLGF 1Y8RB 3HOWJ 1PUFA 5IPAA 4RA2A 3TKYA 5CVVA 2VONA 2L02A 3TOBA 1VZ0A 1ZYRF 2M4GA 2UXNA 1HKSA 2EA4A 4EJTA 4S04A 2IGOA 3TOAA 4AC0A 3CC2I 2PMHA 3V7RA 3VYTB 4BGDA 2NOJB 1FIPA 1FPQA 4C2MJ 4XN0A 5DS9A 4I7HA 4MTDA 2V6EA 5FKMA 4YFNF 4A3EJ 1XTAA 2Y31A 3K0LA 4H4KC 2MH2A 4LOCA 3VYUB 1JXSA 4LLNA 1YIJI 3DKWA 5C4XJ 1BBYA 5ERIA 2JVGA 4BE1A 4HG2A 4HRIA 2E7WA 4FE7A 3A01B 3DBHB 2XGCA 1OYIA 4I0AA 4HF2A 3I4PA 3OYFA 2ZXHA 3ZRGA 4A3GJ 1Z21A 5D8LB 3K69A 2EH3A 2B9SA 4MGRA 2IS2A 3KX2A 2VQHA 4UV8A 2WB1N 3PUBA 1BR2A 2D1HA 1BN5A 4CGZA 3HM5A 1OCZH 5ICGA 4CH7A 5HDKA 2R7DA 4KMUX 2WWYA 5HDNA 3OYAA 1XSVA 2O6GE 5BNGA 1WI3A 3LL7A 5FROA 3G1OA 1BC8C 1TWAJ 3OS0A 2VXDA 5HLTA 1QHGA 1QVUA 4DZPA 4Y4RA 5ILUA 3FXLA 1G3TA 2Q0OA 3CCEI 4Y3OA 4KISA 3H5AA 2V9KA 3CUOA 3TDZC 2IT0A 1P4AA 3WU2C 4NC6A 1B1BA 1FP2A 4G8XA 1YS6A 2ID6A 3E0JB 3ZMTA 5IP9J 2ZMEC 2R92J 3GLXA 3GZ5A 2QKMB 3KP2A 4M71A 1O3QA 2L0KA 3NARA 3I4NJ 4ON0A 3ZPLA 1F4KA 5DV5A 4MLOA 4QIWN 4O3MA 2PQ8A 3JTHA 2AXTC 3A0HC 2QBYB 1D5VA 1S5LC 2L2OA 2ZJPF 3QOEA 2FJ1A 3CMMA 5DUKA 3ZOBA 1Y56A 4OU0A 2LKXA 1O7FA 3VB2A 3G4SI 3PQJA 5HODA 1W7PD 1XDUA 1BJAA 3TDUC 3OYKA 2OD5A 2CV2A 3TP0A 1XGSA 3DTIA 1JJ8C 3QOPA 3A03A 4ZDOA 1ZLJA 1AKHB 2DA1A 4BJ6C 1U8BA 5FLXK 2FE3A 1QA6A 1IDZA 1IO2A 4BQOA 5HS7A 4B4CA 4N9IA 2GM4A 1LFBA 4EJOA 2MBFA 5FO5A 2XKOA 4XRMA 1P9QC 2M0MA 2OCCH 3OIQA 4XSXF 5TJJA 3ECOA 3ZQQA 1STZA 1H0MA 5B5EC 2IGKA 5D5VB 1ZREA 5D4SA 3JRIA 1XS9A 1R6RA 2BXZA 1XGOA 1T6SA 3Q3SA 2Z5UA 1MJ9A 2KJCA 3TEDA 2E1CA 3H3VK 4EMSA 2LFBA 3DWLE 1Y39A 4J00A 1WJFA 1XGNA 3MD2A 1XMAA 4JP0A 5IYCJ 3LWFA 3S2HJ 5E17F 1Z6RA 2HOEA 1NH3A 1V5FA 1AWCA 5KK1A 1ZG3A 4JX5A 1QZYA 4YELA 3KE2A 2A6HF 1E3HA 3M07A 5E3MA 4XLPF 2PMZN 2QBYA 2CQNA 2JUGA 1D1CA 3N05A 3CESA 5L3GA 5E20A 2O5RA 2XAJA 4JYKA 4E4HA 3W6JB 3ISPA 2Z33A 6PAXA 2HWVA 4MIMA 1T38A 3BPXA 2A05A 2XRLA 2K02A 1LFPA 2EFPA 2E36A 3K10A 1AOYA 3EYIA 1ODDA 4XOPA 1VQPI 5K5QA 4L5JA 3DBRB 4YIIA 5IT9Z 2E1OA 3S1NJ 4HW0A 1MSFC 4YIFA 1ZRDA 4KIFA 4XSZF 5E1XA 3BJ6A 3JSOA 3T0YA 4I2OA 1EF4A 3CO6C 5IOZA 2VBWA 3K4BA 1SANA 3RKQA 1YW7A 2VN2A 2XAUA 1LVAA 4D7NA 1JKQC 1WFXA 5C3EJ 2XV4S 3KCCA 3ERMA 4PUSA 1ETVA 3S3MA 1Z1DA 3GLLA 2EB7A 2BY3A 1N75A 5JLXA 2LYCA 1O3RA 4DW6A 2EILH 2CGPA 4HEA2 4ZTJA 4CUGA 4QSHA 1U5TA 3FXOA 4M73A 3BTJA 1ETOA 1WH7A 3H9QA 4DJAA 4Z2YA 2OQRA 1H9TA 3H92A 3IH2A 2QF7A 4PFPA 5LGUA 5LEJA 2L4AA 4HX4A 1FIAA 2ZKZA 3F22A 1OJLA 4ENKA 1ZQ3P 3RI4A 4BXXJ 4BDYA 3ABMH 3MKZA 2KZVA 3MEXA 1Z05A 5FJ8J 4AVZA 3GZ6A 1R23A 3CUQB 1W1WE 1MBEA 3OYNA 1FMVA 1R5HA 1KU7A 1X1CA 2X0LA 4MFEA 4UUTA 4M3EA 2DU9A 2W24A 4DQ2A 1H88C 2MYSA 1TLHB 1R00A 2KFDA 3QPTA 4GXOA 1PP8F 1MH3A 4OMYA 2XPWA 1GV5A 1QGPA 2FSWA 1CQTA 1GV2A 1GVDA 3V42A 1A6QA 2V79A 4MEYF 1WWXA 2LKSA 3BLYA 1P4XA 1Y0NA 4XLEA 2BY1A 2CUJA 2H6BA 2R7FA 4RB3C 2DTRA 3DU6A 3HKZA 3E5QA 3CDLA 3C3WA 4B1RA 2EIMH 2E2HJ 3JAMZ 2IA1A 4LG0A 2WAQA 2JA8J 3FK6A 2L9SA 1VQ7I 1OR7C 3JRHA 1X2MA 4FE4A 1S8NA 4A0ZA 3G6EI 4IX7A 5D4RA 1MNEA 2F5EA 1JE8A 4RGSA 2UZKA 1K6YA 2GWRA 5F0FA 3S32A 1FSHA 2CV0A 1L0OC 2IGMA 1VQOI 4KNYA 2JSPA 4FX0A 4JBAA 4W97A 3G3ZA 2DT7B 2PFBA 1I3AA 3HOZJ 4BL0B 1FEXA 4II3A 3LMMA 2XAHA 1UCRA 4A3FJ 3L09A 3BY6A 3BG3A 4F55A 5C44J 3L7WA 1UHWA 2H8WA 3PFIA 2K9SA 1NG7A 2VQLA 3C2BA 3FXUA 1X4OA 3PUFA 4D1QA 1DP7P 3PO2J 1TQPA 1OPCA 1V5GA 2D2WA 4A5NA 2I8DA 2KJBA 2P8TA 3M3YJ 4XRSG 3IAS2 2HTSA 2ME0A 3RDIA 2DMNA 2CO5A 2VUMJ 2BY0A 2VOOA 2DCEA 5EZHA 5GPCA 4CXFA 2DO7A 2VKEA 2IXSA 1SC7A 3ZCOA 4Q47A 2A61A 1KYWA 1WGXA 4XM3A 1MMAA 2XSJC 1YI2I 1D5YA 2VQCA 2LBFB 4X0GA 1VFCA 4B8XA 2VL8A 4ESFA 2G7HA 2W7NA 1IRFA 4OMZA 2XPVA 3JRDA 2BBYA 2HKOA 9ANTA 5CVUA 4CCNA 5FLMJ 4HYEA 3DKYA 3EQLF 1J9IA 3DEEA 3BR2A 3BROA 4BBSJ 2LH9A 1J09A 1BOBA 3F3XA 5FB2A 1B72A 2CQXA 1QU3A 2Y0SA 4AYBN 3FMRA 5E8IA 3K4CA 1RRJA 1HLVA 1D0ZA 1IF1A 1DGWY 3K4JA 1IRZA 3V8LA 1D1AA 5GP9A 3PFYA 3M1CA 2XASA 1JUSA 3CJRB 1LNWA 4CA0A 4D5CA 3EUHA 2HPIA 3IKVA 2HGCA 2NYXA 1GUUA 1IV6A 3X2QH 3H9JA 2AO9A 4HV6A 4LB5A 4RB0A 3N4MA 2HTJA 2DFEA 2DAOA 4AIKA 4LLLA 1NHAA 3DQVC 2R0QC 2ESHA 3HHHA 1YS7A 4M74A 3RKXA 1OYWA 5DEQA 5IY5H 2A5YB 3K1MA 1KA8A 2P0WA 2Y30A 2JT1A 1IAWA 3RQ4A 2XC7A 2DW4A 4MFDA 5GPAA 2LBFA 4A69C 2M4KA 3OSGA 1QBJA 2MFZA 2P81A 4GYGA 1DGRM 2W4SA 1VNDA 4NNJA 1YRNA 3R4KA 4CHUA 3BR3A 1PUEE 3OSFA 1X3WB 4C3HJ 3K70D 2GXBA 2DFIA 3R0JA 1B9MA 4EVIA 3BC8A 1FSEA 1YOVB 3V8JA 3W6VA 4UV9A 2Z9OA 4F3QA 4CICA 1K78B 1T0FA 4YEJA 2W85A 4B43A 4AM3A 4EJVA 2HFHA 3RKYA 3SZPA 1J7KA 1QQIA 1IJWC 2E5NA 1ETQA 2FRHA 4ZJZA 2Z99A 1XB4A 2BHZA 3MKYB 2BW3A 1P2FA 2HVQA 5B3SH 4G6TB 2PI0A 2CMPA 4CZCA 4A3JJ 4RGRA 1B4AA 1MJAA 2YSRA 3BZCA 3S2WA 1ETXA 1S7OA 2OTLI 2O03A 3D1NI 4KYWA 3Q9VA 4MO7A 4DYQA 1I50J 2XHKA 2O61A 4KN4X 1YJWI 2ZJQF 2QWWA 1GHCA 2HZTA 4A5MA 2D1VA 3WTVC 4D9JA 1HW2A 1HOMA 4PJMA 1YITI 4Q4ZF 3S16J 3PSFA 1SVLA 2LVSA 2QQAA 4LMYA 1SFEA 2V7FA 3F0CA 2DA3A 3PNYA 1MGTA 1S7AA 2DOAA 4HA8A 1BIAA 2H27A 2QUFA 4M3BA 1ZG5A 2XGDA 1BR1A 2VJIA 3A02A 3OS2A 3MZYA 4HQEA 2DDBA 3V4GA 5L3BA 4PGGA 3G1LA 4LGWA 3EPZA 1LPQA 1MBFA 2MH9A 2QGUA 4BNCA 5E1WA 2R7ZJ 4FQGA 5DM7F 4OWRB 3ZQCA 3B6AA 2VBXA 4NUBA 1MSEC 3DTEA 4EV0A 1K78A 4A3LJ 1OFCX 4AD9A 3DLLF 4IHYA 1WZ2A 3ASOH 2LRDA 5TGTA 2W82A 4CZZA 3BR6A 3S1MJ 5B1AH 1MNDA 3QYBA 3QPLA 3TQNA 4ZDPA 4B09A 3WU0A 2K9QA 4XRSA 3G1MA 5L3DA 3WG9A 2A3SA 2ZJRF 2OC6A 4BXFA 5E3LA 4HSRA 1CF7B 5DD4A 2A68F 3T8TA 1Z3YA 1RKTA 4EJUA 2K4JA 2ZXIA 4MQVA 2GLOA 2KLOA 2WBMA 1JKOC 2ZNZA 3PQKA 1VQ6I 2GIVA 3ABLH 2STWA 5HS9A 4XKWA 3K4MA 5B66C 2H1KA 1JI8A 3MZ8A 3M7GA 2DA2A 1D3YA 2FBHA 2HYJA 3I53A 2K5CA 5IT3A 5LBQA 1UAAA 4AU7A 3BG7A 1VQ4I 5IYBJ 2HDDA 3JRAA 1SD7A 2E5ZA 1X19A 1PUFB 1Y8QB 1APLC 5JHFA 5AONA 2W25A 3SHFA 1ZLKA 3CLOA 4I02A 1UHSA 5KCMA 3LSJA 4B47A 4KIGA 2COBA 2VT2A 3OL3A 2LREA 2JVHA 5CLSA 2HVRA 2A6TA 3IUOA 4XLCA 5CJ9A 4YFKF 4KICA 2ZMEA 2IRFG 4EM1A 3DKXA 4MTEA 1O4XA 2G0EA 1LUJB 2V4JC 2WV0A 3CDHA 3Q0VA 1T33A 3C2HA 4C30A 3L2RA 1T0FC 2VLAA 4UVBA 2NRAC 3FDYA 3NWSA 3SFIA 5DUIA 3J81K 1FLIA 3PNTA 4UNOA 3I64A 3I58A 2STTA 4IKFA 2FOWA 5F1JA 3BZ6A 3WHCA 2XB5A 3EYYA 1BJZA 3CJTB 2QYOA 1Y1WJ 3ULQB 3HRUA 4A6DA 3QODA 1SD5A 2DA4A 4EQQA 2GIZA 5DCMB 3HOSA 2M45A 3ABTA 2K3PA 2VJJA 1SFOJ 2R5ZA 3K6GA 5JHUA 4LK0F 4S05A 3CDIA 1PJRA 2FF4A 5HDGA 5H6RA 4F92B 1SAXA 4Q48A 3I54A 2FBIA 3F6OA 4Y13A 1S3JA 5DTDA 2DFHA 4A3IJ 5IT9K 3TW7A 5M3MJ 3GO5A 1HF0A 2JA2A 5EEAA 3DXJF 3ONQA 3JREA 1L3LA 4OIPF 1YX3A 3G73A 2V6CA 2FQ4A 4IHTA 1TNSA 3VYRB 3GW2A 1DDNA 3BP8A 2H09A 3HRMA 1USTA 4ZYHA 4BKXA 3DTKA 2K9NA 1FBSA 1HXDA 1K61A 4HNVA 