2RQQA

Structure of c-terminal region of cdt1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
GPLGSMTRCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVDLAGLTARLAHHVHAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA replication factor Cdt1
publication title Structure and mutagenesis studies of the C-terminal region of licensing factor Cdt1 enable the identification of key residues for binding to replicative helicase Mcm proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2009-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1420 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2rqqA01
2KLOA 2RQQA 3A4CA
chains in the Genus database with same CATH superfamily
2X1EA 1B9MA 1YS6A 2IP2A 5JVGF 1HW1A 1N75A 1V5GA 4J00A 3I3LA 3ZQIA 4O5VA 2IGKA 1IUYA 1WJ5A 5F0CA 2BYVE 5HS9A 5IP7J 3H3VK 3BZ6A 1T38A 3BC8A 2CMPA 4AWXB 4XLFA 5A2QZ 2VC1A 2UZKA 2EZHA 3RYRA 3CDLA 3JSPA 4AU7A 2PEXA 1EH6A 3OWTA 5E3LA 1Y1WJ 4ZDLA 3F8CA 3WTWC 1T2KA 3I71A 4I99C 1HDPA 2K02A 3GTMJ 4U0YA 2ZC2A 1QHGA 5DEQA 3W6JB 1ITYA 3L9FA 4JP0A 5FGMA 2O03A 1RUNA 5EEGA 2ZXJA 3T1BA 3KLNA 4BY1J 5JVTA 2FBHA 3FDYA 2ESHA 4LFUA 1J59A 1I6XA 4HF1A 4UVCA 2QENA 3HTSB 2EB7A 4ENJA 4KMFA 1O57A 2DK5A 5K5OA 2Y31A 2A05A 5E3MA 2K9MA 1RETA 5DYMA 3T8TA 5D5WB 4IO9F 4Z6YA 1XDSA 1QPIA 1HQCA 1FTTA 4LIVA 3GTGJ 3W6KB 1W7PD 1U3EM 2OTJI 4ZYHA 2LVSA 2FBIA 4I01A 3L1PA 3C1DA 1HBXG 1I1SA 3LA3A 2FD5A 2CUJA 3U1DA 1RZ4A 2MABA 4YIFA 1PUFB 4HRIA 4N0BA 1VQ9I 4JOMA 1B8IA 4F52A 3WODF 4X6AJ 1X1AA 5FLVA 2DTRA 5ICCA 5IT9Z 1USSA 4WX9A 1F43A 3GMEA 1ETQA 1JUSA 1GDTA 4UVAA 4CYCB 2VPLA 1XCVA 5ILVA 4P55A 2NRAC 3V8KA 1LE8A 3BTLA 2NVYJ 2XKPA 1W4MA 2KZVA 3FKJA 5F1RA 2Y9YA 5HLTA 2MBFA 3F6OA 1BM9A 4A3IJ 2FNAA 5BPDA 1ZARA 3E5XA 3PM1A 3COAC 3LSKA 3RZOJ 4MFEA 2DODA 1OPCA 1J2XA 4M9SA 3RSNA 1T33A 5KCMA 1MBEA 4B3XA 5DM7F 5CPRB 1ZKGA 4Q48A 1XC5A 3CESA 3PIPF 1FP2A 3LSPA 2PJRB 3OOUA 3SQNA 3S15J 2ZFUA 3V7RA 3JR9A 4PSWA 1J0RA 2E35A 5HLGA 4A93J 4L18B 2W84A 4HF2A 4Y52J 2VODA 2F5VA 4HEA2 4C3HJ 2M34A 3G1OA 4OINF 5CQEA 4CA0A 1FLIA 3DFGA 1XGNA 3C3WA 4C2MJ 1HLVA 2JA8J 2P7CB 2QVOA 3DEWA 1ETWA 2JVHA 3QYFA 1G3SA 5LEKA 3CCMI 1ZG3A 4KN4X 1LQ1A 3OL3A 1ON1A 5M3FJ 2X51A 4KUMA 3V7CA 3Q0WA 1CGPA 4XLCA 3CUOA 3EUHC 5H6QA 1YHQI 4W97A 1S7AA 1VQMI 1MMAA 2A6EF 3GTPJ 1AOYA 3BT9A 2KPMA 2EFQA 3BLYA 3LSMA 3LSRA 1R4NB 2F4MB 2Y75A 2R7ZJ 3S1RJ 2M7BA 2XF6A 4XKVA 1TZLA 5FFZA 3LQQA 4BKXA 3AL0B 3H1CA 4BJ5C 5FRMA 2KLOA 2JMWA 1TWCJ 1XD7A 1O3SA 5JI6A 4F91B 3ELKA 2ZMEC 2L02A 2JN6A 4EATA 2VBYA 5EYRA 5TRDA 4L9NA 5FRNA 3CJQB 3WU1B 2K5CA 5CVRA 2Z5UA 1JGGA 1QU3A 1MBHA 2MH2A 2O7OA 3IUOA 2OA4A 2XIGA 2BOLA 4LB6B 4NDLA 2RQPA 3TW7A 4HW0A 4ITVA 3D1NI 1OFCX 4JQFA 1HSJA 1LKXA 1XSDA 3KETA 1V55H 3DPTA 2L01A 1K79A 2EFOA 2EINH 4RBOA 2R7VA 3MAJA 1KU7A 2DA4A 4XORA 1SC7A 1QZYA 2J5OA 1KQ9A 2HZDA 5DV5A 2V9KA 4XBFA 2O3FA 1BJAA 5KHDA 4IRIA 4OMYA 3QOEA 2MYSA 4XL9A 4ZC3A 2XROA 3FK7A 4HNVA 1DUXC 1LUJB 3IWFA 4LK1F 3JRAA 4FE4A 1F9NA 2D5VA 4YFXF 1IXRC 5HLHA 1D8JA 2DMPA 5K5RA 3M1EA 4J19A 1T08B 3DBLB 4EJVA 4YFNF 4QIWN 2NNYA 3WE3A 1Z67A 3H35A 3TBIA 5M3MJ 3LL7A 3WTTC 2LKXA 1D0YA 5C3EJ 3OYKA 3BPVA 2DBBA 5HDGA 3SZTA 2GWRA 2LLKA 4HBLA 1RNLA 1IW7F 1W5SA 1WZ2A 3QWLA 4CZZA 1D1CA 4WK8F 2ICWG 1BW5A 4FASD 1T6SA 2JT1A 5FROA 1NG6A 3KEOA 5LHHA 1X1CA 1FEXA 1XSVA 2G0EA 3ASOH 3ZQQA 1A5JA 3KZIC 1VQ5I 2EV5A 2W4SA 3OS0A 4BNCA 4XK4A 4BHPA 3ASNH 4XKWA 2PFBA 1B72A 2MLKA 2R93J 3K10A 2W85A 3GLLA 3PJRA 3K4JA 4GCVA 4A3FJ 1R6RA 3LSGA 1LDDA 1W36C 3JRDA 4FTHA 1WJAA 2R7WA 3E5UA 3GTLJ 1WQ2A 1H8AC 1WJEA 2XF5A 4KN7X 1JT0A 1TW3A 4H0EA 3FM5A 5J40A 3DTEA 2HWVA 3OYIA 5IYDJ 2M8EA 5HVQC 3LA7A 2ME0A 2RV8A 1SMYF 4ZYEA 1W7PB 5M5WJ 5KAFC 2JUCA 2OPTA 3DKYA 5CYVA 3Q0UA 4B48A 2QBYB 3IAS2 2AXLA 5GTIC 2PJRA 2LKSA 2MD5A 4PJLA 3CCVI 1LDJA 1SFKA 1YG2A 2R7QA 2WBMA 4N4OB 2O0YA 1X58A 3ZMZA 3K4BA 2C6YA 1JGSA 2E7XA 2KRCA 2PJPA 2R7RA 1PVEA 2F5CA 4RB0A 2OJED 3OSFA 2LREA 2OCCH 2XGXA 2XVCA 3GZ5A 1G8XA 4OU0A 3HOZJ 2ZO4A 3MWMA 3OY9A 2DQLA 4HPQA 4D5FA 1FYKA 5FD5A 3HYIA 2O61A 4RGUA 1BI0A 2FOWA 4W1UA 1W5TA 3VDXA 2K4BA 4GFBA 3RPUA 4RS8A 4LLGF 5KVRA 3S3MA 1K6YA 5E1WA 1KONA 1JHHA 3QPHA 1FBQA 3VSKA 3KP5A 1WJDA 5D6EA 3H9GA 3HRMA 1R5ID 4M9XA 2MGQA 1F36A 3RKYA 4C3IJ 2P5LC 2XPUA 3HG9A 4U0WA 3BJAA 1ZLKA 2MA3A 1T0FA 2ZJPF 1YJNI 4A69C 4BEHB 3R0JA 1ZGWA 2FOKA 2QGUA 1VTNC 4BBSJ 3LSTA 4NC8A 2QQAA 3DV8A 1FOXA 3QPLA 2X0LA 2Q1ZB 2XB0X 4XMYA 1TP4A 3CUQB 3ISPA 3KP7A 4NBQA 1MGTA 4WXHA 5TJJA 2BXZA 5J4VA 4MHGA 1JJ8C 1OYWA 3U2RA 2GBYA 4G6QA 4FT8A 1HKSA 5L3BA 2E1MB 2X6XA 5L3FA 1PUFA 2JVGA 4UB8C 3MEXA 3RI4A 2ELHA 1TNSA 4BE0A 1R1VA 2HEOA 1S5LC 2HFHA 2MW8A 3CJTB 1EF4A 1BC7C 1AKHB 3MN2A 2AS5F 4UVBA 1J7KA 2X6WA 4HV5A 2EFNA 2ADUA 1T56A 3GUDA 3G6EI 1QHHD 4I98B 5FB2A 4HDVA 4HQEA 3B6AA 4CYCA 3IAM2 4DIQA 2VBZA 1WH5A 2A07F 4AYBN 1V5EA 3G73A 4PDKA 1SANA 1K7AA 1LDKB 2DA1A 3SYTA 2VASA 1HKQA 3FXRA 3VFZA 2AXTC 4XICA 5F64A 1FNNA 2GOXB 1BR4A 3GFJA 2HOSA 3BY6A 3HC7A 3Q9VA 1JI8A 3F8NA 2VB6A 4RM3A 1WRJA 2YSRA 4IOCF 1HW5A 2EV0A 3AG2H 3M3YJ 1JTXA 1XCBA 4N9IA 1RR7A 3W3CA 2VPRA 3JREA 3ZMVA 1ZTRA 3H9JA 3G4SI 4DZPA 4WXDA 1Q1HA 3JRGA 1RESA 3RPUD 5GPCA 4A3BJ 2LY1A 4BACA 3Q9SA 3HKZA 2Y69H 3FXUA 2JSCA 2P81A 4RGSA 1B6AA 5IT3A 4L5JA 5LGNA 1VI0A 2ZNZA 3KYCB 4EV0A 1KU3A 1P6RA 4G7ZF 5AONA 2JQ7A 3SJMA 4MGRA 5D4SA 2DT5A 2MFZA 2XASA 4HYEA 5EZGA 2DFEA 4BL0B 1LB2A 4BAYA 2BBYA 1Y0NA 3LWFA 2L7KA 3J7ZI 2BY0A 3ABKH 1JKRC 1Z0XA 3E6DA 3S93A 2VKEA 3P9IA 1TWGJ 4CSWA 3K4LA 4QLCU 1OCTC 3F21A 1FZPB 1U8BA 1X3WB 3E6BA 2LK2A 3M07A 3PFIA 4X1EA 5ILSA 1BW6A 5TGTA 2V1UA 3QP5A 2E1NA 2NOJB 2DI3A 1SVOA 1LVAA 2KL4A 4D7NA 1TTYA 4ETSA 5BOXA 2G7HA 4A3MJ 3ERED 2OQRA 4BXUA 4BE1A 1K6OA 3ZMDA 2CH0A 3K4KA 3MMYB 5AIQA 4B09A 3RCOA 1KQ8A 1PYVA 2BXYA 4KICA 3NQOA 4CCJA 2X6OA 1OYIA 2IPQX 2Q2EA 4R1HA 2VJIA 1ACIA 1OCCH 4I76A 1JKQC 5KK1A 1FTZA 3SFIA 3DBHB 3ABUA 2STTA 4I0BA 1Z9CA 5F6FA 1MW7A 2WAQA 4ZTJA 4XLAA 3HRUA 3HOXJ 1V54H 3L2UA 3CCSI 3E3VA 2CQQA 3M1CA 4D0PA 1XTAA 5C4XJ 1Z3YA 3ZMUA 4EJWA 3OYAA 4AIJA 1ZGAA 1TWHJ 1ZYRF 4L5EA 4BE2A 2LFBA 4M3BA 5BMZA 4Q5SF 4LG0B 1BIAA 4HX8A 5ICFA 3T5XA 2LMDA 2R7SA 4BDYA 4EJUA 1LFUP 4XRSG 2ESNA 3BJOA 4E70A 4E7HA 4HQMA 2XPWA 3OL4A 4A3KJ 4ZTFA 2KQRA 2IA2A 2M45A 5HS7A 4BY7J 3HUGB 1VQ8I 4KISA 3DXJF 2Y0SA 1IO2A 2M1BA 3TKYA 5KAIC 1MH3A 3CF2A 2LYCA 3BCBA 4HV6A 2VUMJ 4QPQA 1IRGA 3TOAA 4Q47A 1GXPA 4BS9A 4PJJA 4DBQA 3KIOA 1I5ZA 2JA6J 3GFLA 4YELA 1OJLA 4S04A 1WSUA 2XB5A 3ZPLA 1W0TA 2HYFA 3PO3J 3PUFA 2RAEA 3ZGKA 3ZMTA 1DU6A 3GYHX 4AIHA 3HDDA 4LK0F 2WB1N 4GYIA 2QQBA 3HGGA 1X2MA 4IHVA 4IJAA 4L5IA 2DOAA 4NHJA 2VXDA 3DTKA 2GQQA 4IF4A 4A6EA 1BJZA 3VSLA 2NVQJ 3UKGA 2LNBA 2FMYA 5EEAA 5IT9K 5BNGA 1W7PA 2P8TA 4JYKA 2E2IJ 1SD6A 3U21A 4G12A 3OYDA 1R58A 5LGUA 3ZQCA 2Z3YA 2JK3A 2QBYA 3FK6A 4CO8A 2KJCA 5DD4A 2ZKZA 3TDZC 2B63J 2R3SA 3K70D 1NTCA 2FEZA 5LRRA 3GTOJ 4QSHA 4Y3OA 3CF5F 2COMA 2COBA 3AAFA 1U6GA 1F4KA 2DT7B 2L9NA 2QWWA 4F55A 2CG4A 2CYYA 1O7FA 2WV0A 4ZDPA 4EGZA 1Z7UA 2ID3A 3LOCA 2L7MP 3FIWA 1ZH5A 2HQRA 4PZJA 2OZ6A 4JK1X 4PGHA 2QKLB 2L7FP 2XHKA 3CCJI 3GF2A 3ABTA 2KFDA 2X1DA 3M8EA 4CGZA 1FBSA 2FBKA 3SFZA 4WCGA 2Y9ZA 1BOBA 2DU9A 2X48A 2VQLA 4MTDA 2TCTA 4IZZA 1JUPA 3A02A 3I58A 2LG4A 5E17F 4EMSA 2IA0A 3R0AA 1ETYA 4BJ6C 2V1DA 1IN6A 2R7OA 4L0YB 1BR2A 1XN7A 1GUUA 3H3UA 4BEHA 4U88A 3VOEA 2LF8A 2O5RA 4XRFA 3E97A 5FFXA 2PX9A 1O3QA 4A3GJ 2A3SA 2VQHA 4XOPA 3CUQA 4A12A 5D5XB 2CUZA 3NARA 3F8FA 3ABMH 3HRSA 2R5YA 5L3GA 1G2HA 3M8FA 3VPRA 4IL6C 