2RQXA

Solution nmr structure of pmrd from klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MEWWVKKVQDNASASLCRVVLQSGALEMIAEIEACRLRLREGDKLTPLADARYCLNNNPTQTLKIRNATHYSSERWTNADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and phospho-PmrA recognition mode of PmrD from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Signaling protein
molecule keywords Polymyxin B resistance protein
total genus 8
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.650 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rqxA00
2RQXA 4HN7A 2JSOA
chains in the Genus database with same CATH superfamily
4DA2A 1VQAA 2C9OA 3S2HB 1NR4A 5BN5A 3VA5A 2K4KA 2ZXPA 1YI2A 1XX8A 2R3ZA 2JJQA 3TP8A 2HD3A 2CWAA 4DR6Q 1C0AA 1VQMA 2EYFA 5BN3A 1F9PA 3D4DA 2SEBD 3ZJYC 1YNND 3HGBA 5J3BA 2B8GA 2F0GA 4XQJA 2UXDL 4GOPB 1S4ZA 5NUCA 3UDFA 1BCPB 1OXTA 1F2MA 2A8VA 3RD4A 1U4RA 3I7FA 2L12A 2WKCA 4GN5A 2BA0A 3DM3A 5T1IA 1V8QA 3E3XA 2DUDA 4A3GB 3FKIB 2N55A 1B3QA 3S1NH 3JC66 4I7ZC 4RG1A 1M90C 2CH4W 1A63A 3M9BA 4KN4C 4X3SA 2F0PA 3F2UA 5IIFA 1YNJC 1Y1WH 2PQAA 2RDFA 4YHHQ 4GZYC 1SNMA 4A93H 1TWCH 1I5FA 1DCZA 2VUMG 4BY7G 1STEA 1SAPA 2ATWA 1JWUD 4LMQD 2I5LX 3BVZA 3C1EA 1JJCB 1XWEA 3B6YA 3PUVA 1WTVA 3IAYA 4PG3A 5IWAQ 3T1YQ 3W1BA 2WB1E 3E9HA 4OELB 2WAQG 3OW2A 2BE5C 1EOVA 1GM5A 2V1CC 5CV5A 2F1MA 4CGYB 4CDCC 1I4QA 2OTLA 2KEEA 2AWNA 5I2YA 1EQRA 1SMXA 4YCWA 4DV5Q 5KRUA 2BH8A 5EJWA 1KC8C 4DNRB 2JA8B 2A73B 1E24A 1NMGA 1YNJD 1S40A 3OW7A 2WB1B 5CYUA 5DLQE 3MXPA 4DV3L 1O7YA 2ZXOA 2HQEA 5FO9B 4RCNA 4DAYA 3TZUA 4DR2L 3A5UA 1PFSA 1YVCA 1BQQT 3BVGA 5C3WA 1RDPD 5EBCA 3KJOA 1CKMA 3H3VH 4R8NA 1SEBD 1S72A 1F2ZA 5EBDA 3KBGA 2B63G 1VQJA 2QEJC 3H3VC 1RJTA 1Y69U 3FP9A 2A6HC 1I3QH 2B3GA 3MXGA 4B3RL 4V0BA 3SK4A 4BXXH 1PLFA 1YBYA 4LUOA 1I4XA 4BY7B 2YYZA 4J8QA 4M8AA 4JPBW 3NEMA 1CZGA 4N9PA 1VS0A 5L37A 3STBC 5LL6S 1YHQA 5I4DA 2B63B 2QKIC 2IX0A 2B2YA 3GTOB 5K36G 1PYBA 1IL2A 4JBKA 5ELOA 4KLKA 1IYJB 1EOTA 3H0GG 2EVBA 5FLMG 1V1OA 2XIWA 4JI6L 3J7ZC 3GTGB 3R2IA 4JI8L 4DR6L 1GUOA 1BDOA 2L9HA 3HOXG 3HOVH 3ZYYX 1KAAA 5C4XB 3KFUA 5EGTA 1QCBD 2K75A 2RVLA 4OX9L 3AYHB 3CAMA 2UXDQ 2NVTB 1HJPA 3RMHA 3HRZC 1ENFA 5IT9c 1LT6D 3CC2A 4KHZA 3FRPB 1VQ5A 2KCNA 3HS0C 2E2HH 4X66L 1WTQA 2Y0SG 3F2CA 1LTBD 2BCOA 5IODA 1MHWC 3CRKC 1JOOA 4Y7NB 3QOJA 2PI2A 1CA6A 3HOVG 3HFZB 4I65A 1JJGA 3S1QB 2XWJB 4UHVA 1EU3A 2FMCA 3NELA 3OIQA 3C1FA 4A3FG 4UAIA 3IFTA 3GTMB 1D6EC 1NR2A 2IPKD 5FJ8G 1FJGQ 4LF6Q 4JV5L 3QIAA 1LTID 2HQLA 3KOJA 5H1SE 1Q7YC 1PH2A 4OEMB 1JMCA 3M4OB 1ONLA 1TS4A 5LMNQ 1X3PA 5EPJA 4P75A 3I55A 4QGUA 1ET9A 2XSCA 1K0SA 3U9SA 3CQZB 3S1RB 3G6EA 1SXTA 1MD2D 1KHIA 2ZTCA 1EUJA 4DGZA 3MXUA 3QOLA 3CCQA 2K50A 2NZ1D 1IL8A 3HOZH 2PNHA 3SK5A 2WV6D 1HQRD 1MGSA 1N36Q 1PTOH 1ZEQX 2N8NA 5C44G 3A8JE 4C3IH 2VQFL 1YHBA 2KUMA 3MWYW 4KJNA 5KNBA 2O5IC 1LTGD 2K5QA 3W5OA 3RNUA 1JICA 1BO0A 2ZM6Q 4P74A 1EWHA 4DV7Q 2DN8A 3FPPA 3HP3A 2O2LD 3Q24A 4DV2L 2N3SA 1RODA 4JI2L 1VQ4A 2VB3X 2G5DA 2WAQB 4WJWA 4DUYQ 3M4PA 1E2ZA 1EY8A 4A76A 2JYOA 5C44H 2Y0SE 3GQBA 3R93A 1PFNA 2D2CC 1FNUA 1DOKA 3NXWA 4XYQA 2RDHA 2K03A 1QOHA 1SNQA 4RAUC 4FF3A 4QUCA 5LHY1 4DR4L 1Y8PB 1SNOA 4JI3Q 1QB5D 1HA5A 1ESFA 5M9OA 1DYQA 4C3HH 1FNWA 2B2TA 2EJFC 4G57A 2A6ED 5KGUA 1EFWA 4LF9Q 2A68D 1K8GA 1IKLA 4FO2A 3S17B 4E6IA 2EY1A 2HDLA 1LM0A 2EQSA 3EFXD 2KCMA 3UE0A 3I4OA 4A3CG 3CRLC 2HT1A 3D31A 3KJPA 4YWKA 3X3MA 4GOPA 4JI8Q 1ZKOA 3I2ZA 3T53B 2NVXB 3F1ZA 3G7LA 1HNXL 3NP8A 3DWPA 3TBIB 5COYA 5LMUL 4NXNQ 3HOWB 2X6LA 1N32Q 5IGCA 1C48A 2B2TC 1XMQL 3W1GA 1HNXQ 2JA6B 3AFQA 1UEAB 3TRZA 1I50B 1JC7A 2F3IA 3CQZH 4K5XA 3S1RH 1Q46A 3BG3A 1MBYA 4RA8A 4CJ1B 1YJWA 1A3VA 5GAHC 3F2BA 2I5MX 4IFDJ 1EL0A 1N33L 2C5CA 4HJ5A 1CSPA 4OHJA 3K7AB 2VNUD 3I4NB 4MZ9A 1GUGA 2QDBA 4HIDA 3GTMH 1N34L 1LABA 1M1KC 4A3LH 4HIOA 4DAMA 3QWNA 2VY3A 1O7IA 3HOYG 1STGA 1G51A 2YTVA 3U4VA 1Y1VG 1QILA 5JJIA 1FGUA 1IBKQ 1U5KA 3S24A 2JSOA 2VL6A 3S2DB 3J81L 4JBMA 2UUBQ 1B1ZA 1L1OB 2WKDA 2JEBI 5IE8A 2NVXH 4K8IA 2B2WA 2F0IA 4C3JG 5IGGA 4KKUA 2CW0D 3MFYA 3K81C 3DUZA 5LL6X 3HOYB 3FVQA 2ZT9C 5DM63 2NVTH 1HNWL 1O80A 2K04A 5HGTA 1EIFA 1VQPA 1Q82C 1B70B 4GNXB 4LFCQ 3PIO3 3Q23A 1N8RC 4B3TQ 1BVSA 5IP9H 2ZM6L 4JI1Q 2NB0A 4ZK9B 5I6YA 3C3LA 1SE8A 4YWMA 3S15B 3MTSA 3S17H 2ES2A 2NUCA 5IGFA 4LW1A 3PO2B 3MA2B 1EYCA 1SMYC 5IYBH 4DR7L 4DUYL 1STBA 2MQHA 4DAYB 4LF4L 3U58A 2HUGA 4HMJA 2ZJRA 1E1TA 1VF5C 1H9SA 1II3A 3TS2A 1BBWA 4HN7A 1HRJA 4BY7H 4DKAC 3S9WA 5C0XH 5IT9L 1PH5A 1D5XC 1WTRA 2KENA 1DGSA 1D2BA 2L55A 3UDGA 1YITA 1O7LA 1TXYA 1V1PA 4ZCKA 4HCSA 4XQNA 3P7JA 2ZJPA 4FP5D 4K2LA 1JB7A 1PTOB 3VDYA 3BVMA 3M85A 4MN3A 5C5MA 2IW3A 1SBBB 1YZ6A 4UY8C 3HOZB 1ZYRC 4IPGA 4WRDA 1VQDA 4A3FB 4JI6Q 1EYDA 3CCEA 2KHIA 1XNQL 4UDUC 2R61A 4XT1B 4X62L 1STHA 3H09A 3J80i 1HPCA 2I07B 1GD7A 4C3IB 3S14B 4GNXC 3HKZE 1G291 4RKLA 2NN6H 3A55A 3M4OH 2CQOA 3NBHA 4X62Q 4DV1L 1HTPA 1HCZA 2Z6KC 2LY7A 2K6AA 4A3KG 3MFGA 1E2WA 4XTCS 3J81j 2ZTEA 1YEZA 2EOTA 1A0IA 4TKOB 3A0JA 2AQ1B 4DV1Q 1VQLA 2NVQB 4QB4A 1BKBA 1S5DD 3LWUA 2MO0A 4IFDI 4CHTB 2IT1A 2PMZB 4KJOA 1JR0D 4DR1Q 4JI5Q 1WTHA 4APVA 4H7BA 4K5VA 5JVG3 4KD4A 4J6HA 2QGQA 1KNEA 3DMUA 3SK8A 5C3XA 3GTPB 2KOLA 5IP7H 3OTOQ 4A93B 4JI7L 1Q1BA 5GAGC 1H9SB 2E5LQ 5C4XH 3A5ZB 4L5TA 3RN5A 4NXMQ 4P2CB 3CC7A 4AYBE 2EJGC 3J80c 3VR3A 3KF8B 2F0DA 3R8BA 1GHJA 4A3GH 1B8AA 2YV5A 5IT9E 2VQFQ 1R4QB 5EPLA 1PHJA 3L0OA 3GTOH 2P5ZX 1TWGB 4GNXA 3VR4A 1SFOH 4HSPA 1ICWA 2CQAA 2KJXA 1IBMQ 3GTGH 1HUNA 5A2QE 3N52A 1ILQA 4IO9A 5JJKA 3O13A 5IYBG 2EXDA 2F0QA 1CT1D 2K14A 5ELEA 2BH2A 1NJIC 2SNMA 1IBML 4R4TA 4ABNA 1KXLA 4JI0Q 2J4XA 3DWQA 1BCPD 4IPHA 4A3MG 1DONA 5G3LF 5E3FA 2XRSD 2RQXA 5C4HA 4NMZA 4Q0FA 4FXGC 1F77A 3GD7A 2UXCL 4OO1G 3Q6SA 4YCVA 1I6HH 2F0VA 3PQIA 4NKLA 3QG1A 2PCFB 1IZ6A 4ZLTF 1BUVT 5C6AA 1RF2D 4XYOA 2N88A 2HDMA 2TSSA 4RGTA 1L1OC 5JJZA 3V2TA 2EYLA 4DV5L 1GOZA 1D5MC 4EVOA 1K73C 2EDGA 4OO1H 4TSSA 3S2DH 2PYKA 2X69A 2BOSA 1JB3A 2QW7A 3RUZA 3TQYA 2RSOA 1SJHD 2BDNA 3I70A 3QB3A 2GN5A 3PMFA 1LT4D 3H0GB 1CSQA 1I6VC 3DXJC 4ME5A 4LF8L 4A3BG 3BU2A 1EFID 1LTLA 2OTJA 2E8GA 1U9RA 1B3AA 2MPMA 2NZOA 5AJ3Q 2JA8G 3I4NH 1EY9A 5K36H 1QZGA 1YJ9A 1QJOA 4GN3B 2J0TD 5FO8B 1XMOQ 4POGA 1LUZA 1KRSA 1WVLA 3HOUH 4LK1C 1MJCA 1SE2A 4IURA 3I90A 3EBEA 4DV4L 3WOEA 4B08A 5JPNC 4A3BH 1Q81C 5DM73 1U0LA 1BCPF 1LT3D 4YWLA 5IP7G 3BDOA 4PQXA 4LF7L 2HCIA 2Z1CA 2QDLA 3T1HL 1Y1WB 1BOSA 1EQQA 2JA6H 1B9MA 1N34Q 4NP5A 4FYDA 5IYDH 4PZ7A 2Q8TA 1PYWD 1V9PA 2UU9Q 3TS0A 2EYHA 1QNUA 3LWEA 4PMBA 2Q2HA 1NBWA 1X54A 3S1NB 1IHZA 4AH6A 2NVYH 1KTKA 5CV4A 4R1JA 1ENCA 3E6ZX 2EYJA 3IFDA 3J7AV 1LACA 5TSSA 1TWHH 4IOCA 3IL8A 5J1ZA 1M8AA 1N9WA 3K5NA 1XTCD 4CBVA 2I46A 4RCOA 3JAMc 5IYDG 5JEAG 2F03A 4A3EB 3KF8A 1FL0A 2Q8RE 3GTKB 4BBSB 1UWVA 4IJHA 4LFCL 5D65A 5FLXc 4GOPC 1GUSA 3IKJA 1XNRQ 4C56C 1TWAH 5JEAJ 4DUZQ 2O4XA 4C2MH 4BS9A 5DEHA 2GVBA 4A3MH 4ME3A 3S2HH 4KKSA 2QILA 4LFBQ 1GO3E 1SYGA 1J5EQ 2RSNA 1HA6A 1V1PB 1U4MA 1JORA 1NY4A 3OWEB 1QVFA 2UUAL 4JI4L 3BYTB 3M4QA 1STAA 2JA5G 3L9AX 1FGBD 2GA4B 2UUCL 1UE6A 3J80L 5JEAH 2ZJQA 1SN8A 2KQ3A 4IUVA 4BA2I 2SNSA 2F0HA 3HKSA 5I2XA 1TU2B 2NTTA 3T1YL 1NMFA 3DHQA 2XVSA 4L6TB 5C5LA 2E2IB 4CDFC 1PRTB 1Z6HA 4LF5L 2IWHA 3H15A 3HOUB 3I4MB 4QIWE 2MGSA 1HQMC 3URYA 3VR5A 5CV6A 1RD9D 4Y52H 4OIJA 3M7GA 5IYCG 1I4RA 4EX5A 3CU7A 1S3OA 1TS3A 1XNQQ 3AMUA 1SR3A 3CW2C 1VQ7A 1PA6A 1Y8NB 3D4WA 1Y1VH 1EEFD 4F7XA 2HHHQ 1PDQA 4AIMA 3AU7A 1CHQD 1L1OA 4A3DH 4ZUIA 4FF1A 4RHRA 3P20A 5CV8A 4JC0A 1NE3A 4OGQC 4G7OC 4A3IG 1PXUA 3JAME 1PRTC 1IW7D 1T5EA 2B2VA 1VDZA 4GS3A 3D6WA 4MNOA 2IL8A 5IYCH 2F0WA 3CCUA 5C3EH 3NQTA 4HIMA 4FDBA 4HSVA 4H13C 1V1QA 1VQKA 1KDAA 3PUZA 4B9WA 2A69C 1K8MA 1EWCA 1UAPA 4B3RQ 1VQNA 4CKBA 