3P7NA 4YFXF 4S0HB 3UKGA 1R1UA 2R7OA 5L3EA 1GXPA 1R49A 2M7AA 4HF1A 2BVLA 1MBHA 2P4WA 3FMSA 3MWMA 1MW7A 1IN5A 3F8CA 3BG9A 3ZMUA 5A2QZ 1E0EA 4WF2A 4KJZA 1JHHA 1LDJA 3AG3H 2IA2A 3K2ZA 4CYCA 1T8IA 2JWTA 1BR4A 2EJRA 2OBPA 2Y9YA 1N77A 2DPDA 1OKRA 4OIRF 1HDPA 1BM9A 4F93B 4NC7A 3GFJA 5DCMA 4FT8A 4H0EA 5DD8A 2VPRA 3ROUA 2ECBA 3GTJJ 2E2JJ 3K70C 2H6CA 3H35A 1SMYF 2AQFA 3BQYA 1I6HJ 2EFQA 4M3FA 2QA4I 2IA0A 4WCGA 2DMQA 4G7OF 4ZC3A 4IOAF 5TRDA 1KGSA 1BW5A 4I01A 3U1DA 5J3LA 4E7IA 3DEUA 3HRSA 1ZKGA 4AIJA 4IRIA 4ASNA 2ZJ2A 2UWMA 1B6AA 2CS3A 3Q0UA 3Q5FA 3F8FA 3DCFA 2FUG2 4DOZA 2W48A 2WB1A 2ZBKA 1PP7U 3BTLA 2FEZA 2JMWA 3QQAA 2KIUA 2JZYA 2GZWA 4XMYA 3H3UA 5TISC 3LNQA 2KHMA 2VKHA 3FM3A 4LJZF 3KP6A 4FETA 3PL8A 3BR1A 3HPHA 3JAMK 4R8HA 3E7LA 1ONVA 3ZR8X 1Y6IA 2VC1A 3UR3C 3HSRA 4Z6YA 4QPOA 3LOCA 2NOGA 2E7XA 1RC9A 1SFXA 2IEKA 3IRRA 4OAZA 2Y75A 4DYRA 4V19K 2E71A 1Z7LA 5AIPA 4TV7A 1W0TA 2GAUA 1HC8A 2VBYA 1VI0A 4EGZA 1MMDA 5LLQA 4BE0A 2HOTA 1XCVA 4E7SA 3BJOA 2VXZA 1R5GA 1VQ5I 2TCTA 5K7ZA 5F1RA 3IC7A 2RNJA 3AAFA 2XF5A 4B48A 2D45A 2G7UA 2IJLA 3HOVJ 2LDUA 3QYEA 3KYDB 5FLVA 3S3NA 4M72A 1HA8A 4UUSA 1U8RA 2BOLA 2IW5A 1IN7A 1WHUA 3PIOF 3F8NA 2ID3A 3IWZA 3Q0WA 3ZQGA 2UV1A 2W1OA 3I71A 3I3LA 1YHQI 3JRFA 2CWEA 2NS0A 5GADJ 1WQ2A 4JK1X 1J2XA 2O8KA 3S1QJ 1I5ZA 4HV5A 1G3YA 3O3KA 2R7TA 1Z6TA 1ZN2A 3LAPA 2Y0MA 3HTSB 4XKCA 1OR7A 1U5TB 3D5RC 1KZHA 3OYJA 1K6OA 3J81Z 1FZPB 3FZVA 1T95A 4CSWA 2E19A 3AL0B 3WU1B 4XLFA 3VSKA 3O8GA 1K4SA 1J59A 4MEXF 2IP2A 1MJBA 1DQUA 3NQOA 3LSHA 2QLZA 5M5XJ 4UVAA 2R3SA 3H5RA 3FMQA 1UG0A 4FTHA 4KA4A 2HYGD 2KRCA 2QQBA 4PSWA 3AKZA 2UUZA 3HUGB 2W84A 3LSPA 2HQRA 1ETWA 2GOMA 3HPGA 2H94A 4KFCA 1E3OC 4XORA 5F6FA 3SDGA 2ELKA 4U7BA 1DP3A 1GT0C 2B63J 3K1NA 3RJPA 3KZYA 2JA6J 1LKXA 3E97A 3K1PA 4L5IA 2P6SA 3HOTA 2HQAA 1FOWA 2FBKA 2Y48A 5CVJA 1HKQA 2FOKA 2R7VA 1UELB 1NG6A 1PYVA 4HNTA 2EPFA 1WJAA 2L9NA 3FK7A 4FX4A 1Z7UA 3D5LA 1X1PA 4BQAA 2XKPA 1A31A 2YUSA 1ZGAA 4EEFG 1IRXA 2JJ7A 4CYDA 1A5JA 2F4IA 3M1EA 4LG0B 4XOTA 2IBDA 3ZQ7A 1RR7A 1W7PA 3W3CA 3DPLC 5C4JJ 3LSTA 1HBXG 4UY8I 1BI0A 1VQMI 4G6DA 2EIKH 5E18F 5F08A 1ZARA 5F0CA 3LQRA 1XPXA 1SFKA 1IRGA 2HQNA 3IH3A 4V2GA 4G7HF 1ZGWA 4RB2C 1ZRCA 5BS6A 2E2IJ 2KKOA 3HUGA 2RGVA 3WG7H 3E3VA 1LE8A 3F72A 2L4MA 1D8JA 1M1EB 3HYIA 4PGHA 1FP1D 3KLNA 4IHVA 3IH4A 5GAEJ 1MH4A 2M1BA 4KIBA 4CCJA 2ACJA 2MC3A 2XVCA 1TTYA 3FBIB 1IV8A 4DBRA 3JRGA 5J4YA 3I4MJ 3WTXC 1T2KA 3GFIA 1R5ID 3GXOA 1YW9A 2M3AA 3MVPA 2KDZA 2FD5A 1BI1A 3BR5A 1MBGA 3QU6A 2CG4A 2K3FA 1UJ8A 2WADA 1WJDA 3HOUJ 1LDDA 2EK5A 2ETHA 3OV8A 2BVMA 5LGNA 3OS1A 1JHFA 3MKLA 3MKWB 3I59A 5FRNA 1G8XA 3MAJA 3L2UA 5BQTA 3V7SA 4ANJA 4ETSA 2IS1A 1XMKA 2O3FA 1KQ0A 4HPQA 1X3ZB 4E6KG 1HW1A 3VYSB 1YYVA 3LSGA 3MMYB 2ISZA 1IDYA 3PO3J 1B72B 2DODA 3HOYJ 5GTIC 4MQ9F 2DYRH 2KISA 1G3WA 3E5XA 2N8GA 3KPHA 1R22A 3OYMA 1IC8A 5D6EA 2ELJA 2XF7A 2L3DA 2IGNA 2KMUA 3KYLA 3R6SA 1TNTA 2WY8Q 4L9TA 1WCMJ 5JVTA 1XN7A 1W36D 5KVRA 4IF4A 1W0UA 2K85A 1U9OA 1ZRFA 3H3ZA 1QPMA 4FASD 2PJPA 3K4NA 2DT6A 4JOMA 3SEQA 3CJQB 2AHQA 3O8HA 4ESBA 2DMUA 3ML6A 1F1ZA 3CQZJ 2VT3A 2LG4A 4I99C 4IPAA 1EH7A 4P1WA 5ED4A 2R93J 4IHSA 1WRJA 2XSDC 3C2GA 3WTTC 1LQ1A 4LFUA 5HLHA 3H9GA 1G4DA 4BHPA 4CCKA 1KQ8A 2XB0X 2AQEA 4KT5C 4RAYA 5GAHJ 1KYZA 4M6VA 2CYYA 1IW7F 1WKMA 3HGYA 1E2XA 2FXAA 3B6CA 1XC5A 1YRNB 4F7ZA 3HBLA 2OZ6A 1MZBA 1VQNI 2O9LA 1WJ5A 2E1NA 3KEOA 4WWCA 4M9XA 4LIVA 4G94A 1BOAA 4KN7X 4RGXA 5JFRA 2OQGA 1QO0D 4A2UA 4XRFA 1A04A 2G9WA 2BXYA 3T5XA 4XLHA 3LQQA 1E17A 2CUFA 1P6RA 2VBZA 1YIOA 3QP6A 1DPRA 3KLOA 1P92A 4O5VA 4HF0A 1R7JA 1FNNA 2ZC2A 4IQ4A 1JUPA 5LHIA 3TGNA 3RTRA 4LD5A 1TBXA 2HVSA 1YG2A 3FXRA 5FKOA 1Y1VJ 2BW3B 3P5JA 4PJNA 4BYYA 3F23A 4GDFA 3C7JA 4ZZDA 3CCRI 2GXGA 5BOXA 1A6IA 2P5KA 2Y2ZA 3HIFA 2HKXA 3E6MA 2XROA 2OAZA 1RUOA 4KMFA 5ICCA 4P55A 3CCQI 1V55H 4G9YA 3CZ6A 4Y7NJ 3L2QA 2NVYJ 1O7LA 2DA5A 1IG7A 1R71A 2BYVE 3QU3A 4AIDA 5HS8A 1T98A 1X1AA 4AIHA 5ILVA 2GA1A 4A12A 2YR2A 4BEHA 4RS8A 3OYHA 4WXDA 4ENNA 4PFOA 4IQJA 1V4RA 3FKIJ 2QVOA 3PNVA 1RR8C 5B1BH 5IP7J 4J19A 4CDGA 5CQGA 2LMDA 2PMUA 5J8CA 1ERDA 3CC7I 2VODA 4BJ5C 4DYCA 2DLLA 4II2A 2ELHA 3DP7A 4HLXA 3AG4H 4K2EA 3E6CC 2A69F 1A36A 3M8EA 4RAZA 3GTKJ 1XMXA 1O3TA 2LLKA 1OLTA 3GX4X 1HQCA 1R9TJ 5CVRA 4BU2A 2DA6A 3BZKA 2M9HA 1Y0UA 1R1TA 2GBYA 1IUFA 3HEFA 2XAGA 2M8GX 4AUXA 5E8GA 4C2UA 2X48A 3JTGA 2OUMA 4FCYA 2HXIA 4RDUA 2FNAA 2EZKA 2I10A 4M3GA 1IXSB 2LP0A 3HGGA 3DV8A 4CCLA 1EJ9A 3H1CA 5HVQC 4IOCF 4YG2F 2QZ8A 2V9PA 3E1SA 2P5VA 1WI9A 5A2QK 2CQQA 3FXKA 4IRGA 2X6YA 4NB5A 4D0PA 1KQ9A 2CW7A 4BHCA 5CQEA 4IHXA 3H36A 3K7AJ 2CU7A 2RNGA 4ABZA 1SD4A 3BJAA 3N97A 1REPC 3FXJA 5GTHC 4XICA 1Q1VA 3RPUD 4RM3A 4A0YA 3JRBA 2K9LA 3LFKA 2L54A 2ZXJA 1ON2A 1Q1HA 1FWZA 1RZ4A 3DU5A 4XL9A 4BQQA 4XLNF 1TL8A 3HRTA 5JVGF 2Z1DA 5FGMA 2VC0A 1TQIA 2NVQJ 2L7ZA 3I9V2 3L2WA 3HDDA 1FYLA 3RIRA 3QRFF 2AS5F 4D7MA 1WPKA 3MFKA 2CRGA 2GOXB 5K7FA 1OCPA 4WXHA 4ZTFA 1QPIA 1S7EA 4A3MJ 4BBRJ 4I98B 2HEOA 4X1EA 5M3FJ 2Y9ZA 5M5WJ 2ZMEB 2CUEA 2MABA 3I55I 3MQ0A 5EG0B 1ZELA 3JSPA 3F21A 2NVXJ 4U0WA 3C1DA 3WE3A 2CFXA 1ZH5A 3VFZA 1X1DA 4XKVA 1OISA 2XRNA 4NDLA 3WTYC 5J4VA 4QPQA 1HDDC 5E79C 2XF6A 1NTCA 1J75A 2R4GA 5E3OA 4U87A 3OIPA 3GTQJ 3OYLA 1X4PA 5K1YA 2B0LA 1U0JA 1SMTA 3QPSA 4A3KJ 2DXIA 3RSNA 1BI2A 2QENA 1MIJA 2OZUA 1NK3P 2BZTA 3I5UA 4DZJA 3RKWA 1I27A 3KYCB 3SFZA 2P7VB 2R5ZB 2IS4A 1VF9A 5BPIA 4RBOA 1N25A 1YTYA 1CGPA 3A2KA 1ZGJA 1W5CC 4FHTA 1U78A 1LB2A 4L9VA 3CMAI 3IWFA 4NQWA 3QWLA 3U1KA 2FQ3A 3WGGA 4L9JA 2EZHA 3WTSC 2OPTA 4CCOA 1PDNC 3MCZA 4ZZLA
chains in the Genus database with same CATH topology