3ZQ7A 3WG7H 2QQ9A 3BJ6A 4A5MA 2QM3A 1MIJA 4AC0A 2L4MA 1IN4A 1Y1VJ 1IRZA 2NVUB 1VQOI 2CWEA 4FCYA 2J5PA 3HOUJ 1MMDA 3PSIA 3NWTA 1AKHA 4MTEA 1SFOJ 4XLNF 1IGNA 1P2FA 2GIVA 1UHSA 3CLOA 3L2CA 2IGMA 4D9JA 5EJCA 1RC9A 1B4AA 2E60A 1SD5A 1T0FC 3FBNB 4IHYA 2HXOA 3DLAA 3ZMSA 2IGNA 2NXNB 2O8XA 2OZUA 4E7IA 4RMNA 5J1UA 4BHCA 2M30A 4K2EA 3O3KA 3CCLI 4BQAA 1JTYA 2VBWA 3QODA 4CH7A 4RB3C 3DQVC 1S9HA 1YYVA 3IH2A 4JX6A 4BGDA 4BXFA 3I9V2 3BQYA 1Z05A 3DEEA 1N78A 3WHCA 1BI3A 2OU2A 4CCMA 4PUSA 3JRFA 2GXBA 1KA8A 3AG4H 1ONVA 2K3PA 2B0LA 3CMMA 1WKMA 5HNHA 3RTRA 1YX3A 2E19A 5LD2C 5J1YA 1MNMC 5K7FA 4OIQF 1IUFA 3J80Z 4E7KA 2E7WA 2KRFA 2EILH 3S32A 1IC8A 2WADA 2EZIA 3ZR8X 4OAZA 4BXXJ 2Z9OA 4UHTA 1ZREA 5B1BH 1VF9A 3EYYA 1L0OC 3D5LA 2DDBA 4MFDA 2IVMA 4E7ZA 1QNTA 2MLGA 1K78B 2JPCA 2H8WA 4V2GA 1IXCA 1IRXA 2V6CA 2EJRA 2OTLI 2JRTA 1FYMA 3TDUC 2QSGX 2IA1A 2IGOA 3K9TA 2RNGA 3ROUA 4UV9A 4UNOA 4XLPF 4XLHA 4CCNA 2YX7A 1YIJI 4JBAA 3HB9A 3I54A 1AHDP 1B9NA 2M0MA 1VQ6I 1M1EB 2BE5F 1OQYA 3BTIA 2RN7A 3WTSC 3JTGA 2GAUA 1I3AA 2GXGA 3FXLA 1E3OC 1UG0A 3WG9A 3RQ4A 1Z77A 4CDGA 3TGNA 3B02A 2DAOA 1S6LA 3EUKL 3A0HC 2HPMA 2H1KA 3AL0C 2FQ4A 1IN5A 2PN6A 3IP4B 3UNGC 3UR3C 1J9IA 4U87A 3I59B 3GFIA 4GDFA 1D1BA 1I50J 3IH3A 3KX2A 1FSHA 1JT6A 3S3OA 1VFCA 3GZ6A 1R23A 3VWBA 5E3OA 4M3EA 4LG0A 1QRYA 1U9OA 1ZR4A 2M8GX 2RVCA 2Q2EB 1MD0A 1TNTA 4DYQA 5D5VB 1YTYA 2LY9A 1RKTA 3DKWA 3J81Z 2O8KA 4BJTA 4LLNA 4ENKA 1SVLA 2HXIA 1S7OA 4E6KG 1R7JA 2KIFA 2YUSA 1ZN2A 3HUGA 4IXAA 4J01A 3W6VA 1ZELA 1VNDA 3C7JA 3PNVA 1XG1A 1HA8A 3CCYA 3BTCA 3K70C 1HXDA 2D2WA 2DFFA 1FSEA 4Y17A 4I02A 1K61A 1FX7A 3HPHA 2RREA 4HG2A 3IRRA 2WAEA 4KJZA 2R7XA 2K9LA 3OOPA 1DDNA 1MMSA 2JRMA 4UY8I 2WC2A 4BQQA 4ZZLA 1E3PA 3SXYA 3OS2A 3LFKA 3FMQA 1J75A 3K4NA 3O8GA 2OC6A 3W2VA 2G9WA 1RR8C 1TQMA 1ZLJA 1RUOA 3A2KA 4P9FA 4IHWA 1F1ZA 1QO0D 3DU5A 4LIUA 1LPQA 4LD5A 5TISC 3G71I 4ESJA 1X3ZB 2VN2A 5E3NA 2Z33A 1BC8C 4AVPA 4UXNA 1KQ0A 2P5VA 2VI6A 4FETA 2PMUA 4F93B 1LFPA 5B5EC 3V8LA 2M87A 1REPC 1XSXA 2XRLA 5FJ8J 4BHBA 4BUPA 2F5DA 5EG0B 2HTJA 2IJLA 4HX7A 2DTZA 4LG3A 1WGXA 4LJZF 3IV5A 3FXOA 5JR3A 1ZGJA 4IQ4A 1NHAA 1JUMA 1U2WA 4XONA 2XAQA 2HPIA 1X1DA 2ELKA 2WV1A 2K7LA 3VEPA 3P5JA 3IC7A 4PFOA 1FMWA 5DUKA 5KNLA 2VXZA 2F4OB 4HSTA 4HNUA 1KU9A 4HX4A 3M9AA 2LR8A 3N97A 2D1VA 3JRBA 1NK2P 2HKOA 1ZG5A 5HDKA 4YRVA 4CYDA 1Y8RB 5D4RA 2DXIA 2FSWA 4L9TA 1XX5A 1HW2A 2QQ8A 1AWCA 3FZVA 4AYBA 2IAIA 1ERDA 2BGCA 5EDNA 3HHHA 1IDYA 2ZXHA 4FISA 1MSFC 1R5HA 1UCRA 4UB6C 1U78A 4DBRA 2KISA 5B3SH 2PG4A 4LLLA 1LFBA 3RKQA 2I5UA 4PJNA 3H0GJ 4EM0B 4I2OA 3HOYJ 2DOEA 1JXSA 1EJ9A 2UUZA 2YS9A 1BIBA 2Z2SB 4Y7NJ 4YIRX 3SEZA 4E7JA 1PP8F 1TQIA 1E17A 1ENHA 3DCFA 4L9JA 1ZRFA 4UUTA 1E3HA 1DGRM 3RYPA 3JAMZ 1G4DA 1IN7A 2WA0A 1QGPA 1G3TA 2F2EA 1ORKA 3KE2A 2L5QA 3TMOA 1U5TB 2XKOA 2ISZA 1IJWC 3HSEA 2PMZA 5J1RA 3QYBA 1LEAA 3DPLC 4YIIA 2FRHA 3M7GA 3BQZA 2A61A 3I4NJ 2ZCWA 3S2WA 1SAUA 3ONQA 1XMAA 1WCMJ 3RIRA 1WI9A 2R5YB 3FX3A 1POGA 5CKTA 4F92B 3OYNA 4HLYA 3K1NA 4G6TB 3HRTA 2LD5A 2VC0A 1XGOA 1DPRA 2ISYA 2V1XA 3CUQC 4AIKA 1IAWA 5CLSA 2HQNA 3WGGA 1YOVB 1DQUA 2TDXA 3L2RA 1S7EA 2HDCA 2KP6A 4IX7A 4ANJA 4A2UA 2E1MC 2ZXWH 3FKIJ 3J7AY 1OR7A 3S14J 4ZDOA 4FE7A 3GEZA 1GV5A 1CF7B 4RAFA 4OIOF 4ASNA 6PAXA 1AA7A 2PMHA 3H9QA 1B59A 3E1SA 2RGVA 5GADJ 4KA4A 2DMQA 2HNHA 1BI1A 5FLMJ 3KEQA 3MKLA 3A01B 1V4RA 2QSHX 4P96A 2V26A 3QP6A 1NH3A 3LNQA 2ZJQF 3JW4A 3QPTA 2HKXA 2HDDA 5JHFA 3N05A 5IPAA 1ZHFA 1MMGA 4A3EJ 4DGWB 4CCKA 3QAHA 3U1KA 1SMTA 1K78A 2XDVA 4C2UA 2XGDA 3LSJA 2LP0A 1X4OA 5IOYA 3PUBA 4KIFA 3LSIA 2HOAA 3K2ZA 3VYTB 3FXJA 5E20A 3KEYA 5DD8A 2VT3A 1FBUA 1YITI 5F27A 4TV7A 1N25A 2K4JA 1QPMA 2H1LA 4AM3A 3FMRA 4RB2C 1A6QA 4S0HB 1HCRA 1KGSA 4QPOA 2ZXIA 2CV2A 3GBGA 2BVLA 2FNPA 2JWTA 4BU2A 3WHBA 4UUSB 4E7LA 1ZAOA 2XV4S 3K69A 4PJMA 3OYLA 4WF2A 4EJOA 3GO5A 2A5WA 3K4CA 2XGCA 3OMYA 1AU7A 2CGPA 1DPUA 3VODA 1FOWA 1MBFA 2XRNA 2BHYA 2HQAA 2K86A 1YFHA 2VJJA 2DA3A 2XAFA 3C18A 3CC7I 2CV0A 3S2DJ 2A6TA 4IHSA 1YRNB 4LITA 3U9GA 3DWLE 4H4KC 2L4AA 3CZ6A 4PSXA 4JX5A 4EVIA 2L9RA 5DTDA 1HOMA 1IXSB 1PDNC 3MCZA 4KNYA 2HDWA 3H3ZA 4M71A 1Z3XA 5L3EA 2DMNA 4U7BA 3G3ZA 4GGGA 2NS7A 2VL8A 1XS9A 1D8KA 2GA2A 2RC4A 2E2HJ 2UXXA 2WB1A 3RJPA 1MJ9A 3ABLH 2NNNA 4HSRA 3HIFA 2HU9A 3I59A 4IKFA 3HTUA 1A36A 1MSEC 2VKDA 2QYOA 3BP8A 4A3CJ 3ECOA 3TW6A 1WH7A 2DA5A 2XC7A 5DDGA 3BWGA 2XUBA 2X1CA 2OQGA 3GCMA 4B1RA 4CHUA 4PK4A 3K1MA 2E71A 4IEJA 5EZHA 4Y4RA 2VE8A 2QF7A 2XF7A 4I0AA 2AO9A 4XSXF 2ZJ2A 5CJ9A 1STZA 5DUIA 2HVRA 2DN0A 2KHMA 3BTJA 2MG4A 5H6RA 1GXQA 2EZLA 3F8MA 2IT0A 2F4IA 3BPXA 4XRSA 2LSOA 3SDGA 3V8JA 5FKKA 1VQLI 3FHZA 3V42A 2EFWA 1SAXA 4G7OF 4IQJA 4NNJA 2HYGD 2BVMA 2F5EA 4DOZA 1MJAA 4X0GA 3LAPA 2KMUA 1G6NA 4KMUX 4RM2A 1TC3C 5DM6F 1RPWA 1USTA 3KYLA 2YX4A 1MNEA 4B4CA 3T0YA 4B44A 1A35A 2K40A 2NVTJ 4OIRF 3KP2A 1T98A 2RKHA 3GZNB 4IHTA 1R9TJ 2EQRA 2UXNA 3DPUA 4OWRB 3TP3A 1FPQA 2IBDA 5JHUA 4NUBA 2OAZA 3H36A 2EFPA 2R5ZB 2I8DA 2FU4A 3F6VA 3BDDA 1TL8A 1UMQA 3ZN1A 2XPVA 2X85A 1L3LA 3GW2A 2EBIA 3PQJA 4E4HA 2GXAA 3HKZN 1MBGA 3L2WA 3LA2A 3IKTA 1UFMA 5EG0A 2VE9A 2M3AA 4GXOA 1Z6RA 1Y8QB 2QLZA 3F3XA 1S3JA 2E1OA 3I53A 2ZSHB 5JFRA 5JLXA 1WWXA 1BR1A 3BG7A 2H27A 4V2FA 5ICGA 5CVJA 1WVRA 4BH9A 3QRFF 1HSTA 2W82A 2XSJC 5BQTA 2K85A 4R79A 3W2AA 4EM2A 2HR3A 1YJWI 3TQNA 3MZYA 2V4JC 1P4XA 2Z1DA 2L0KA 3BOQA 3LMMA 3O6BB 4LMYA 3FMSA 3WGIA 1S72I 1IDZA 1I39A 1I3QJ 4P9UA 2BY3A 4F7ZA 2EIKH 3WU2C 5LRSA 4XRMA 2CQXA 3TP0A 2OF7A 5HLIA 2LKPA 1I27A 3BROA 2LY2A 4FX0A 3WU0A 4RLQA 2GZWA 1D3YA 2X4HA 2OUMA 1OISA 3J80K 3R6SA 3M4OJ 1EV7A 1D5VA 2QSFX 1OCPA 2VONA 3M8JA 4EJTA 2I10A 2PQ8A 1IRFA 4RGXA 3CC2I 2FA5A 3T8RA 2WTEA 1X1PA 2WAQN 3GTQJ 2KT0A 5AIPA 2BW3B 2UV1A 5CVVA 1G59A 2NVXJ 2R92J 5FO5A 1D0ZA 2DT6A 2VT2A 1H89C 1DGWY 2K9NA 2M4GA 3BG3A 5LFAA 1Y6IA 5EEHA 4XR6A 1GHCA 5B66C 4U7DA 4XKCA 3W2WA 3OYMA 1J09A 4IPAA 5FD6A 2MC4A 3HJEA 5L3DA 3F23A 3CO6C 1ETOA 1XGSA 3TO9A 4DYRA 2IEKA 1FJLA 2P4WA 5GTHC 3R61A 3J7AO 1WJBA 3DP7A 1U5TA 1YLFA 5FKMA 1HC8A 3NWSA 1C0WA 2JUGA 3S17J 1ODDA 3BR5A 5LHGA 2LBFB 4ZH4F 4CCLA 1MH4A 1KZHA 4CCOA 1DP7P 1Z91A 4HZFA 4XNFA 3K0LA 3Q0VA 1GVDA 3B6CA 2Q8KA 3HZJA 2CQKA 3NRVA 5BS6A 3GX4X 4M3FA 2L3DA 1N77A 2BHZA 1U8RA 2FUG2 2QCOA 3E0JB 4C2TA 3H5NA 4RLFA 1BBYA 1WI3A 1WJFA 1SFUA 1W36D 1BI2A 3C2GA 3OYFA 2R7FA 1CF7A 2AHQA 1Z6TA 2YU9J 2QEXI 4N9HA 3DBRB 1UZCA 4WXCA 5E8GA 2WAFA 2M0CA 2A6HF 3CJRB 4HAMA 3WE2A 1IF1A 3J81K 3OYJA 2RNJA 3A01A 3EQLF 5LEJA 2E5NA 2E5ZA 3NAUA 1T39A 2KJBA 3SZGA 3CCRI 1MDMB 4A0ZA 2GM4A 3PSFA 3H5AA 1MZBA 2Q0OA 4FQGA 2KIUA 1FOYA 2IS2A 1IZ1A 1Y39A 3S1MJ 2DOFA 3I56I 5E1XA 2JTVA 3REOA 4CUGA 3CC4I 5K7HA 4EEFG 3G1LA 1TWFJ 5DS9A 3SHFA 2QA4I 3CJNA 3JTHA 3GLXA 5FLXZ 4M3DA 4OAYA 3EUAA 4PJ0C 4HNTA 1XGMA 1OMIA 3EYIA 1OR7C 3RKXA 4P5OA 1K83J 1YW9A 1D5YA 4S05A 3RQIA 1VQPI 2KIMA 2KDOA 5LLQA 1OKRA 2E34A 1QQIA 2E36A 3I4MJ 5EF6A 4L9VA 1QZZA 2IS4A 2GIZA 5CQGA 3F72A 4UUSA 4ESFA 2H6CA 2DA7A 4DNCA 1OCRH 4B47A 5FKOA 3ZP5A 4BDZA 2UWMA 2NYXA 2DQRA 2CO5A 5F08A 2DDAA 2CFXA 1YRNA 2PI0A 4XN3A 2V79A 3E6CC 4A3JJ 4P1WA 9ANTA 1O3RA 3WTXC 3SDBA 2KKOA 2A5YB 2CW0F 2L54A 2LDUA 1XMKA 3AG3H 3ERMA 4U0VA 4G8XA 1S29A 3PFYA 4OMZA 1GT0C 2CS3A 2ACJA 1U9NA 2CUEA 1R1UA 2LOOA 4MQVA 2JSPA 1Y0UA 2WWYA 5LHIA 1UJ8A 3A0BC 2DMUA 1H9TA 4M3GA 4ZYDA 2CFOA 3BR1A 3E7LA 3GVAA 1W5CC 2ME6A 4PGGA 4I7HA 3MFKA 2EIMH 4Y13A 1MNDA 3GXOA 3L09A 4RAYA 2JA5J 3AFHA 3ESWB 2PBIA 1HDDC 1I1GA 4RGRA 3KZZA 3NEUA 2XSDC 2IXSA 4C30A 1MKMA 2EV6A 1R00A 4E7SA 5E79C 4CICA 