2QF7A 3L3OC 3HOWG 3STBD 4A3CH 4LAAA 1J9OA 3OWFA 4ZQ3A 1K8AC 2AUJD 4KMUC 2R92H 3MAQA 2F0LA 2KVMA 5FLMH 1S5CD 2JA5B 1UE7A 3OOCA 3F2DA 3EVQA 1OTCA 3RZOH 3SXHA 1Y8OB 3J81i 2E5LL 3MC0B 3PCOB 2ALYB 2FFKB 4DAVA 2A68C 2JA9A 1X3GA 1HHVA 4NXML 3EA6A 4MTKA 3PSIA 5CORA 3BZDB 3D3RA 3QR8A 3H94A 4WJ4A 1HH2P 1BBUA 2PW7A 1RCVD 3E0JA 2F0TA 1CKNA 3GV6A 3HOVB 4DR3L 2CVRA 2PQEA 2N49A 2OQKA 5FOBB 1VF7A 3ULJA 2EYPA 2MP1A 1A62A 2O5JC 4JOIC 1Q3LA 1X55A 3EN2A 5E1FA 3N6RA 3PO2G 2G9DA 3ONAB 1SYDA 2UUBL 5A35A 1CQFA 1WTOA 1UUPA 4GLAC 2VZAA 5ELFA 3V05A 5I9OA 3A56A 3TREA 1WD1A 2B63H 3RZOB 3VYSA 2JA5H 1K83B 4A3LG 1B44D 4WFN3 2VUMB 1G8ZD 1X3FA 1FVIA 1PFBA 3S16B 1MSGA 3CF5A 5GROA 2K5VA 5D3IB 1R9TB 3A7LA 1IBLQ 2RHSB 3KLSA 3BS1A 3T56B 1TWFB 2F0NA 3GTPH 2A5HA 4JI1L 2RHQB 1NSNS 1C4QA 2UXCQ 4DU9A 3PGZA 4B9XA 3ULPA 1PZKD 1SNCA 2F0MA 2CFMA 1EQTA 1AE3A 1L0YB 1GHKA 4QL5A 3K59A 4DK3C 2EIFA 2K33A 1CKOA 1HNZL 2BE5D 2QA4A 4LF4Q 3MEHA 3RZDH 4KHPQ 1PZJD 4K6DA 1EU4A 4UP9A 1PVOA 3PIP3 4IFDG 3KK7A 3PUWA 3OYYA 3U9OA 2KHSA 5F2DA 4FF2A 4LF6L 2XN9C 1JOKA 4S3SA 1DZ1A 4RH6A 1VQ9A 2LS01 3PV0A 4K2KA 1AW7A 4C1NI 1VMCA 1L0WA 2H1EA 3JAML 1D1IA 1RHPA 4IPCA 3LNNA 1Y1VB 4JYAQ 4X65Q 2PZUA 2MJ8A 3EQLC 1G6PA 2KA7A 3J7AF 3G71A 1PH1A 4XDXA 3BZCA 1EZ6A 1SYFA 4CDEC 5C3EG 3ICEA 2NWGA 2JQOA 1KLUD 1VCIA 4CJ2C 5CV7A 2PPBC 4X65L 1JE5A 1I4PA 2EY6A 3HEJA 4RGMA 4A3FH 1RIPA 1N36L 5D3DA 3TZDA 5M3FB 4DV3Q 3I4MG 3GTQH 5C0XJ 1H9KA 3K0YA 3SDZA 2CKZB 4O0AA 3UDIA 4X3KA 2R6GA 3BDLA 1QUQA 1TWCB 2VXWA 1DXMA 3QO2A 1EEID 4A93G 3L2PA 4OL7A 4A3EG 3Q0AA 2SDFA 2VUMH 2Q8IB 3Q22A 1HZCA 1LYLA 4ALPA 1EYGA 4LFAQ 1K3RA 4UP8A 2ASBA 3MEFA 4K8JA 4L63B 1JWMD 4HMIA 1YNNC 2E2IH 4JI5L 1BR9A 2D62A 1WI5A 4GKKQ 1G2TA 1KAWA 2F4VL 2N78A 4DR5Q 4DF7A 4QY7A 1YNXA 4JBWA 4RHSA 1BCPC 1F9SA 2MFIA 1GJXA 4A3EH 3LGJA 5ISRA 3U50C 2B2YC 1VQFA 4NXNL 5LMUQ 4DNTB 3BZKA 2IX3A 3CCRA 3TMEA 3AQQA 3CCSA 2JA7B 1SLJA 1UE1A 2A6HD 2KBNA 1SMYD 3TDQA 1F9RA 5G3LD 4KN7C 1BXTA 1DM0B 1OO9B 2YTYA 2M2LA 1CQVA 1X9NA 4A4IA 4A75A 4MTNA 4DV6L 2EYOA 4LUZA 5BN4A 2BDOA 2J7ZA 4YIJA 5I6WA 2Z8LA 2R92B 4LFBL 4FXKC 4N8X1 1OXVA 3GTJH 4JK1C 2WFWA 4A3KB 1G6ZA 2JE6I 4FVMA 3P75A 1TWHB 3CCVA 1STNA 2UUAQ 4DV6Q 1VQOA 1QWYA 2SOBA 3BJUA 3Q8DA 2UUCQ 4PZ6A 1A3TA 1KABA 2NTSA 4FNFA 1IBLL 4HR7B 2DY8A 4A3GG 3CPFA 2OEOA 1PZID 2Z4IA 2K28A 1Y14B 3AB9A 3K80C 4TVAB 1XJVA 1HR0L 5AFWA 1VQCA 5CBEE 2D9UA 4B3ML 2RCNA 3OTOL 1MSHA 5IWAL 3PO3B 1QVCA 1L2FA 2YU9H 2JA6G 3M3YB 3I91A 3J81E 2EZVA 1E1OA 3FDTA 3SGIA 4X3UA 1Z7TA 2K7VA 3HG9A 5CBAE 3KBXA 4RWSC 3PUXA 5GQOA 3PIPA 1KRTA 3H0GH 3SHLA 4KV6A 4H02A 1K0RA 3K58A 2EYMA 3J81c 4BBSG 1S5ED 2FXQA 5IGBA 1O7ZA 2X6GA 1MI2A 5JOBA 3NPPA 1LO5D 2Y0SB 2K5NA 3D6CA 4P72A 2A19A 4KY6A 3SEBA 4K0KQ 1CM9A 4AQYL 5IY0A 1F2LA 2EY5A 3ULLA 4X64L 3I4MH 1E0BA 2FJ2A 1XPOA 1E7ZA 1IYUA 3ERSX 1AEXA 3J7A5 4FXDA 3KDFA 4PZ8A 1QVGA 1JE4A 4DXFA 1X3QA 2AQ2B 5IGEA 4L5QA 1O78A 1PYSB 4JI2Q 5C0XG 4V190 2E76C 5M5XH 2L5TA 2WIIB 4QUFA 2DNEA 5AJ3L 4IJLA 4CKCA 2AMCB 1KQSA 4A3MB 2F52A 1SRUA 5IGDA 2OF1A 2I5HA 4ULLA 2PQAB 1MKHA 1TWAB 1BNZA 3E5SA 1I6HB 3KF6A 3EJIA 4PMWA 4ILWA 4IUUA 5JPMC 2L0CA 5C4JB 1X6OA 3OHXC 1DJRD 1Q8KA 3CCMA 3MXNB 1X65A 4XQQA 5J39A 2CCZA 1FYCA 3D8GA 4K5WA 4TQUS 2VW9A 5M5YB 2UU9L 1GXDC 4DR3Q 3M7NA 2WINB 5ELDA 3ERQA 4EQOA 2M00A 2NVYB 2R7FA 4DK1A 3DM1A 3J80E 5M3MB 4ZKCB 4XT3B 1PH9A 2MO1A 2NYZD 1SFOB 1LV9A 1NCVA 4DXGA 1CHPD 5KYIA 1PFMA 1RL2A 1TWGH 4HEDA 2MNAA 1B2TA 4P71A 2E2DC 1Z9FA 3EROA 5EAYA 3RR5A 3K0XA 4ZAIA 4KTAA 4PV1C 2UXBL 1OXUA 3OSOA 1HXYD 1YIJA 4YHHL 4BY1B 1HFNA 1XMQQ 1H9JA 1BF4A 4OO1I 1T5XD 1A6XA 1TY2A 1P16A 1LLRD 5CC4A 2B2VC 2UXBQ 4IUNA 4DUZL 3MHBA 1TS2A 1JT8A 4NPSA 1TVXA 3I4LA 5DNFA 1J5EL 2XNAC 4MHEA 1A15A 5CGKA 4BY1G 4JV5Q 3ITPA 1G2SA 2F0SA 3L7ZC 3I4NG 3K5OA 4JI4Q 2AHOB 4HCEA 1IKMA 4R4CA 1N33Q 2WAQE 1Q8IA 4IQZA 4DV0L 1MIUA 2OT2A 2E74C 4RGNA 2DGYA 3KLWA 4NW2A 4H0LC 4RMFA 1T9HA 2H5XA 2WACA 5E4XA 2K32A 2RDGA 2A6EC 3I72A 1LTTD 4BXXG 1I94L 1R4PB 2NVQH 2FMMA 4GLXA 1SE4A 4QMGA 1H9RA 4BY1H 3A54A 4IOAA 3MXNA 1GVPA 1BBXC 2EE1A 1WD0A 4IZ8A 3I8ZA 4IUPA 1WCMH 3KF6B 1M4VA 3HZXA 1EZ8A 2TMPA 1CKNB 2PMZE 1KNAA 5BR8L 1J8IA 1U4LA 4KY5A 5M3MH 4JI0L 4M1UB 3A7AB 1QE6A 2C35B 1XXGA 3VR6A 4ZYSA 3IRBA 3QJYA 4WORA 1GUTA 3M4YA 1DOMA 2A1AA 2A74C 3PF5A 1LTRD 5DAUA 1KL9A 2PO4A 4JW0A 5EKLA 1XPRA 2R93H 3DLLA 1I3QB 2VQEL 1ASYA 4GKKL 1TS5A 1B4OA 2K52A 4BWGB 1IYVA 1B50A 2RF4A 1CTMA 3FHWA 4ZRZA 1V43A 2PI2E 3A74A 4EQPA 4DK6C 1ICFB 2VQEQ 2CW0C 2B2UC 4I7AA 5K5PA 3HOYH 1AP0A 4OX9Q 3CMEA 1I4HA 1CI3M 1E22A 2E75C 3R2TA 1AN8A 2E2JB 2ENBA 2R93G 4MIUA 1PRTD 2DJFC 4HJ9A 2CWPA 4L8JA 1GKHA 4GKJQ 4G7ZC 1ENAA 4OIKA 2JA8H 1XPUA 1WCMB 1TY0A 5FLXL 1CUKA 4X3TA 1HR0W 1N32L 1L0XB 1PH4A 4OWXB 3SR1A 3TSSA 2LKVA 3GTLB 2K5WA 3CC4A 1AH9A 3SVMA 1EY0A 1W6JA 3DWAA 4A3DG 5ELCA 2B2UA 4LUVA 1WTXA 4A3IH 1AFPA 1VQ8A 1X3EA 2K5HA 2NZHA 1EY7A 1EY6A 4N8FA 4QCLA 1PRTF 3R3OA 3PO3H 3VYTA 1VQ6A 1FR3A 1W6KA 1I50H 2IJ0A 2RKSA 3NQIA 4DAPA 4A3JG 4CJ0B 4EQ5A 1J6QA 1IW7C 1P8LA 2MHVA 4G7HC 3EIVA 1ZXTA 2Z0SA 4LF7Q 2ZTDA 3HOWH 4H44C 2LXJA 1VQIA 5KEEA 3S14H 1F9QA 4L5SA 4L5RC 2JEAI 1A2UA 2IHEA 4U68A 3D4RA 3WDNA 1JWSD 4KHPL 3G48A 3NHHA 2JA7G 3FEWX 3K5MA 4GN4B 2B29A 2ZXRA 2DY7A 1XNRL 2KCCA 2ICIA 1UEBA 2F0FA 1SYEA 2NN6G 2IX1A 3T4AC 2OWOA 2B8FA 2IHFA 2NBFA 3S1MH 5C4JH 2R7ZG 1ET6A 4JYAL 1HZAA 1WOCA 1DOLA 5M5YH 2H4OA 1XTDA 1EIYB 4IUQA 4C3IG 1QUQB 1Q1EA 1TIID 1D7QA 1AZPA 2LFNA 5M5XB 3RLNA 4BBRB 4DV7L 2R7ZB 3VYUA 3PO2H 1KLGD 4JI3L 3H91A 4JBJA 5C44B 4DV2Q 3S15H 1SE3A 4Z9CB 2R7ZH 1LT5D 4C3HB 3FMCA 1HNZQ 3TN2A 2F0EA 5JJLA 3K6OA 3CMAA 2BA1A 4HJ7A 3K7UC 3GDEA 5FO7B 3SE0A 4Q5VA 3CCJA 5C4XG 2K1BA 4QF4A 4RGOS 2L1BA 3J7YW 3S1MB 5HURA 3NWSA 1KIXA 4HAEA 2PZWA 3DEPA 3F8TA 2F0UA 2WB1G 3OIPA 2A69D 5CV9A 1LTSD 2NN6I 5M3FH 2DJGC 2B2WC 5KIXA 4ODGA 5ELBA 2VB2X 1NTGA 2L15A 2AWOA 1VMPA 4DN4M 2EJMA 4DFAA 3NWTA 5JAVA 3CXCA 3KLRA 4DR2Q 1ASZA 4IN3A 3CHBD 3JAMi 2HHHL 1VQGA 4LF8Q 4P73A 3K7AH 2F3VA 2DNCA 3HKZG 2PNRC 5J22A 4LWCA 2KHJA 1SNDA 2OCEA 2VS1A 2XRQD 1VQEA 5M3FG 2D0OA 4J15A 4QIWB 1Y1WG 3PO3G 2HIXA 4CKEA 5KNDA 2RBMA 1A3UA 4ZKBB 2AUKA 4IALA 3UI2A 3K5LA 1TQOA 4A3JH 4A3IB 4B3SL 3HKZB 3S1QH 5D14A 4R8IA 4DV0Q 2Q2UA 1FJGL 3W2DA 3WWVA 2QEXA 4OXPA 4O2DA 3T1HQ 3RLOA 3SK6A 1IBKL 3I56A 2EY2A 3GTLH 5C0XI 3GP7A 4PNYA 3D0FA 1I94Q 2JA7H 1EY5A 3GTJB 2HIVA 1HFGA 4EQNA 3X3NA 3S16H 2Q2TA 2K05A 1SROA 3TEHB 4AYBG 4JOIA 1EIHA 1ZYRD 3KLSX 4OWTB 1H9MA 4K14A 4C1NK 2ID0A 3CKIB 5FK9C 2E2JH 1X32A 2E2HB 3ER0A 1ML0D 1SYBA 5FJ8H 4B3TL 2R7DA 4POFA 1A2TA 2Z6KA 5E4WC 3P1HA 2M9VA 1UE5A 5EKIA 2OXPA 4R4IA 1HTLD 1WJJA 3NTIA 1OXXK 2F0OA 5A2QL 2B39A 3NBIA 2MUYA 4DPGA 1EYAA 4RKBA 2JK8A 4C3JH 1K9MC 1W3SA 1G91A 3E0EA 1HNWQ 1FNVA 3GV3A 3U4ZA 3K57A 1QZHA 2R92G 1W2BA 2R93B 1D1KA 2IY5B 2RA4A 1LTAD 1DD2A 3HOZG 2F0JA 3HOUG 5IP9G 2XTIA 1U4PA 1PH3A 1JQYD 1S5BD 4KK7A 3GTQB 4KHVA 2OQ0A 4IFDH 1EIGA 3C2PA 4LJZC 1WYDA 1WTPA 4EGVA 2Z4HA 3ND9A 1HZ9A 2JXMB 2F0KA 5LMNW 4KKTA 4HJ8A 4ZUJA 5IOCA 4YCUA 3UDXA 3GO5A 3A8KE 1E2VA 1NAPA 1STYA 4IPDA 1WTWA 3OPOA 4GLVB 3NBHB 4CDDC 3T13A 3HOXH 1RTOA 1WFQA 2EPBA 4X6AH 2KCTA 4OWWB 2K01A 1VQHA 3H3VI 1XYIA 1JOQA 4K0KL 1VQBA 1PH7A 4JVZA 4N9TA 4IUTA 3RZDB 4C3HG 1CK1A 2JN4A 3K8AA 3G4SA 5FLXE 3HOXB 3PUYA 4JG2A 5CR3A 1F2YA 1S5FD 4LNQA 4DR1L 5M3MG 5T1GA 5EPKA 4TRDA 2EXZA 1EY4A 4O1NA 3E9IA 4R4OA 4J1MA 1E3PA 3AEVA 1FD7D 3TP6A 2F4VQ 2XWBB 4Y7NH 1K83H 2CH4A 3I73A 1PMRA 2L4NA 4DR5L 1C9OA 4LF9L 3OMGA 1D8LA 4B3SQ 1PV4A 3AFPA 1KDCA 1K28A 2LMCB 3NTHA 5I9PA 5GADC 1TWFH 1PH8A 3FKIG 3CCLA 1R9TH 2Z6BA 1AZQA 3TP7A 4F8MA 3NTKA 1GUWA 3C46A 1X56A 4U673 3CPWA 4R9WA 2QCPX 1K3BC 3WOFA 4K6LA 1HZBA 1YHAA 1Z47A 4C3JB 4PMCA 