4PJJA 4NC8A 4XMYA 5HNFA 4EATA 3FKJA 1EA3A 4N4OB 4RLQA 2KHMA 2VKHA 3OYCA 4FETA 3PL8A 4BDYA 3HPHA 3SYTA 1W36C 3MKZA 2KZVA 2F5VA 1Y6IA 2VASA 3A1YA 3ZR8X 2R7SA 3K4LA 4AVZA 3UR3C 4IZZA 4BACA 4QPOA 2HU9A 3OYNA 1FMVA 1X1CA 2V1NA 4KT6A 1V5EA 4OAZA 2MYSA 3NWTA 3W2VA 2X85A 1Z7LA 3TBIA 3J7AY 3VWBA 2R7WA 1MMDA 4BE0A 4E7SA 2VXZA 1TT0A 3V42A 4C9YA 2R7UA 4PJLA 2XF5A 3BLYA 2R7XA 4B48A 4BDZA 3UNGC 4XLEA 4DBQA 3QYEA 3AFHA 2CUJA 3S3NA 3OMYA 1HA8A 3DU6A 2VIXA 3HKZA 4F52A 2BOLA 3GBGA 1G59A 3PJRA 3S93A 2UV1A 2WAQA 2W1OA 1N78A 2MD0A 2L9SA 3I3LA 1OR7C 4BJTA 2PJRA 2R7TA 2R7QA 4IX7A 1MNEA 4XKCA 2L7KA 3D5RC 3OYJA 1K6YA 3CP2A 3S32A 2X6XA 4NQWB 5KHDA 2VJ5A 2CV0A 3A4CA 2IGMA 1T95A 2JSPA 4CSWA 2M7BA 2DT7B 3AL0B 3SEZA 4XLFA 3VSKA 4ITVA 4C2TA 2X51A 4BL0B 1DQUA 3LSHA 4II3A 2IS6A 3LMMA 3H5RA 1UG0A 5LD2C 2KRCA 4PSWA 4F55A 3AKZA 2UUZA 3W2AA 3DPUA 3LSKA 2VPLA 3HUGB 3OYIA 2DJIA 1NG7A 2VQLA 4R79A 1X4OA 2X1DA 1LVKA 4BS9A 4D1QA 2GOMA 3HPGA 1V5GA 2I8DA 4XORA 4E7KA 3IAS2 4U7BA 1DP3A 1LKXA 3QYFA 2DCEA 4BE2A 3HOTA 2HQAA 3VDXA 2ZSHB 2IXSA 4HSTA 2ZFUA 3ZCOA 3H5NA 5CKTA 4XM3A 1MMAA 2XSJC 4RMNA 4B3XA 3OOUA 2Z16A 2VQCA 2LBFB 2R7VA 4X0GA 4Y33A 1SAUA 1NG6A 1PYVA 1UELB 2VL8A 3BCBA 2CH0A 1WJAA 2L9NA 3LSMA 4PK4A 4HNTA 2W7NA 3D5LA 3DPTA 4BUPA 4CCNA 3F9KA 3EUKL 3DKYA 4B44A 3DEEA 2LH9A 1J09A 1IRXA 1BOBA 3SDBA 2F4IA 1QU3A 2Y0SA 5HNHA 4RM2A 4E7JA 4XOTA 3W3CA 3DPLC 4LG3A 3H0DA 3K4CA 3S8PA 1D0ZA 3EUHC 3ZGKA 2RREA 3OL4A 4F91B 1WJBA 1DGWY 3K4JA 3OR1C 4N4NB 4E7HA 1D1AA 3OWTA 3PFYA 1SFKA 3M1CA 4DIQA 3CJRB 4CA0A 2HPIA 3OYDA 3H9JA 2X1EA 1AA7A 4XQFA 3DQVC 4ZYAA 3M8JA 2OV7A 4CCJA 2CW8A 3FBIB 3IP4B 1D1BA 2P0WA 3BG6A 4DBRA 2Z2SB 3RQ4A 2XDVA 2WAEA 2XC7A 2LBFA 2M4KA 2F6CA 2M3AA 2MFZA 1DGRM 2HDWA 2W4SA 2A5WA 2LC2A 4NNJA 2VB6A 2WADA 3OY9A 1WJDA 3KEYA 2KRHA 2BVMA 3OS1A 3K70D 1WJEA 3MKWB 3CP8A 3BC8A 5FRNA 1G8XA 3L2UA 4ANJA 2CV1A 2IS1A 2VKDA 4F3QA 2WY7Q 3K4KA 4GRIA 4HPQA 2K9MA 3HG9A 4YEJA 4E6KG 3VYSB 3LSGA 3MMYB 4XR6A 4B43A 3FBNB 2CFOA 2E5NA 4PSXA 4BQNA 4ZJZA 3MKYB 2BW3A 3OYMA 2HVQA 2ELJA 2RQQA 2XF7A 2IGNA 2KMUA 4G6TB 1FMWA 4OAYA 3KYLA 2CMPA 1MMNA 2E1MB 4CZCA 2LY2A 2WY8Q 3SZGA 2VJ4A 2KQRA 1W36D 3PSIA 4FASD 5CPRB 2KP6A 4LITA 3K4NA 2DT6A 4JOMA 3SEQA 4CCMA 3IAM2 3CJQB 3D5SC 4D9JA 4PJMA 2LG4A 5LFAA 1KONA 3PSFA 4P1WA 1VZ0A 2V7FA 2M4GA 3C2GA 2PMZA 3PNYA 2DOAA 2IGOA 3H9GA 2CUZA 1BR1A 2VJIA 4CCKA 3VYTB 4BGDA 3OS2A 2NOJB 2AQEA 4XN0A 3EPZA 2V26A 4E7ZA 2V6EA 2W00A 3L2VA 4OWRB 4NUBA 4XLAA 4H4KC 3VYUB 2WAFA 4ZDLA 3DTEA 1WJ5A 2JVGA 4BE1A 4HG2A 4LIVA 4HRIA 5HOOA 2LOOA 2LRDA 3OYGA 2E1MC 5TGTA 2W82A 3OYFA 2ZXHA 4XLHA 3ZRGA 1Z21A 1MNDA 3QYBA 4XKBA 4ZDPA 2IS2A 3KX2A 2VQHA 2L5QA 3PUBA 1BR2A 2OC6A 4IQ4A 4BXFA 4HSRA 2VQGA 3RTRA 2HVSA 1Z3YA 2ZXIA 2BW3B 2KLOA 2WBMA 4PJNA 4CH7A 2HPMA 4XKWA 3OYAA 3K4MA 1JI8A 5FROA 3LL7A 3OS0A 2MC4A 2VXDA 3CZ6A 1QHGA 4XN3A 5HLTA 3L2QA 2K5CA 4Y4RA 3RCOA 1UAAA 4AU7A 3BG7A 3OR2C 4Y3OA 3BCAA 4KISA 3H5AA 1X1AA 2V9KA 5FRMA 2QKLB 4BEHA 2E5ZA 4DGWB 1X19A 3OYHA 5JHFA 3E0JB 4PFOA 5KCMA 4B47A 4IQJA 2QKMB 3U21A 4YRVA 2X6WA 1S9HA 3OL3A 2LREA 2JVHA 2HVRA 2A6TA 1D0XA 2R7RA 3PNVA 3IUOA 4XLCA 4MLOA 4KITB 4HNUA 5CQGA 1ERDA 2LY1A 3DKXA 4BJ5C 2V4JC 3HXLA 4II2A 2L2OA 3C2HA 3QOEA 4C30A 4XNFA 3CMMA 3L2RA 1T0FC 2VLAA 1Y56A 3FDYA 3NWSA 3PNTA 1OLTA 4JQFA 4BU2A 4IKFA 3OYKA 2CV2A 3DTIA 1D0YA 3LSIA 3CF2A 4C2UA 3HC7A 2OUMA 3LFUA 4ZDOA 3G2BA 3QODA 4BJ6C 1X1BA 3HOSA 4CCLA 4XONA 2K3PA 2VJJA 3K6GA 2HZDA 4BQOA 5HVQC 5KNLA 1PJRA 3E1SA 4F92B 2KPMA 2X6YA 1P9QC 2CW7A 2M0MA 3OIQA 2ZSIB 5CQEA 3ZQQA 4RLFA 2IGKA 1Z3XA 2JA2A 1QHHD 2RNGA 3TL4X 1R6RA 3ONQA 1MMGA 1YX3A 3RPUD 4RM3A 1WJCA 3DWLE 2K9LA 4J00A 1WJFA 3VYRB 3MD2A 3DU5A 4XL9A 4BQQA 1GLNA 1V5FA 4YELA 2Z1DA 3DTKA 3DLAA 4BEHB 3ZXSA 3I9V2 3OYEA 3L2WA 2R7OA 2JUGA 3S3OA 1D1CA 3N05A 2M7AA 3CESA 2O5RA 2GOXB 2BVLA 2E60A 4E4HA 4ZTFA 4P5OA 4LIUA 1MW7A 2MABA 1LFPA 3K10A 3HL2A 1E0EA 4KJZA 1ZELA 4XOPA 1BR4A 1N77A 4E7LA 1LDKB 1X1DA 4XKVA 2KL4A 4F93B 1YX5A 4NC7A 4QPQA 2XF6A 2R4GA 1TZLA 3OIPA 4U87A 3K4BA 3OYLA 3K70C 1X4PA 3H35A 2AQFA 2XAUA 3W2WA 1U0JA 1WFXA 2X1CA 2KDOA 2DXIA 3RSNA 4ZC3A 4PUSA 3S3MA 1N75A 2HNHA 2IS4A 2LYCA 4E7IA 4AYBA 4HEA2 3TMOA 3A2KA 2UWMA 4ZTJA 4CUGA 3AL0C 2CS3A 3VSLA 3OYBA 1YE9A 3EUAA 3FHNA 4J01A 3H9QA 4DJAA 2FUG2 4DOZA 2Q1ZB 2PJRB 2WA0A 2Q2EB 2WB1A 4PFPA 4CCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLO A;  3A4C A;  2RQQ A; 
#chains in the Genus database with same CATH topology
 5J47 A;  1EA3 A;  1RPW A;  3OYC A;  1WSU A;  4GGG A;  3SYT A;  1W36 C;  1K7A A;  2R7S A;  3NRV A;  3GVA A;  2P6T A;  2LTP A;  4IZZ A;  1FOX A;  3S15 J;  2HU9 A;  1EH6 A;  5EG0 A;  2COM A;  2V1N A;  4NHJ A;  2VE9 A;  5D6F A;  2DI3 A;  3ZQL A;  4YIR X;  3W2V A;  3J7A Y;  1E3P A;  2R7W A;  5D8K B;  1TT0 A;  5ILS A;  3VEP A;  4CYC B;  1I1G A;  3BWG A;  1HCR A;  3S17 J;  1ORK A;  2J5P A;  1UHM A;  4BH9 A;  3UNG C;  3QAH A;  1ACI A;  4DBQ A;  4ZYD A;  1P7I A;  2M87 A;  1FYM A;  3PM1 A;  3DFG A;  1B8I B;  2BV6 A;  4N9H A;  1RI7 A;  1W5T A;  3GBG A;  1XGM A;  2H8R A;  2GXA A;  5FD5 A;  3PJR A;  5DCF A;  4I76 A;  3S2D J;  3IL2 A;  1N78 A;  1MKM A;  2KIM A;  2K4B A;  4BJT A;  1FBU A;  2EZI A;  2MGQ A;  1ZTR A;  1QRY A;  3NEU A;  2EFO A;  2R7Q A;  1YO5 C;  4MHG A;  2XAF A;  1WH5 A;  1JGS A;  2L7K A;  4B3A A;  3VOD A;  3CP2 A;  3L9F A;  2ZO4 A;  2X6X A;  4DNC A;  1BI3 A;  2VJ5 A;  3A4C A;  2LK2 A;  2NVT J;  5F0H A;  3WE2 A;  3J80 Z;  2JN6 A;  1OMI A;  2WV1 A;  1X2N A;  3H0G J;  4R1H A;  3BTC A;  4ITV A;  5IP6 A;  1HST A;  2DYS H;  2KIF A;  2KZG A;  5GAG J;  4C2T A;  4D5F A;  4OIQ F;  5FFZ A;  2IS6 A;  4IXA A;  2L9R A;  2FX0 A;  1B9N A;  5LD2 C;  2YU9 J;  3E5U A;  2VPL A;  2MA3 A;  3DPU A;  3LSK A;  5L3F A;  3P9C A;  4G7Z F;  3CCM I;  2HQ5 A;  2RN7 A;  2X1D A;  4BS9 A;  2K7L A;  2A6E F;  1R4M B;  3JR9 A;  3BQZ A;  3FM5 A;  3A0B C;  1I3Q J;  3QYF A;  1T56 A;  1RKW A;  3MZH A;  3BPV A;  3VDX A;  3FX3 A;  2EZL A;  2ZSH B;  3O6B B;  4HST A;  5FD6 A;  5J6X A;  1JGG A;  1AHD P;  3H5N A;  4RMN A;  1RES A;  2QQ9 A;  4B3X A;  4EM2 A;  3OOU A;  5LEK A;  1B8I A;  4EGY A;  1GDT A;  4Y33 A;  4CCM A;  1DUX C;  1XSD A;  2CH0 A;  3FXQ A;  1AU7 A;  5EEH A;  4BHB A;  5H20 A;  2QQ8 A;  3DPT A;  4BUP A;  1RNL A;  3TW6 A;  4ZYE A;  3F9K A;  1U6G A;  4PJ0 C;  3EUK L;  3GTM J;  2NVU B;  4UVC A;  2M30 A;  4UUS B;  2BHY A;  2CQ7 A;  1EKE A;  3SDB A;  1IUY A;  3CMY A;  1BC7 C;  5HNH A;  4RM2 A;  2QCO A;  3CD6 I;  4P96 A;  3H0D A;  3CTA A;  3U9G A;  1B59 A;  4IHW A;  5FKL A;  4UHT A;  4HOB A;  3ZGK A;  2B7E A;  2RRE A;  2CSO A;  3OL4 A;  3REO A;  1NK2 P;  2DOF A;  3OIO A;  4N4N B;  4XK4 A;  4E7H A;  3ZMS A;  1J5Y A;  3OWT A;  2WC2 A;  2BE5 F;  4DIQ A;  5H6Q A;  2FU4 A;  2HOA A;  1YLF A;  2DK5 A;  2FNP A;  3RYP A;  1JKR C;  3ZN0 A;  1U3E M;  3I56 I;  2J5O A;  2DMP A;  2LF8 A;  3GUD A;  3BR0 A;  3RPQ A;  4I0B A;  4MNU A;  3DEW A;  2JA7 J;  1MMS A;  3GTO J;  1DU6 A;  1IXC A;  2VI6 A;  2RV8 A;  2CW8 A;  3IP4 B;  1D1B A;  3BG6 A;  1S29 A;  2JRM A;  1QVT A;  3QP5 A;  3HOX J;  2XDV A;  2LR8 A;  3ECH A;  5EF6 A;  2QSH X;  3S14 J;  1HKT A;  1FT9 A;  1TP4 A;  2QM3 A;  2F6C A;  2ICW G;  2LC2 A;  2VB6 A;  2JK3 A;  3OY9 A;  2ZCW A;  4M6Y A;  2XIG A;  1PVE A;  1T08 B;  3FXM A;  1WJE A;  1H89 C;  5J1U A;  2KIQ A;  1VTN C;  1IN4 A;  2ADU A;  3A01 A;  1Z0X