4M9ZA 3PL8A 4M6VA 4HDUA 2IW5A 2VJ4A 3H92A 3QU6A 3K2AA 4LGWA 4DZJA 3OYEA 3S8PA 2CW8A 1QVUA 2D45A 1FT9A 1Y56A 3CP8A 3CMYA 1FC3A 1ON2A 2ZMEB 3S2HJ 4QWQA 4CXFA 4F3QA 2R7DA 2XAJA 2HS5A 3OYBA 4A6DA 2VOOA 3L2VA 2ZFWA 5ILUA 3I4PA 1UAAA 1EH8A 2HGCA 4OOIA 3F9KA 3QYEA 2B7EA 1NK3P 2STWA 3K6GA 5E18F 4B43A 1BN5A 2DA6A 2M4KA 1XB4A 1JE8A 2EWNA 1RKWA 1YW7A 3C2HA 1OCZH 4C3JJ 4QTRA 2M9HA 3HOVJ 2YR2A 5DCMB 2FF4A 5IOZA 1GV2A 2CQ7A 2EZKA 2OCEA 1VZ0A 2CUFA 2W48A 2R5ZA 4ABZA 4XQFA 5D6FA 3N4MA 2HQ5A 1NG7A 3JAMK 2JA2A 2LTPA 2O6GE 3LQRA 2DJIA 1H0MA 4I09A 2V6EA 3OS1A 3D5RC 2L7ZA 4KFCA 4AVZA 4DYCA 2AQEA 4IOAF 1VQNI 4KYWA 2A69F 2IS1A 3KFWX 3IL2A 3F22A 3TEDA 3S1QJ 3ZXSA 3ULQB 4XM3A 3FXKA 5F0FA 5HDNA 3BCAA 1H9GA 3R60A 4UV8A 3MKYB 2R0QC 2ECCA 1I6HJ 2GOMA 1HKTA 2H6BA 3CCQI 4N4NB 2NS8A 2WY8Q 5K5QA 3HOSA 1TW2A 1QVTA 2Z99A 3BZCA 3FISA 1YE9A 1ZG1A 2R7UA 1MBJA 5J47A 3HOWJ 3BR6A 2L9VA 3OIOA 5GAEJ 4L0ZB 2HVQA 2M5WA 3F8BA 1ZRCA 3HM5A 3L2QA 3FWEA 1SVMA 1YJ9I 1ZQ3P 2EA2A 4M6XA 2JA7J 1Z7LA 1IV8A 3O2PE 5H2FC 2DA2A 3JRIA 1XDUA 2WY7Q 1X1BA 2P6SA 1JJ6C 5ERIA 3F0CA 4RDUA 5C4JJ 2ZNYA 2HI3A 2EH3A 3FXQA 3IWZA 2OD5A 2L2OA 4A0YA 1IN8A 3G2BA 2W00A 5HOOA 1K4SA 3CCEI 4ON0A 1T95A 2BW3A 2MD0A 4G7HF 3OIQA 2ETHA 4XOTA 5D5UB 5B1AH 1FOKA 2DYRH 3L00A 3PNTA 1VQKI 3KPHA 2BZTA 2EPFA 4IRGA 4XSZF 1YO5C 2GLOA 2O9LA 1X4PA 3OSGA 2X6YA 1FP1D 3DEUA 3A03A 1TT0A 5HODA 5IYCJ 1APLC 1FWZA 3RPQA 3VYSB 1MBKA 1XMXA 2BEOA 3Q3SA 2QZ8A 2DMTA 2LF7A 5EGOB 3KYDB 1ETKA 3DKXA 1FY7A 2KZGA 3I64A 1R36A 3OIPA 4OIPF 2LBFA 3ZCOA 2W57A 3BZKA 5GP9A 2CV1A 3ZRGA 5GPAA 4NQWB 2FJ1A 1EA3A 2FMLA 4LB5A 2KDZA 2EK5A 1V3FA 2VBXA 3G1MA 4HF0A 1K4TA 3WTVC 1ZRDA 1BOAA 4RB1A 2TRTA 3HPGA 1W1WE 1YW8A 2P6TA 3HSFA 2ECBA 3CCUI 1P4AA 4G9YA 2FE3A 3L7WA 3JCUC 2P5KA 5IP9J 1QA6A 4A3DJ 2DW4A 4IVNA 3CQZJ 1SFXA 1IV6A 3V4GA 4D1QA 2H94A 4MNUA 3PQKA 1B1BA 3QQAA 1A6IA 4NC7A 1YX5A 2BY1A 2E2JJ 5J3LA 1BA5A 2XAHA 1BL0A 1DU0A 2BY2A 5D8LB 1U5TC 3OR2C 3K4MA 4HLXA 2X9DA 4R8HA 1E2XA 4BQNA 4XKBA 3V7SA 4DQ2A 2JZYA 3IRQA 1O3TA 2RDPA 5D8KB 1MDMA 4A5NA 3HBLA 3BG6A 3LSHA 3HL2A 4RAGA 4Y33A 1EKEA 5JLWA 4O6JA 4NC6A 1SEUA 1A31A 1YQAA 1R49A 3ZOBA 1F5TA 2Z16A 5K1YA 2BV6A 4IHXA 2NAZA 3FHNA 2P0WA 1R1TA 1T8IA 3PIOF 2F48A 4GO1A 3LAJA 1FYLA 3P9KA 3JRHA 1V5FA 2G7UA 1LJ9A 4IRHA 1KYWA 2FX0A 2HYJA 2NOGA 3IHUA 1X19A 1PJRA 2K27A 3KZYA 1Z21A 2KIQA 3FBIB 2XAUA 3MQ0A 4BQOA 3B73A 5E8IA 4G6DA 3AKZA 3MKWB 3TL4X 1UG2A 1JKPC 4DW6A 2DO7A 4RA2A 4C9YA 2VLAA 1WJCA 3E5QA 3DLLF 4YFKF 3BG5A 2OV7A 4GRIA 5FKLA 3WTZA 3DU6A 1UB9A 2PLYA 1E0EA 2GA1A 1UHWA 1G3WA 2VJ5A 3BG9A 4XLEA 3VYRB 2VKHA 2Y30A 1VQ4I 3HSRA 5H20A 5CVIA 5CVUA 1GLNA 3EPZA 2D1HA 3IH4A 1LVKA 2ZB9A 4EGYA 1SD7A 3ZQHA 4ESBA 5IP6A 4D5CA 1O4XA 3RKWA 2CJJA 1CQTA 1SFEA 1B8IB 2VKVA 1P7IA 3TO7A 4ZYAA 5ICEA 4M74A 4A0XA 1EH7A 1RI7A 4MIMA 3I5UA 4I6ZA 2JJ7A 4KIGA 2YU3A 3CP2A 5FKNA 4AD9A 1UHMA 2DFIA 1D0XA 3OR1C 3SZPA 3IKVA 1LE8B 3KP6A 1OCOH 4D7MA 2F5FA 2YPRA 3KP3A 4Y15A 1TWAJ 2FXAA 2B9SA 1TBXA 3S3NA 1RRJA 2K9QA 2P7VB 2QKMB 2RQQA 3E6MA 3EUHA 3HHGA 2VQGA 1FMVA 1DP3A 3CO7C 3OYCA 4DJAA 2DYSH 5C44J 2IS6A 1R22A 3RZDJ 1WFXA 3GWZA 2ZBKA 2PMZN 1P92A 5E1ZB 3JSOA 1Q1VA 3RDIA 3C2BA 2CSOA 2OBPA 3A1YA 5J8CA 2HOTA 2XAGA 3HGYA 2R4GA 4ZYGA 3QOPA 5J8FA 2KRHA 2ZMEA 5LGTA 4V19K 4PFPA 4YG2F 3OYGA 2Y2ZA 3DTIA 3OV8A 1P4WA 3P7NA 3WTYC 5M5YJ 1ETXA 5F04A 2QUFA 1TQPA 1X3UA 1YS7A 4WWCA 3CD6I 3MZ8A 1U0JA 5IY5H 1Z1DA 1OLTA 2FQ3A 1JKOC 1TLHB 2EA4A 2M7AA 3VYUB 4MLOA 3ZQGA 2NS0A 2W7NA 5BPIA 1W0UA 3DF8A 2VQCA 2V9VA 4A3LJ 3SEQA 1WHUA 3ZQLA 2HZTA 4HOBA 5DCMA 3J7YJ 2XGEA 3EETA 1SD4A 3O8HA 1P7JA 4XIDA 3EDPA 5F0HA 1R71A 3QU3A 1ETVA 1ZR2A 4Z2YA 4MO7A 1VQ7I 1QZEA 1TT5B 4PCQA 3S1NJ 2CU7A 5J4YA 3K1PA 4CZCA 4YEJA 5K7ZA 2ID6A 2DPDA 5L3CA 5LBQA 3FM3A 3ML6A 2R7TA 1IG7A 4II3A 2H8RA 2W25A 2CW7A 3BR0A 4ZJZA 2DK8A 3MD2A 1J5YA 3KCCA 1HF0A 3OYHA 2HTSA 5DCFA 1MJBA 2VIXA 5GAGJ 1H88C 2AQFA 3MKZA 4GYGA 2E1CA 2V1NA 4BYYA 3JRCA 3HXLA 4KDPA 1FIPA 2W24A 3X2QH 1OYYA 2M2EA 4KT6A 2DCEA 1R4MB 5A2QK 4Q4ZF 2HOEA 1P9QC 5J6XA 3GTKJ 3LFUA 1JHFA 2ELJA 3Q5FA 4BBRJ 3FXMA 2V9PA 2CRGA 1YI2I 2LC2A 3I0TA 3I55I 3ECHA 2CQNA 2JPBA 1PUEE 1ZK8A 3ZQFA 3VB2A 2Y48A 3AG1H 5M5XJ 1ULYA 3TOBA 3GTJJ 1FIAA 1MMNA 1X2NA 2F6CA 2K9SA 3HOTA 4M72A 3CLQA 1WPKA 2A68F 4AUXA 4MQ9F 2HVSA 3A4CA 4ZZDA 3ZN0A 2ZJRF 5IYBJ 4M6YA 2IRFG 2H09A 1KYZA 3PO2J 4HA8A 3P9CA 1XPXA 4XN0A 4MEXF 4LOCA 3CMAI 3CDIA 4ENNA 5FLXK 4NB5A 3D5SC 1RIOH 2DLLA 2LH9A 2MC3A 3HEFA 4FX4A 1KU2A 1QBJA 3CTAA 4M73A 3WGHA 1PP7U 4RAZA 4G94A 1R5GA 4AIDA 2MH9A 2V7FA 4II2A 1A04A 5HNFA 4ENMA 1LEBA 2LRDA 2EIJH 2L9SA 3CMEI 2ZSIB 2DPUA 1B72B 1D1AA 3TO6A 1LNWA 5EGOA 3H0DA 3CDHA 3BR2A 4UUVA 3K7AJ 4EM1A 3S16J 1S8NA 3MVPA 4MEYF 2N8GA 1O7LA 3BR3A 1UELB 3FF5A 3GFMA 3WTUC 2Y0MA 3D0SA 5F1JA 3MZHA 3PNYA 3H5RA 4NQWA 2W1OA 5HS8A 2DJNA 3KLOA 4B3AA 2K3FA 1GVJA 4JX4A 5GAHJ 1G3YA 3KP4A 3R4KA 3QPSA 4KIBA 5ED4A 1YIOA 2DFHA 4KITB 2MSYA 4O3MA 2VOPA 2Y0SN 4FHTA 4EQQA 4KT5C 4B8XA
chains in the Genus database with same CATH topology
1Y56A 2X1EA 2UUZA 2CH0A 3K4KA 3CP8A 3MMYB 1N75A 2Z2SB 1V5GA 3RCOA 4J00A 3I3LA 1PYVA 3SEZA 4E7JA 2IGKA 4CCJA 4F3QA 1WJ5A 3OYBA 3L2VA 1UAAA 2VJIA 3BC8A 1DGRM 2CMPA 4XLFA 3F9KA 3QYEA 2WA0A 3K6GA 4B43A 4AU7A 3OWTA 2L5QA 2M4KA 3TMOA 4ZDLA 1MW7A 2WAQA 4ZTJA 4XLAA 2PMZA 3L2UA 3QYBA 3C2HA 3DPLC 3M1CA 1Z3YA 3OYAA 4BE2A 1SAUA 3ONQA 1VZ0A 1QHGA 5CKTA 4F92B 3OYNA 4XQFA 4G6TB 2R7SA 4BDYA 1NG7A 3FDYA 4E7HA 2JA2A 3OL4A 1DQUA 4ZTFA 2DJIA 2V6EA 2KQRA 3D5RC 3OS1A 3L2RA 2KP6A 4AVZA 4IX7A 3HUGB 4ANJA 4KISA 2AQEA 2K9MA 2Y0SA 2E1MC 3J7AY 4ZDOA 2IS1A 4LIVA 3CF2A 2LYCA 1AA7A 3BCBA 3ZXSA 4XM3A 4QPQA 3BCAA 3H9QA 3E1SA 3MKYB 4BS9A 4PJJA 2GOMA 2HNHA 4DBQA 2CUJA 2MABA 4YELA 4HRIA 4N4NB 2V26A 2WY8Q 3HOSA 4JOMA 4F52A 1X1AA 1YE9A 3N05A 5JHFA 3ZGKA 2R7UA 1MMGA 4DGWB 4CCKA 2HVQA 2XDVA 4C2UA 3L2QA 1X4OA 3PUBA 2VPLA 3LSIA 3FKJA 3VYTB 2KZVA 1Z7LA 3KEYA 5HLTA 2DOAA 2VXDA 3LSKA 3DTKA 2WY7Q 1X1BA 3RSNA 2CV2A 4QPOA 2ZXIA 5KCMA 4B3XA 3VSLA 3GBGA 2BVLA 2L2OA 5CPRB 3G2BA 2W00A 3CESA 5HOOA 4BU2A 4E7LA 3OOUA 2ZFUA 3U21A 4PJMA 3OYDA 3OYLA 4PSWA 1T95A 3K4CA 2A5WA 2MD0A 2BW3A 3OMYA 3OIQA 4XOTA 2HQAA 2F5VA 2VJJA 4HEA2 3K70D 3PNTA 5CQEA 4CA0A 4Y3OA 1X4PA 2CV0A 2X6YA 2A6TA 4LITA 3DWLE 1TT0A 2DT7B 2JVHA 2L9NA 3QYFA 4H4KC 3CZ6A 4PSXA 4F55A 3OL3A 2X51A 3VYSB 4ZDPA 2HDWA 1Z3XA 4XLCA 4U7BA 2VL8A 3EUHC 1MMAA 2QKLB 2WB1A 3DKXA 2KPMA 3BLYA 2X1DA 3OIPA 4HSRA 2HU9A 4IKFA 3LSMA 2LBFA 3ZCOA 1BOBA 2CV1A 3ZRGA 2VKDA 2VQLA 4NQWB 2M7BA 2XF6A 4XKVA 1EA3A 1TZLA 2XC7A 4IZZA 2LG4A 3AL0B 4BJ5C 5FRMA 2X1CA 2KLOA 3HPGA 4BJ6C 4PK4A 4Y4RA 4F91B 2R7OA 1BR2A 2XF7A 4EATA 4BEHA 5FRNA 3CJQB 2O5RA 2HVRA 2K5CA 2KHMA 4D1QA 1QU3A 2VQHA 4XOPA 2F4IA 4NC7A 1YX5A 2CUZA 3IUOA 3V42A 2BOLA 4IQJA 4NNJA 3OR2C 2BVMA 4DOZA 3K4MA 4ITVA 4X0GA 2KMUA 4JQFA 1LKXA 4RM2A 4BQNA 4XKBA 3DPTA 3KYLA 3BG6A 2R7VA 1MMDA 3LSHA 1MNEA 3NWTA 3PSIA 4Y33A 4B44A 3HL2A 4XORA 2IGMA 4D9JA 2Z16A 2HZDA 2E60A 2V9KA 1T0FC 3FBNB 3DLAA 3FHNA 5KHDA 2IGNA 3DPUA 4OWRB 3QOEA 2MYSA 2P0WA 4E7IA 4XL9A 4NUBA 4RMNA 4ZC3A 2I8DA 1V5FA 3QODA 4CH7A 3DQVC 1S9HA 2X85A 4BGDA 4E4HA 4BXFA 3I9V2 1X19A 1PJRA 3L2WA 3DEEA 1N78A 1Z21A 3FBIB 4BQOA 2M3AA 2XAUA 4PUSA 4CCMA 3H35A 3TBIA 3AKZA 3MKWB 3LL7A 2K3PA 3TL4X 1D0YA 3OYKA 4C9YA 2VLAA 1WJCA 3CMMA 2OV7A 4GRIA 2ZSHB 3RTRA 1YX3A 5HNHA 5LD2C 3DU6A 1E0EA 1BR1A 2VJ5A 3BG7A 4XLEA 3VYRB 1D1CA 2VKHA 4E7KA 4FASD 5FROA 1NG6A 1GLNA 3EPZA 3S32A 1X1CA 1LVKA 2W82A 2XSJC 4R79A 3W2AA 2WADA 