5EQ0A 3NE5B 4JCVE 4ID6A 5C4ZA 4KD3A 4G4KA 3A8IE 2Z9HA 4JI7Q 1EWIA 4C2MB 1RKNA 2G9HD 2I0QA 2PW5A 1QNKA 1NNXA 1SNPA 3KDFB 1SYCA 1SDFA 2V4DA 3VYRA 3V96A 1B53A 4YY3L 1B9NA 3KUPA 2HCCA 3PF4A 1PTOC 3KYHC 2CHBD 1CFMA 4KY7A 5KNCA 4HTHA 3G6JB 5JVH3 5EKKA 5M5WB 1I4GA 3I3CA 5ELNA 3BYYB 3T51B 4YY3Q 1Q90A 1K8OA 3UE1A 4X66Q 3W3AA 3CD6A 5BR8Q 2PZTA 4BA1I 1YJNA 3RN2A 1PTOD 3BDCA 4XIGS 1CZWA 1IXRA 4F88A 1HR0Q 4B3MQ 1PH6A 2FINB 1JJ2A 1ILPA 2D0PA 1C7YA 2FHTA 4A3JB 1HUMA 4LF5Q 4F87A 1JCKB 3PIOA 4NB3A 1A8VA 4QJFA 1TR5A 1ESRA 3H6MA 1B7YB 4HJAA 1TKWB 4A3BB 4WJ3M 2K5DA 5LMNL 1UNSA 2RCFA 2KEDA 3T16A 2XGTA 5GAEC 1NUCA 3NUCA 5C3EB 3MVVA 4AQYQ 5KYLA 2YTXA 4RFBA 5FKAC 4X64Q 3DEOA 4DK0A 1Q12A 4DNIA 1H95A 2F3WA 2GVAA 3VR2A 2D5DA 2Q2IA 4A3DB 1OXSC 1CA5A 3CP0A 1SJED 3ND8A 1QG7A 1TT2A 4QQBX 3NSWA 3NK9A 1SSOA 4GKJL 4DR7Q 4UPAA 2YU9B 3M3YH 3RLFA 1KDBA 2LXKA 2F4IA 3OMCA 4DV4Q 4BBRG 2WP8J 4KI0A 4NDXA 4AYBB 1WCMG 4R4QA 3MZ5A 2ICEC 1GUNA 2AQ3B 2AKWB 1KD1C 2KECA 4HIKA 3TP5A 3NENA 4FF4A 3VA7A 3LX0A 3FKIH 5HY6A 1XMOL 1PTOF 4O42A 5HGQA 4UP7A 2LSSA 1Q86C 5CMDA 4LFAL 1AE2A 4A3KH 1MJEA 1D5ZC 1RTNA 1EQVA 4BBSH 2JP1A 4DR4Q 3GTKH 1C8CA 5E7NA 3FPUB 4BBRH 5M5WH 4XXEA 2L11A 4OONA
chains in the Genus database with same CATH topology
4DA2A 2C9OA 3S2HB 1NR4A 5BN5A 3VA5A 2ZXPA 1XX8A 2R3ZA 3TP8A 2EYFA 5BN3A 1F9PA 3D4DA 2SEBD 1YNND 3HGBA 2B8GA 2F0GA 4XQJA 1S4ZA 5NUCA 1BCPB 1OXTA 1F2MA 3RD4A 1U4RA 2L12A 2WKCA 2BA0A 5T1IA 1V8QA 4A3GB 3FKIB 2N55A 4I7ZC 4KN4C 4X3SA 2F0PA 3F2UA 5IIFA 1YNJC 2RDFA 4GZYC 1SNMA 1DCZA 1STEA 1SAPA 1JWUD 4LMQD 3BVZA 3C1EA 1XWEA 3PUVA 1WTVA 3IAYA 2BE5C 5CV5A 2F1MA 4CGYB 1I4QA 2KEEA 2AWNA 5I2YA 5KRUA 5EJWA 4DNRB 2JA8B 2A73B 1YNJD 3OW7A 2WB1B 5CYUA 3MXPA 1O7YA 2ZXOA 2HQEA 5FO9B 4RCNA 4DAYA 3TZUA 3BVGA 1BQQT 5C3WA 1RDPD 5EBCA 4R8NA 1SEBD 1F2ZA 5EBDA 3KBGA 2QEJC 3H3VC 1RJTA 1Y69U 2A6HC 3MXGA 4V0BA 3SK4A 1PLFA 1I4XA 4BY7B 2YYZA 4J8QA 4M8AA 1CZGA 4N9PA 5LL6S 5I4DA 2B63B 2QKIC 2IX0A 2B2YA 3GTOB 5K36G 1EOTA 2EVBA 1V1OA 2XIWA 3GTGB 3R2IA 1GUOA 1BDOA 2L9HA 3ZYYX 1KAAA 5C4XB 5EGTA 1QCBD 2RVLA 2NVTB 3RMHA 3HRZC 1ENFA 1LT6D 4KHZA 3FRPB 2KCNA 3HS0C 1WTQA 1LTBD 2BCOA 5IODA 3CRKC 1JOOA 4Y7NB 3QOJA 1CA6A 4I65A 3S1QB 2XWJB 1EU3A 2FMCA 3OIQA 3C1FA 4UAIA 3IFTA 3GTMB 1D6EC 1NR2A 2IPKD 3QIAA 1LTID 3M4OB 1ONLA 1TS4A 1X3PA 5EPJA 1ET9A 2XSCA 3U9SA 3CQZB 3S1RB 1SXTA 1MD2D 4DGZA 3MXUA 3QOLA 2NZ1D 1IL8A 3SK5A 2WV6D 1HQRD 1MGSA 1PTOH 1ZEQX 3A8JE 2KUMA 3MWYW 4KJNA 5KNBA 2O5IC 1LTGD 2K5QA 1JICA 1BO0A 1EWHA 2DN8A 3FPPA 3HP3A 2O2LD 3Q24A 1RODA 2VB3X 2WAQB 4WJWA 1E2ZA 1EY8A 2JYOA 3GQBA 3R93A 1PFNA 2D2CC 1FNUA 1DOKA 3NXWA 4XYQA 2RDHA 2K03A 1QOHA 1SNQA 4RAUC 4FF3A 4QUCA 5LHY1 1Y8PB 1SNOA 1QB5D 1HA5A 1ESFA 5M9OA 1DYQA 1FNWA 2B2TA 2EJFC 4G57A 2A6ED 5KGUA 2A68D 1IKLA 4FO2A 3S17B 4E6IA 2EY1A 2HDLA 3EFXD 3CRLC 3D31A 3X3MA 1ZKOA 3T53B 2NVXB 3G7LA 3NP8A 3DWPA 3TBIB 5COYA 3HOWB 2X6LA 5IGCA 1C48A 2B2TC 2JA6B 1UEAB 1I50B 1JC7A 4K5XA 3BG3A 1MBYA 4RA8A 4CJ1B 1A3VA 4IFDJ 1EL0A 2C5CA 4OHJA 3K7AB 2VNUD 3I4NB 1GUGA 2QDBA 1LABA 3QWNA 1STGA 1QILA 2JSOA 3S2DB 3J81L 1B1ZA 2WKDA 2JEBI 2F0IA 4C3JG 2B2WA 4K8IA 5IGGA 2CW0D 3MFYA 4KKUA 3DUZA 5LL6X 3HOYB 3FVQA 2ZT9C 5DM63 1O80A 2K04A 5HGTA 3PIO3 3Q23A 2NB0A 4ZK9B 5I6YA 3C3LA 3S15B 3MTSA 2NUCA 5IGFA 3PO2B 3MA2B 1EYCA 1SMYC 1STBA 2HUGA 4HMJA 1VF5C 1H9SA 1II3A 4HN7A 1HRJA 3S9WA 5C0XH 5IT9L 1D5XC 1WTRA 1D2BA 2L55A 1O7LA 1V1PA 4HCSA 4XQNA 3P7JA 4FP5D 4K2LA 1PTOB 3BVMA 3M85A 4MN3A 5C5MA 2IW3A 1SBBB 3HOZB 1ZYRC 4WRDA 4A3FB 1EYDA 4UDUC 2R61A 4XT1B 1STHA 3H09A 1HPCA 2I07B 4C3IB 3S14B 1G291 4RKLA 2NN6H 3A55A 3NBHA 1HTPA 1HCZA 2LY7A 2K6AA 3MFGA 1E2WA 4XTCS 2EOTA 4TKOB 2AQ1B 2NVQB 4QB4A 1S5DD 3LWUA 4IFDI 4CHTB 2IT1A 2PMZB 4KJOA 1JR0D 4H7BA 4K5VA 5JVG3 4KD4A 4J6HA 1KNEA 3DMUA 3SK8A 5C3XA 3GTPB 2KOLA 4A93B 1Q1BA 1H9SB 4P2CB 2EJGC 3VR3A 2F0DA 3R8BA 1GHJA 5IT9E 1R4QB 5EPLA 1TWGB 3VR4A 4HSPA 1ICWA 2CQAA 2KJXA 1HUNA 5A2QE 3N52A 1ILQA 3O13A 2F0QA 1CT1D 5ELEA 2SNMA 4ABNA 2J4XA 3DWQA 1BCPD 1DONA 5G3LF 5E3FA 2XRSD 2RQXA 5C4HA 4NMZA 4Q0FA 4FXGC 1F77A 3GD7A 4OO1G 3Q6SA 2F0VA 4NKLA 3QG1A 2PCFB 4ZLTF 1BUVT 5C6AA 1RF2D 4XYOA 2N88A 2HDMA 2TSSA 4RGTA 5JJZA 3V2TA 2EYLA 1GOZA 1D5MC 4EVOA 4OO1H 2EDGA 4TSSA 2PYKA 2X69A 2BOSA 1JB3A 3RUZA 2RSOA 1SJHD 2BDNA 3I70A 3QB3A 3PMFA 1LT4D 3H0GB 1I6VC 3DXJC 4ME5A 1EFID 1U9RA 1B3AA 2MPMA 1EY9A 5K36H 1QJOA 2J0TD 5FO8B 1WVLA 4LK1C 1SE2A 4IURA 3I90A 3WOEA 4B08A 5JPNC 5DM73 1BCPF 1LT3D 3BDOA 4PQXA 2HCIA 2Z1CA 1Y1WB 1BOSA 1B9MA 4FYDA 4NP5A 2Q8TA 1PYWD 2EYHA 1QNUA 3LWEA 4PMBA 3S1NB 1IHZA 1KTKA 5CV4A 1ENCA 3E6ZX 2EYJA 3IFDA 3J7AV 1LACA 5TSSA 3IL8A 5J1ZA 1M8AA 3K5NA 1XTCD 4CBVA 2I46A 4RCOA 5JEAG 2F03A 4A3EB 3KF8A 2Q8RE 3GTKB 4BBSB 5D65A 1GUSA 3IKJA 4C56C 5JEAJ 2O4XA 4BS9A 5DEHA 4KKSA 2QILA 1SYGA 2RSNA 1HA6A 1V1PB 1U4MA 1JORA 3OWEB 3BYTB 1STAA 3L9AX 1FGBD 2GA4B 3J80L 5JEAH 2KQ3A 4IUVA 4BA2I 2SNSA 2F0HA 5I2XA 1TU2B 2NTTA 3DHQA 2XVSA 4L6TB 5C5LA 2E2IB 1PRTB 1Z6HA 2IWHA 3HOUB 3I4MB 2MGSA 1HQMC 3URYA 3VR5A 5CV6A 1RD9D 4OIJA 3M7GA 1I4RA 3CU7A 1TS3A 3AMUA 1Y8NB 3D4WA 1EEFD 4F7XA 1PDQA 3AU7A 1CHQD 4ZUIA 4FF1A 4RHRA 3P20A 5CV8A 4OGQC 4G7OC 1PXUA 3JAME 1PRTC 1IW7D 1T5EA 2B2VA 1VDZA 3D6WA 2IL8A 2F0WA 3NQTA 4HSVA 4H13C 1KDAA 3PUZA 4B9WA 2A69C 1K8MA 1EWCA 1UAPA 4CKBA 2QF7A 3L3OC 4LAAA 1J9OA 3OWFA 4ZQ3A 2AUJD 4KMUC 3MAQA 2F0LA 2KVMA 1S5CD 2JA5B 3OOCA 3EVQA 3SXHA 1Y8OB 3MC0B 2FFKB 4DAVA 2A68C 1HHVA 3EA6A 5CORA 3BZDB 3D3RA 3H94A 2PW7A 1RCVD 3E0JA 2F0TA 3GV6A 3HOVB 2CVRA 2PQEA 5FOBB 1VF7A 2EYPA 2MP1A 2O5JC 1Q3LA 5E1FA 3N6RA 2G9DA 3ONAB 1SYDA 5A35A 1CQFA 1WTOA 1UUPA 5ELFA 3V05A 5I9OA 3A56A 1WD1A 3RZOB 3VYSA 1K83B 1B44D 4WFN3 2VUMB 1G8ZD 1PFBA 3S16B 1MSGA 5D3IB 1R9TB 3A7LA 3KLSA 3BS1A 3T56B 1TWFB 2F0NA 2A5HA 1NSNS 1C4QA 4DU9A 4B9XA 1PZKD 1SNCA 2F0MA 1EQTA 1GHKA 1L0YB 3K59A 2K33A 2BE5D 3MEHA 1PZJD 4K6DA 1EU4A 3PIP3 4IFDG 3KK7A 3PUWA 3U9OA 4FF2A 2KHSA 5F2DA 2XN9C 1JOKA 4S3SA 1DZ1A 4RH6A 2LS01 3PV0A 4K2KA 1AW7A 4C1NI 1VMCA 2H1EA 3JAML 1D1IA 1RHPA 3LNNA 1Y1VB 2PZUA 2MJ8A 3EQLC 2KA7A 3J7AF 4XDXA 1EZ6A 1SYFA 2NWGA 1KLUD 1VCIA 4CJ2C 5CV7A 2PPBC 1I4PA 2EY6A 3HEJA 4RGMA 5D3DA 3TZDA 5M3FB 5C0XJ 1H9KA 3K0YA 3SDZA 4X3KA 2R6GA 3BDLA 1TWCB 2VXWA 1DXMA 3QO2A 1EEID 4OL7A 3Q0AA 2SDFA 2Q8IB 3Q22A 4K8JA 4L63B 1JWMD 4HMIA 1YNNC 1BR9A 2D62A 1G2TA 4DF7A 4JBWA 4RHSA 1BCPC 1F9SA 1GJXA 5ISRA 2B2YC 4DNTB 2IX3A 3TMEA 2JA7B 2A6HD 3TDQA 1SMYD 1F9RA 5G3LD 4KN7C 1BXTA 1DM0B 1OO9B 2M2LA 1CQVA 2EYOA 5BN4A 2BDOA 2J7ZA 4YIJA 5I6WA 2Z8LA 2R92B 4FXKC 1OXVA 4JK1C 1G6ZA 4A3KB 2JE6I 4FVMA 3P75A 1TWHB 1STNA 1QWYA 2SOBA 1A3TA 1KABA 2NTSA 4FNFA 4HR7B 2DY8A 2OEOA 1PZID 2Z4IA 2K28A 3AB9A 5AFWA 5CBEE 2D9UA 1MSHA 3PO3B 3M3YB 3I91A 3J81E 2EZVA 3FDTA 4X3UA 1Z7TA 2K7VA 3HG9A 5CBAE 3KBXA 4RWSC 3PUXA 3SHLA 4KV6A 3K58A 2EYMA 1S5ED 5IGBA 1O7ZA 2X6GA 1MI2A 5JOBA 3NPPA 1LO5D 2Y0SB 3D6CA 4KY6A 3SEBA 1CM9A 1F2LA 2EY5A 1E0BA 2FJ2A 1IYUA 1AEXA 4FXDA 1JE4A 4DXFA 1X3QA 2AQ2B 5IGEA 1O78A 4V190 5C0XG 2E76C 2L5TA 2WIIB 4QUFA 2DNEA 4CKCA 4A3MB 5IGDA 2OF1A 4ULLA 1TWAB 1BNZA 3E5SA 1I6HB 3EJIA 4PMWA 4ILWA 4IUUA 5JPMC 2L0CA 5C4JB 3OHXC 1DJRD 5J39A 4XQQA 1FYCA 3D8GA 4K5WA 4TQUS 5M5YB 1GXDC 3M7NA 2WINB 5ELDA 3ERQA 4EQOA 2M00A 2NVYB 4DK1A 3DM1A 3J80E 5M3MB 4ZKCB 4XT3B 2NYZD 1SFOB 1LV9A 1NCVA 4DXGA 1CHPD 5KYIA 1PFMA 4HEDA 1B2TA 2E2DC 3EROA 4ZAIA 4KTAA 4PV1C 1OXUA 3OSOA 1HXYD 4BY1B 1HFNA 1H9JA 1BF4A 4OO1I 1T5XD 1A6XA 1TY2A 1LLRD 5CC4A 2B2VC 4IUNA 3MHBA 1TS2A 1TVXA 3I4LA 5DNFA 2XNAC 4MHEA 1A15A 5CGKA 1G2SA 3ITPA 2F0SA 3L7ZC 3K5OA 4HCEA 1IKMA 1Q8IA 4IQZA 2OT2A 2E74C 4RGNA 4NW2A 4H0LC 2WACA 5E4XA 2K32A 2RDGA 2A6EC 3I72A 1LTTD 1R4PB 2FMMA 