A;  3B02 A;  4BY1 J;  2HS5 A;  2OU2 A;  2XPU A;  3L2C A;  4ZH4 F;  5CYV A;  3T8R A;  2DTZ A;  2WY7 Q;  5D5X B;  4GRI A;  3AG2 H;  2C6Y A;  2TDX A;  2EFW A;  5M5Y J;  3P9I A;  4XR6 A;  5AIQ A;  2EBI A;  1DPU A;  3CCU I;  2DT5 A;  1R1V A;  1K79 A;  4HQM A;  4PSX A;  4BQN A;  1R58 A;  1G2H A;  3ABK H;  5JI6 A;  1W7P B;  1KU3 A;  2O7O A;  4Q5S F;  2IPQ X;  3F6V A;  1FMW A;  4OAY A;  4LB6 B;  2LY2 A;  2VE8 A;  1I39 A;  4M9S A;  1Z9C A;  5LGT A;  2JRT A;  3SZG A;  1ULY A;  2VJ4 A;  2EV0 A;  1VQ9 I;  3FHZ A;  4BY7 J;  1LE8 B;  1LEA A;  3IAM 2;  1BL0 A;  1MNM C;  4WK8 F;  3D5S C;  4U0Y A;  1TW2 A;  3IRQ A;  2OTJ I;  1J0R A;  1W4M A;  1IZ1 A;  2F2E A;  2V9V A;  5E3N A;  1F9N A;  1KON A;  2VKV A;  5LFA A;  1MDM B;  2YX4 A;  4G12 A;  5FKN A;  4XBF A;  1XX5 A;  2PMZ A;  3E6B A;  3RZO J;  3GFL A;  3GTP J;  2CUZ A;  3TO7 A;  4WX9 A;  5J40 A;  3HB9 A;  1MBK A;  2PLY A;  2KRF A;  5LRS A;  4XID A;  2DBB A;  2V26 A;  2ZB9 A;  4E7Z A;  2K86 A;  2W00 A;  4GCV A;  1VQL I;  3L2V A;  2LSO A;  1JUM A;  1XG1 A;  3V8K A;  3GZN B;  3ESW B;  3CCL I;  4XLA A;  2WAF A;  4ZDL A;  1XD7 A;  2L01 A;  2QSF X;  2EFN A;  2E34 A;  3ASN H;  1FC3 A;  1S6L A;  1O57 A;  4UXN A;  4L9N A;  3I59 B;  5HOO A;  2LOO A;  1VQ8 I;  1LFU P;  3KP5 A;  1OYY A;  5HLI A;  2E1M C;  3OYG A;  1AKH A;  5LHG A;  4EJW A;  2WTE A;  5EJC A;  4HDU A;  5EZG A;  3Q9S A;  2OF7 A;  5KAF C;  1G3S A;  4XKB A;  5K5R A;  1R36 A;  2LNB A;  2YPR A;  3ZMD A;  2DPU A;  2L5Q A;  3RYR A;  1LJ9 A;  3JW4 A;  2RC4 A;  1TC3 C;  2VQG A;  5J8F A;  1SD6 A;  3KP7 A;  1USS A;  2A07 F;  3ZQF A;  2HPM A;  3JCU C;  2JPC A;  3RQI A;  2F4O B;  2ISY A;  2MC4 A;  4XN3 A;  1FX7 A;  2QEX I;  5IYD J;  2F4M B;  1UFM A;  3RCO A;  1OQY A;  1MDM A;  2V1X A;  3OR2 C;  4JX6 A;  3BCA A;  4QWQ A;  2F5C A;  1RET A;  5FRM A;  2Y69 H;  2NS8 A;  1JTX A;  2QKL B;  4DGW B;  5F64 A;  5F04 A;  3CCV I;  5L3C A;  1SVM A;  4HX8 A;  1ZK8 A;  1F43 A;  4HZF A;  3U21 A;  4YRV A;  2X6W A;  1S9H A;  4U0V A;  5ICF A;  2HOS A;  3J7A O;  2BGC A;  1D0X A;  2OA4 A;  2R7R A;  2X6O A;  4KIT B;  2ZXW H;  4HNU A;  5K7H A;  2LY1 A;  4GYI A;  1U9N A;  3HXL A;  2ECC A;  3LA7 A;  2BY2 A;  4IEJ A;  3GCM A;  4XNF A;  2M34 A;  3B73 A;  2LKP A;  3HKZ N;  1X3U A;  4JQF A;  1P4W A;  1TT5 B;  1I6X A;  4I6Z A;  2XGE A;  2WAQ N;  3VOE A;  5J1Y A;  3LSI A;  1D0Y A;  3SJM A;  3CF2 A;  3WOD F;  3HC7 A;  2ME6 A;  1ZR2 A;  1K83 J;  3LFU A;  4UUV A;  3G2B A;  5FFX A;  4HLY A;  5ICE A;  4P9F A;  1X1B A;  2DJN A;  1POG A;  2NAZ A;  2IVM A;  4XON A;  3GYH X;  4UB8 C;  2HZD A;  5KNL A;  1ZAO A;  5EYR A;  4BXU A;  1SFU A;  4IRH A;  2KPM A;  1JTY A;  3JRC A;  2ZSI B;  4EM0 B;  4N0B A;  2NNY A;  4RLF A;  1Z3X A;  1FTZ A;  2EWN A;  3EET A;  1DU0 A;  1QHH D;  3TL4 X;  1MMG A;  3RZD J;  2MLK A;  1IXR C;  3ELK A;  1TWG J;  1WJC A;  1IGN A;  3CO7 C;  3R0A A;  2JA5 J;  1GLN A;  2RDP A;  1Z77 A;  5JLW A;  2CQK A;  5LHH A;  2HR3 A;  1EH8 A;  1FOY A;  3DLA A;  1C0W A;  2DQR A;  1T39 A;  5EEG A;  4BEH B;  3ZXS A;  1OCT C;  3C18 A;  3OYE A;  3CUQ A;  3E6D A;  3S3O A;  1MD0 A;  3HHG A;  3CME I;  1FY7 A;  2E60 A;  3BDD A;  3BT9 A;  5FLX Z;  1IN8 A;  4P5O A;  4C3I J;  4LIU A;  3L1P A;  1ZR4 A;  3HJE A;  4PCQ A;  3G71 I;  3HL2 A;  2M8E A;  1OCC H;  1YW8 A;  4Y52 J;  3KFW X;  3LA3 A;  4QTR A;  4E7L A;  2JSC A;  2M2E A;  3WGI A;  1LDK B;  3SXY A;  2KL4 A;  4QLC U;  1YX5 A;  1UZC A;  2EIJ H;  2DK8 A;  2Y0S N;  5J1R A;  4PDK A;  2Q8K A;  3CC4 I;  1FJL A;  1TZL A;  2JPB A;  4KDP A;  1FOK A;  5CVI A;  3TP3 A;  3W2W A;  3HSE A;  4O6J A;  2X1C A;  2KDO A;  2OCE A;  3CJN A;  3L00 A;  3KZI C;  5EDN A;  3BG5 A;  1U5T C;  2HNH A;  1QZZ A;  2K27 A;  2Z3Y A;  4JX4 A;  4AYB A;  3TMO A;  1TW3 A;  3HSF A;  4KUM A;  2L7F P;  3AL0 C;  1ITY A;  4X6A J;  4M3D A;  2PBI A;  3VSL A;  3OYB A;  1YE9 A;  2M0C A;  1TWF J;  3EUA A;  3FHN A;  3ZMV A;  4J01 A;  2VOP A;  2Q1Z B;  1SEU A;  2PJR B;  2WA0 A;  2Q2E B;  1HSJ A;  3R60 A;  4HAM A;  3M8F A;  4IVN A;  1ETY A;  4PJJ A;  4NC8 A;  5HNF A;  1XSX A;  4EAT A;  3FKJ A;  4N4O B;  4RLQ A;  4P9U A;  4RB1 A;  3J7Y J;  2V1U A;  4Y17 A;  4CO8 A;  3GEZ A;  3KET A;  3F8B A;  4PZJ A;  1LEB A;  3CCY A;  1TQM A;  2RAE A;  4C3J J;  1TWC J;  2F5V A;  2JUC A;  2VAS A;  3A1Y A;  3K4L A;  4A0X A;  1JT0 A;  3TO9 A;  4BAC A;  2NNN A;  4A3D J;  1UMQ A;  3QPH A;  4W1U A;  2JTV A;  4KT6 A;  3M4O J;  2FA5 A;  3PIP F;  1V5E A;  2HI3 A;  2RVC A;  4L18 B;  1QNT A;  3NWT A;  5FKK A;  1Z67 A;  2X85 A;  3KIO A;  3LSR A;  1RIO H;  3TBI A;  3VWB A;  2F48 A;  3J80 K;  5DM6 F;  4IO9 F;  3LA2 A;  3CF5 F;  4G6Q A;  4C9Y A;  2R7U A;  1SVO A;  2EQR A;  4PJL A;  3DBL B;  1YJN I;  3IHU A;  1YFH A;  5K5O A;  2EIN H;  2ESN A;  5HLG A;  2CJJ A;  2R7X A;  1OCO H;  4BDZ A;  1R4N B;  3F8M A;  4IJA A;  1FYK A;  5H2F C;  1EV7 A;  3P9K A;  4ENM A;  3AFH A;  3OMY A;  2BEO A;  4OIO F;  2VIX A;  4F52 A;  3WTZ A;  2F5D A;  1G59 A;  3S93 A;  3ERE D;  2EA2 A;  4LK1 F;  1X58 A;  1RUN A;  2O0Y A;  2RKH A;  2MD0 A;  4ENJ A;  4L0Z B;  4OIN F;  1F5T A;  1F36 A;  2PJR A;  2Q2E A;  2EV6 A;  3WTU C;  1BW6 A;  2HDC A;  3S1R J;  2UXX A;  3HTU A;  1YJ9 I;  1GXQ A;  1QZE A;  1O3S A;  2L9V A;  2X9D A;  5IOY A;  2NXN B;  1H8A C;  2DOE A;  2PN6 A;  1ETK A;  4NQW B;  4AWX B;  5KHD A;  3WHB A;  1HW5 A;  3CUQ C;  2EV5 A;  3SZT A;  4M9Z A;  5DDG A;  4HX7 A;  2M7B A;  3GTL J;  3SEZ A;  4M6X A;  2YX7 A;  3KP4 A;  2ZNY A;  2X4H A;  1UB9 A;  4OOI A;  3MN2 A;  2X51 A;  4V2F A;  1W5S A;  3ZP5 A;  2ZFW A;  3M9A A;  3W2A A;  2DA7 A;  3FIS A;  3OYI A;  1KU9 A;  2DJI A;  3KEQ A;  1A35 A;  2IAI A;  2MG4 A;  4R79 A;  3CCJ I;  1LVK A;  4GFB A;  4E7K A;  5EGO B;  3HZJ A;  3I0T A;  1Z91 A;  3CLQ A;  3GME A;  4UB6 C;  1OCR H;  2XUB A;  4Y15 A;  4GO1 A;  1VQK I;  1TWH J;  3ABU A;  3O2P E;  4BE2 A;  3OOP A;  2LY9 A;  1MBJ A;  2FML A;  2ZFU A;  4HDV A;  5CKT A;  2MLG A;  2LD5 A;  4NBQ A;  4A3B J;  1V54 H;  1XCB A;  3K9T A;  2Z16 A;  4BAY A;  1SAU A;  3BCB A;  2GQQ A;  3LSM A;  4PK4 A;  5KAI C;  3KP3 A;  2OJE D;  3DF8 A;  2HXO A;  1JT6 A;  2YS9 A;  1BIB A;  2K40 A;  1S72 I;  4B44 A;  3FF5 A;  2DN0 A;  3GFM A;  5E1Z B;  3GF2 A;  5LRR A;  2R5Y B;  2D5V A;  2M5W A;  4E7J A;  2O8X A;  3GWZ A;  1H9G A;  3BOQ A;  4LG3 A;  3U2R A;  3LAJ A;  3ZQH A;  2PEX A;  3S8P A;  3EUH C;  3GTG J;  2YU3 A;  1WJB A;  4F91 B;  2F5F A;  1XDS A;  3OR1 C;  5D5U