3ZR8X 3ZQQA 4OAZA 2V4JC 2W4SA 2Z1DA 3LMMA 3OS0A 4XKWA 4ZYAA 3D5LA 3K10A 3PJRA 3K4JA 4E7ZA 3CP2A 1R6RA 3LSGA 1W36C 2LY2A 1D0XA 3OR1C 1IRXA 4RLQA 1WJAA 2R7WA 2OUMA 1WJEA 2XF5A 3S3NA 2QKMB 2RQQA 3M8JA 2VQGA 3DTEA 2IGOA 3OYIA 5HVQC 2RNGA 1FMVA 1DP3A 3OYCA 4DJAA 2IS6A 4XLHA 3DKYA 1WFXA 4CCNA 4B48A 3IAS2 2BW3B 2UV1A 1G59A 1D0ZA 2PJRA 2DT6A 4PJLA 1DGWY 1SFKA 2R7QA 2M0MA 2M4GA 2WBMA 3A1YA 4N4OB 1Y6IA 2R4GA 5LFAA 4XR6A 3K4BA 2KRHA 2KRCA 4XKCA 3W2WA 4PFPA 1J09A 3OYMA 2R7RA 3OYGA 2LREA 2MC4A 3DTIA 1G8XA 1UG0A 3OY9A 3RQ4A 4HPQA 1U0JA 1OLTA 3EUKL 2M7AA 1WJBA 2HPMA 3VYUB 3AL0C 4MLOA 3IP4B 2W7NA 3NWSA 3UNGC 3VDXA 2JUGA 2VQCA 3UR3C 3SEQA 4U87A 2LBFB 4CCLA 3S3MA 1D1BA 1K6YA 3KX2A 4CCOA 3S3OA 3VWBA 1KONA 3VSKA 4XNFA 1WJDA 3H9GA 2Q2EB 1N77A 3HG9A 4CZCA 4BJTA 2FUG2 4YEJA 3E0JB 4C2TA 4BEHB 2R7TA 3H5NA 4II3A 4E6KG 4RLFA 2CW7A 4ZJZA 4J01A 4NC8A 1ZELA 3MD2A 1WJFA 2Q1ZB 3PNVA 4XMYA 1W36D 3C2GA 3OYHA 3OYFA 1HA8A 2VIXA 3K70C 2AQFA 3MKZA 2V1NA 3HXLA 2WAFA 3HPHA 2RREA 3CJRB 4HG2A 2WAEA 2DCEA 2E1MB 4KJZA 4KT6A 3OYJA 2R7XA 2K9LA 2X6XA 1P9QC 2JVGA 2E5NA 2E5ZA 4BQQA 4BE0A 3LFUA 3SZGA 2ELJA 3PSFA 3OS2A 3H5AA 3K4NA 2IS2A 2OC6A 2X6WA 3W2VA 2LC2A 4CUGA 1QHHD 3A2KA 3IAM2 4DIQA 3DU5A 4OAYA 4LIUA 3EUAA 4HNTA 1V5EA 1MMNA 3HOTA 1LDKB 1OR7C 2F6CA 4P5OA 3SYTA 2VASA 4FETA 4F93B 1LFPA 2KDOA 2GOXB 1BR4A 2HVSA 4BUPA 3A4CA 2IS4A 3HC7A 5CQGA 4LG3A 1JI8A 2VB6A 4RM3A 4XN0A 4B47A 4BDZA 4IQ4A 2UWMA 4XONA 3D5SC 2LH9A 2HPIA 3W3CA 1X1DA 3H9JA 4XN3A 4PFOA 1FMWA 4P1WA 3SDBA 2V7FA 4II2A 3RPUD 5KNLA 5HNFA 2VXZA 2LRDA 2LY1A 4HSTA 4HNUA 3PFYA 2L9SA 4BACA 2ZSIB 3HKZA 2CS3A 2LOOA 1D1AA 2JSPA 4YRVA 3H0DA 2DXIA 2CFOA 2MFZA 4BL0B 1UELB 2L7KA 1MNDA 4AYBA 3AFHA 3S93A 1ERDA 3PNYA 3H5RA 4CSWA 2W1OA 3K4LA 2IXSA 2ZXHA 4C30A 4DBRA 4E7SA 5TGTA 2NOJB 3PL8A 2KL4A 4KITB 4PJNA 2VJ4A 3OYEA 3S8PA 2CW8A 4BE1A 2PJRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLO A;  2RQQ A;  3A4C A; 
#chains in the Genus database with same CATH topology
 2X1E A;  1B9M A;  1YS6 A;  2IP2 A;  5JVG F;  1HW1 A;  1N75 A;  1V5G A;  4J00 A;  3I3L A;  3ZQI A;  4O5V A;  2IGK A;  1IUY A;  1WJ5 A;  5F0C A;  2BYV E;  5HS9 A;  5IP7 J;  3H3V K;  3BZ6 A;  1T38 A;  3BC8 A;  2CMP A;  4AWX B;  4XLF A;  5A2Q Z;  2VC1 A;  2UZK A;  2EZH A;  3RYR A;  3CDL A;  3JSP A;  4AU7 A;  2PEX A;  1EH6 A;  3OWT A;  5E3L A;  1Y1W J;  4ZDL A;  3F8C A;  3WTW C;  1T2K A;  3I71 A;  4I99 C;  1HDP A;  2K02 A;  3GTM J;  4U0Y A;  2ZC2 A;  1QHG A;  5DEQ A;  3W6J B;  1ITY A;  3L9F A;  4JP0 A;  5FGM A;  2O03 A;  1RUN A;  5EEG A;  2ZXJ A;  3T1B A;  3KLN A;  4BY1 J;  5JVT A;  2FBH A;  3FDY A;  2ESH A;  4LFU A;  1J59 A;  1I6X A;  4HF1 A;  4UVC A;  2QEN A;  3HTS B;  2EB7 A;  4ENJ A;  4KMF A;  1O57 A;  2DK5 A;  5K5O A;  2Y31 A;  2A05 A;  5E3M A;  2K9M A;  1RET A;  5DYM A;  3T8T A;  5D5W B;  4IO9 F;  4Z6Y A;  1XDS A;  1QPI A;  1HQC A;  1FTT A;  4LIV A;  3GTG J;  3W6K B;  1W7P D;  1U3E M;  2OTJ I;  4ZYH A;  2LVS A;  2FBI A;  4I01 A;  3L1P A;  3C1D A;  1HBX G;  1I1S A;  3LA3 A;  2FD5 A;  2CUJ A;  3U1D A;  1RZ4 A;  2MAB A;  4YIF A;  1PUF B;  4HRI A;  4N0B A;  1VQ9 I;  4JOM A;  1B8I A;  4F52 A;  3WOD F;  4X6A J;  1X1A A;  5FLV A;  2DTR A;  5ICC A;  5IT9 Z;  1USS A;  4WX9 A;  1F43 A;  3GME A;  1ETQ A;  1JUS A;  1GDT A;  4UVA A;  4CYC B;  2VPL A;  1XCV A;  5ILV A;  4P55 A;  2NRA C;  3V8K A;  1LE8 A;  3BTL A;  2NVY J;  2XKP A;  1W4M A;  2KZV A;  3FKJ A;  5F1R A;  2Y9Y A;  5HLT A;  2MBF A;  3F6O A;  1BM9 A;  4A3I J;  2FNA A;  5BPD A;  1ZAR A;  3E5X A;  3PM1 A;  3COA C;  3LSK A;  3RZO J;  4MFE A;  2DOD A;  1OPC A;  1J2X A;  4M9S A;  3RSN A;  1T33 A;  5KCM A;  1MBE A;  4B3X A;  5DM7 F;  5CPR B;  1ZKG A;  4Q48 A;  1XC5 A;  3CES A;  3PIP F;  1FP2 A;  3LSP A;  2PJR B;  3OOU A;  3SQN A;  3S15 J;  2ZFU A;  3V7R A;  3JR9 A;  4PSW A;  1J0R A;  2E35 A;  5HLG A;  4A93 J;  4L18 B;  2W84 A;  4HF2 A;  4Y52 J;  2VOD A;  2F5V A;  4HEA 2;  4C3H J;  2M34 A;  3G1O A;  4OIN F;  5CQE A;  4CA0 A;  1FLI A;  3DFG A;  1XGN A;  3C3W A;  4C2M J;  1HLV A;  2JA8 J;  2P7C B;  2QVO A;  3DEW A;  1ETW A;  2JVH A;  3QYF A;  1G3S A;  5LEK A;  3CCM I;  1ZG3 A;  4KN4 X;  1LQ1 A;  3OL3 A;  1ON1 A;  5M3F J;  2X51 A;  4KUM A;  3V7C A;  3Q0W A;  1CGP A;  4XLC A;  3CUO A;  3EUH C;  5H6Q A;  1YHQ I;  4W97 A;  1S7A A;  1VQM I;  1MMA A;  2A6E F;  3GTP J;  1AOY A;  3BT9 A;  2KPM A;  2EFQ A;  3BLY A;  3LSM A;  3LSR A;  1R4N B;  2F4M B;  2Y75 A;  2R7Z J;  3S1R J;  2M7B A;  2XF6 A;  4XKV A;  1TZL A;  5FFZ A;  3LQQ A;  4BKX A;  3AL0 B;  3H1C A;  4BJ5 C;  5FRM A;  2KLO A;  2JMW A;  1TWC J;  1XD7 A;  1O3S A;  5JI6 A;  4F91 B;  3ELK A;  2ZME C;  2L02 A;  2JN6 A;  4EAT A;  2VBY A;  5EYR A;  5TRD A;  4L9N A;  5FRN A;  3CJQ B;  3WU1 B;  2K5C A;  5CVR A;  2Z5U A;  1JGG A;  1QU3 A;  1MBH A;  2MH2 A;  2O7O A;  3IUO A;  2OA4 A;  2XIG A;  2BOL A;  4LB6 B;  4NDL A;  2RQP A;  3TW7 A;  4HW0 A;  4ITV A;  3D1N I;  1OFC X;  4JQF A;  1HSJ A;  1LKX A;  1XSD A;  3KET A;  1V55 H;  3DPT A;  2L01 A;  1K79 A;  2EFO A;  2EIN H;  4RBO A;  2R7V A;  3MAJ A;  1KU7 A;  2DA4 A;  4XOR A;  1SC7 A;  1QZY A;  2J5O A;  1KQ9 A;  2HZD A;  5DV5 A;  2V9K A;  4XBF A;  2O3F A;  1BJA A;  5KHD A;  4IRI A;  4OMY A;  3QOE A;  2MYS A;  4XL9 A;  4ZC3 A;  2XRO A;  3FK7 A;  4HNV A;  1DUX C;  1LUJ B;  3IWF A;  4LK1 F;  3JRA A;  4FE4 A;  1F9N A;  2D5V A;  4YFX F;  1IXR C;  5HLH A;  1D8J A;  2DMP A;  5K5R A;  3M1E A;  4J19 A;  1T08 B;  3DBL B;  4EJV A;  4YFN F;  4QIW N;  2NNY A;  3WE3 A;  1Z67 A;  3H35 A;  3TBI A;  5M3M J;  3LL7 A;  3WTT C;  2LKX A;  1D0Y A;  5C3E J;  3OYK A;  3BPV A;  2DBB A;  5HDG A;  3SZT A;  2GWR A;  2LLK A;  4HBL A;  1RNL A;  1IW7 F;  1W5S A;  1WZ2 A;  3QWL A;  4CZZ A;  1D1C A;  4WK8 F;  2ICW G;  1BW5 A;  4FAS D;  1T6S A;  2JT1 A;  5FRO A;  1NG6 A;  3KEO A;  5LHH A;  1X1C A;  1FEX A;  1XSV A;  2G0E A;  3ASO H;  3ZQQ A;  1A5J A;  3KZI C;  1VQ5 I;  2EV5 A;  2W4S A;  3OS0 A;  4BNC A;  4XK4 A;  4BHP A;  3ASN H;  4XKW A;  2PFB A;  1B72 A;  2MLK A;  2R93 J;  3K10 A;  2W85 A;  3GLL A;  3PJR A;  3K4J A;  4GCV A;  4A3F J;  1R6R A;  3LSG A;  1LDD A;  1W36 C;  3JRD A;  4FTH A;  1WJA A;  2R7W A;  3E5U A;  3GTL J;  1WQ2 A;  1H8A C;  1WJE A;  2XF5 A;  4KN7 X;  1JT0 A;  1TW3 A;  4H0E A;  3FM5 A;  5J40 A;  3DTE A;  2HWV A;  3OYI A;  5IYD J;  2M8E A;  5HVQ C;  3LA7 A;  2ME0 A;  2RV8 A;  1SMY F;  4ZYE A;  1W7P B;  5M5W J;  5KAF C;  2JUC A;  2OPT A;  3DKY A;  5CYV A;  3Q0U A;  4B48 A;  2QBY B;  3IAS 2;  2AXL A;  5GTI C;  2PJR A;  2LKS A;  2MD5 A;  4PJL A;  3CCV I;  1LDJ A;  1SFK A;  1YG2 A;  2R7Q A;  2WBM A;  4N4O B;  2O0Y A;  1X58 A;  3ZMZ A;  3K4B A;  2C6Y A;  1JGS A;  2E7X A;  2KRC A;  2PJP A;  2R7R A;  1PVE A;  2F5C A;  4RB0 A;  2OJE D;  3OSF A;  2LRE A;  2OCC H;  2XGX A;  2XVC A;  3GZ5 A;  1G8X A;  4OU0 A;  3HOZ J;  2ZO4 A;  3MWM A;  3OY9 A;  2DQL A;  4HPQ A;  4D5F A;  1FYK A;  5FD5 A;  3HYI A;  2O61 A;  4RGU A;  1BI0 A;  2FOW A;  4W1U A;  1W5T A;  3VDX A;  2K4B A;  4GFB A;  3RPU A;  4RS8 A;  4LLG F;  5KVR A;  3S3M A;  1K6Y A;  5E1W A;  1KON A;  1JHH A;  3QPH A;  1FBQ A;  3VSK A;  3KP5 A;  1WJD A;  5D6E A;  3H9G A;  3HRM A;  1R5I D;  4M9X A;  2MGQ A;  1F36 A;  3RKY A;  4C3I J;  2P5L C;  2XPU A;  3HG9 A;  4U0W A;  3BJA A;  1ZLK A;  2MA3 A;  1T0F A;  2ZJP F;  1YJN I;  4A69 C;  4BEH B;  3R0J A;  1ZGW A;  2FOK A;  2QGU A;  1VTN C;  4BBS J;  3LST A;  4NC8 A;  