1SE4A 4QMGA 1H9RA 3A54A 3MXNA 1BBXC 2EE1A 1WD0A 4IZ8A 3I8ZA 4IUPA 1M4VA 3HZXA 1EZ8A 2TMPA 1KNAA 1J8IA 1U4LA 4KY5A 4M1UB 3A7AB 1QE6A 1XXGA 3VR6A 4ZYSA 3QJYA 4WORA 1GUTA 3M4YA 1DOMA 2A74C 1LTRD 5DAUA 2PO4A 5EKLA 1I3QB 1TS5A 1B4OA 4BWGB 1IYVA 1B50A 1CTMA 4ZRZA 1V43A 4EQPA 2CW0C 2B2UC 5K5PA 1AP0A 1I4HA 1CI3M 2E75C 3R2TA 1AN8A 2E2JB 2ENBA 4MIUA 1PRTD 4L8JA 4G7ZC 1ENAA 4OIKA 1WCMB 1TY0A 5FLXL 4X3TA 1L0XB 3SR1A 3TSSA 2LKVA 3GTLB 2K5WA 3SVMA 1EY0A 1W6JA 3DWAA 5ELCA 2B2UA 1WTXA 1AFPA 1EY7A 1EY6A 4QCLA 1PRTF 3R3OA 3VYTA 1FR3A 1W6KA 2IJ0A 2RKSA 3NQIA 4DAPA 4CJ0B 1IW7C 2MHVA 4G7HC 1ZXTA 4H44C 5KEEA 1F9QA 2JEAI 1A2UA 4U68A 3D4RA 3WDNA 1JWSD 3NHHA 3FEWX 3K5MA 2ZXRA 2DY7A 2KCCA 2ICIA 2F0FA 1SYEA 2NN6G 2IX1A 3T4AC 2B8FA 2NBFA 1ET6A 1DOLA 2H4OA 4IUQA 4C3IG 1Q1EA 1TIID 1AZPA 2LFNA 5M5XB 4BBRB 2R7ZB 3VYUA 1KLGD 3H91A 5C44B 1SE3A 4Z9CB 1LT5D 4C3HB 3FMCA 3TN2A 2F0EA 3K6OA 2BA1A 5FO7B 3SE0A 4Q5VA 2K1BA 4QF4A 4RGOS 2L1BA 3J7YW 3S1MB 5HURA 3NWSA 4HAEA 2PZWA 3DEPA 2F0UA 3OIPA 2A69D 5CV9A 1LTSD 2NN6I 2B2WC 5KIXA 4ODGA 5ELBA 2VB2X 2AWOA 1VMPA 4DN4M 2EJMA 4DFAA 3NWTA 5JAVA 3KLRA 4IN3A 3CHBD 2F3VA 2DNCA 2PNRC 5J22A 1SNDA 2XRQD 4QIWB 4CKEA 5KNDA 2RBMA 1A3UA 4ZKBB 2AUKA 4IALA 3UI2A 3K5LA 1TQOA 4A3IB 3HKZB 5D14A 4R8IA 3W2DA 3SK6A 2EY2A 5C0XI 3GP7A 4PNYA 1EY5A 3GTJB 1HFGA 4EQNA 3X3NA 2K05A 1EIHA 1ZYRD 3KLSX 1H9MA 4K14A 4C1NK 2ID0A 3CKIB 5FK9C 2E2HB 1X32A 1ML0D 1SYBA 1A2TA 5E4WC 3P1HA 2M9VA 5EKIA 2OXPA 1HTLD 3NTIA 1OXXK 2F0OA 5A2QL 2B39A 3NBIA 2MUYA 1EYAA 4RKBA 1G91A 1FNVA 3GV3A 3K57A 2R93B 1D1KA 2RA4A 1LTAD 1DD2A 2F0JA 1U4PA 1JQYD 1S5BD 4KK7A 3GTQB 4KHVA 4IFDH 1EIGA 3C2PA 4LJZC 1WTPA 4EGVA 2Z4HA 3ND9A 2JXMB 2F0KA 4KKTA 4ZUJA 5IOCA 3GO5A 3A8KE 1E2VA 1NAPA 1STYA 1WTWA 3OPOA 3T13A 1RTOA 2EPBA 2K01A 1XYIA 1JOQA 4N9TA 4IUTA 3RZDB 4C3HG 1CK1A 5FLXE 3HOXB 3PUYA 5CR3A 1F2YA 1S5FD 5T1GA 5EPKA 4TRDA 2EXZA 1EY4A 4O1NA 4J1MA 1FD7D 3TP6A 2XWBB 3I73A 1PMRA 2L4NA 3OMGA 1KDCA 2LMCB 3NTHA 5I9PA 1AZQA 3TP7A 4F8MA 3NTKA 1GUWA 3C46A 4U673 4R9WA 2QCPX 3WOFA 4K6LA 1Z47A 4C3JB 4PMCA 5EQ0A 3NE5B 4ID6A 5C4ZA 4KD3A 4G4KA 3A8IE 4C2MB 1RKNA 2G9HD 2PW5A 1QNKA 1SNPA 1SYCA 1SDFA 2V4DA 3VYRA 3V96A 1B53A 1B9NA 3KUPA 2HCCA 1PTOC 2CHBD 1CFMA 4KY7A 5KNCA 4HTHA 3G6JB 5JVH3 5EKKA 5M5WB 1I4GA 3I3CA 3BYYB 3T51B 1Q90A 1K8OA 3W3AA 2PZTA 4BA1I 1PTOD 3BDCA 4XIGS 1CZWA 4F88A 2FINB 1ILPA 2FHTA 4A3JB 1HUMA 4F87A 1JCKB 1TR5A 1ESRA 3H6MA 1TKWB 4A3BB 2K5DA 1UNSA 2KEDA 3T16A 1NUCA 3NUCA 5C3EB 3MVVA 5KYLA 4RFBA 5FKAC 3DEOA 4DK0A 1Q12A 2F3WA 3VR2A 2D5DA 4A3DB 1OXSC 1CA5A 1SJED 3ND8A 1QG7A 1TT2A 3NSWA 3NK9A 1SSOA 2YU9B 3RLFA 1KDBA 2F4IA 3OMCA 2WP8J 4KI0A 4NDXA 4AYBB 3MZ5A 2ICEC 1GUNA 2AQ3B 2KECA 3TP5A 4FF4A 3VA7A 3LX0A 1PTOF 4O42A 5CMDA 1D5ZC 1RTNA 1EQVA 2JP1A 1C8CA 3FPUB 4XXEA 2L11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQX A;  4HN7 A;  2JSO A; 
#chains in the Genus database with same CATH topology
 4DA2 A;  1VQA A;  2C9O A;  3S2H B;  1NR4 A;  5BN5 A;  3VA5 A;  2K4K A;  2ZXP A;  1YI2 A;  1XX8 A;  2R3Z A;  2JJQ A;  3TP8 A;  2HD3 A;  2CWA A;  4DR6 Q;  1C0A A;  1VQM A;  2EYF A;  5BN3 A;  1F9P A;  3D4D A;  2SEB D;  3ZJY C;  1YNN D;  3HGB A;  5J3B A;  2B8G A;  2F0G A;  4XQJ A;  2UXD L;  4GOP B;  1S4Z A;  5NUC A;  3UDF A;  1BCP B;  1OXT A;  1F2M A;  2A8V A;  3RD4 A;  1U4R A;  3I7F A;  2L12 A;  2WKC A;  4GN5 A;  2BA0 A;  3DM3 A;  5T1I A;  1V8Q A;  3E3X A;  2DUD A;  4A3G B;  3FKI B;  2N55 A;  1B3Q A;  3S1N H;  3JC6 6;  4I7Z C;  4RG1 A;  1M90 C;  2CH4 W;  1A63 A;  3M9B A;  4KN4 C;  4X3S A;  2F0P A;  3F2U A;  5IIF A;  1YNJ C;  1Y1W H;  2PQA A;  2RDF A;  4YHH Q;  4GZY C;  1SNM A;  4A93 H;  1TWC H;  1I5F A;  1DCZ A;  2VUM G;  4BY7 G;  1STE A;  1SAP A;  2ATW A;  1JWU D;  4LMQ D;  2I5L X;  3BVZ A;  3C1E A;  1JJC B;  1XWE A;  3B6Y A;  3PUV A;  1WTV A;  3IAY A;  4PG3 A;  5IWA Q;  3T1Y Q;  3W1B A;  2WB1 E;  3E9H A;  4OEL B;  2WAQ G;  3OW2 A;  2BE5 C;  1EOV A;  1GM5 A;  2V1C C;  5CV5 A;  2F1M A;  4CGY B;  4CDC C;  1I4Q A;  2OTL A;  2KEE A;  2AWN A;  5I2Y A;  1EQR A;  1SMX A;  4YCW A;  4DV5 Q;  5KRU A;  2BH8 A;  5EJW A;  1KC8 C;  4DNR B;  2JA8 B;  2A73 B;  1E24 A;  1NMG A;  1YNJ D;  1S40 A;  3OW7 A;  2WB1 B;  5CYU A;  5DLQ E;  3MXP A;  4DV3 L;  1O7Y A;  2ZXO A;  2HQE A;  5FO9 B;  4RCN A;  4DAY A;  3TZU A;  4DR2 L;  3A5U A;  1PFS A;  1YVC A;  1BQQ T;  3BVG A;  5C3W A;  1RDP D;  5EBC A;  3KJO A;  1CKM A;  3H3V H;  4R8N A;  1SEB D;  1S72 A;  1F2Z A;  5EBD A;  3KBG A;  2B63 G;  1VQJ A;  2QEJ C;  3H3V C;  1RJT A;  1Y69 U;  3FP9 A;  2A6H C;  1I3Q H;  2B3G A;  3MXG A;  4B3R L;  4V0B A;  3SK4 A;  4BXX H;  1PLF A;  1YBY A;  4LUO A;  1I4X A;  4BY7 B;  2YYZ A;  4J8Q A;  4M8A A;  4JPB W;  3NEM A;  1CZG A;  4N9P A;  1VS0 A;  5L37 A;  3STB C;  5LL6 S;  1YHQ A;  5I4D A;  2B63 B;  2QKI C;  2IX0 A;  2B2Y A;  3GTO B;  5K36 G;  1PYB A;  1IL2 A;  4JBK A;  5ELO A;  4KLK A;  1IYJ B;  1EOT A;  3H0G G;  2EVB A;  5FLM G;  1V1O A;  2XIW A;  4JI6 L;  3J7Z C;  3GTG B;  3R2I A;  4JI8 L;  4DR6 L;  1GUO A;  1BDO A;  2L9H A;  3HOX G;  3HOV H;  3ZYY X;  1KAA A;  5C4X B;  3KFU A;  5EGT A;  1QCB D;  2K75 A;  2RVL A;  4OX9 L;  3AYH B;  3CAM A;  2UXD Q;  2NVT B;  1HJP A;  3RMH A;  3HRZ C;  1ENF A;  5IT9 c;  1LT6 D;  3CC2 A;  4KHZ A;  3FRP B;  1VQ5 A;  2KCN A;  3HS0 C;  2E2H H;  4X66 L;  1WTQ A;  2Y0S G;  3F2C A;  1LTB D;  2BCO A;  5IOD A;  1MHW C;  3CRK C;  1JOO A;  4Y7N B;  3QOJ A;  2PI2 A;  1CA6 A;  3HOV G;  3HFZ B;  4I65 A;  1JJG A;  3S1Q B;  2XWJ B;  4UHV A;  1EU3 A;  2FMC A;  3NEL A;  3OIQ A;  3C1F A;  4A3F G;  4UAI A;  3IFT A;  3GTM B;  1D6E C;  1NR2 A;  2IPK D;  5FJ8 G;  1FJG Q;  4LF6 Q;  4JV5 L;  3QIA A;  1LTI D;  2HQL A;  3KOJ A;  5H1S E;  1Q7Y C;  1PH2 A;  4OEM B;  1JMC A;  3M4O B;  1ONL A;  1TS4 A;  5LMN Q;  1X3P A;  5EPJ A;  4P75 A;  3I55 A;  4QGU A;  1ET9 A;  2XSC A;  1K0S A;  3U9S A;  3CQZ B;  3S1R B;  3G6E A;  1SXT A;  1MD2 D;  1KHI A;  2ZTC A;  1EUJ A;  4DGZ A;  3MXU A;  3QOL A;  3CCQ A;  2K50 A;  2NZ1 D;  1IL8 A;  3HOZ H;  2PNH A;  3SK5 A;  2WV6 D;  1HQR D;  1MGS A;  1N36 Q;  1PTO H;  1ZEQ X;  2N8N A;  5C44 G;  3A8J E;  4C3I H;  2VQF L;  1YHB A;  2KUM A;  3MWY W;  4KJN A;  5KNB A;  2O5I C;  1LTG D;  2K5Q A;  3W5O A;  3RNU A;  1JIC A;  1BO0 A;  2ZM6 Q;  4P74 A;  1EWH A;  4DV7 Q;  2DN8 A;  3FPP A;  3HP3 A;  2O2L D;  3Q24 A;  4DV2 L;  2N3S A;  1ROD A;  4JI2 L;  1VQ4 A;  2VB3 X;  2G5D A;  2WAQ B;  4WJW A;  4DUY Q;  3M4P A;  1E2Z A;  1EY8 A;  4A76 A;  2JYO A;  5C44 H;  2Y0S E;  3GQB A;  3R93 A;  1PFN A;  2D2C C;  1FNU A;  1DOK A;  3NXW A;  4XYQ A;  2RDH A;  2K03 A;  1QOH A;  1SNQ A;  4RAU C;  4FF3 A;  4QUC A;  5LHY 1;  4DR4 L;  1Y8P B;  1SNO A;  4JI3 Q;  1QB5 D;  1HA5 A;  1ESF A;  5M9O A;  1DYQ A;  4C3H H;  1FNW A;  2B2T A;  2EJF C;  4G57 A;  2A6E D;  5KGU A;  1EFW A;  4LF9 Q;  2A68 D;  1K8G A;  1IKL A;  4FO2 A;  3S17 B;  4E6I A;  2EY1 A;  2HDL A;  1LM0 A;  2EQS A;  3EFX D;  2KCM A;  3UE0 A;  3I4O A;  4A3C G;  3CRL C;  2HT1 A;  3D31 A;  3KJP A;  4YWK A;  3X3M A;  4GOP A;  4JI8 Q;  1ZKO A;  3I2Z A;  3T53 B;  2NVX B;  3F1Z A;  3G7L A;  1HNX L;  3NP8 A;  3DWP A;  3TBI B;  5COY A;  5LMU L;  4NXN Q;  3HOW B;  2X6L A;  1N32 Q;  5IGC A;  1C48 A;  2B2T C;  1XMQ L;  3W1G A;  1HNX Q;  2JA6 B;  3AFQ A;  1UEA B;  3TRZ A;  1I50 B;  1JC7 A;  2F3I A;  3CQZ H;  4K5X A;  3S1R H;  1Q46 A;  3BG3 A;  1MBY A;  4RA8 A;  4CJ1 B;  1YJW A;  1A3V A;  5GAH C;  3F2B A;  2I5M X;  4IFD J;  1EL0 A;  1N33 L;  2C5C A;  4HJ5 A;  1CSP A;  4OHJ A;  3K7A B;  2VNU D;  3I4N B;  4MZ9 A;  1GUG A;  2QDB A;  4HID A;  3GTM H;  1N34 L;  1LAB A;  1M1K