B;  2E35 A;  2XAQ A;  2HYF A;  3BTI A;  4U7D A;  2DQL A;  2AXL A;  2NS7 A;  3K2A A;  3OYD A;  4L5E A;  2I5U A;  1ZHF A;  1GVJ A;  2X1E A;  1AA7 A;  5F27 A;  5EGO A;  1YQA A;  3D0S A;  4A6E A;  4XQF A;  1FBQ A;  4ZYA A;  3CCS I;  4ESJ A;  3EDP A;  2W57 A;  3M8J A;  3J7Z I;  2OV7 A;  1IN6 A;  1JKP C;  2V1D A;  2JQ7 A;  3R61 A;  3RPU A;  4I09 A;  2DMT A;  4ZYG A;  2Z2S B;  4RGU A;  4L0Y B;  2WAE A;  2TRT A;  5DYM A;  3SQN A;  1V3F A;  2XGX A;  4RAF A;  2CW0 F;  3W6K B;  2HDW A;  3IV5 A;  2A5W A;  3VPR A;  4A3C J;  1BA5 A;  3COA C;  4FIS A;  3FIW A;  3KEY A;  2KRH A;  4RAG A;  3CP8 A;  3TO6 A;  2PG4 A;  2R5Y A;  1U2W A;  5BMZ A;  2CV1 A;  2VKD A;  3K4K A;  2DFF A;  1P7J A;  2K9M A;  2KT0 A;  4IL6 C;  3HG9 A;  2DDA A;  2GA2 A;  3ZN1 A;  2RQP A;  4U88 A;  3V7C A;  3FBN B;  2MW8 A;  1ENH A;  2P5L C;  1JJ6 C;  2CFO A;  1CF7 A;  1WVR A;  1KU2 A;  3ZQI A;  1FTT A;  1I1S A;  3WGH A;  3T1B A;  3IKT A;  3FWE A;  2H1L A;  5JR3 A;  2RQQ A;  5BPD A;  4A93 J;  2LF7 A;  2FMY A;  2E1M B;  1D8K A;  1MMN A;  2L7M P;  5D5W B;  1G6N A;  1ZG1 A;  2P7C B;  2QSG X;  1ON1 A;  3AG1 H;  2MD5 A;  4WXC A;  4HBL A;  3WTW C;  2MSY A;  2KQR A;  4E70 A;  3KZZ A;  2PX9 A;  1UG2 A;  1K4T A;  3PSI A;  3ZMZ A;  5CPR B;  2KP6 A;  4LIT A;  4AVP A;  3NAU A;  4LLG F;  1Y8R B;  3HOW J;  1PUF A;  5IPA A;  4RA2 A;  3TKY A;  5CVV A;  2VON A;  2L02 A;  3TOB A;  1VZ0 A;  1ZYR F;  2M4G A;  2UXN A;  1HKS A;  2EA4 A;  4EJT A;  4S04 A;  2IGO A;  3TOA A;  4AC0 A;  3CC2 I;  2PMH A;  3V7R A;  3VYT B;  4BGD A;  2NOJ B;  1FIP A;  1FPQ A;  4C2M J;  4XN0 A;  5DS9 A;  4I7H A;  4MTD A;  2V6E A;  5FKM A;  4YFN F;  4A3E J;  1XTA A;  2Y31 A;  3K0L A;  4H4K C;  2MH2 A;  4LOC A;  3VYU B;  1JXS A;  4LLN A;  1YIJ I;  3DKW A;  5C4X J;  1BBY A;  5ERI A;  2JVG A;  4BE1 A;  4HG2 A;  4HRI A;  2E7W A;  4FE7 A;  3A01 B;  3DBH B;  2XGC A;  1OYI A;  4I0A A;  4HF2 A;  3I4P A;  3OYF A;  2ZXH A;  3ZRG A;  4A3G J;  1Z21 A;  5D8L B;  3K69 A;  2EH3 A;  2B9S A;  4MGR A;  2IS2 A;  3KX2 A;  2VQH A;  4UV8 A;  2WB1 N;  3PUB A;  1BR2 A;  2D1H A;  1BN5 A;  4CGZ A;  3HM5 A;  1OCZ H;  5ICG A;  4CH7 A;  5HDK A;  2R7D A;  4KMU X;  2WWY A;  5HDN A;  3OYA A;  1XSV A;  2O6G E;  5BNG A;  1WI3 A;  3LL7 A;  5FRO A;  3G1O A;  1BC8 C;  1TWA J;  3OS0 A;  2VXD A;  5HLT A;  1QHG A;  1QVU A;  4DZP A;  4Y4R A;  5ILU A;  3FXL A;  1G3T A;  2Q0O A;  3CCE I;  4Y3O A;  4KIS A;  3H5A A;  2V9K A;  3CUO A;  3TDZ C;  2IT0 A;  1P4A A;  3WU2 C;  4NC6 A;  1B1B A;  1FP2 A;  4G8X A;  1YS6 A;  2ID6 A;  3E0J B;  3ZMT A;  5IP9 J;  2ZME C;  2R92 J;  3GLX A;  3GZ5 A;  2QKM B;  3KP2 A;  4M71 A;  1O3Q A;  2L0K A;  3NAR A;  3I4N J;  4ON0 A;  3ZPL A;  1F4K A;  5DV5 A;  4MLO A;  4QIW N;  4O3M A;  2PQ8 A;  3JTH A;  2AXT C;  3A0H C;  2QBY B;  1D5V A;  1S5L C;  2L2O A;  2ZJP F;  3QOE A;  2FJ1 A;  3CMM A;  5DUK A;  3ZOB A;  1Y56 A;  4OU0 A;  2LKX A;  1O7F A;  3VB2 A;  3G4S I;  3PQJ A;  5HOD A;  1W7P D;  1XDU A;  1BJA A;  3TDU C;  3OYK A;  2OD5 A;  2CV2 A;  3TP0 A;  1XGS A;  3DTI A;  1JJ8 C;  3QOP A;  3A03 A;  4ZDO A;  1ZLJ A;  1AKH B;  2DA1 A;  4BJ6 C;  1U8B A;  5FLX K;  2FE3 A;  1QA6 A;  1IDZ A;  1IO2 A;  4BQO A;  5HS7 A;  4B4C A;  4N9I A;  2GM4 A;  1LFB A;  4EJO A;  2MBF A;  5FO5 A;  2XKO A;  4XRM A;  1P9Q C;  2M0M A;  2OCC H;  3OIQ A;  4XSX F;  5TJJ A;  3ECO A;  3ZQQ A;  1STZ A;  1H0M A;  5B5E C;  2IGK A;  5D5V B;  1ZRE A;  5D4S A;  3JRI A;  1XS9 A;  1R6R A;  2BXZ A;  1XGO A;  1T6S A;  3Q3S A;  2Z5U A;  1MJ9 A;  2KJC A;  3TED A;  2E1C A;  3H3V K;  4EMS A;  2LFB A;  3DWL E;  1Y39 A;  4J00 A;  1WJF A;  1XGN A;  3MD2 A;  1XMA A;  4JP0 A;  5IYC J;  3LWF A;  3S2H J;  5E17 F;  1Z6R A;  2HOE A;  1NH3 A;  1V5F A;  1AWC A;  5KK1 A;  1ZG3 A;  4JX5 A;  1QZY A;  4YEL A;  3KE2 A;  2A6H F;  1E3H A;  3M07 A;  5E3M A;  4XLP F;  2PMZ N;  2QBY A;  2CQN A;  2JUG A;  1D1C A;  3N05 A;  3CES A;  5L3G A;  5E20 A;  2O5R A;  2XAJ A;  4JYK A;  4E4H A;  3W6J B;  3ISP A;  2Z33 A;  6PAX A;  2HWV A;  4MIM A;  1T38 A;  3BPX A;  2A05 A;  2XRL A;  2K02 A;  1LFP A;  2EFP A;  2E36 A;  3K10 A;  1AOY A;  3EYI A;  1ODD A;  4XOP A;  1VQP I;  5K5Q A;  4L5J A;  3DBR B;  4YII A;  5IT9 Z;  2E1O A;  3S1N J;  4HW0 A;  1MSF C;  4YIF A;  1ZRD A;  4KIF A;  4XSZ F;  5E1X A;  3BJ6 A;  3JSO A;  3T0Y A;  4I2O A;  1EF4 A;  3CO6 C;  5IOZ A;  2VBW A;  3K4B A;  1SAN A;  3RKQ A;  1YW7 A;  2VN2 A;  2XAU A;  1LVA A;  4D7N A;  1JKQ C;  1WFX A;  5C3E J;  2XV4 S;  3KCC A;  3ERM A;  4PUS A;  1ETV A;  3S3M A;  1Z1D A;  3GLL A;  2EB7 A;  2BY3 A;  1N75 A;  5JLX A;  2LYC A;  1O3R A;  4DW6 A;  2EIL H;  2CGP A;  4HEA 2;  4ZTJ A;  4CUG A;  4QSH A;  1U5T A;  3FXO A;  4M73 A;  3BTJ A;  1ETO A;  1WH7 A;  3H9Q A;  4DJA A;  4Z2Y A;  2OQR A;  1H9T A;  3H92 A;  3IH2 A;  2QF7 A;  4PFP A;  5LGU A;  5LEJ A;  2L4A A;  4HX4 A;  1FIA A;  2ZKZ A;  3F22 A;  1OJL A;  4ENK A;  1ZQ3 P;  3RI4 A;  4BXX J;  4BDY A;  3ABM H;  3MKZ A;  2KZV A;  3MEX A;  1Z05 A;  5FJ8 J;  4AVZ A;  3GZ6 A;  1R23 A;  3CUQ B;  1W1W E;  1MBE A;  3OYN A;  1FMV A;  1R5H A;  1KU7 A;  1X1C A;  2X0L A;  4MFE A;  4UUT A;  4M3E A;  2DU9 A;  2W24 A;  4DQ2 A;  1H88 C;  2MYS A;  1TLH B;  1R00 A;  2KFD A;  3QPT A;  4GXO A;  1PP8 F;  1MH3 A;  4OMY A;  2XPW A;  1GV5 A;  1QGP A;  2FSW A;  1CQT A;  1GV2 A;  1GVD A;  3V42 A;  1A6Q A;  2V79 A;  4MEY F;  1WWX A;  2LKS A;  3BLY A;  1P4X A;  1Y0N A;  4XLE A;  2BY1 A;  2CUJ A;  2H6B A;  2R7F A;  4RB3 C;  2DTR A;  3DU6 A;  3HKZ A;  3E5Q A;  3CDL A;  3C3W A;  4B1R A;  2EIM H;  2E2H J;  3JAM Z;  2IA1 A;  4LG0 A;  2WAQ A;  2JA8 J;  3FK6 A;  2L9S A;  1VQ7 I;  1OR7 C;  3JRH A;  1X2M A;  4FE4 A;  1S8N A;  4A0Z A;  3G6E I;  4IX7 A;  5D4R A;  1MNE A;  2F5E A;  1JE8 A;  4RGS A;  2UZK A;  1K6Y A;  2GWR A;  5F0F A;  3S32 A;  1FSH A;  2CV0 A;  1L0O C;  2IGM A;  1VQO I;  4KNY A;  2JSP A;  4FX0 A;  4JBA A;  4W97 A;  3G3Z A;  2DT7 B;  2PFB A;  1I3A A;  3HOZ J;  4BL0 B;  1FEX A;  4II3 A;  3LMM A;  2XAH A;  1UCR A;  4A3F J;  3L09 A;  3BY6 A;  3BG3 A;  4F55 A;  5C44 J;  3L7W A;  1UHW A;  2H8W A;  3PFI A;  2K9S A;  1NG7 A;  2VQL A;  3C2B A;  3FXU A;  1X4O A;  3PUF A;  4D1Q A;  1DP7 P;  3PO2 J;  1TQP A;  1OPC A;  1V5G A;  2D2W A;  4A5N A;  2I8D A;  2KJB A;  2P8T A;  3M3Y J;  4XRS G;  3IAS 2;  2HTS A;  2ME0 A;  3RDI A;  2DMN A;  2CO5 A;  2VUM J;  2BY0 A;  2VOO A;  2DCE A;  5EZH A;  5GPC A;  4CXF A;  2DO7 A;  2VKE A;  2IXS A;  1SC7 A;  3ZCO A;  4Q47 A;  2A61 A;  1KYW A;  1WGX A;  4XM3 A;  1MMA A;  2XSJ C;  1YI2 I;  1D5Y A;  2VQC A;  2LBF B;  4X0G A;  1VFC A;  4B8X A;  2VL8 A;  4ESF A;  2G7H A;  2W7N A;  1IRF A;  4OMZ A;  2XPV A;  3JRD A;  2BBY A;  2HKO A;  9ANT A;  5CVU A;  4CCN A;  5FLM J;  4HYE A;  3DKY A;  3EQL F;  1J9I A;  3DEE A;  3BR2 A;  3BRO A;  4BBS J;  2LH9 A;  1J09 A;  1BOB A;  3F3X A;  5FB2 A;  1B72 A;  2CQX A;  1QU3 A;  2Y0S A;  4AYB N;  3FMR A;  5E8I A;  3K4C A;  1RRJ A;  1HLV A;  1D0Z A;  1IF1 A;  1DGW Y;  3K4J A;  1IRZ A;  3V8L A;  1D1A A;  5GP9 A;  3PFY A;  3M1C A;  2XAS A;  1JUS A;  3CJR B;  1LNW A;  4CA0 A;  4D5C A;  3EUH A;  2HPI A;  3IKV A;  2HGC A;  2NYX A;  1GUU A;  1IV6 A;  3X2Q H;  3H9J A;  2AO9 A;  4HV6 A;  4LB5 A;  4RB0 A;  3N4M A;  2HTJ A;  2DFE A;  2DAO A;  4AIK A;  4LLL A;  1NHA A;  3DQV C;  2R0Q C;  2ESH A;  3HHH A;  1YS7 A;  4M74 A;  3RKX A;  1OYW A;  5DEQ A;  5IY5 H;  2A5Y B;  3K1M A;  1KA8 A;  2P0W A;  2Y30 A;  2JT1 A;  1IAW A;  3RQ4 A;  2XC7 A;  2DW4 A;  4MFD A;  5GPA A;  2LBF A;  4A69 C;  2M4K A;  3OSG A;  1QBJ A;  2MFZ A;  2P81 A;  4GYG A;  1DGR M;  2W4S A;  1VND A;  4NNJ A;  1YRN A;  3R4K A;  4CHU A;  3BR3 A;  1PUE E;  3OSF A;  1X3W B;  4C3H J;  3K70 D;  2GXB A;  2DFI A;  3R0J A;  1B9M A;  4EVI A;  3BC8 A;  1FSE A;  1YOV B;  3V8J A;  3W6V A;  4UV9 A;  2Z9O A;  4F3Q A;  4CIC A;  1K78 B;  1T0F A;  4YEJ A;  2W85 A;  4B43 A;  4AM3 A;  4EJV A;  2HFH A;  3RKY A;  3SZP A;  1J7K A;  1QQI A;  1IJW C;  2E5N A;  1ETQ A;  2FRH A;  4ZJZ A;  2Z99 A;  1XB4 A;  2BHZ A;  3MKY B;  2BW3 A;  1P2F A;  2HVQ A;  5B3S H;  4G6T B;  2PI0 A;  2CMP A;  4CZC A;  4A3J J;  4RGR A;  1B4A A;  1MJA A;  2YSR A;  3BZC A;  3S2W A;  1ETX A;  1S7O A;  2OTL I;  2O03 A;  3D1N I;  4KYW A;  3Q9V A;  4MO7 A;  4DYQ A;  1I50 J;  2XHK A;  2O61 A;  4KN4 X;  1YJW I;  2ZJQ F;  2QWW A;  1GHC A;  2HZT A;  4A5M A;  2D1V A;  3WTV C;  4D9J A;  1HW2 A;  1HOM A;  4PJM A;  1YIT I;  4Q4Z F;  3S16 J;  3PSF A;  1SVL A;  2LVS A;  2QQA A;  4LMY A;  1SFE A;  2V7F A;  3F0C A;  2DA3 A;  3PNY A;  1MGT A;  1S7A A;  2DOA A;  4HA8 A;  1BIA A;  2H27 A;  2QUF A;  4M3B A;  1ZG5 A;  2XGD A;  1BR1 A;  2VJI A;  3A02 A;  3OS2 A;  3MZY A;  4HQE A;  2DDB A;  3V4G A;  5L3B A;  4PGG A;  3G1L A;  4LGW A;  3EPZ A;  1LPQ A;  1MBF A;  2MH9 A;  2QGU A;  4BNC A;  5E1W A;  2R7Z J;  4FQG A;  5DM7 F;  4OWR B;  3ZQC A;  3B6A A;  2VBX A;  4NUB A;  1MSE C;  3DTE A;  4EV0 A;  1K78 A;  4A3L J;  1OFC X;  4AD9 A;  3DLL F;  4IHY A;  1WZ2 A;  3ASO H;  2LRD A;  5TGT A;  2W82 A;  4CZZ A;  3BR6 A;  3S1M J;  5B1A H;  1MND A;  3QYB A;  3QPL A;  3TQN A;  4ZDP A;  4B09 A;  3WU0 A;  2K9Q A;  4XRS A;  3G1M A;  5L3D A;  3WG9 A;  2A3S A;  2ZJR F;  2OC6 A;  4BXF A;  5E3L A;  4HSR A;  1CF7 B;  5DD4 A;  2A68 F;  3T8T A;  1Z3Y A;  1RKT A;  4EJU A;  2K4J A;  2ZXI A;  4MQV A;  2GLO A;  2KLO A;  2WBM A;  1JKO C;  2ZNZ A;  3PQK A;  1VQ6 I;  2GIV A;  3ABL H;  2STW A;  5HS9 A;  4XKW A;  3K4M A;  5B66 C;  2H1K A;  1JI8 A;  3MZ8 A;  3M7G A;  2DA2 A;  1D3Y A;  2FBH A;  2HYJ A;  3I53 A;  2K5C A;  5IT3 A;  5LBQ A;  1UAA A;  4AU7 A;  3BG7 A;  1VQ4 I;  5IYB J;  2HDD A;  3JRA A;  1SD7 A;  2E5Z A;  1X19 A;  1PUF B;  1Y8Q B;  1APL C;  5JHF A;  5AON A;  2W25 A;  3SHF A;  1ZLK A;  3CLO A;  4I02 A;  1UHS A;  5KCM A;  3LSJ A;  4B47 A;  4KIG A;  2COB A;  2VT2 A;  3OL3 A;  2LRE A;  2JVH A;  5CLS A;  2HVR A;  2A6T A;  3IUO A;  4XLC A;  5CJ9 A;  4YFK F;  4KIC A;  2ZME A;  2IRF G;  4EM1 A;  3DKX A;  4MTE A;  1O4X A;  2G0E A;  1LUJ B;  2V4J C;  2WV0 A;  3CDH A;  3Q0V A;  1T33 A;  3C2H A;  4C30 A;  3L2R A;  1T0F C;  2VLA A;  4UVB A;  2NRA C;  3FDY A;  3NWS A;  3SFI A;  5DUI A;  3J81 K;  1FLI A;  3PNT A;  4UNO A;  3I64 A;  3I58 A;  2STT A;  4IKF A;  2FOW A;  5F1J A;  3BZ6 A;  3WHC A;  2XB5 A;  3EYY A;  1BJZ A;  3CJT B;  2QYO A;  1Y1W J;  3ULQ B;  3HRU A;  4A6D A;  3QOD A;  1SD5 A;  2DA4 A;  4EQQ A;  2GIZ A;  5DCM B;  3HOS A;  2M45 A;  3ABT A;  2K3P A;  2VJJ A;  1SFO J;  2R5Z A;  3K6G A;  5JHU A;  4LK0 F;  4S05 A;  3CDI A;  1PJR A;  2FF4 A;  5HDG A;  5H6R A;  4F92 B;  1SAX A;  4Q48 A;  3I54 A;  2FBI A;  3F6O A;  4Y13 A;  1S3J A;  5DTD A;  2DFH A;  4A3I J;  5IT9 K;  3TW7 A;  5M3M J;  3GO5 A;  1HF0 A;  2JA2 A;  5EEA A;  3DXJ F;  3ONQ A;  3JRE A;  1L3L A;  4OIP F;  1YX3 A;  3G73 A;  2V6C A;  2FQ4 A;  4IHT A;  1TNS A;  3VYR B;  3GW2 A;  1DDN A;  3BP8 A;  2H09 A;  3HRM A;  1UST A;  4ZYH A;  4BKX A;  3DTK A;  2K9N A;  1FBS A;  1HXD A;  1K61 A;  4HNV A;  3P7N A;  4YFX F;  4S0H B;  3UKG A;  1R1U A;  2R7O A;  5L3E A;  1GXP A;  1R49 A;  2M7A A;  4HF1 A;  2BVL A;  1MBH A;  2P4W A;  3FMS A;  3MWM A;  1MW7 A;  1IN5 A;  3F8C A;  3BG9 A;  3ZMU A;  5A2Q Z;  1E0E A;  4WF2 A;  4KJZ A;  1JHH A;  1LDJ A;  3AG3 H;  2IA2 A;  3K2Z A;  4CYC A;  1T8I A;  2JWT A;  1BR4 A;  2EJR A;  2OBP A;  2Y9Y A;  1N77 A;  2DPD A;  1OKR A;  4OIR F;  1HDP A;  1BM9 A;  4F93 B;  4NC7 A;  3GFJ A;  5DCM A;  4FT8 A;  4H0E A;  5DD8 A;  2VPR A;  3ROU A;  2ECB A;  3GTJ J;  2E2J J;  3K70 C;  2H6C A;  3H35 A;  1SMY F;  2AQF A;  3BQY A;  1I6H J;  2EFQ A;  4M3F A;  2QA4 I;  2IA0 A;  4WCG A;  2DMQ A;  4G7O F;  4ZC3 A;  4IOA F;  5TRD A;  1KGS A;  1BW5 A;  4I01 A;  3U1D A;  5J3L A;  4E7I A;  3DEU A;  3HRS A;  1ZKG A;  4AIJ A;  4IRI A;  4ASN A;  2ZJ2 A;  2UWM A;  1B6A A;  2CS3 A;  3Q0U A;  3Q5F A;  3F8F A;  3DCF A;  2FUG 2;  4DOZ A;  2W48 A;  2WB1 A;  2ZBK A;  1PP7 U;  3BTL A;  2FEZ A;  2JMW A;  3QQA A;  2KIU A;  2JZY A;  2GZW A;  4XMY A;  3H3U A;  5TIS C;  3LNQ A;  2KHM A;  2VKH A;  3FM3 A;  4LJZ F;  3KP6 A;  4FET A;  3PL8 A;  3BR1 A;  3HPH A;  3JAM K;  4R8H A;  3E7L A;  1ONV A;  3ZR8 X;  1Y6I A;  2VC1 A;  3UR3 C;  3HSR A;  4Z6Y A;  4QPO A;  3LOC A;  2NOG A;  2E7X A;  1RC9 A;  1SFX A;  2IEK A;  3IRR A;  4OAZ A;  2Y75 A;  4DYR A;  4V19 K;  2E71 A;  1Z7L A;  5AIP A;  4TV7 A;  1W0T A;  2GAU A;  1HC8 A;  2VBY A;  1VI0 A;  4EGZ A;  1MMD A;  5LLQ A;  4BE0 A;  2HOT A;  1XCV A;  4E7S A;  3BJO A;  2VXZ A;  1R5G A;  1VQ5 I;  2TCT A;  5K7Z A;  5F1R A;  3IC7 A;  2RNJ A;  3AAF A;  2XF5 A;  4B48 A;  2D45 A;  2G7U A;  2IJL A;  3HOV J;  2LDU A;  3QYE A;  3KYD B;  5FLV A;  3S3N A;  4M72 A;  1HA8 A;  4UUS A;  1U8R A;  2BOL A;  2IW5 A;  1IN7 A;  1WHU A;  3PIO F;  3F8N A;  2ID3 A;  3IWZ A;  3Q0W A;  3ZQG A;  2UV1 A;  2W1O A;  3I71 A;  3I3L A;  1YHQ I;  3JRF A;  2CWE A;  2NS0 A;  5GAD J;  1WQ2 A;  4JK1 