2QQA A;  3DV8 A;  1FOX A;  3QPL A;  2X0L A;  2Q1Z B;  2XB0 X;  4XMY A;  1TP4 A;  3CUQ B;  3ISP A;  3KP7 A;  4NBQ A;  1MGT A;  4WXH A;  5TJJ A;  2BXZ A;  5J4V A;  4MHG A;  1JJ8 C;  1OYW A;  3U2R A;  2GBY A;  4G6Q A;  4FT8 A;  1HKS A;  5L3B A;  2E1M B;  2X6X A;  5L3F A;  1PUF A;  2JVG A;  4UB8 C;  3MEX A;  3RI4 A;  2ELH A;  1TNS A;  4BE0 A;  1R1V A;  2HEO A;  1S5L C;  2HFH A;  2MW8 A;  3CJT B;  1EF4 A;  1BC7 C;  1AKH B;  3MN2 A;  2AS5 F;  4UVB A;  1J7K A;  2X6W A;  4HV5 A;  2EFN A;  2ADU A;  1T56 A;  3GUD A;  3G6E I;  1QHH D;  4I98 B;  5FB2 A;  4HDV A;  4HQE A;  3B6A A;  4CYC A;  3IAM 2;  4DIQ A;  2VBZ A;  1WH5 A;  2A07 F;  4AYB N;  1V5E A;  3G73 A;  4PDK A;  1SAN A;  1K7A A;  1LDK B;  2DA1 A;  3SYT A;  2VAS A;  1HKQ A;  3FXR A;  3VFZ A;  2AXT C;  4XIC A;  5F64 A;  1FNN A;  2GOX B;  1BR4 A;  3GFJ A;  2HOS A;  3BY6 A;  3HC7 A;  3Q9V A;  1JI8 A;  3F8N A;  2VB6 A;  4RM3 A;  1WRJ A;  2YSR A;  4IOC F;  1HW5 A;  2EV0 A;  3AG2 H;  3M3Y J;  1JTX A;  1XCB A;  4N9I A;  1RR7 A;  3W3C A;  2VPR A;  3JRE A;  3ZMV A;  1ZTR A;  3H9J A;  3G4S I;  4DZP A;  4WXD A;  1Q1H A;  3JRG A;  1RES A;  3RPU D;  5GPC A;  4A3B J;  2LY1 A;  4BAC A;  3Q9S A;  3HKZ A;  2Y69 H;  3FXU A;  2JSC A;  2P81 A;  4RGS A;  1B6A A;  5IT3 A;  4L5J A;  5LGN A;  1VI0 A;  2ZNZ A;  3KYC B;  4EV0 A;  1KU3 A;  1P6R A;  4G7Z F;  5AON A;  2JQ7 A;  3SJM A;  4MGR A;  5D4S A;  2DT5 A;  2MFZ A;  2XAS A;  4HYE A;  5EZG A;  2DFE A;  4BL0 B;  1LB2 A;  4BAY A;  2BBY A;  1Y0N A;  3LWF A;  2L7K A;  3J7Z I;  2BY0 A;  3ABK H;  1JKR C;  1Z0X A;  3E6D A;  3S93 A;  2VKE A;  3P9I A;  1TWG J;  4CSW A;  3K4L A;  4QLC U;  1OCT C;  3F21 A;  1FZP B;  1U8B A;  1X3W B;  3E6B A;  2LK2 A;  3M07 A;  3PFI A;  4X1E A;  5ILS A;  1BW6 A;  5TGT A;  2V1U A;  3QP5 A;  2E1N A;  2NOJ B;  2DI3 A;  1SVO A;  1LVA A;  2KL4 A;  4D7N A;  1TTY A;  4ETS A;  5BOX A;  2G7H A;  4A3M J;  3ERE D;  2OQR A;  4BXU A;  4BE1 A;  1K6O A;  3ZMD A;  2CH0 A;  3K4K A;  3MMY B;  5AIQ A;  4B09 A;  3RCO A;  1KQ8 A;  1PYV A;  2BXY A;  4KIC A;  3NQO A;  4CCJ A;  2X6O A;  1OYI A;  2IPQ X;  2Q2E A;  4R1H A;  2VJI A;  1ACI A;  1OCC H;  4I76 A;  1JKQ C;  5KK1 A;  1FTZ A;  3SFI A;  3DBH B;  3ABU A;  2STT A;  4I0B A;  1Z9C A;  5F6F A;  1MW7 A;  2WAQ A;  4ZTJ A;  4XLA A;  3HRU A;  3HOX J;  1V54 H;  3L2U A;  3CCS I;  3E3V A;  2CQQ A;  3M1C A;  4D0P A;  1XTA A;  5C4X J;  1Z3Y A;  3ZMU A;  4EJW A;  3OYA A;  4AIJ A;  1ZGA A;  1TWH J;  1ZYR F;  4L5E A;  4BE2 A;  2LFB A;  4M3B A;  5BMZ A;  4Q5S F;  4LG0 B;  1BIA A;  4HX8 A;  5ICF A;  3T5X A;  2LMD A;  2R7S A;  4BDY A;  4EJU A;  1LFU P;  4XRS G;  2ESN A;  3BJO A;  4E70 A;  4E7H A;  4HQM A;  2XPW A;  3OL4 A;  4A3K J;  4ZTF A;  2KQR A;  2IA2 A;  2M45 A;  5HS7 A;  4BY7 J;  3HUG B;  1VQ8 I;  4KIS A;  3DXJ F;  2Y0S A;  1IO2 A;  2M1B A;  3TKY A;  5KAI C;  1MH3 A;  3CF2 A;  2LYC A;  3BCB A;  4HV6 A;  2VUM J;  4QPQ A;  1IRG A;  3TOA A;  4Q47 A;  1GXP A;  4BS9 A;  4PJJ A;  4DBQ A;  3KIO A;  1I5Z A;  2JA6 J;  3GFL A;  4YEL A;  1OJL A;  4S04 A;  1WSU A;  2XB5 A;  3ZPL A;  1W0T A;  2HYF A;  3PO3 J;  3PUF A;  2RAE A;  3ZGK A;  3ZMT A;  1DU6 A;  3GYH X;  4AIH A;  3HDD A;  4LK0 F;  2WB1 N;  4GYI A;  2QQB A;  3HGG A;  1X2M A;  4IHV A;  4IJA A;  4L5I A;  2DOA A;  4NHJ A;  2VXD A;  3DTK A;  2GQQ A;  4IF4 A;  4A6E A;  1BJZ A;  3VSL A;  2NVQ J;  3UKG A;  2LNB A;  2FMY A;  5EEA A;  5IT9 K;  5BNG A;  1W7P A;  2P8T A;  4JYK A;  2E2I J;  1SD6 A;  3U21 A;  4G12 A;  3OYD A;  1R58 A;  5LGU A;  3ZQC A;  2Z3Y A;  2JK3 A;  2QBY A;  3FK6 A;  4CO8 A;  2KJC A;  5DD4 A;  2ZKZ A;  3TDZ C;  2B63 J;  2R3S A;  3K70 D;  1NTC A;  2FEZ A;  5LRR A;  3GTO J;  4QSH A;  4Y3O A;  3CF5 F;  2COM A;  2COB A;  3AAF A;  1U6G A;  1F4K A;  2DT7 B;  2L9N A;  2QWW A;  4F55 A;  2CG4 A;  2CYY A;  1O7F A;  2WV0 A;  4ZDP A;  4EGZ A;  1Z7U A;  2ID3 A;  3LOC A;  2L7M P;  3FIW A;  1ZH5 A;  2HQR A;  4PZJ A;  2OZ6 A;  4JK1 X;  4PGH A;  2QKL B;  2L7F P;  2XHK A;  3CCJ I;  3GF2 A;  3ABT A;  2KFD A;  2X1D A;  3M8E A;  4CGZ A;  1FBS A;  2FBK A;  3SFZ A;  4WCG A;  2Y9Z A;  1BOB A;  2DU9 A;  2X48 A;  2VQL A;  4MTD A;  2TCT A;  4IZZ A;  1JUP A;  3A02 A;  3I58 A;  2LG4 A;  5E17 F;  4EMS A;  2IA0 A;  3R0A A;  1ETY A;  4BJ6 C;  2V1D A;  1IN6 A;  2R7O A;  4L0Y B;  1BR2 A;  1XN7 A;  1GUU A;  3H3U A;  4BEH A;  4U88 A;  3VOE A;  2LF8 A;  2O5R A;  4XRF A;  3E97 A;  5FFX A;  2PX9 A;  1O3Q A;  4A3G J;  2A3S A;  2VQH A;  4XOP A;  3CUQ A;  4A12 A;  5D5X B;  2CUZ A;  3NAR A;  3F8F A;  3ABM H;  3HRS A;  2R5Y A;  5L3G A;  1G2H A;  3M8F A;  3VPR A;  4IL6 C;  3ZQ7 A;  3WG7 H;  2QQ9 A;  3BJ6 A;  4A5M A;  2QM3 A;  1MIJ A;  4AC0 A;  2L4M A;  1IN4 A;  1Y1V J;  1IRZ A;  2NVU B;  1VQO I;  2CWE A;  4FCY A;  2J5P A;  3HOU J;  1MMD A;  3PSI A;  3NWT A;  1AKH A;  4MTE A;  1SFO J;  4XLN F;  1IGN A;  1P2F A;  2GIV A;  1UHS A;  3CLO A;  3L2C A;  2IGM A;  4D9J A;  5EJC A;  1RC9 A;  1B4A A;  2E60 A;  1SD5 A;  1T0F C;  3FBN B;  4IHY A;  2HXO A;  3DLA A;  3ZMS A;  2IGN A;  2NXN B;  2O8X A;  2OZU A;  4E7I A;  4RMN A;  5J1U A;  4BHC A;  2M30 A;  4K2E A;  3O3K A;  3CCL I;  4BQA A;  1JTY A;  2VBW A;  3QOD A;  4CH7 A;  4RB3 C;  3DQV C;  1S9H A;  1YYV A;  3IH2 A;  4JX6 A;  4BGD A;  4BXF A;  3I9V 2;  3BQY A;  1Z05 A;  3DEE A;  1N78 A;  3WHC A;  1BI3 A;  2OU2 A;  4CCM A;  4PUS A;  3JRF A;  2GXB A;  1KA8 A;  3AG4 H;  1ONV A;  2K3P A;  2B0L A;  3CMM A;  1WKM A;  5HNH A;  3RTR A;  1YX3 A;  2E19 A;  5LD2 C;  5J1Y A;  1MNM C;  5K7F A;  4OIQ F;  1IUF A;  3J80 Z;  4E7K A;  2E7W A;  2KRF A;  2EIL H;  3S32 A;  1IC8 A;  2WAD A;  2EZI A;  3ZR8 X;  4OAZ A;  4BXX J;  2Z9O A;  4UHT A;  1ZRE A;  5B1B H;  1VF9 A;  3EYY A;  1L0O C;  3D5L A;  2DDB A;  4MFD A;  2IVM A;  4E7Z A;  1QNT A;  2MLG A;  1K78 B;  2JPC A;  2H8W A;  4V2G A;  1IXC A;  1IRX A;  2V6C A;  2EJR A;  2OTL I;  2JRT A;  1FYM A;  3TDU C;  2QSG X;  2IA1 A;  2IGO A;  3K9T A;  2RNG A;  3ROU A;  4UV9 A;  4UNO A;  4XLP F;  4XLH A;  4CCN A;  2YX7 A;  1YIJ I;  4JBA A;  3HB9 A;  3I54 A;  1AHD P;  1B9N A;  2M0M A;  1VQ6 I;  1M1E B;  2BE5 F;  1OQY A;  3BTI A;  2RN7 A;  3WTS C;  3JTG A;  2GAU A;  1I3A A;  2GXG A;  3FXL A;  1E3O C;  1UG0 A;  3WG9 A;  3RQ4 A;  1Z77 A;  4CDG A;  3TGN A;  3B02 A;  2DAO A;  1S6L A;  3EUK L;  3A0H C;  2HPM A;  2H1K A;  3AL0 C;  2FQ4 A;  1IN5 A;  2PN6 A;  3IP4 B;  3UNG C;  3UR3 C;  1J9I A;  4U87 A;  3I59 B;  3GFI A;  4GDF A;  1D1B A;  1I50 J;  3IH3 A;  3KX2 A;  1FSH A;  1JT6 A;  3S3O A;  1VFC A;  3GZ6 A;  1R23 A;  3VWB A;  5E3O A;  4M3E A;  4LG0 A;  1QRY A;  1U9O A;  1ZR4 A;  2M8G X;  2RVC A;  2Q2E B;  1MD0 A;  1TNT A;  4DYQ A;  5D5V B;  1YTY A;  2LY9 A;  1RKT A;  3DKW A;  3J81 Z;  2O8K A;  4BJT A;  4LLN A;  4ENK A;  1SVL A;  2HXI A;  1S7O A;  4E6K G;  1R7J A;  2KIF A;  2YUS A;  1ZN2 A;  3HUG A;  4IXA A;  4J01 A;  3W6V A;  1ZEL A;  1VND A;  3C7J A;  3PNV A;  1XG1 A;  1HA8 A;  3CCY A;  3BTC A;  3K70 C;  1HXD A;  2D2W A;  2DFF A;  1FSE A;  4Y17 A;  4I02 A;  1K61 A;  1FX7 A;  3HPH A;  2RRE A;  4HG2 A;  3IRR A;  2WAE A;  4KJZ A;  2R7X A;  2K9L A;  3OOP A;  1DDN A;  1MMS A;  2JRM A;  4UY8 I;  2WC2 A;  4BQQ A;  4ZZL A;  1E3P A;  3SXY A;  3OS2 A;  3LFK A;  3FMQ A;  1J75 A;  3K4N A;  3O8G A;  2OC6 A;  3W2V A;  2G9W A;  1RR8 C;  1TQM A;  1ZLJ A;  1RUO A;  3A2K A;  4P9F A;  4IHW A;  1F1Z A;  1QO0 D;  3DU5 A;  4LIU A;  1LPQ A;  4LD5 A;  5TIS C;  