C;  4A3L H;  4HIO A;  4DAM A;  3QWN A;  2VY3 A;  1O7I A;  3HOY G;  1STG A;  1G51 A;  2YTV A;  3U4V A;  1Y1V G;  1QIL A;  5JJI A;  1FGU A;  1IBK Q;  1U5K A;  3S24 A;  2JSO A;  2VL6 A;  3S2D B;  3J81 L;  4JBM A;  2UUB Q;  1B1Z A;  1L1O B;  2WKD A;  2JEB I;  5IE8 A;  2NVX H;  4K8I A;  2B2W A;  2F0I A;  4C3J G;  5IGG A;  4KKU A;  2CW0 D;  3MFY A;  3K81 C;  3DUZ A;  5LL6 X;  3HOY B;  3FVQ A;  2ZT9 C;  5DM6 3;  2NVT H;  1HNW L;  1O80 A;  2K04 A;  5HGT A;  1EIF A;  1VQP A;  1Q82 C;  1B70 B;  4GNX B;  4LFC Q;  3PIO 3;  3Q23 A;  1N8R C;  4B3T Q;  1BVS A;  5IP9 H;  2ZM6 L;  4JI1 Q;  2NB0 A;  4ZK9 B;  5I6Y A;  3C3L A;  1SE8 A;  4YWM A;  3S15 B;  3MTS A;  3S17 H;  2ES2 A;  2NUC A;  5IGF A;  4LW1 A;  3PO2 B;  3MA2 B;  1EYC A;  1SMY C;  5IYB H;  4DR7 L;  4DUY L;  1STB A;  2MQH A;  4DAY B;  4LF4 L;  3U58 A;  2HUG A;  4HMJ A;  2ZJR A;  1E1T A;  1VF5 C;  1H9S A;  1II3 A;  3TS2 A;  1BBW A;  4HN7 A;  1HRJ A;  4BY7 H;  4DKA C;  3S9W A;  5C0X H;  5IT9 L;  1PH5 A;  1D5X C;  1WTR A;  2KEN A;  1DGS A;  1D2B A;  2L55 A;  3UDG A;  1YIT A;  1O7L A;  1TXY A;  1V1P A;  4ZCK A;  4HCS A;  4XQN A;  3P7J A;  2ZJP A;  4FP5 D;  4K2L A;  1JB7 A;  1PTO B;  3VDY A;  3BVM A;  3M85 A;  4MN3 A;  5C5M A;  2IW3 A;  1SBB B;  1YZ6 A;  4UY8 C;  3HOZ B;  1ZYR C;  4IPG A;  4WRD A;  1VQD A;  4A3F B;  4JI6 Q;  1EYD A;  3CCE A;  2KHI A;  1XNQ L;  4UDU C;  2R61 A;  4XT1 B;  4X62 L;  1STH A;  3H09 A;  3J80 i;  1HPC A;  2I07 B;  1GD7 A;  4C3I B;  3S14 B;  4GNX C;  3HKZ E;  1G29 1;  4RKL A;  2NN6 H;  3A55 A;  3M4O H;  2CQO A;  3NBH A;  4X62 Q;  4DV1 L;  1HTP A;  1HCZ A;  2Z6K C;  2LY7 A;  2K6A A;  4A3K G;  3MFG A;  1E2W A;  4XTC S;  3J81 j;  2ZTE A;  1YEZ A;  2EOT A;  1A0I A;  4TKO B;  3A0J A;  2AQ1 B;  4DV1 Q;  1VQL A;  2NVQ B;  4QB4 A;  1BKB A;  1S5D D;  3LWU A;  2MO0 A;  4IFD I;  4CHT B;  2IT1 A;  2PMZ B;  4KJO A;  1JR0 D;  4DR1 Q;  4JI5 Q;  1WTH A;  4APV A;  4H7B A;  4K5V A;  5JVG 3;  4KD4 A;  4J6H A;  2QGQ A;  1KNE A;  3DMU A;  3SK8 A;  5C3X A;  3GTP B;  2KOL A;  5IP7 H;  3OTO Q;  4A93 B;  4JI7 L;  1Q1B A;  5GAG C;  1H9S B;  2E5L Q;  5C4X H;  3A5Z B;  4L5T A;  3RN5 A;  4NXM Q;  4P2C B;  3CC7 A;  4AYB E;  2EJG C;  3J80 c;  3VR3 A;  3KF8 B;  2F0D A;  3R8B A;  1GHJ A;  4A3G H;  1B8A A;  2YV5 A;  5IT9 E;  2VQF Q;  1R4Q B;  5EPL A;  1PHJ A;  3L0O A;  3GTO H;  2P5Z X;  1TWG B;  4GNX A;  3VR4 A;  1SFO H;  4HSP A;  1ICW A;  2CQA A;  2KJX A;  1IBM Q;  3GTG H;  1HUN A;  5A2Q E;  3N52 A;  1ILQ A;  4IO9 A;  5JJK A;  3O13 A;  5IYB G;  2EXD A;  2F0Q A;  1CT1 D;  2K14 A;  5ELE A;  2BH2 A;  1NJI C;  2SNM A;  1IBM L;  4R4T A;  4ABN A;  1KXL A;  4JI0 Q;  2J4X A;  3DWQ A;  1BCP D;  4IPH A;  4A3M G;  1DON A;  5G3L F;  5E3F A;  2XRS D;  2RQX A;  5C4H A;  4NMZ A;  4Q0F A;  4FXG C;  1F77 A;  3GD7 A;  2UXC L;  4OO1 G;  3Q6S A;  4YCV A;  1I6H H;  2F0V A;  3PQI A;  4NKL A;  3QG1 A;  2PCF B;  1IZ6 A;  4ZLT F;  1BUV T;  5C6A A;  1RF2 D;  4XYO A;  2N88 A;  2HDM A;  2TSS A;  4RGT A;  1L1O C;  5JJZ A;  3V2T A;  2EYL A;  4DV5 L;  1GOZ A;  1D5M C;  4EVO A;  1K73 C;  2EDG A;  4OO1 H;  4TSS A;  3S2D H;  2PYK A;  2X69 A;  2BOS A;  1JB3 A;  2QW7 A;  3RUZ A;  3TQY A;  2RSO A;  1SJH D;  2BDN A;  3I70 A;  3QB3 A;  2GN5 A;  3PMF A;  1LT4 D;  3H0G B;  1CSQ A;  1I6V C;  3DXJ C;  4ME5 A;  4LF8 L;  4A3B G;  3BU2 A;  1EFI D;  1LTL A;  2OTJ A;  2E8G A;  1U9R A;  1B3A A;  2MPM A;  2NZO A;  5AJ3 Q;  2JA8 G;  3I4N H;  1EY9 A;  5K36 H;  1QZG A;  1YJ9 A;  1QJO A;  4GN3 B;  2J0T D;  5FO8 B;  1XMO Q;  4POG A;  1LUZ A;  1KRS A;  1WVL A;  3HOU H;  4LK1 C;  1MJC A;  1SE2 A;  4IUR A;  3I90 A;  3EBE A;  4DV4 L;  3WOE A;  4B08 A;  5JPN C;  4A3B H;  1Q81 C;  5DM7 3;  1U0L A;  1BCP F;  1LT3 D;  4YWL A;  5IP7 G;  3BDO A;  4PQX A;  4LF7 L;  2HCI A;  2Z1C A;  2QDL A;  3T1H L;  1Y1W B;  1BOS A;  1EQQ A;  2JA6 H;  1B9M A;  1N34 Q;  4NP5 A;  4FYD A;  5IYD H;  4PZ7 A;  2Q8T A;  1PYW D;  1V9P A;  2UU9 Q;  3TS0 A;  2EYH A;  1QNU A;  3LWE A;  4PMB A;  2Q2H A;  1NBW A;  1X54 A;  3S1N B;  1IHZ A;  4AH6 A;  2NVY H;  1KTK A;  5CV4 A;  4R1J A;  1ENC A;  3E6Z X;  2EYJ A;  3IFD A;  3J7A V;  1LAC A;  5TSS A;  1TWH H;  4IOC A;  3IL8 A;  5J1Z A;  1M8A A;  1N9W A;  3K5N A;  1XTC D;  4CBV A;  2I46 A;  4RCO A;  3JAM c;  5IYD G;  5JEA G;  2F03 A;  4A3E B;  3KF8 A;  1FL0 A;  2Q8R E;  3GTK B;  4BBS B;  1UWV A;  4IJH A;  4LFC L;  5D65 A;  5FLX c;  4GOP C;  1GUS A;  3IKJ A;  1XNR Q;  4C56 C;  1TWA H;  5JEA J;  4DUZ Q;  2O4X A;  4C2M H;  4BS9 A;  5DEH A;  2GVB A;  4A3M H;  4ME3 A;  3S2H H;  4KKS A;  2QIL A;  4LFB Q;  1GO3 E;  1SYG A;  1J5E Q;  2RSN A;  1HA6 A;  1V1P B;  1U4M A;  1JOR A;  1NY4 A;  3OWE B;  1QVF A;  2UUA L;  4JI4 L;  3BYT B;  3M4Q A;  1STA A;  2JA5 G;  3L9A X;  1FGB D;  2GA4 B;  2UUC L;  1UE6 A;  3J80 L;  5JEA H;  2ZJQ A;  1SN8 A;  2KQ3 A;  4IUV A;  4BA2 I;  2SNS A;  2F0H A;  3HKS A;  5I2X A;  1TU2 B;  2NTT A;  3T1Y L;  1NMF A;  3DHQ A;  2XVS A;  4L6T B;  5C5L A;  2E2I B;  4CDF C;  1PRT B;  1Z6H A;  4LF5 L;  2IWH A;  3H15 A;  3HOU B;  3I4M B;  4QIW E;  2MGS A;  1HQM C;  3URY A;  3VR5 A;  5CV6 A;  1RD9 D;  4Y52 H;  4OIJ A;  3M7G A;  5IYC G;  1I4R A;  4EX5 A;  3CU7 A;  1S3O A;  1TS3 A;  1XNQ Q;  3AMU A;  1SR3 A;  3CW2 C;  1VQ7 A;  1PA6 A;  1Y8N B;  3D4W A;  1Y1V H;  1EEF D;  4F7X A;  2HHH Q;  1PDQ A;  4AIM A;  3AU7 A;  1CHQ D;  1L1O A;  4A3D H;  4ZUI A;  4FF1 A;  4RHR A;  3P20 A;  5CV8 A;  4JC0 A;  1NE3 A;  4OGQ C;  4G7O C;  4A3I G;  1PXU A;  3JAM E;  1PRT C;  1IW7 D;  1T5E A;  2B2V A;  1VDZ A;  4GS3 A;  3D6W A;  4MNO A;  2IL8 A;  5IYC H;  2F0W A;  3CCU A;  5C3E H;  3NQT A;  4HIM A;  4FDB A;  4HSV A;  4H13 C;  1V1Q A;  1VQK A;  1KDA A;  3PUZ A;  4B9W A;  2A69 C;  1K8M A;  1EWC A;  1UAP A;  4B3R Q;  1VQN A;  4CKB A;  2QF7 A;  3L3O C;  3HOW G;  3STB D;  4A3C H;  4LAA A;  1J9O A;  3OWF A;  4ZQ3 A;  1K8A C;  2AUJ D;  4KMU C;  2R92 H;  3MAQ A;  2F0L A;  2KVM A;  5FLM H;  1S5C D;  2JA5 B;  1UE7 A;  3OOC A;  3F2D A;  3EVQ A;  1OTC A;  3RZO H;  3SXH A;  1Y8O B;  3J81 i;  2E5L L;  3MC0 B;  3PCO B;  2ALY B;  2FFK B;  4DAV A;  2A68 C;  2JA9 A;  1X3G A;  1HHV A;  4NXM L;  3EA6 A;  4MTK A;  3PSI A;  5COR A;  3BZD B;  3D3R A;  3QR8 A;  3H94 A;  4WJ4 A;  1HH2 P;  1BBU A;  2PW7 A;  1RCV D;  3E0J A;  2F0T A;  1CKN A;  3GV6 A;  3HOV B;  4DR3 L;  2CVR A;  2PQE A;  2N49 A;  2OQK A;  5FOB B;  1VF7 A;  3ULJ A;  2EYP A;  2MP1 A;  1A62 A;  2O5J C;  4JOI C;  1Q3L A;  1X55 A;  3EN2 A;  5E1F A;  3N6R A;  3PO2 G;  2G9D A;  3ONA B;  1SYD A;  2UUB L;  5A35 A;  1CQF A;  1WTO A;  1UUP A;  4GLA C;  2VZA A;  5ELF A;  3V05 A;  5I9O A;  3A56 A;  3TRE A;  1WD1 A;  2B63 H;  3RZO B;  3VYS A;  2JA5 H;  1K83 B;  4A3L G;  1B44 D;  4WFN 3;  2VUM B;  1G8Z D;  1X3F A;  1FVI A;  1PFB A;  3S16 B;  1MSG A;  3CF5 A;  5GRO A;  2K5V A;  5D3I B;  1R9T B;  3A7L A;  1IBL Q;  2RHS B;  3KLS A;  3BS1 A;  3T56 B;  1TWF B;  2F0N A;  3GTP H;  2A5H A;  4JI1 L;  2RHQ B;  1NSN S;  1C4Q A;  2UXC Q;  4DU9 A;  3PGZ A;  4B9X A;  3ULP A;  1PZK D;  1SNC A;  2F0M A;  2CFM A;  1EQT A;  1AE3 A;  1L0Y B;  1GHK A;  4QL5 A;  3K59 A;  4DK3 C;  2EIF A;  2K33 A;  1CKO A;  1HNZ L;  2BE5 D;  2QA4 A;  4LF4 Q;  3MEH A;  3RZD H;  4KHP Q;  1PZJ D;  4K6D A;  1EU4 A;  4UP9 A;  1PVO A;  3PIP 3;  4IFD G;  3KK7 A;  3PUW A;  3OYY A;  3U9O A;  2KHS A;  5F2D A;  4FF2 A;  4LF6 L;  2XN9 C;  1JOK A;  4S3S A;  1DZ1 A;  4RH6 A;  1VQ9 A;  2LS0 1;  3PV0 A;  4K2K A;  1AW7 A;  4C1N I;  1VMC A;  1L0W A;  2H1E A;  3JAM L;  1D1I A;  1RHP A;  4IPC A;  3LNN A;  1Y1V B;  4JYA Q;  4X65 Q;  2PZU A;  2MJ8 A;  3EQL C;  1G6P A;  