X;  1J2X A;  2O8K A;  3S1Q J;  1I5Z A;  4HV5 A;  1G3Y A;  3O3K A;  2R7T A;  1Z6T A;  1ZN2 A;  3LAP A;  2Y0M A;  3HTS B;  4XKC A;  1OR7 A;  1U5T B;  3D5R C;  1KZH A;  3OYJ A;  1K6O A;  3J81 Z;  1FZP B;  3FZV A;  1T95 A;  4CSW A;  2E19 A;  3AL0 B;  3WU1 B;  4XLF A;  3VSK A;  3O8G A;  1K4S A;  1J59 A;  4MEX F;  2IP2 A;  1MJB A;  1DQU A;  3NQO A;  3LSH A;  2QLZ A;  5M5X J;  4UVA A;  2R3S A;  3H5R A;  3FMQ A;  1UG0 A;  4FTH A;  4KA4 A;  2HYG D;  2KRC A;  2QQB A;  4PSW A;  3AKZ A;  2UUZ A;  3HUG B;  2W84 A;  3LSP A;  2HQR A;  1ETW A;  2GOM A;  3HPG A;  2H94 A;  4KFC A;  1E3O C;  4XOR A;  5F6F A;  3SDG A;  2ELK A;  4U7B A;  1DP3 A;  1GT0 C;  2B63 J;  3K1N A;  3RJP A;  3KZY A;  2JA6 J;  1LKX A;  3E97 A;  3K1P A;  4L5I A;  2P6S A;  3HOT A;  2HQA A;  1FOW A;  2FBK A;  2Y48 A;  5CVJ A;  1HKQ A;  2FOK A;  2R7V A;  1UEL B;  1NG6 A;  1PYV A;  4HNT A;  2EPF A;  1WJA A;  2L9N A;  3FK7 A;  4FX4 A;  1Z7U A;  3D5L A;  1X1P A;  4BQA A;  2XKP A;  1A31 A;  2YUS A;  1ZGA A;  4EEF G;  1IRX A;  2JJ7 A;  4CYD A;  1A5J A;  2F4I A;  3M1E A;  4LG0 B;  4XOT A;  2IBD A;  3ZQ7 A;  1RR7 A;  1W7P A;  3W3C A;  3DPL C;  5C4J J;  3LST A;  1HBX G;  4UY8 I;  1BI0 A;  1VQM I;  4G6D A;  2EIK H;  5E18 F;  5F08 A;  1ZAR A;  5F0C A;  3LQR A;  1XPX A;  1SFK A;  1IRG A;  2HQN A;  3IH3 A;  4V2G A;  4G7H F;  1ZGW A;  4RB2 C;  1ZRC A;  5BS6 A;  2E2I J;  2KKO A;  3HUG A;  2RGV A;  3WG7 H;  3E3V A;  1LE8 A;  3F72 A;  2L4M A;  1D8J A;  1M1E B;  3HYI A;  4PGH A;  1FP1 D;  3KLN A;  4IHV A;  3IH4 A;  5GAE J;  1MH4 A;  2M1B A;  4KIB A;  4CCJ A;  2ACJ A;  2MC3 A;  2XVC A;  1TTY A;  3FBI B;  1IV8 A;  4DBR A;  3JRG A;  5J4Y A;  3I4M J;  3WTX C;  1T2K A;  3GFI A;  1R5I D;  3GXO A;  1YW9 A;  2M3A A;  3MVP A;  2KDZ A;  2FD5 A;  1BI1 A;  3BR5 A;  1MBG A;  3QU6 A;  2CG4 A;  2K3F A;  1UJ8 A;  2WAD A;  1WJD A;  3HOU J;  1LDD A;  2EK5 A;  2ETH A;  3OV8 A;  2BVM A;  5LGN A;  3OS1 A;  1JHF A;  3MKL A;  3MKW B;  3I59 A;  5FRN A;  1G8X A;  3MAJ A;  3L2U A;  5BQT A;  3V7S A;  4ANJ A;  4ETS A;  2IS1 A;  1XMK A;  2O3F A;  1KQ0 A;  4HPQ A;  1X3Z B;  4E6K G;  1HW1 A;  3VYS B;  1YYV A;  3LSG A;  3MMY B;  2ISZ A;  1IDY A;  3PO3 J;  1B72 B;  2DOD A;  3HOY J;  5GTI C;  4MQ9 F;  2DYR H;  2KIS A;  1G3W A;  3E5X A;  2N8G A;  3KPH A;  1R22 A;  3OYM A;  1IC8 A;  5D6E A;  2ELJ A;  2XF7 A;  2L3D A;  2IGN A;  2KMU A;  3KYL A;  3R6S A;  1TNT A;  2WY8 Q;  4L9T A;  1WCM J;  5JVT A;  1XN7 A;  1W36 D;  5KVR A;  4IF4 A;  1W0U A;  2K85 A;  1U9O A;  1ZRF A;  3H3Z A;  1QPM A;  4FAS D;  2PJP A;  3K4N A;  2DT6 A;  4JOM A;  3SEQ A;  3CJQ B;  2AHQ A;  3O8H A;  4ESB A;  2DMU A;  3ML6 A;  1F1Z A;  3CQZ J;  2VT3 A;  2LG4 A;  4I99 C;  4IPA A;  1EH7 A;  4P1W A;  5ED4 A;  2R93 J;  4IHS A;  1WRJ A;  2XSD C;  3C2G A;  3WTT C;  1LQ1 A;  4LFU A;  5HLH A;  3H9G A;  1G4D A;  4BHP A;  4CCK A;  1KQ8 A;  2XB0 X;  2AQE A;  4KT5 C;  4RAY A;  5GAH J;  1KYZ A;  4M6V A;  2CYY A;  1IW7 F;  1WKM A;  3HGY A;  1E2X A;  2FXA A;  3B6C A;  1XC5 A;  1YRN B;  4F7Z A;  3HBL A;  2OZ6 A;  1MZB A;  1VQN I;  2O9L A;  1WJ5 A;  2E1N A;  3KEO A;  4WWC A;  4M9X A;  4LIV A;  4G94 A;  1BOA A;  4KN7 X;  4RGX A;  5JFR A;  2OQG A;  1QO0 D;  4A2U A;  4XRF A;  1A04 A;  2G9W A;  2BXY A;  3T5X A;  4XLH A;  3LQQ A;  1E17 A;  2CUF A;  1P6R A;  2VBZ A;  1YIO A;  3QP6 A;  1DPR A;  3KLO A;  1P92 A;  4O5V A;  4HF0 A;  1R7J A;  1FNN A;  2ZC2 A;  4IQ4 A;  1JUP A;  5LHI A;  3TGN A;  3RTR A;  4LD5 A;  1TBX A;  2HVS A;  1YG2 A;  3FXR A;  5FKO A;  1Y1V J;  2BW3 B;  3P5J A;  4PJN A;  4BYY A;  3F23 A;  4GDF A;  3C7J A;  4ZZD A;  3CCR I;  2GXG A;  5BOX A;  1A6I A;  2P5K A;  2Y2Z A;  3HIF A;  2HKX A;  3E6M A;  2XRO A;  2OAZ A;  1RUO A;  4KMF A;  5ICC A;  4P55 A;  3CCQ I;  1V55 H;  4G9Y A;  3CZ6 A;  4Y7N J;  3L2Q A;  2NVY J;  1O7L A;  2DA5 A;  1IG7 A;  1R71 A;  2BYV E;  3QU3 A;  4AID A;  5HS8 A;  1T98 A;  1X1A A;  4AIH A;  5ILV A;  2GA1 A;  4A12 A;  2YR2 A;  4BEH A;  4RS8 A;  3OYH A;  4WXD A;  4ENN A;  4PFO A;  4IQJ A;  1V4R A;  3FKI J;  2QVO A;  3PNV A;  1RR8 C;  5B1B H;  5IP7 J;  4J19 A;  4CDG A;  5CQG A;  2LMD A;  2PMU A;  5J8C A;  1ERD A;  3CC7 I;  2VOD A;  4BJ5 C;  4DYC A;  2DLL A;  4II2 A;  2ELH A;  3DP7 A;  4HLX A;  3AG4 H;  4K2E A;  3E6C C;  2A69 F;  1A36 A;  3M8E A;  4RAZ A;  3GTK J;  1XMX A;  1O3T A;  2LLK A;  1OLT A;  3GX4 X;  1HQC A;  1R9T J;  5CVR A;  4BU2 A;  2DA6 A;  3BZK A;  2M9H A;  1Y0U A;  1R1T A;  2GBY A;  1IUF A;  3HEF A;  2XAG A;  2M8G X;  4AUX A;  5E8G A;  4C2U A;  2X48 A;  3JTG A;  2OUM A;  4FCY A;  2HXI A;  4RDU A;  2FNA A;  2EZK A;  2I10 A;  4M3G A;  1IXS B;  2LP0 A;  3HGG A;  3DV8 A;  4CCL A;  1EJ9 A;  3H1C A;  5HVQ C;  4IOC F;  4YG2 F;  2QZ8 A;  2V9P A;  3E1S A;  2P5V A;  1WI9 A;  5A2Q K;  2CQQ A;  3FXK A;  4IRG A;  2X6Y A;  4NB5 A;  4D0P A;  1KQ9 A;  2CW7 A;  4BHC A;  5CQE A;  4IHX A;  3H36 A;  3K7A J;  2CU7 A;  2RNG A;  4ABZ A;  1SD4 A;  3BJA A;  3N97 A;  1REP C;  3FXJ A;  5GTH C;  4XIC A;  1Q1V A;  3RPU D;  4RM3 A;  4A0Y A;  3JRB A;  2K9L A;  3LFK A;  2L54 A;  2ZXJ A;  1ON2 A;  1Q1H A;  1FWZ A;  1RZ4 A;  3DU5 A;  4XL9 A;  4BQQ A;  4XLN F;  1TL8 A;  3HRT A;  5JVG F;  2Z1D A;  5FGM A;  2VC0 A;  1TQI A;  2NVQ J;  2L7Z A;  3I9V 2;  3L2W A;  3HDD A;  1FYL A;  3RIR A;  3QRF F;  2AS5 F;  4D7M A;  1WPK A;  3MFK A;  2CRG A;  2GOX B;  5K7F A;  1OCP A;  4WXH A;  4ZTF A;  1QPI A;  1S7E A;  4A3M J;  4BBR J;  4I98 B;  2HEO A;  4X1E A;  5M3F J;  2Y9Z A;  5M5W J;  2ZME B;  2CUE A;  2MAB A;  3I55 I;  3MQ0 A;  5EG0 B;  1ZEL A;  3JSP A;  3F21 A;  2NVX J;  4U0W A;  3C1D A;  3WE3 A;  2CFX A;  1ZH5 A;  3VFZ A;  1X1D A;  4XKV A;  1OIS A;  2XRN A;  4NDL A;  3WTY C;  5J4V A;  4QPQ A;  1HDD C;  5E79 C;  2XF6 A;  1NTC A;  1J75 A;  2R4G A;  5E3O A;  4U87 A;  3OIP A;  3GTQ J;  3OYL A;  1X4P A;  5K1Y A;  2B0L A;  1U0J A;  1SMT A;  3QPS A;  4A3K J;  2DXI A;  3RSN A;  1BI2 A;  2QEN A;  1MIJ A;  2OZU A;  1NK3 P;  2BZT A;  3I5U A;  4DZJ A;  3RKW A;  1I27 A;  3KYC B;  3SFZ A;  2P7V B;  2R5Z B;  2IS4 A;  1VF9 A;  5BPI A;  4RBO A;  1N25 A;  1YTY A;  1CGP A;  3A2K A;  1ZGJ A;  1W5C C;  4FHT A;  1U78 A;  1LB2 A;  4L9V A;  3CMA I;  3IWF A;  4NQW A;  3QWL A;  3U1K A;  2FQ3 A;  3WGG A;  4L9J A;  2EZH A;  3WTS C;  2OPT A;  4CCO A;  1PDN C;  3MCZ A;  4ZZL A; 
#chains in the Genus database with same CATH homology