3G71 I;  4ESJ A;  1X3Z B;  2VN2 A;  5E3N A;  2Z33 A;  1BC8 C;  4AVP A;  4UXN A;  1KQ0 A;  2P5V A;  2VI6 A;  4FET A;  2PMU A;  4F93 B;  1LFP A;  5B5E C;  3V8L A;  2M87 A;  1REP C;  1XSX A;  2XRL A;  5FJ8 J;  4BHB A;  4BUP A;  2F5D A;  5EG0 B;  2HTJ A;  2IJL A;  4HX7 A;  2DTZ A;  4LG3 A;  1WGX A;  4LJZ F;  3IV5 A;  3FXO A;  5JR3 A;  1ZGJ A;  4IQ4 A;  1NHA A;  1JUM A;  1U2W A;  4XON A;  2XAQ A;  2HPI A;  1X1D A;  2ELK A;  2WV1 A;  2K7L A;  3VEP A;  3P5J A;  3IC7 A;  4PFO A;  1FMW A;  5DUK A;  5KNL A;  2VXZ A;  2F4O B;  4HST A;  4HNU A;  1KU9 A;  4HX4 A;  3M9A A;  2LR8 A;  3N97 A;  2D1V A;  3JRB A;  1NK2 P;  2HKO A;  1ZG5 A;  5HDK A;  4YRV A;  4CYD A;  1Y8R B;  5D4R A;  2DXI A;  2FSW A;  4L9T A;  1XX5 A;  1HW2 A;  2QQ8 A;  1AWC A;  3FZV A;  4AYB A;  2IAI A;  1ERD A;  2BGC A;  5EDN A;  3HHH A;  1IDY A;  2ZXH A;  4FIS A;  1MSF C;  1R5H A;  1UCR A;  4UB6 C;  1U78 A;  4DBR A;  2KIS A;  5B3S H;  2PG4 A;  4LLL A;  1LFB A;  3RKQ A;  2I5U A;  4PJN A;  3H0G J;  4EM0 B;  4I2O A;  3HOY J;  2DOE A;  1JXS A;  1EJ9 A;  2UUZ A;  2YS9 A;  1BIB A;  2Z2S B;  4Y7N J;  4YIR X;  3SEZ A;  4E7J A;  1PP8 F;  1TQI A;  1E17 A;  1ENH A;  3DCF A;  4L9J A;  1ZRF A;  4UUT A;  1E3H A;  1DGR M;  3RYP A;  3JAM Z;  1G4D A;  1IN7 A;  2WA0 A;  1QGP A;  1G3T A;  2F2E A;  1ORK A;  3KE2 A;  2L5Q A;  3TMO A;  1U5T B;  2XKO A;  2ISZ A;  1IJW C;  3HSE A;  2PMZ A;  5J1R A;  3QYB A;  1LEA A;  3DPL C;  4YII A;  2FRH A;  3M7G A;  3BQZ A;  2A61 A;  3I4N J;  2ZCW A;  3S2W A;  1SAU A;  3ONQ A;  1XMA A;  1WCM J;  3RIR A;  1WI9 A;  2R5Y B;  3FX3 A;  1POG A;  5CKT A;  4F92 B;  3OYN A;  4HLY A;  3K1N A;  4G6T B;  3HRT A;  2LD5 A;  2VC0 A;  1XGO A;  1DPR A;  2ISY A;  2V1X A;  3CUQ C;  4AIK A;  1IAW A;  5CLS A;  2HQN A;  3WGG A;  1YOV B;  1DQU A;  2TDX A;  3L2R A;  1S7E A;  2HDC A;  2KP6 A;  4IX7 A;  4ANJ A;  4A2U A;  2E1M C;  2ZXW H;  3FKI J;  3J7A Y;  1OR7 A;  3S14 J;  4ZDO A;  4FE7 A;  3GEZ A;  1GV5 A;  1CF7 B;  4RAF A;  4OIO F;  4ASN A;  6PAX A;  1AA7 A;  2PMH A;  3H9Q A;  1B59 A;  3E1S A;  2RGV A;  5GAD J;  4KA4 A;  2DMQ A;  2HNH A;  1BI1 A;  5FLM J;  3KEQ A;  3MKL A;  3A01 B;  1V4R A;  2QSH X;  4P96 A;  2V26 A;  3QP6 A;  1NH3 A;  3LNQ A;  2ZJQ F;  3JW4 A;  3QPT A;  2HKX A;  2HDD A;  5JHF A;  3N05 A;  5IPA A;  1ZHF A;  1MMG A;  4A3E J;  4DGW B;  4CCK A;  3QAH A;  3U1K A;  1SMT A;  1K78 A;  2XDV A;  4C2U A;  2XGD A;  3LSJ A;  2LP0 A;  1X4O A;  5IOY A;  3PUB A;  4KIF A;  3LSI A;  2HOA A;  3K2Z A;  3VYT B;  3FXJ A;  5E20 A;  3KEY A;  5DD8 A;  2VT3 A;  1FBU A;  1YIT I;  5F27 A;  4TV7 A;  1N25 A;  2K4J A;  1QPM A;  2H1L A;  4AM3 A;  3FMR A;  4RB2 C;  1A6Q A;  4S0H B;  1HCR A;  1KGS A;  4QPO A;  2ZXI A;  2CV2 A;  3GBG A;  2BVL A;  2FNP A;  2JWT A;  4BU2 A;  3WHB A;  4UUS B;  4E7L A;  1ZAO A;  2XV4 S;  3K69 A;  4PJM A;  3OYL A;  4WF2 A;  4EJO A;  3GO5 A;  2A5W A;  3K4C A;  2XGC A;  3OMY A;  1AU7 A;  2CGP A;  1DPU A;  3VOD A;  1FOW A;  1MBF A;  2XRN A;  2BHY A;  2HQA A;  2K86 A;  1YFH A;  2VJJ A;  2DA3 A;  2XAF A;  3C18 A;  3CC7 I;  2CV0 A;  3S2D J;  2A6T A;  4IHS A;  1YRN B;  4LIT A;  3U9G A;  3DWL E;  4H4K C;  2L4A A;  3CZ6 A;  4PSX A;  4JX5 A;  4EVI A;  2L9R A;  5DTD A;  1HOM A;  1IXS B;  1PDN C;  3MCZ A;  4KNY A;  2HDW A;  3H3Z A;  4M71 A;  1Z3X A;  5L3E A;  2DMN A;  4U7B A;  3G3Z A;  4GGG A;  2NS7 A;  2VL8 A;  1XS9 A;  1D8K A;  2GA2 A;  2RC4 A;  2E2H J;  2UXX A;  2WB1 A;  3RJP A;  1MJ9 A;  3ABL H;  2NNN A;  4HSR A;  3HIF A;  2HU9 A;  3I59 A;  4IKF A;  3HTU A;  1A36 A;  1MSE C;  2VKD A;  2QYO A;  3BP8 A;  4A3C J;  3ECO A;  3TW6 A;  1WH7 A;  2DA5 A;  2XC7 A;  5DDG A;  3BWG A;  2XUB A;  2X1C A;  2OQG A;  3GCM A;  4B1R A;  4CHU A;  4PK4 A;  3K1M A;  2E71 A;  4IEJ A;  5EZH A;  4Y4R A;  2VE8 A;  2QF7 A;  2XF7 A;  4I0A A;  2AO9 A;  4XSX F;  2ZJ2 A;  5CJ9 A;  1STZ A;  5DUI A;  2HVR A;  2DN0 A;  2KHM A;  3BTJ A;  2MG4 A;  5H6R A;  1GXQ A;  2EZL A;  3F8M A;  2IT0 A;  2F4I A;  3BPX A;  4XRS A;  2LSO A;  3SDG A;  3V8J A;  5FKK A;  1VQL I;  3FHZ A;  3V42 A;  2EFW A;  1SAX A;  4G7O F;  4IQJ A;  4NNJ A;  2HYG D;  2BVM A;  2F5E A;  4DOZ A;  1MJA A;  4X0G A;  3LAP A;  2KMU A;  1G6N A;  4KMU X;  4RM2 A;  1TC3 C;  5DM6 F;  1RPW A;  1UST A;  3KYL A;  2YX4 A;  1MNE A;  4B4C A;  3T0Y A;  4B44 A;  1A35 A;  2K40 A;  2NVT J;  4OIR F;  3KP2 A;  1T98 A;  2RKH A;  3GZN B;  4IHT A;  1R9T J;  2EQR A;  2UXN A;  3DPU A;  4OWR B;  3TP3 A;  1FPQ A;  2IBD A;  5JHU A;  4NUB A;  2OAZ A;  3H36 A;  2EFP A;  2R5Z B;  2I8D A;  2FU4 A;  3F6V A;  3BDD A;  1TL8 A;  1UMQ A;  3ZN1 A;  2XPV A;  2X85 A;  1L3L A;  3GW2 A;  2EBI A;  3PQJ A;  4E4H A;  2GXA A;  3HKZ N;  1MBG A;  3L2W A;  3LA2 A;  3IKT A;  1UFM A;  5EG0 A;  2VE9 A;  2M3A A;  4GXO A;  1Z6R A;  1Y8Q B;  2QLZ A;  3F3X A;  1S3J A;  2E1O A;  3I53 A;  2ZSH B;  5JFR A;  5JLX A;  1WWX A;  1BR1 A;  3BG7 A;  2H27 A;  4V2F A;  5ICG A;  5CVJ A;  1WVR A;  4BH9 A;  3QRF F;  1HST A;  2W82 A;  2XSJ C;  5BQT A;  2K85 A;  4R79 A;  3W2A A;  4EM2 A;  2HR3 A;  1YJW I;  3TQN A;  3MZY A;  2V4J C;  1P4X A;  2Z1D A;  2L0K A;  3BOQ A;  3LMM A;  3O6B B;  4LMY A;  3FMS A;  3WGI A;  1S72 I;  1IDZ A;  1I39 A;  1I3Q J;  4P9U A;  2BY3 A;  4F7Z A;  2EIK H;  3WU2 C;  5LRS A;  4XRM A;  2CQX A;  3TP0 A;  2OF7 A;  5HLI A;  2LKP A;  1I27 A;  3BRO A;  2LY2 A;  4FX0 A;  3WU0 A;  4RLQ A;  2GZW A;  1D3Y A;  2X4H A;  2OUM A;  1OIS A;  3J80 K;  3R6S A;  3M4O J;  1EV7 A;  1D5V A;  2QSF X;  1OCP A;  2VON A;  3M8J A;  4EJT A;  2I10 A;  2PQ8 A;  1IRF A;  4RGX A;  3CC2 I;  2FA5 A;  3T8R A;  2WTE A;  1X1P A;  2WAQ N;  3GTQ J;  2KT0 A;  5AIP A;  2BW3 B;  2UV1 A;  5CVV A;  1G59 A;  2NVX J;  2R92 J;  5FO5 A;  1D0Z A;  2DT6 A;  2VT2 A;  1H89 C;  1DGW Y;  2K9N A;  2M4G A;  3BG3 A;  5LFA A;  1Y6I A;  5EEH A;  4XR6 A;  1GHC A;  5B66 C;  4U7D A;  4XKC A;  3W2W A;  3OYM A;  1J09 A;  4IPA A;  5FD6 A;  2MC4 A;  3HJE A;  5L3D A;  3F23 A;  3CO6 C;  1ETO A;  1XGS A;  3TO9 A;  4DYR A;  2IEK A;  1FJL A;  2P4W A;  5GTH C;  3R61 A;  3J7A O;  1WJB A;  3DP7 A;  1U5T A;  1YLF A;  5FKM A;  1HC8 A;  3NWS A;  1C0W A;  2JUG A;  3S17 J;  1ODD A;  3BR5 A;  5LHG A;  2LBF B;  4ZH4 F;  4CCL A;  1MH4 A;  1KZH A;  4CCO A;  1DP7 P;  1Z91 A;  4HZF A;  4XNF A;  3K0L A;  3Q0V A;  1GVD A;  3B6C A;  2Q8K A;  3HZJ A;  2CQK A;  3NRV A;  5BS6 A;  3GX4 X;  4M3F A;  2L3D A;  1N77 A;  2BHZ A;  1U8R A;  2FUG 2;  2QCO A;  3E0J B;  4C2T A;  3H5N A;  4RLF A;  1BBY A;  1WI3 A;  1WJF A;  1SFU A;  1W36 D;  1BI2 A;  3C2G A;  3OYF A;  2R7F A;  1CF7 A;  2AHQ A;  1Z6T A;  2YU9 J;  2QEX I;  4N9H A;  3DBR B;  1UZC A;  4WXC A;  5E8G A;  2WAF A;  2M0C A;  2A6H F;  3CJR B;  4HAM A;  3WE2 A;  1IF1 A;  3J81 K;  3OYJ A;  2RNJ A;  3A01 A;  3EQL F;  5LEJ A;  2E5N A;  2E5Z A;  3NAU A;  1T39 A;  2KJB A;  3SZG A;  3CCR I;  1MDM B;  4A0Z A;  2GM4 A;  3PSF A;  3H5A A;  1MZB A;  2Q0O A;  4FQG A;  2KIU A;  1FOY A;  2IS2 A;  1IZ1 A;  1Y39 A;  3S1M J;  2DOF A;  3I56 I;  5E1X A;  2JTV A;  3REO A;  4CUG A;  3CC4 I;  5K7H A;  4EEF G;  3G1L A;  1TWF J;  5DS9 A;  3SHF A;  2QA4 I;  3CJN A;  3JTH A;  3GLX A;  5FLX Z;  4M3D A;  4OAY A;  3EUA A;  4PJ0 C;  4HNT A;  1XGM A;  1OMI A;  3EYI A;  1OR7 C;  3RKX A;  4P5O A;  1K83 J;  1YW9 A;  1D5Y A;  4S05 A;  3RQI A;  1VQP I;  2KIM A;  2KDO A;  5LLQ A;  1OKR A;  2E34 A;  1QQI A;  2E36 A;  3I4M J;  5EF6 A;  4L9V A;  1QZZ A;  2IS4 A;  2GIZ A;  5CQG A;  3F72 A;  4UUS A;  4ESF A;  2H6C A;  2DA7 A;  4DNC A;  1OCR H;  4B47 A;  5FKO A;  3ZP5 A;  4BDZ A;  2UWM A;  2NYX A;  2DQR A;  2CO5 A;  5F08 A;  2DDA A;  2CFX A;  1YRN A;  2PI0 A;  4XN3 A;  2V79 A;  3E6C C;  4A3J J;  4P1W A;  9ANT A;  1O3R A;  3WTX C;  3SDB A;  2KKO A;  2A5Y B;  2CW0 F;  2L54 A;  2LDU A;  1XMK A;  3AG3 H;  3ERM A;  4U0V A;  4G8X A;  1S29 A;  3PFY A;  4OMZ A;  1GT0 C;  2CS3 A;  2ACJ A;  1U9N A;  2CUE A;  1R1U A;  2LOO A;  4MQV A;  2JSP A;  1Y0U A;  2WWY A;  5LHI A;  1UJ8 A;  3A0B C;  2DMU A;  1H9T A;  4M3G A;  4ZYD A;  2CFO A;  3BR1 A;  3E7L A;  3GVA A;  1W5C C;  2ME6 A;  4PGG A;  4I7H A;  3MFK A;  2EIM H;  4Y13 A;  1MND A;  3GXO A;  3L09 A;  4RAY A;  2JA5 J;  3AFH A;  3ESW B;  2PBI A;  1HDD C;  1I1G A;  4RGR A;  3KZZ A;  3NEU A;  2XSD C;  2IXS A;  4C30 A;  1MKM A;  2EV6 A;  1R00 A;  4E7S A;  5E79 C;  4CIC A;  4M9Z A;  3PL8 A;  4M6V A;  4HDU A;  2IW5 A;  2VJ4 A;  3H92 A;  3QU6 A;  3K2A A;  4LGW A;  4DZJ A;  3OYE A;  3S8P A;  2CW8 A;  1QVU A;  2D45 A;  1FT9 A;  1Y56 A;  3CP8 A;  3CMY A;  1FC3 A;  1ON2 A;  2ZME B;  3S2H J;  4QWQ A;  4CXF A;  4F3Q A;  2R7D A;  2XAJ A;  2HS5 A;  3OYB A;  4A6D A;  2VOO A;  3L2V A;  2ZFW A;  5ILU A;  3I4P A;  1UAA A;  1EH8 A;  2HGC A;  4OOI A;  3F9K A;  3QYE A;  2B7E A;  1NK3 P;  2STW A;  3K6G A;  5E18 F;  4B43 A;  1BN5 A;  2DA6 A;  2M4K A;  1XB4 A;  1JE8 A;  2EWN A;  1RKW A;  1YW7 A;  3C2H A;  1OCZ H;  4C3J J;  4QTR A;  2M9H A;  3HOV J;  2YR2 A;  5DCM B;  2FF4 A;  5IOZ A;  1GV2 A;  2CQ7 A;  2EZK A;  2OCE A;  1VZ0 A;  2CUF A;  2W48 A;  2R5Z A;  4ABZ A;  4XQF A;  5D6F A;  3N4M A;  2HQ5 A;  1NG7 A;  3JAM K;  2JA2 A;  2LTP A;  2O6G E;  3LQR A;  2DJI A;  1H0M A;  4I09 A;  2V6E A;  3OS1 A;  3D5R C;  2L7Z A;  4KFC A;  4AVZ A;  4DYC A;  2AQE A;  4IOA F;  1VQN I;  4KYW A;  2A69 F;  2IS1 A;  3KFW X;  3IL2 A;  3F22 A;  3TED A;  3S1Q J;  3ZXS A;  3ULQ B;  4XM3 A;  3FXK A;  5F0F A;  5HDN A;  3BCA A;  1H9G A;  3R60 A;  4UV8 A;  3MKY B;  2R0Q C;  2ECC A;  1I6H J;  2GOM A;  1HKT A;  2H6B A;  3CCQ I;  4N4N B;  2NS8 A;  2WY8 Q;  5K5Q A;  3HOS A;  1TW2 A;  1QVT A;  2Z99 A;  3BZC A;  3FIS A;  1YE9 A;  1ZG1 A;  2R7U A;  1MBJ A;  5J47 A;  3HOW J;  3BR6 A;  2L9V A;  3OIO A;  5GAE J;  4L0Z B;  2HVQ A;  2M5W A;  3F8B A;  1ZRC A;  3HM5 A;  3L2Q A;  3FWE A;  1SVM A;  1YJ9 I;  1ZQ3 P;  2EA2 A;  4M6X A;  2JA7 J;  1Z7L A;  1IV8 A;  3O2P E;  5H2F C;  2DA2 A;  3JRI A;  1XDU A;  2WY7 Q;  1X1B A;  2P6S A;  1JJ6 C;  5ERI A;  3F0C A;  4RDU A;  5C4J J;  2ZNY A;  2HI3 A;  2EH3 A;  3FXQ A;  3IWZ A;  2OD5 A;  2L2O A;  4A0Y A;  1IN8 A;  3G2B A;  2W00 A;  5HOO A;  1K4S A;  3CCE I;  4ON0 A;  1T95 A;  2BW3 A;  2MD0 A;  4G7H F;  3OIQ A;  2ETH A;  4XOT A;  5D5U B;  5B1A H;  1FOK A;  2DYR H;  3L00 A;  3PNT A;  1VQK I;  3KPH A;  2BZT A;  2EPF A;  4IRG A;  4XSZ F;  1YO5 C;  2GLO A;  2O9L A;  1X4P A;  3OSG A;  2X6Y A;  1FP1 D;  3DEU A;  3A03 A;  1TT0 A;  5HOD A;  5IYC J;  1APL C;  1FWZ A;  3RPQ A;  3VYS B;  1MBK A;  1XMX A;  2BEO A;  3Q3S A;  2QZ8 A;  2DMT A;  2LF7 A;  5EGO B;  3KYD B;  1ETK A;  3DKX A;  1FY7 A;  2KZG A;  3I64 A;  1R36 A;  3OIP A;  4OIP F;  2LBF A;  3ZCO A;  2W57 A;  3BZK A;  5GP9 A;  2CV1 A;  3ZRG A;  5GPA A;  4NQW B;  2FJ1 A;  1EA3 A;  2FML A;  4LB5 A;  2KDZ A;  2EK5 A;  1V3F A;  2VBX A;  3G1M A;  4HF0 A;  1K4T A;  3WTV C;  1ZRD A;  1BOA A;  4RB1 A;  2TRT A;  3HPG A;  1W1W E;  1YW8 A;  2P6T A;  3HSF A;  2ECB A;  3CCU I;  1P4A A;  4G9Y A;  2FE3 A;  3L7W A;  3JCU C;  2P5K A;  5IP9 J;  1QA6 A;  4A3D J;  2DW4 A;  4IVN A;  3CQZ J;  1SFX A;  1IV6 A;  3V4G A;  4D1Q A;  2H94 A;  4MNU A;  3PQK A;  1B1B A;  3QQA A;  1A6I A;  4NC7 A;  1YX5 A;  2BY1 A;  2E2J J;  5J3L A;  1BA5 A;  2XAH A;  1BL0 A;  1DU0 A;  2BY2 A;  5D8L B;  1U5T C;  3OR2 C;  3K4M A;  4HLX A;  2X9D A;  4R8H A;  1E2X A;  4BQN A;  4XKB A;  3V7S A;  4DQ2 A;  2JZY A;  3IRQ A;  1O3T A;  2RDP A;  5D8K B;  1MDM A;  4A5N A;  3HBL A;  3BG6 A;  3LSH A;  3HL2 A;  4RAG A;  4Y33 A;  1EKE A;  5JLW A;  4O6J A;  4NC6 A;  1SEU A;  1A31 A;  1YQA A;  1R49 A;  3ZOB A;  1F5T A;  2Z16 A;  5K1Y A;  2BV6 A;  4IHX A;  2NAZ A;  3FHN A;  2P0W A;  1R1T A;  1T8I A;  3PIO F;  2F48 A;  4GO1 A;  3LAJ A;  1FYL A;  3P9K A;  3JRH A;  1V5F A;  2G7U A;  1LJ9 A;  4IRH A;  1KYW A;  2FX0 A;  2HYJ A;  2NOG A;  3IHU A;  1X19 A;  1PJR A;  2K27 A;  3KZY A;  1Z21 A;  2KIQ A;  3FBI B;  2XAU A;  3MQ0 A;  4BQO A;  3B73 A;  5E8I A;  4G6D A;  3AKZ A;  3MKW B;  3TL4 X;  1UG2 A;  1JKP C;  4DW6 A;  2DO7 A;  4RA2 A;  4C9Y A;  2VLA A;  1WJC A;  3E5Q A;  3DLL F;  4YFK F;  3BG5 A;  2OV7 A;  4GRI A;  5FKL A;  3WTZ A;  3DU6 A;  1UB9 A;  2PLY A;  1E0E A;  2GA1 A;  1UHW A;  1G3W A;  2VJ5 A;  3BG9 A;  4XLE A;  3VYR B;  2VKH A;  2Y30 A;  1VQ4 I;  3HSR A;  5H20 A;  5CVI A;  5CVU A;  1GLN A;  3EPZ A;  2D1H A;  3IH4 A;  1LVK A;  2ZB9 A;  4EGY A;  1SD7 A;  3ZQH A;  4ESB A;  5IP6 A;  4D5C A;  1O4X A;  3RKW A;  2CJJ A;  1CQT A;  1SFE A;  1B8I B;  2VKV A;  1P7I A;  3TO7 A;  4ZYA A;  5ICE A;  4M74 A;  4A0X A;  1EH7 A;  1RI7 A;  4MIM A;  3I5U A;  4I6Z A;  2JJ7 A;  4KIG A;  2YU3 A;  3CP2 A;  5FKN A;  4AD9 A;  1UHM A;  2DFI A;  1D0X A;  3OR1 C;  3SZP A;  3IKV A;  1LE8 B;  3KP6 A;  1OCO H;  4D7M A;  2F5F A;  2YPR A;  3KP3 A;  4Y15 A;  1TWA J;  2FXA A;  2B9S A;  1TBX A;  3S3N A;  1RRJ A;  2K9Q A;  2P7V B;  2QKM B;  2RQQ A;  3E6M A;  3EUH A;  3HHG A;  2VQG A;  1FMV A;  1DP3 A;  3CO7 C;  3OYC A;  4DJA A;  2DYS H;  5C44 J;  2IS6 A;  1R22 A;  3RZD J;  1WFX A;  3GWZ A;  2ZBK A;  2PMZ N;  1P92 A;  5E1Z B;  3JSO A;  1Q1V A;  3RDI A;  3C2B A;  2CSO A;  2OBP A;  3A1Y A;  5J8C A;  2HOT A;  2XAG A;  3HGY A;  2R4G A;  4ZYG A;  3QOP A;  5J8F A;  2KRH A;  2ZME A;  5LGT A;  4V19 K;  4PFP A;  4YG2 F;  3OYG A;  2Y2Z A;  3DTI A;  3OV8 A;  1P4W A;  3P7N A;  3WTY C;  5M5Y J;  1ETX A;  5F04 A;  2QUF A;  1TQP A;  1X3U A;  1YS7 A;  4WWC A;  3CD6 I;  3MZ8 A;  1U0J A;  5IY5 H;  1Z1D A;  1OLT A;  2FQ3 A;  1JKO C;  1TLH B;  2EA4 A;  2M7A A;  3VYU B;  4MLO A;  3ZQG A;  2NS0 A;  2W7N A;  5BPI A;  1W0U A;  3DF8 A;  2VQC A;  2V9V A;  4A3L J;  3SEQ A;  1WHU A;  3ZQL A;  2HZT A;  4HOB A;  5DCM A;  3J7Y J;  2XGE A;  3EET A;  1SD4 A;  3O8H A;  1P7J A;  4XID A;  3EDP A;  5F0H A;  1R71 A;  3QU3 A;  1ETV A;  1ZR2 A;  4Z2Y A;  4MO7 A;  1VQ7 I;  1QZE A;  1TT5 B;  4PCQ A;  3S1N J;  2CU7 A;  5J4Y A;  3K1P A;  4CZC A;  4YEJ A;  5K7Z A;  2ID6 A;  2DPD A;  5L3C A;  5LBQ A;  3FM3 A;  3ML6 A;  2R7T A;  1IG7 A;  4II3 A;  2H8R A;  2W25 A;  2CW7 A;  3BR0 A;  4ZJZ A;  2DK8 A;  3MD2 A;  1J5Y A;  3KCC A;  1HF0 A;  3OYH A;  2HTS A;  5DCF A;  1MJB A;  2VIX A;  5GAG J;  1H88 C;  2AQF A;  3MKZ A;  4GYG A;  2E1C A;  2V1N A;  4BYY A;  3JRC A;  3HXL A;  4KDP A;  1FIP A;  2W24 A;  3X2Q H;  1OYY A;  2M2E A;  4KT6 A;  2DCE A;  1R4M B;  5A2Q K;  4Q4Z F;  2HOE A;  1P9Q C;  5J6X A;  3GTK J;  3LFU A;  1JHF A;  2ELJ A;  3Q5F A;  4BBR J;  3FXM A;  2V9P A;  2CRG A;  1YI2 I;  2LC2 A;  3I0T A;  3I55 I;  3ECH A;  2CQN A;  2JPB A;  1PUE E;  1ZK8 A;  3ZQF A;  3VB2 A;  2Y48 A;  3AG1 H;  5M5X J;  1ULY A;  3TOB A;  3GTJ J;  1FIA A;  1MMN A;  1X2N A;  2F6C A;  2K9S A;  3HOT A;  4M72 A;  3CLQ A;  1WPK A;  2A68 F;  4AUX A;  4MQ9 F;  2HVS A;  3A4C A;  4ZZD A;  3ZN0 A;  2ZJR F;  5IYB J;  4M6Y A;  2IRF G;  2H09 A;  1KYZ A;  3PO2 J;  4HA8 A;  3P9C A;  1XPX A;  4XN0 A;  4MEX F;  4LOC A;  3CMA I;  3CDI A;  4ENN A;  5FLX K;  4NB5 A;  3D5S C;  1RIO H;  2DLL A;  2LH9 A;  2MC3 A;  3HEF A;  4FX4 A;  1KU2 A;  1QBJ A;  3CTA A;  4M73 A;  3WGH A;  1PP7 U;  4RAZ A;  4G94 A;  1R5G A;  4AID A;  2MH9 A;  2V7F A;  4II2 A;  1A04 A;  5HNF A;  4ENM A;  1LEB A;  2LRD A;  2EIJ H;  2L9S A;  3CME I;  2ZSI B;  2DPU A;  1B72 B;  1D1A A;  3TO6 A;  1LNW A;  5EGO A;  3H0D A;  3CDH A;  3BR2 A;  4UUV A;  3K7A J;  4EM1 A;  3S16 J;  1S8N A;  3MVP A;  4MEY F;  2N8G A;  1O7L A;  3BR3 A;  1UEL B;  3FF5 A;  3GFM A;  3WTU C;  2Y0M A;  3D0S A;  5F1J A;  3MZH A;  3PNY A;  3H5R A;  4NQW A;  2W1O A;  5HS8 A;  2DJN A;  3KLO A;  4B3A A;  2K3F A;  1GVJ A;  4JX4 A;  5GAH J;  1G3Y A;  3KP4 A;  3R4K A;  3QPS A;  4KIB A;  5ED4 A;  1YIO A;  2DFH A;  4KIT B;  2MSY A;  4O3M A;  2VOP A;  2Y0S N;  4FHT A;  4EQQ A;  4KT5 C;  4B8X A; 