2KA7 A;  3J7A F;  3G71 A;  1PH1 A;  4XDX A;  3BZC A;  1EZ6 A;  1SYF A;  4CDE C;  5C3E G;  3ICE A;  2NWG A;  2JQO A;  1KLU D;  1VCI A;  4CJ2 C;  5CV7 A;  2PPB C;  4X65 L;  1JE5 A;  1I4P A;  2EY6 A;  3HEJ A;  4RGM A;  4A3F H;  1RIP A;  1N36 L;  5D3D A;  3TZD A;  5M3F B;  4DV3 Q;  3I4M G;  3GTQ H;  5C0X J;  1H9K A;  3K0Y A;  3SDZ A;  2CKZ B;  4O0A A;  3UDI A;  4X3K A;  2R6G A;  3BDL A;  1QUQ A;  1TWC B;  2VXW A;  1DXM A;  3QO2 A;  1EEI D;  4A93 G;  3L2P A;  4OL7 A;  4A3E G;  3Q0A A;  2SDF A;  2VUM H;  2Q8I B;  3Q22 A;  1HZC A;  1LYL A;  4ALP A;  1EYG A;  4LFA Q;  1K3R A;  4UP8 A;  2ASB A;  3MEF A;  4K8J A;  4L63 B;  1JWM D;  4HMI A;  1YNN C;  2E2I H;  4JI5 L;  1BR9 A;  2D62 A;  1WI5 A;  4GKK Q;  1G2T A;  1KAW A;  2F4V L;  2N78 A;  4DR5 Q;  4DF7 A;  4QY7 A;  1YNX A;  4JBW A;  4RHS A;  1BCP C;  1F9S A;  2MFI A;  1GJX A;  4A3E H;  3LGJ A;  5ISR A;  3U50 C;  2B2Y C;  1VQF A;  4NXN L;  5LMU Q;  4DNT B;  3BZK A;  2IX3 A;  3CCR A;  3TME A;  3AQQ A;  3CCS A;  2JA7 B;  1SLJ A;  1UE1 A;  2A6H D;  2KBN A;  1SMY D;  3TDQ A;  1F9R A;  5G3L D;  4KN7 C;  1BXT A;  1DM0 B;  1OO9 B;  2YTY A;  2M2L A;  1CQV A;  1X9N A;  4A4I A;  4A75 A;  4MTN A;  4DV6 L;  2EYO A;  4LUZ A;  5BN4 A;  2BDO A;  2J7Z A;  4YIJ A;  5I6W A;  2Z8L A;  2R92 B;  4LFB L;  4FXK C;  4N8X 1;  1OXV A;  3GTJ H;  4JK1 C;  2WFW A;  4A3K B;  1G6Z A;  2JE6 I;  4FVM A;  3P75 A;  1TWH B;  3CCV A;  1STN A;  2UUA Q;  4DV6 Q;  1VQO A;  1QWY A;  2SOB A;  3BJU A;  3Q8D A;  2UUC Q;  4PZ6 A;  1A3T A;  1KAB A;  2NTS A;  4FNF A;  1IBL L;  4HR7 B;  2DY8 A;  4A3G G;  3CPF A;  2OEO A;  1PZI D;  2Z4I A;  2K28 A;  1Y14 B;  3AB9 A;  3K80 C;  4TVA B;  1XJV A;  1HR0 L;  5AFW A;  1VQC A;  5CBE E;  2D9U A;  4B3M L;  2RCN A;  3OTO L;  1MSH A;  5IWA L;  3PO3 B;  1QVC A;  1L2F A;  2YU9 H;  2JA6 G;  3M3Y B;  3I91 A;  3J81 E;  2EZV A;  1E1O A;  3FDT A;  3SGI A;  4X3U A;  1Z7T A;  2K7V A;  3HG9 A;  5CBA E;  3KBX A;  4RWS C;  3PUX A;  5GQO A;  3PIP A;  1KRT A;  3H0G H;  3SHL A;  4KV6 A;  4H02 A;  1K0R A;  3K58 A;  2EYM A;  3J81 c;  4BBS G;  1S5E D;  2FXQ A;  5IGB A;  1O7Z A;  2X6G A;  1MI2 A;  5JOB A;  3NPP A;  1LO5 D;  2Y0S B;  2K5N A;  3D6C A;  4P72 A;  2A19 A;  4KY6 A;  3SEB A;  4K0K Q;  1CM9 A;  4AQY L;  5IY0 A;  1F2L A;  2EY5 A;  3ULL A;  4X64 L;  3I4M H;  1E0B A;  2FJ2 A;  1XPO A;  1E7Z A;  1IYU A;  3ERS X;  1AEX A;  3J7A 5;  4FXD A;  3KDF A;  4PZ8 A;  1QVG A;  1JE4 A;  4DXF A;  1X3Q A;  2AQ2 B;  5IGE A;  4L5Q A;  1O78 A;  1PYS B;  4JI2 Q;  5C0X G;  4V19 0;  2E76 C;  5M5X H;  2L5T A;  2WII B;  4QUF A;  2DNE A;  5AJ3 L;  4IJL A;  4CKC A;  2AMC B;  1KQS A;  4A3M B;  2F52 A;  1SRU A;  5IGD A;  2OF1 A;  2I5H A;  4ULL A;  2PQA B;  1MKH A;  1TWA B;  1BNZ A;  3E5S A;  1I6H B;  3KF6 A;  3EJI A;  4PMW A;  4ILW A;  4IUU A;  5JPM C;  2L0C A;  5C4J B;  1X6O A;  3OHX C;  1DJR D;  1Q8K A;  3CCM A;  3MXN B;  1X65 A;  4XQQ A;  5J39 A;  2CCZ A;  1FYC A;  3D8G A;  4K5W A;  4TQU S;  2VW9 A;  5M5Y B;  2UU9 L;  1GXD C;  4DR3 Q;  3M7N A;  2WIN B;  5ELD A;  3ERQ A;  4EQO A;  2M00 A;  2NVY B;  2R7F A;  4DK1 A;  3DM1 A;  3J80 E;  5M3M B;  4ZKC B;  4XT3 B;  1PH9 A;  2MO1 A;  2NYZ D;  1SFO B;  1LV9 A;  1NCV A;  4DXG A;  1CHP D;  5KYI A;  1PFM A;  1RL2 A;  1TWG H;  4HED A;  2MNA A;  1B2T A;  4P71 A;  2E2D C;  1Z9F A;  3ERO A;  5EAY A;  3RR5 A;  3K0X A;  4ZAI A;  4KTA A;  4PV1 C;  2UXB L;  1OXU A;  3OSO A;  1HXY D;  1YIJ A;  4YHH L;  4BY1 B;  1HFN A;  1XMQ Q;  1H9J A;  1BF4 A;  4OO1 I;  1T5X D;  1A6X A;  1TY2 A;  1P16 A;  1LLR D;  5CC4 A;  2B2V C;  2UXB Q;  4IUN A;  4DUZ L;  3MHB A;  1TS2 A;  1JT8 A;  4NPS A;  1TVX A;  3I4L A;  5DNF A;  1J5E L;  2XNA C;  4MHE A;  1A15 A;  5CGK A;  4BY1 G;  4JV5 Q;  3ITP A;  1G2S A;  2F0S A;  3L7Z C;  3I4N G;  3K5O A;  4JI4 Q;  2AHO B;  4HCE A;  1IKM A;  4R4C A;  1N33 Q;  2WAQ E;  1Q8I A;  4IQZ A;  4DV0 L;  1MIU A;  2OT2 A;  2E74 C;  4RGN A;  2DGY A;  3KLW A;  4NW2 A;  4H0L C;  4RMF A;  1T9H A;  2H5X A;  2WAC A;  5E4X A;  2K32 A;  2RDG A;  2A6E C;  3I72 A;  1LTT D;  4BXX G;  1I94 L;  1R4P B;  2NVQ H;  2FMM A;  4GLX A;  1SE4 A;  4QMG A;  1H9R A;  4BY1 H;  3A54 A;  4IOA A;  3MXN A;  1GVP A;  1BBX C;  2EE1 A;  1WD0 A;  4IZ8 A;  3I8Z A;  4IUP A;  1WCM H;  3KF6 B;  1M4V A;  3HZX A;  1EZ8 A;  2TMP A;  1CKN B;  2PMZ E;  1KNA A;  5BR8 L;  1J8I A;  1U4L A;  4KY5 A;  5M3M H;  4JI0 L;  4M1U B;  3A7A B;  1QE6 A;  2C35 B;  1XXG A;  3VR6 A;  4ZYS A;  3IRB A;  3QJY A;  4WOR A;  1GUT A;  3M4Y A;  1DOM A;  2A1A A;  2A74 C;  3PF5 A;  1LTR D;  5DAU A;  1KL9 A;  2PO4 A;  4JW0 A;  5EKL A;  1XPR A;  2R93 H;  3DLL A;  1I3Q B;  2VQE L;  1ASY A;  4GKK L;  1TS5 A;  1B4O A;  2K52 A;  4BWG B;  1IYV A;  1B50 A;  2RF4 A;  1CTM A;  3FHW A;  4ZRZ A;  1V43 A;  2PI2 E;  3A74 A;  4EQP A;  4DK6 C;  1ICF B;  2VQE Q;  2CW0 C;  2B2U C;  4I7A A;  5K5P A;  3HOY H;  1AP0 A;  4OX9 Q;  3CME A;  1I4H A;  1CI3 M;  1E22 A;  2E75 C;  3R2T A;  1AN8 A;  2E2J B;  2ENB A;  2R93 G;  4MIU A;  1PRT D;  2DJF C;  4HJ9 A;  2CWP A;  4L8J A;  1GKH A;  4GKJ Q;  4G7Z C;  1ENA A;  4OIK A;  2JA8 H;  1XPU A;  1WCM B;  1TY0 A;  5FLX L;  1CUK A;  4X3T A;  1HR0 W;  1N32 L;  1L0X B;  1PH4 A;  4OWX B;  3SR1 A;  3TSS A;  2LKV A;  3GTL B;  2K5W A;  3CC4 A;  1AH9 A;  3SVM A;  1EY0 A;  1W6J A;  3DWA A;  4A3D G;  5ELC A;  2B2U A;  4LUV A;  1WTX A;  4A3I H;  1AFP A;  1VQ8 A;  1X3E A;  2K5H A;  2NZH A;  1EY7 A;  1EY6 A;  4N8F A;  4QCL A;  1PRT F;  3R3O A;  3PO3 H;  3VYT A;  1VQ6 A;  1FR3 A;  1W6K A;  1I50 H;  2IJ0 A;  2RKS A;  3NQI A;  4DAP A;  4A3J G;  4CJ0 B;  4EQ5 A;  1J6Q A;  1IW7 C;  1P8L A;  2MHV A;  4G7H C;  3EIV A;  1ZXT A;  2Z0S A;  4LF7 Q;  2ZTD A;  3HOW H;  4H44 C;  2LXJ A;  1VQI A;  5KEE A;  3S14 H;  1F9Q A;  4L5S A;  4L5R C;  2JEA I;  1A2U A;  2IHE A;  4U68 A;  3D4R A;  3WDN A;  1JWS D;  4KHP L;  3G48 A;  3NHH A;  2JA7 G;  3FEW X;  3K5M A;  4GN4 B;  2B29 A;  2ZXR A;  2DY7 A;  1XNR L;  2KCC A;  2ICI A;  1UEB A;  2F0F A;  1SYE A;  2NN6 G;  2IX1 A;  3T4A C;  2OWO A;  2B8F A;  2IHF A;  2NBF A;  3S1M H;  5C4J H;  2R7Z G;  1ET6 A;  4JYA L;  1HZA A;  1WOC A;  1DOL A;  5M5Y H;  2H4O A;  1XTD A;  1EIY B;  4IUQ A;  4C3I G;  1QUQ B;  1Q1E A;  1TII D;  1D7Q A;  1AZP A;  2LFN A;  5M5X B;  3RLN A;  4BBR B;  4DV7 L;  2R7Z B;  3VYU A;  3PO2 H;  1KLG D;  4JI3 L;  3H91 A;  4JBJ A;  5C44 B;  4DV2 Q;  3S15 H;  1SE3 A;  4Z9C B;  2R7Z H;  1LT5 D;  4C3H B;  3FMC A;  1HNZ Q;  3TN2 A;  2F0E A;  5JJL A;  3K6O A;  3CMA A;  2BA1 A;  4HJ7 A;  3K7U C;  3GDE A;  5FO7 B;  3SE0 A;  4Q5V A;  3CCJ A;  5C4X G;  2K1B A;  4QF4 A;  4RGO S;  2L1B A;  3J7Y W;  3S1M B;  5HUR A;  3NWS A;  1KIX A;  4HAE A;  2PZW A;  3DEP A;  3F8T A;  2F0U A;  2WB1 G;  3OIP A;  2A69 D;  5CV9 A;  1LTS D;  2NN6 I;  5M3F H;  2DJG C;  2B2W C;  5KIX A;  4ODG A;  5ELB A;  2VB2 X;  1NTG A;  2L15 A;  2AWO A;  1VMP A;  4DN4 M;  2EJM A;  4DFA A;  3NWT A;  5JAV A;  3CXC A;  3KLR A;  4DR2 Q;  1ASZ A;  4IN3 A;  3CHB D;  3JAM i;  2HHH L;  1VQG A;  4LF8 Q;  4P73 A;  3K7A H;  2F3V A;  2DNC A;  3HKZ G;  2PNR C;  5J22 A;  4LWC A;  2KHJ A;  1SND A;  2OCE A;  2VS1 A;  2XRQ D;  1VQE A;  5M3F G;  2D0O A;  4J15 A;  4QIW B;  1Y1W G;  3PO3 G;  2HIX A;  4CKE A;  5KND A;  2RBM A;  1A3U A;  4ZKB B;  2AUK A;  4IAL A;  3UI2 A;  3K5L A;  1TQO A;  4A3J H;  4A3I B;  4B3S L;  3HKZ B;  3S1Q H;  5D14 A;  4R8I A;  4DV0 Q;  2Q2U A;  1FJG L;  3W2D A;  3WWV A;  2QEX A;  4OXP A;  4O2D A;  3T1H Q;  3RLO A;  3SK6 A;  1IBK L;  3I56 A;  2EY2 A;  3GTL H;  5C0X I;  3GP7 A;  4PNY A;  3D0F A;  1I94 Q;  2JA7 H;  1EY5 A;  3GTJ B;  2HIV A;  1HFG