 4PJJ A;  4NC8 A;  4XMY A;  5HNF A;  4EAT A;  3FKJ A;  1EA3 A;  4N4O B;  4RLQ A;  2KHM A;  2VKH A;  3OYC A;  4FET A;  3PL8 A;  4BDY A;  3HPH A;  3SYT A;  1W36 C;  3MKZ A;  2KZV A;  2F5V A;  1Y6I A;  2VAS A;  3A1Y A;  3ZR8 X;  2R7S A;  3K4L A;  4AVZ A;  3UR3 C;  4IZZ A;  4BAC A;  4QPO A;  2HU9 A;  3OYN A;  1FMV A;  1X1C A;  2V1N A;  4KT6 A;  1V5E A;  4OAZ A;  2MYS A;  3NWT A;  3W2V A;  2X85 A;  1Z7L A;  3TBI A;  3J7A Y;  3VWB A;  2R7W A;  1MMD A;  4BE0 A;  4E7S A;  2VXZ A;  1TT0 A;  3V42 A;  4C9Y A;  2R7U A;  4PJL A;  2XF5 A;  3BLY A;  2R7X A;  4B48 A;  4BDZ A;  3UNG C;  4XLE A;  4DBQ A;  3QYE A;  3AFH A;  2CUJ A;  3S3N A;  3OMY A;  1HA8 A;  3DU6 A;  2VIX A;  3HKZ A;  4F52 A;  2BOL A;  3GBG A;  1G59 A;  3PJR A;  3S93 A;  2UV1 A;  2WAQ A;  2W1O A;  1N78 A;  2MD0 A;  2L9S A;  3I3L A;  1OR7 C;  4BJT A;  2PJR A;  2R7T A;  2R7Q A;  4IX7 A;  1MNE A;  4XKC A;  2L7K A;  3D5R C;  3OYJ A;  1K6Y A;  3CP2 A;  3S32 A;  2X6X A;  4NQW B;  5KHD A;  2VJ5 A;  2CV0 A;  3A4C A;  2IGM A;  1T95 A;  2JSP A;  4CSW A;  2M7B A;  2DT7 B;  3AL0 B;  3SEZ A;  4XLF A;  3VSK A;  4ITV A;  4C2T A;  2X51 A;  4BL0 B;  1DQU A;  3LSH A;  4II3 A;  2IS6 A;  3LMM A;  3H5R A;  1UG0 A;  5LD2 C;  2KRC A;  4PSW A;  4F55 A;  3AKZ A;  2UUZ A;  3W2A A;  3DPU A;  3LSK A;  2VPL A;  3HUG B;  3OYI A;  2DJI A;  1NG7 A;  2VQL A;  4R79 A;  1X4O A;  2X1D A;  1LVK A;  4BS9 A;  4D1Q A;  2GOM A;  3HPG A;  1V5G A;  2I8D A;  4XOR A;  4E7K A;  3IAS 2;  4U7B A;  1DP3 A;  1LKX A;  3QYF A;  2DCE A;  4BE2 A;  3HOT A;  2HQA A;  3VDX A;  2ZSH B;  2IXS A;  4HST A;  2ZFU A;  3ZCO A;  3H5N A;  5CKT A;  4XM3 A;  1MMA A;  2XSJ C;  4RMN A;  4B3X A;  3OOU A;  2Z16 A;  2VQC A;  2LBF B;  2R7V A;  4X0G A;  4Y33 A;  1SAU A;  1NG6 A;  1PYV A;  1UEL B;  2VL8 A;  3BCB A;  2CH0 A;  1WJA A;  2L9N A;  3LSM A;  4PK4 A;  4HNT A;  2W7N A;  3D5L A;  3DPT A;  4BUP A;  4CCN A;  3F9K A;  3EUK L;  3DKY A;  4B44 A;  3DEE A;  2LH9 A;  1J09 A;  1IRX A;  1BOB A;  3SDB A;  2F4I A;  1QU3 A;  2Y0S A;  5HNH A;  4RM2 A;  4E7J A;  4XOT A;  3W3C A;  3DPL C;  4LG3 A;  3H0D A;  3K4C A;  3S8P A;  1D0Z A;  3EUH C;  3ZGK A;  2RRE A;  3OL4 A;  4F91 B;  1WJB A;  1DGW Y;  3K4J A;  3OR1 C;  4N4N B;  4E7H A;  1D1A A;  3OWT A;  3PFY A;  1SFK A;  3M1C A;  4DIQ A;  3CJR B;  4CA0 A;  2HPI A;  3OYD A;  3H9J A;  2X1E A;  1AA7 A;  4XQF A;  3DQV C;  4ZYA A;  3M8J A;  2OV7 A;  4CCJ A;  2CW8 A;  3FBI B;  3IP4 B;  1D1B A;  2P0W A;  3BG6 A;  4DBR A;  2Z2S B;  3RQ4 A;  2XDV A;  2WAE A;  2XC7 A;  2LBF A;  2M4K A;  2F6C A;  2M3A A;  2MFZ A;  1DGR M;  2HDW A;  2W4S A;  2A5W A;  2LC2 A;  4NNJ A;  2VB6 A;  2WAD A;  3OY9 A;  1WJD A;  3KEY A;  2KRH A;  2BVM A;  3OS1 A;  3K70 D;  1WJE A;  3MKW B;  3CP8 A;  3BC8 A;  5FRN A;  1G8X A;  3L2U A;  4ANJ A;  2CV1 A;  2IS1 A;  2VKD A;  4F3Q A;  2WY7 Q;  3K4K A;  4GRI A;  4HPQ A;  2K9M A;  3HG9 A;  4YEJ A;  4E6K G;  3VYS B;  3LSG A;  3MMY B;  4XR6 A;  4B43 A;  3FBN B;  2CFO A;  2E5N A;  4PSX A;  4BQN A;  4ZJZ A;  3MKY B;  2BW3 A;  3OYM A;  2HVQ A;  2ELJ A;  2RQQ A;  2XF7 A;  2IGN A;  2KMU A;  4G6T B;  1FMW A;  4OAY A;  3KYL A;  2CMP A;  1MMN A;  2E1M B;  4CZC A;  2LY2 A;  2WY8 Q;  3SZG A;  2VJ4 A;  2KQR A;  1W36 D;  3PSI A;  4FAS D;  5CPR B;  2KP6 A;  4LIT A;  3K4N A;  2DT6 A;  4JOM A;  3SEQ A;  4CCM A;  3IAM 2;  3CJQ B;  3D5S C;  4D9J A;  4PJM A;  2LG4 A;  5LFA A;  1KON A;  3PSF A;  4P1W A;  1VZ0 A;  2V7F A;  2M4G A;  3C2G A;  2PMZ A;  3PNY A;  2DOA A;  2IGO A;  3H9G A;  2CUZ A;  1BR1 A;  2VJI A;  4CCK A;  3VYT B;  4BGD A;  3OS2 A;  2NOJ B;  2AQE A;  4XN0 A;  3EPZ A;  2V26 A;  4E7Z A;  2V6E A;  2W00 A;  3L2V A;  4OWR B;  4NUB A;  4XLA A;  4H4K C;  3VYU B;  2WAF A;  4ZDL A;  3DTE A;  1WJ5 A;  2JVG A;  4BE1 A;  4HG2 A;  4LIV A;  4HRI A;  5HOO A;  2LOO A;  2LRD A;  3OYG A;  2E1M C;  5TGT A;  2W82 A;  3OYF A;  2ZXH A;  4XLH A;  3ZRG A;  1Z21 A;  1MND A;  3QYB A;  4XKB A;  4ZDP A;  2IS2 A;  3KX2 A;  2VQH A;  2L5Q A;  3PUB A;  1BR2 A;  2OC6 A;  4IQ4 A;  4BXF A;  4HSR A;  2VQG A;  3RTR A;  2HVS A;  1Z3Y A;  2ZXI A;  2BW3 B;  2KLO A;  2WBM A;  4PJN A;  4CH7 A;  2HPM A;  4XKW A;  3OYA A;  3K4M A;  1JI8 A;  5FRO A;  3LL7 A;  3OS0 A;  2MC4 A;  2VXD A;  3CZ6 A;  1QHG A;  4XN3 A;  5HLT A;  3L2Q A;  2K5C A;  4Y4R A;  3RCO A;  1UAA A;  4AU7 A;  3BG7 A;  3OR2 C;  4Y3O A;  3BCA A;  4KIS A;  3H5A A;  1X1A A;  2V9K A;  5FRM A;  2QKL B;  4BEH A;  2E5Z A;  4DGW B;  1X19 A;  3OYH A;  5JHF A;  3E0J B;  4PFO A;  5KCM A;  4B47 A;  4IQJ A;  2QKM B;  3U21 A;  4YRV A;  2X6W A;  1S9H A;  3OL3 A;  2LRE A;  2JVH A;  2HVR A;  2A6T A;  1D0X A;  2R7R A;  3PNV A;  3IUO A;  4XLC A;  4MLO A;  4KIT B;  4HNU A;  5CQG A;  1ERD A;  2LY1 A;  3DKX A;  4BJ5 C;  2V4J C;  3HXL A;  4II2 A;  2L2O A;  3C2H A;  3QOE A;  4C30 A;  4XNF A;  3CMM A;  3L2R A;  1T0F C;  2VLA A;  1Y56 A;  3FDY A;  3NWS A;  3PNT A;  1OLT A;  4JQF A;  4BU2 A;  4IKF A;  3OYK A;  2CV2 A;  3DTI A;  1D0Y A;  3LSI A;  3CF2 A;  4C2U A;  3HC7 A;  2OUM A;  3LFU A;  4ZDO A;  3G2B A;  3QOD A;  4BJ6 C;  1X1B A;  3HOS A;  4CCL A;  4XON A;  2K3P A;  2VJJ A;  3K6G A;  2HZD A;  4BQO A;  5HVQ C;  5KNL A;  1PJR A;  3E1S A;  4F92 B;  2KPM A;  2X6Y A;  1P9Q C;  2CW7 A;  2M0M A;  3OIQ A;  2ZSI B;  5CQE A;  3ZQQ A;  4RLF A;  2IGK A;  1Z3X A;  2JA2 A;  1QHH D;  2RNG A;  3TL4 X;  1R6R A;  3ONQ A;  1MMG A;  1YX3 A;  3RPU D;  4RM3 A;  1WJC A;  3DWL E;  2K9L A;  4J00 A;  1WJF A;  3VYR B;  3MD2 A;  3DU5 A;  4XL9 A;  4BQQ A;  1GLN A;  1V5F A;  4YEL A;  2Z1D A;  3DTK A;  3DLA A;  4BEH B;  3ZXS A;  3I9V 2;  3OYE A;  3L2W A;  2R7O A;  2JUG A;  3S3O A;  1D1C A;  3N05 A;  2M7A A;  3CES A;  2O5R A;  2GOX B;  2BVL A;  2E60 A;  4E4H A;  4ZTF A;  4P5O A;  4LIU A;  1MW7 A;  2MAB A;  1LFP A;  3K10 A;  3HL2 A;  1E0E A;  4KJZ A;  1ZEL A;  4XOP A;  1BR4 A;  1N77 A;  4E7L A;  1LDK B;  1X1D A;  4XKV A;  2KL4 A;  4F93 B;  1YX5 A;  4NC7 A;  4QPQ A;  2XF6 A;  2R4G A;  1TZL A;  3OIP A;  4U87 A;  3K4B A;  3OYL A;  3K70 C;  1X4P A;  3H35 A;  2AQF A;  2XAU A;  3W2W A;  1U0J A;  1WFX A;  2X1C A;  2KDO A;  2DXI A;  3RSN A;  4ZC3 A;  4PUS A;  3S3M A;  1N75 A;  2HNH A;  2IS4 A;  2LYC A;  4E7I A;  4AYB A;  4HEA 2;  3TMO A;  3A2K A;  2UWM A;  4ZTJ A;  4CUG A;  3AL0 C;  2CS3 A;  3VSL A;  3OYB A;  1YE9 A;  3EUA A;  3FHN A;  4J01 A;  3H9Q A;  4DJA A;  2FUG 2;  4DOZ A;  2Q1Z B;  2PJR B;  2WA0 A;  2Q2E B;  2WB1 A;  4PFP A;  4CCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...