#chains in the Genus database with same CATH homology
 1Y56 A;  2X1E A;  2UUZ A;  2CH0 A;  3K4K A;  3CP8 A;  3MMY B;  1N75 A;  2Z2S B;  1V5G A;  3RCO A;  4J00 A;  3I3L A;  1PYV A;  3SEZ A;  4E7J A;  2IGK A;  4CCJ A;  4F3Q A;  1WJ5 A;  3OYB A;  3L2V A;  1UAA A;  2VJI A;  3BC8 A;  1DGR M;  2CMP A;  4XLF A;  3F9K A;  3QYE A;  2WA0 A;  3K6G A;  4B43 A;  4AU7 A;  3OWT A;  2L5Q A;  2M4K A;  3TMO A;  4ZDL A;  1MW7 A;  2WAQ A;  4ZTJ A;  4XLA A;  2PMZ A;  3L2U A;  3QYB A;  3C2H A;  3DPL C;  3M1C A;  1Z3Y A;  3OYA A;  4BE2 A;  1SAU A;  3ONQ A;  1VZ0 A;  1QHG A;  5CKT A;  4F92 B;  3OYN A;  4XQF A;  4G6T B;  2R7S A;  4BDY A;  1NG7 A;  3FDY A;  4E7H A;  2JA2 A;  3OL4 A;  1DQU A;  4ZTF A;  2DJI A;  2V6E A;  2KQR A;  3D5R C;  3OS1 A;  3L2R A;  2KP6 A;  4AVZ A;  4IX7 A;  3HUG B;  4ANJ A;  4KIS A;  2AQE A;  2K9M A;  2Y0S A;  2E1M C;  3J7A Y;  4ZDO A;  2IS1 A;  4LIV A;  3CF2 A;  2LYC A;  1AA7 A;  3BCB A;  3ZXS A;  4XM3 A;  4QPQ A;  3BCA A;  3H9Q A;  3E1S A;  3MKY B;  4BS9 A;  4PJJ A;  2GOM A;  2HNH A;  4DBQ A;  2CUJ A;  2MAB A;  4YEL A;  4HRI A;  4N4N B;  2V26 A;  2WY8 Q;  3HOS A;  4JOM A;  4F52 A;  1X1A A;  1YE9 A;  3N05 A;  5JHF A;  3ZGK A;  2R7U A;  1MMG A;  4DGW B;  4CCK A;  2HVQ A;  2XDV A;  4C2U A;  3L2Q A;  1X4O A;  3PUB A;  2VPL A;  3LSI A;  3FKJ A;  3VYT B;  2KZV A;  1Z7L A;  3KEY A;  5HLT A;  2DOA A;  2VXD A;  3LSK A;  3DTK A;  2WY7 Q;  1X1B A;  3RSN A;  2CV2 A;  4QPO A;  2ZXI A;  5KCM A;  4B3X A;  3VSL A;  3GBG A;  2BVL A;  2L2O A;  5CPR B;  3G2B A;  2W00 A;  3CES A;  5HOO A;  4BU2 A;  4E7L A;  3OOU A;  2ZFU A;  3U21 A;  4PJM A;  3OYD A;  3OYL A;  4PSW A;  1T95 A;  3K4C A;  2A5W A;  2MD0 A;  2BW3 A;  3OMY A;  3OIQ A;  4XOT A;  2HQA A;  2F5V A;  2VJJ A;  4HEA 2;  3K70 D;  3PNT A;  5CQE A;  4CA0 A;  4Y3O A;  1X4P A;  2CV0 A;  2X6Y A;  2A6T A;  4LIT A;  3DWL E;  1TT0 A;  2DT7 B;  2JVH A;  2L9N A;  3QYF A;  4H4K C;  3CZ6 A;  4PSX A;  4F55 A;  3OL3 A;  2X51 A;  3VYS B;  4ZDP A;  2HDW A;  1Z3X A;  4XLC A;  4U7B A;  2VL8 A;  3EUH C;  1MMA A;  2QKL B;  2WB1 A;  3DKX A;  2KPM A;  3BLY A;  2X1D A;  3OIP A;  4HSR A;  2HU9 A;  4IKF A;  3LSM A;  2LBF A;  3ZCO A;  1BOB A;  2CV1 A;  3ZRG A;  2VKD A;  2VQL A;  4NQW B;  2M7B A;  2XF6 A;  4XKV A;  1EA3 A;  1TZL A;  2XC7 A;  4IZZ A;  2LG4 A;  3AL0 B;  4BJ5 C;  5FRM A;  2X1C A;  2KLO A;  3HPG A;  4BJ6 C;  4PK4 A;  4Y4R A;  4F91 B;  2R7O A;  1BR2 A;  2XF7 A;  4EAT A;  4BEH A;  5FRN A;  3CJQ B;  2O5R A;  2HVR A;  2K5C A;  2KHM A;  4D1Q A;  1QU3 A;  2VQH A;  4XOP A;  2F4I A;  4NC7 A;  1YX5 A;  2CUZ A;  3IUO A;  3V42 A;  2BOL A;  4IQJ A;  4NNJ A;  3OR2 C;  2BVM A;  4DOZ A;  3K4M A;  4ITV A;  4X0G A;  2KMU A;  4JQF A;  1LKX A;  4RM2 A;  4BQN A;  4XKB A;  3DPT A;  3KYL A;  3BG6 A;  2R7V A;  1MMD A;  3LSH A;  1MNE A;  3NWT A;  3PSI A;  4Y33 A;  4B44 A;  3HL2 A;  4XOR A;  2IGM A;  4D9J A;  2Z16 A;  2HZD A;  2E60 A;  2V9K A;  1T0F C;  3FBN B;  3DLA A;  3FHN A;  5KHD A;  2IGN A;  3DPU A;  4OWR B;  3QOE A;  2MYS A;  2P0W A;  4E7I A;  4XL9 A;  4NUB A;  4RMN A;  4ZC3 A;  2I8D A;  1V5F A;  3QOD A;  4CH7 A;  3DQV C;  1S9H A;  2X85 A;  4BGD A;  4E4H A;  4BXF A;  3I9V 2;  1X19 A;  1PJR A;  3L2W A;  3DEE A;  1N78 A;  1Z21 A;  3FBI B;  4BQO A;  2M3A A;  2XAU A;  4PUS A;  4CCM A;  3H35 A;  3TBI A;  3AKZ A;  3MKW B;  3LL7 A;  2K3P A;  3TL4 X;  1D0Y A;  3OYK A;  4C9Y A;  2VLA A;  1WJC A;  3CMM A;  2OV7 A;  4GRI A;  2ZSH B;  3RTR A;  1YX3 A;  5HNH A;  5LD2 C;  3DU6 A;  1E0E A;  1BR1 A;  2VJ5 A;  3BG7 A;  4XLE A;  3VYR B;  1D1C A;  2VKH A;  4E7K A;  4FAS D;  5FRO A;  1NG6 A;  1GLN A;  3EPZ A;  3S32 A;  1X1C A;  1LVK A;  2W82 A;  2XSJ C;  4R79 A;  3W2A A;  2WAD A;  3ZR8 X;  3ZQQ A;  4OAZ A;  2V4J C;  2W4S A;  2Z1D A;  3LMM A;  3OS0 A;  4XKW A;  4ZYA A;  3D5L A;  3K10 A;  3PJR A;  3K4J A;  4E7Z A;  3CP2 A;  1R6R A;  3LSG A;  1W36 C;  2LY2 A;  1D0X A;  3OR1 C;  1IRX A;  4RLQ A;  1WJA A;  2R7W A;  2OUM A;  1WJE A;  2XF5 A;  3S3N A;  2QKM B;  2RQQ A;  3M8J A;  2VQG A;  3DTE A;  2IGO A;  3OYI A;  5HVQ C;  2RNG A;  1FMV A;  1DP3 A;  3OYC A;  4DJA A;  2IS6 A;  4XLH A;  3DKY A;  1WFX A;  4CCN A;  4B48 A;  3IAS 2;  2BW3 B;  2UV1 A;  1G59 A;  1D0Z A;  2PJR A;  2DT6 A;  4PJL A;  1DGW Y;  1SFK A;  2R7Q A;  2M0M A;  2M4G A;  2WBM A;  3A1Y A;  4N4O B;  1Y6I A;  2R4G A;  5LFA A;  4XR6 A;  3K4B A;  2KRH A;  2KRC A;  4XKC A;  3W2W A;  4PFP A;  1J09 A;  3OYM A;  2R7R A;  3OYG A;  2LRE A;  2MC4 A;  3DTI A;  1G8X A;  1UG0 A;  3OY9 A;  3RQ4 A;  4HPQ A;  1U0J A;  1OLT A;  3EUK L;  2M7A A;  1WJB A;  2HPM A;  3VYU B;  3AL0 C;  4MLO A;  3IP4 B;  2W7N A;  3NWS A;  3UNG C;  3VDX A;  2JUG A;  2VQC A;  3UR3 C;  3SEQ A;  4U87 A;  2LBF B;  4CCL A;  3S3M A;  1D1B A;  1K6Y A;  3KX2 A;  4CCO A;  3S3O A;  3VWB A;  1KON A;  3VSK A;  4XNF A;  1WJD A;  3H9G A;  2Q2E B;  1N77 A;  3HG9 A;  4CZC A;  4BJT A;  2FUG 2;  4YEJ A;  3E0J B;  4C2T A;  4BEH B;  2R7T A;  3H5N A;  4II3 A;  4E6K G;  4RLF A;  2CW7 A;  4ZJZ A;  4J01 A;  4NC8 A;  1ZEL A;  3MD2 A;  1WJF A;  2Q1Z B;  3PNV A;  4XMY A;  1W36 D;  3C2G A;  3OYH A;  3OYF A;  1HA8 A;  2VIX A;  3K70 C;  2AQF A;  3MKZ A;  2V1N A;  3HXL A;  2WAF A;  3HPH A;  2RRE A;  3CJR B;  4HG2 A;  2WAE A;  2DCE A;  2E1M B;  4KJZ A;  4KT6 A;  3OYJ A;  2R7X A;  2K9L A;  2X6X A;  1P9Q C;  2JVG A;  2E5N A;  2E5Z A;  4BQQ A;  4BE0 A;  3LFU A;  3SZG A;  2ELJ A;  3PSF A;  3OS2 A;  3H5A A;  3K4N A;  2IS2 A;  2OC6 A;  2X6W A;  3W2V A;  2LC2 A;  4CUG A;  1QHH D;  3A2K A;  3IAM 2;  4DIQ A;  3DU5 A;  4OAY A;  4LIU A;  3EUA A;  4HNT A;  1V5E A;  1MMN A;  3HOT A;  1LDK B;  1OR7 C;  2F6C A;  4P5O A;  3SYT A;  2VAS A;  4FET A;  4F93 B;  1LFP A;  2KDO A;  2GOX B;  1BR4 A;  2HVS A;  4BUP A;  3A4C A;  2IS4 A;  3HC7 A;  5CQG A;  4LG3 A;  1JI8 A;  2VB6 A;  4RM3 A;  4XN0 A;  4B47 A;  4BDZ A;  4IQ4 A;  2UWM A;  4XON A;  3D5S C;  2LH9 A;  2HPI A;  3W3C A;  1X1D A;  3H9J A;  4XN3 A;  4PFO A;  1FMW A;  4P1W A;  3SDB A;  2V7F A;  4II2 A;  3RPU D;  5KNL A;  5HNF A;  2VXZ A;  2LRD A;  2LY1 A;  4HST A;  4HNU A;  3PFY A;  2L9S A;  4BAC A;  2ZSI B;  3HKZ A;  2CS3 A;  2LOO A;  1D1A A;  2JSP A;  4YRV A;  3H0D A;  2DXI A;  2CFO A;  2MFZ A;  4BL0 B;  1UEL B;  2L7K A;  1MND A;  4AYB A;  3AFH A;  3S93 A;  1ERD A;  3PNY A;  3H5R A;  4CSW A;  2W1O A;  3K4L A;  2IXS A;  2ZXH A;  4C30 A;  4DBR A;  4E7S A;  5TGT A;  2NOJ B;  3PL8 A;  2KL4 A;  4KIT B;  4PJN A;  2VJ4 A;  3OYE A;  3S8P A;  2CW8 A;  4BE1 A;  2PJR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...