A;  4EQN A;  3X3N A;  3S16 H;  2Q2T A;  2K05 A;  1SRO A;  3TEH B;  4AYB G;  4JOI A;  1EIH A;  1ZYR D;  3KLS X;  4OWT B;  1H9M A;  4K14 A;  4C1N K;  2ID0 A;  3CKI B;  5FK9 C;  2E2J H;  1X32 A;  2E2H B;  3ER0 A;  1ML0 D;  1SYB A;  5FJ8 H;  4B3T L;  2R7D A;  4POF A;  1A2T A;  2Z6K A;  5E4W C;  3P1H A;  2M9V A;  1UE5 A;  5EKI A;  2OXP A;  4R4I A;  1HTL D;  1WJJ A;  3NTI A;  1OXX K;  2F0O A;  5A2Q L;  2B39 A;  3NBI A;  2MUY A;  4DPG A;  1EYA A;  4RKB A;  2JK8 A;  4C3J H;  1K9M C;  1W3S A;  1G91 A;  3E0E A;  1HNW Q;  1FNV A;  3GV3 A;  3U4Z A;  3K57 A;  1QZH A;  2R92 G;  1W2B A;  2R93 B;  1D1K A;  2IY5 B;  2RA4 A;  1LTA D;  1DD2 A;  3HOZ G;  2F0J A;  3HOU G;  5IP9 G;  2XTI A;  1U4P A;  1PH3 A;  1JQY D;  1S5B D;  4KK7 A;  3GTQ B;  4KHV A;  2OQ0 A;  4IFD H;  1EIG A;  3C2P A;  4LJZ C;  1WYD A;  1WTP A;  4EGV A;  2Z4H A;  3ND9 A;  1HZ9 A;  2JXM B;  2F0K A;  5LMN W;  4KKT A;  4HJ8 A;  4ZUJ A;  5IOC A;  4YCU A;  3UDX A;  3GO5 A;  3A8K E;  1E2V A;  1NAP A;  1STY A;  4IPD A;  1WTW A;  3OPO A;  4GLV B;  3NBH B;  4CDD C;  3T13 A;  3HOX H;  1RTO A;  1WFQ A;  2EPB A;  4X6A H;  2KCT A;  4OWW B;  2K01 A;  1VQH A;  3H3V I;  1XYI A;  1JOQ A;  4K0K L;  1VQB A;  1PH7 A;  4JVZ A;  4N9T A;  4IUT A;  3RZD B;  4C3H G;  1CK1 A;  2JN4 A;  3K8A A;  3G4S A;  5FLX E;  3HOX B;  3PUY A;  4JG2 A;  5CR3 A;  1F2Y A;  1S5F D;  4LNQ A;  4DR1 L;  5M3M G;  5T1G A;  5EPK A;  4TRD A;  2EXZ A;  1EY4 A;  4O1N A;  3E9I A;  4R4O A;  4J1M A;  1E3P A;  3AEV A;  1FD7 D;  3TP6 A;  2F4V Q;  2XWB B;  4Y7N H;  1K83 H;  2CH4 A;  3I73 A;  1PMR A;  2L4N A;  4DR5 L;  1C9O A;  4LF9 L;  3OMG A;  1D8L A;  4B3S Q;  1PV4 A;  3AFP A;  1KDC A;  1K28 A;  2LMC B;  3NTH A;  5I9P A;  5GAD C;  1TWF H;  1PH8 A;  3FKI G;  3CCL A;  1R9T H;  2Z6B A;  1AZQ A;  3TP7 A;  4F8M A;  3NTK A;  1GUW A;  3C46 A;  1X56 A;  4U67 3;  3CPW A;  4R9W A;  2QCP X;  1K3B C;  3WOF A;  4K6L A;  1HZB A;  1YHA A;  1Z47 A;  4C3J B;  4PMC A;  5EQ0 A;  3NE5 B;  4JCV E;  4ID6 A;  5C4Z A;  4KD3 A;  4G4K A;  3A8I E;  2Z9H A;  4JI7 Q;  1EWI A;  4C2M B;  1RKN A;  2G9H D;  2I0Q A;  2PW5 A;  1QNK A;  1NNX A;  1SNP A;  3KDF B;  1SYC A;  1SDF A;  2V4D A;  3VYR A;  3V96 A;  1B53 A;  4YY3 L;  1B9N A;  3KUP A;  2HCC A;  3PF4 A;  1PTO C;  3KYH C;  2CHB D;  1CFM A;  4KY7 A;  5KNC A;  4HTH A;  3G6J B;  5JVH 3;  5EKK A;  5M5W B;  1I4G A;  3I3C A;  5ELN A;  3BYY B;  3T51 B;  4YY3 Q;  1Q90 A;  1K8O A;  3UE1 A;  4X66 Q;  3W3A A;  3CD6 A;  5BR8 Q;  2PZT A;  4BA1 I;  1YJN A;  3RN2 A;  1PTO D;  3BDC A;  4XIG S;  1CZW A;  1IXR A;  4F88 A;  1HR0 Q;  4B3M Q;  1PH6 A;  2FIN B;  1JJ2 A;  1ILP A;  2D0P A;  1C7Y A;  2FHT A;  4A3J B;  1HUM A;  4LF5 Q;  4F87 A;  1JCK B;  3PIO A;  4NB3 A;  1A8V A;  4QJF A;  1TR5 A;  1ESR A;  3H6M A;  1B7Y B;  4HJA A;  1TKW B;  4A3B B;  4WJ3 M;  2K5D A;  5LMN L;  1UNS A;  2RCF A;  2KED A;  3T16 A;  2XGT A;  5GAE C;  1NUC A;  3NUC A;  5C3E B;  3MVV A;  4AQY Q;  5KYL A;  2YTX A;  4RFB A;  5FKA C;  4X64 Q;  3DEO A;  4DK0 A;  1Q12 A;  4DNI A;  1H95 A;  2F3W A;  2GVA A;  3VR2 A;  2D5D A;  2Q2I A;  4A3D B;  1OXS C;  1CA5 A;  3CP0 A;  1SJE D;  3ND8 A;  1QG7 A;  1TT2 A;  4QQB X;  3NSW A;  3NK9 A;  1SSO A;  4GKJ L;  4DR7 Q;  4UPA A;  2YU9 B;  3M3Y H;  3RLF A;  1KDB A;  2LXK A;  2F4I A;  3OMC A;  4DV4 Q;  4BBR G;  2WP8 J;  4KI0 A;  4NDX A;  4AYB B;  1WCM G;  4R4Q A;  3MZ5 A;  2ICE C;  1GUN A;  2AQ3 B;  2AKW B;  1KD1 C;  2KEC A;  4HIK A;  3TP5 A;  3NEN A;  4FF4 A;  3VA7 A;  3LX0 A;  3FKI H;  5HY6 A;  1XMO L;  1PTO F;  4O42 A;  5HGQ A;  4UP7 A;  2LSS A;  1Q86 C;  5CMD A;  4LFA L;  1AE2 A;  4A3K H;  1MJE A;  1D5Z C;  1RTN A;  1EQV A;  4BBS H;  2JP1 A;  4DR4 Q;  3GTK H;  1C8C A;  5E7N A;  3FPU B;  4BBR H;  5M5W H;  4XXE A;  2L11 A;  4OON A; 
#chains in the Genus database with same CATH homology
 4DA2 A;  2C9O A;  3S2H B;  1NR4 A;  5BN5 A;  3VA5 A;  2ZXP A;  1XX8 A;  2R3Z A;  3TP8 A;  2EYF A;  5BN3 A;  1F9P A;  3D4D A;  2SEB D;  1YNN D;  3HGB A;  2B8G A;  2F0G A;  4XQJ A;  1S4Z A;  5NUC A;  1BCP B;  1OXT A;  1F2M A;  3RD4 A;  1U4R A;  2L12 A;  2WKC A;  2BA0 A;  5T1I A;  1V8Q A;  4A3G B;  3FKI B;  2N55 A;  4I7Z C;  4KN4 C;  4X3S A;  2F0P A;  3F2U A;  5IIF A;  1YNJ C;  2RDF A;  4GZY C;  1SNM A;  1DCZ A;  1STE A;  1SAP A;  1JWU D;  4LMQ D;  3BVZ A;  3C1E A;  1XWE A;  3PUV A;  1WTV A;  3IAY A;  2BE5 C;  5CV5 A;  2F1M A;  4CGY B;  1I4Q A;  2KEE A;  2AWN A;  5I2Y A;  5KRU A;  5EJW A;  4DNR B;  2JA8 B;  2A73 B;  1YNJ D;  3OW7 A;  2WB1 B;  5CYU A;  3MXP A;  1O7Y A;  2ZXO A;  2HQE A;  5FO9 B;  4RCN A;  4DAY A;  3TZU A;  3BVG A;  1BQQ T;  5C3W A;  1RDP D;  5EBC A;  4R8N A;  1SEB D;  1F2Z A;  5EBD A;  3KBG A;  2QEJ C;  3H3V C;  1RJT A;  1Y69 U;  2A6H C;  3MXG A;  4V0B A;  3SK4 A;  1PLF A;  1I4X A;  4BY7 B;  2YYZ A;  4J8Q A;  4M8A A;  1CZG A;  4N9P A;  5LL6 S;  5I4D A;  2B63 B;  2QKI C;  2IX0 A;  2B2Y A;  3GTO B;  5K36 G;  1EOT A;  2EVB A;  1V1O A;  2XIW A;  3GTG B;  3R2I A;  1GUO A;  1BDO A;  2L9H A;  3ZYY X;  1KAA A;  5C4X B;  5EGT A;  1QCB D;  2RVL A;  2NVT B;  3RMH A;  3HRZ C;  1ENF A;  1LT6 D;  4KHZ A;  3FRP B;  2KCN A;  3HS0 C;  1WTQ A;  1LTB D;  2BCO A;  5IOD A;  3CRK C;  1JOO A;  4Y7N B;  3QOJ A;  1CA6 A;  4I65 A;  3S1Q B;  2XWJ B;  1EU3 A;  2FMC A;  3OIQ A;  3C1F A;  4UAI A;  3IFT A;  3GTM B;  1D6E C;  1NR2 A;  2IPK D;  3QIA A;  1LTI D;  3M4O B;  1ONL A;  1TS4 A;  1X3P A;  5EPJ A;  1ET9 A;  2XSC A;  3U9S A;  3CQZ B;  3S1R B;  1SXT A;  1MD2 D;  4DGZ A;  3MXU A;  3QOL A;  2NZ1 D;  1IL8 A;  3SK5 A;  2WV6 D;  1HQR D;  1MGS A;  1PTO H;  1ZEQ X;  3A8J E;  2KUM A;  3MWY W;  4KJN A;  5KNB A;  2O5I C;  1LTG D;  2K5Q A;  1JIC A;  1BO0 A;  1EWH A;  2DN8 A;  3FPP A;  3HP3 A;  2O2L D;  3Q24 A;  1ROD A;  2VB3 X;  2WAQ B;  4WJW A;  1E2Z A;  1EY8 A;  2JYO A;  3GQB A;  3R93 A;  1PFN A;  2D2C C;  1FNU A;  1DOK A;  3NXW A;  4XYQ A;  2RDH A;  2K03 A;  1QOH A;  1SNQ A;  4RAU C;  4FF3 A;  4QUC A;  5LHY 1;  1Y8P B;  1SNO A;  1QB5 D;  1HA5 A;  1ESF A;  5M9O A;  1DYQ A;  1FNW A;  2B2T A;  2EJF C;  4G57 A;  2A6E D;  5KGU A;  2A68 D;  1IKL A;  4FO2 A;  3S17 B;  4E6I A;  2EY1 A;  2HDL A;  3EFX D;  3CRL C;  3D31 A;  3X3M A;  1ZKO A;  3T53 B;  2NVX B;  3G7L A;  3NP8 A;  3DWP A;  3TBI B;  5COY A;  3HOW B;  2X6L A;  5IGC A;  1C48 A;  2B2T C;  2JA6 B;  1UEA B;  1I50 B;  1JC7 A;  4K5X A;  3BG3 A;  1MBY A;  4RA8 A;  4CJ1 B;  1A3V A;  4IFD J;  1EL0 A;  2C5C A;  4OHJ A;  3K7A B;  2VNU D;  3I4N B;  1GUG A;  2QDB A;  1LAB A;  3QWN A;  1STG A;  1QIL A;  2JSO A;  3S2D B;  3J81 L;  1B1Z A;  2WKD A;  2JEB I;  2F0I A;  4C3J G;  2B2W A;  4K8I A;  5IGG A;  2CW0 D;  3MFY A;  4KKU A;  3DUZ A;  5LL6 X;  3HOY B;  3FVQ A;  2ZT9 C;  5DM6 3;  1O80 A;  2K04 A;  5HGT A;  3PIO 3;  3Q23 A;  2NB0 A;  4ZK9 B;  5I6Y A;  3C3L A;  3S15 B;  3MTS A;  2NUC A;  5IGF A;  3PO2 B;  3MA2 B;  1EYC A;  1SMY C;  1STB A;  2HUG A;  4HMJ A;  1VF5 C;  1H9S A;  1II3 A;  4HN7 A;  1HRJ A;  3S9W A;  5C0X H;  5IT9 L;  1D5X C;  1WTR A;  1D2B A;  2L55 A;  1O7L A;  1V1P A;  4HCS A;  4XQN A;  3P7J A;  4FP5 D;  4K2L A;  1PTO B;  3BVM A;  3M85 A;  4MN3 A;  5C5M A;  2IW3 A;  1SBB B;  3HOZ B;  1ZYR C;  4WRD A;  4A3F B;  1EYD A;  4UDU C;  2R61 A;  4XT1 B;  1STH A;  3H09 A;  1HPC A;  2I07 B;  4C3I B;  3S14 B;  1G29 1;  4RKL A;  2NN6 H;  3A55 A;  3NBH A;  1HTP A;  1HCZ A;  2LY7 A;  2K6A A;  3MFG A;  1E2W A;  4XTC S;  2EOT A;  4TKO B;  2AQ1 B;  2NVQ B;  4QB4 A;  1S5D D;  3LWU A;  4IFD I;  4CHT B;  2IT1 A;  2PMZ B;  4KJO A;  1JR0 D;  4H7B A;  4K5V A;  5JVG 3;  4KD4 A;  4J6H A;  1KNE A;  3DMU A;  3SK8 A;  5C3X A;  3GTP B;  2KOL A;  4A93 B;  1Q1B A;  1H9S B;  4P2C B;  2EJG C;  3VR3 A;  2F0D A;  3R8B A;  1GHJ A;  5IT9 E;  1R4Q B;  5EPL A;  1TWG B;  3VR4 A;  4HSP A;  1ICW A;  2CQA A;  2KJX A;  1HUN A;  5A2Q E;  3N52 A;  1ILQ A;  3O13 A;  2F0Q A;  1CT1 D;  5ELE A;  2SNM A;  4ABN A;  2J4X A;  3DWQ A;  1BCP D;  1DON A;  5G3L F;  5E3F A;  2XRS D;  2RQX A;  5C4H A;  4NMZ A;  4Q0F A;  4FXG C;  1F77 A;  3GD7 A;  4OO1 G;  3Q6S A;  2F0V A;  4NKL A;  3QG1 A;  2PCF B;  4ZLT F;  1BUV T;  5C6A A;  1RF2 D;  4XYO A;  2N88 A;  2HDM A;  2TSS A;  4RGT A;  5JJZ A;  3V2T A;  2EYL A;  1GOZ A;  1D5M C;  4EVO A;  4OO1 H;  2EDG A;  4TSS A;  2PYK A;  2X69 A;  2BOS A;  1JB3 A;  3RUZ A;  2RSO A;  1SJH D;  2BDN A;  3I70 A;  3QB3 A;  3PMF A;  1LT4 D;  3H0G B;  1I6V C;  3DXJ C;  4ME5 A;  1EFI D;  1U9R A;  1B3A A;  2MPM A;  1EY9 A;  5K36 H;  1QJO A;  2J0T D;  5FO8 B;  1WVL A;  4LK1 C;  1SE2 A;  4IUR A;  3I90 A;  3WOE A;  4B08 A;  5JPN C;  5DM7 3;  1BCP F;  1LT3 D;  3BDO A;  4PQX A;  2HCI A;  2Z1C A;  1Y1W B;  1BOS A;  1B9M A;  4FYD A;  4NP5 A;  2Q8T A;  1PYW D;  2EYH A;  1QNU A;  3LWE A;  4PMB A;  3S1N B;  1IHZ A;  1KTK A;  5CV4 A;  1ENC A;  3E6Z X;  2EYJ A;  3IFD A;  3J7A V;  1LAC A;  5TSS A;  3IL8 A;  5J1Z A;  1M8A A;  3K5N A;  1XTC D;  4CBV A;  2I46 A;  4RCO A;  5JEA G;  2F03 A;  4A3E B;  3KF8 A;  2Q8R E;  3GTK B;  4BBS B;  5D65 A;  1GUS A;  3IKJ A;  4C56 C;  5JEA J;  2O4X A;  4BS9 A;  5DEH A;  4KKS A;  2QIL A;  1SYG A;  2RSN A;  1HA6 A;  1V1P B;  1U4M A;  1JOR A;  3OWE B;  3BYT B;  1STA A;  3L9A X;  1FGB D;  2GA4 B;  3J80 L;  5JEA H;  2KQ3 A;  4IUV A;  4BA2 I;  2SNS A;  2F0H A;  5I2X A;  1TU2 B;  2NTT A;  3DHQ A;  2XVS A;  4L6T B;  5C5L A;  2E2I B;  1PRT B;  1Z6H A;  2IWH A;  3HOU B;  3I4M B;  2MGS A;  1HQM C;  3URY A;  3VR5 A;  5CV6 A;  1RD9 D;  4OIJ A;  3M7G A;  1I4R A;  3CU7 A;  1TS3 A;  3AMU A;  1Y8N B;  3D4W A;  1EEF D;  4F7X A;  1PDQ A;  3AU7 A;  1CHQ D;  4ZUI A;  4FF1 A;  4RHR A;  3P20 A;  5CV8 A;  4OGQ C;  4G7O C;  1PXU A;  3JAM E;  1PRT C;  1IW7 D;  1T5E A;  2B2V A;  1VDZ A;  3D6W A;  2IL8 A;  2F0W A;  3NQT A;  4HSV A;  4H13 C;  1KDA A;  3PUZ A;  4B9W A;  2A69 C;  1K8M A;  1EWC A;  1UAP A;  4CKB A;  2QF7 A;  3L3O C;  4LAA A;  1J9O A;  3OWF A;  4ZQ3 A;  2AUJ D;  4KMU C;  3MAQ A;  2F0L A;  2KVM A;  1S5C D;  2JA5 B;  3OOC A;  3EVQ A;  3SXH A;  1Y8O B;  3MC0 B;  2FFK B;  4DAV A;  2A68 C;  1HHV A;  3EA6 A;  5COR A;  3BZD B;  3D3R A;  3H94 A;  2PW7 A;  1RCV D;  3E0J A;  2F0T A;  3GV6 A;  3HOV B;  2CVR A;  2PQE A;  5FOB B;  1VF7 A;  2EYP A;  2MP1 A;  2O5J C;  1Q3L A;  5E1F A;  3N6R A;  2G9D A;  3ONA B;  1SYD A;  5A35 A;  1CQF A;  1WTO A;  1UUP A;  5ELF A;  3V05 A;  5I9O A;  3A56 A;  1WD1 A;  3RZO B;  3VYS A;  1K83 B;  1B44 D;  4WFN 3;  2VUM B;  1G8Z D;  1PFB A;  3S16 B;  1MSG A;  5D3I B;  1R9T B;  3A7L A;  3KLS A;  3BS1 A;  3T56 B;  1TWF B;  2F0N A;  2A5H A;  1NSN S;  1C4Q A;  4DU9 A;  4B9X A;  1PZK D;  1SNC A;  2F0M A;  1EQT A;  1GHK A;  1L0Y B;  3K59 A;  2K33 A;  2BE5 D;  3MEH A;  1PZJ D;  4K6D A;  1EU4 A;  3PIP 3;  4IFD G;  3KK7 A;  3PUW A;  3U9O A;  4FF2 A;  2KHS A;  5F2D A;  2XN9 C;  1JOK A;  4S3S A;  1DZ1 A;  4RH6 A;  2LS0 1;  3PV0 A;  4K2K A;  1AW7 A;  4C1N I;  1VMC A;  2H1E A;  3JAM L;  1D1I A;  1RHP A;  3LNN A;  1Y1V B;  2PZU A;  2MJ8 A;  3EQL C;  2KA7 A;  3J7A F;  4XDX A;  1EZ6 A;  1SYF A;  2NWG A;  1KLU D;  1VCI A;  4CJ2 C;  5CV7 A;  2PPB C;  1I4P A;  2EY6 A;  3HEJ A;  4RGM A;  5D3D A;  3TZD A;  5M3F B;  5C0X J;  1H9K A;  3K0Y A;  3SDZ A;  4X3K A;  2R6G A;  3BDL A;  1TWC B;  2VXW A;  1DXM A;  3QO2 A;  1EEI D;  4OL7 A;  3Q0A A;  2SDF A;  2Q8I B;  3Q22 A;  4K8J A;  4L63 B;  1JWM D;  4HMI A;  1YNN C;  1BR9 A;  2D62 A;  1G2T A;  4DF7 A;  4JBW A;  4RHS A;  1BCP C;  1F9S A;  1GJX A;  5ISR A;  2B2Y C;  4DNT B;  2IX3 A;  3TME A;  2JA7 B;  2A6H D;  3TDQ A;  1SMY D;  1F9R A;  5G3L D;  4KN7 C;  1BXT A;  1DM0 B;  1OO9 B;  2M2L A;  1CQV A;  2EYO A;  5BN4 A;  2BDO A;  2J7Z A;  4YIJ A;  5I6W A;  2Z8L A;  2R92 B;  4FXK C;  1OXV A;  4JK1 C;  1G6Z A;  4A3K B;  2JE6 I;  4FVM A;  3P75 A;  1TWH B;  1STN A;  1QWY A;  2SOB A;  1A3T A;  1KAB A;  2NTS A;  4FNF A;  4HR7 B;  2DY8 A;  2OEO A;  1PZI D;  2Z4I A;  2K28 A;  3AB9 A;  5AFW A;  5CBE E;  2D9U A;  1MSH A;  3PO3 B;  3M3Y B;  3I91 A;  3J81 E;  2EZV A;  3FDT A;  4X3U A;  1Z7T A;  2K7V A;  3HG9 A;  5CBA E;  3KBX A;  4RWS C;  3PUX A;  3SHL A;  4KV6 A;  3K58 A;  2EYM A;  1S5E D;  5IGB A;  1O7Z A;  2X6G A;  1MI2 A;  5JOB A;  3NPP A;  1LO5 D;  2Y0S B;  3D6C A;  4KY6 A;  3SEB A;  1CM9 A;  1F2L A;  2EY5 A;  1E0B A;  2FJ2 A;  1IYU A;  1AEX A;  4FXD A;  1JE4 A;  4DXF A;  1X3Q A;  2AQ2 B;  5IGE A;  1O78 A;  4V19 0;  5C0X G;  2E76 C;  2L5T A;  2WII B;  4QUF A;  2DNE A;  4CKC A;  4A3M B;  5IGD A;  2OF1 A;  4ULL A;  1TWA B;  1BNZ A;  3E5S A;  1I6H B;  3EJI A;  4PMW A;  4ILW A;  4IUU A;  5JPM C;  2L0C A;  5C4J B;  3OHX C;  1DJR D;  5J39 A;  4XQQ A;  1FYC A;  3D8G A;  4K5W A;  4TQU S;  5M5Y B;  1GXD C;  3M7N A;  2WIN B;  5ELD A;  3ERQ A;  4EQO A;  2M00 A;  2NVY B;  4DK1 A;  3DM1 A;  3J80 E;  5M3M B;  4ZKC B;  4XT3 B;  2NYZ D;  1SFO B;  1LV9 A;  1NCV A;  4DXG A;  1CHP D;  5KYI A;  1PFM A;  4HED A;  1B2T A;  2E2D C;  3ERO A;  4ZAI A;  4KTA A;  4PV1 C;  1OXU A;  3OSO A;  1HXY D;  4BY1 B;  1HFN A;  1H9J A;  1BF4 A;  4OO1 I;  1T5X D;  1A6X A;  1TY2 A;  1LLR D;  5CC4 A;  2B2V C;  4IUN A;  3MHB A;  1TS2 A;  1TVX A;  3I4L A;  5DNF A;  2XNA C;  4MHE A;  1A15 A;  5CGK A;  1G2S A;  3ITP A;  2F0S A;  3L7Z C;  3K5O A;  4HCE A;  1IKM A;  1Q8I A;  4IQZ A;  2OT2 A;  2E74 C;  4RGN A;  4NW2 A;  4H0L C;  2WAC A;  5E4X A;  2K32 A;  2RDG A;  2A6E C;  3I72 A;  1LTT D;  1R4P B;  2FMM A;  1SE4 A;  4QMG A;  1H9R A;  3A54 A;  3MXN A;  1BBX C;  2EE1 A;  1WD0 A;  4IZ8 A;  3I8Z A;  4IUP A;  1M4V A;  3HZX A;  1EZ8 A;  2TMP A;  1KNA A;  1J8I A;  1U4L A;  4KY5 A;  4M1U B;  3A7A B;  1QE6 A;  1XXG A;  3VR6 A;  4ZYS A;  3QJY A;  4WOR A;  1GUT A;  3M4Y A;  1DOM A;  2A74 C;  1LTR D;  5DAU A;  2PO4 A;  5EKL A;  1I3Q B;  1TS5 A;  1B4O A;  4BWG B;  1IYV A;  1B50 A;  1CTM A;  4ZRZ A;  1V43 A;  4EQP A;  2CW0 C;  2B2U C;  5K5P A;  1AP0 A;  1I4H A;  1CI3 M;  2E75 C;  3R2T A;  1AN8 A;  2E2J B;  2ENB A;  4MIU A;  1PRT D;  4L8J A;  4G7Z C;  1ENA A;  4OIK A;  1WCM B;  1TY0 A;  5FLX L;  4X3T A;  1L0X B;  3SR1 A;  3TSS A;  2LKV A;  3GTL B;  2K5W A;  3SVM A;  1EY0 A;  1W6J A;  3DWA A;  5ELC A;  2B2U A;  1WTX A;  1AFP A;  1EY7 A;  1EY6 A;  4QCL A;  1PRT F;  3R3O A;  3VYT A;  1FR3 A;  1W6K A;  2IJ0 A;  2RKS A;  3NQI A;  4DAP A;  4CJ0 B;  1IW7 C;  2MHV A;  4G7H C;  1ZXT A;  4H44 C;  5KEE A;  1F9Q A;  2JEA I;  1A2U A;  4U68 A;  3D4R A;  3WDN A;  1JWS D;  3NHH A;  3FEW X;  3K5M A;  2ZXR A;  2DY7 A;  2KCC A;  2ICI A;  2F0F A;  1SYE A;  2NN6 G;  2IX1 A;  3T4A C;  2B8F A;  2NBF A;  1ET6 A;  1DOL A;  2H4O A;  4IUQ A;  4C3I G;  1Q1E A;  1TII D;  1AZP A;  2LFN A;  5M5X B;  4BBR B;  2R7Z B;  3VYU A;  1KLG D;  3H91 A;  5C44 B;  1SE3 A;  4Z9C B;  1LT5 D;  4C3H B;  3FMC A;  3TN2 A;  2F0E A;  3K6O A;  2BA1 A;  5FO7 B;  3SE0 A;  4Q5V A;  2K1B A;  4QF4 A;  4RGO S;  2L1B A;  3J7Y W;  3S1M B;  5HUR A;  3NWS A;  4HAE A;  2PZW A;  3DEP A;  2F0U A;  3OIP A;  2A69 D;  5CV9 A;  1LTS D;  2NN6 I;  2B2W C;  5KIX A;  4ODG A;  5ELB A;  2VB2 X;  2AWO A;  1VMP A;  4DN4 M;  2EJM A;  4DFA A;  3NWT A;  5JAV A;  3KLR A;  4IN3 A;  3CHB D;  2F3V A;  2DNC A;  2PNR C;  5J22 A;  1SND A;  2XRQ D;  4QIW B;  4CKE A;  5KND A;  2RBM A;  1A3U A;  4ZKB B;  2AUK A;  4IAL A;  3UI2 A;  3K5L A;  1TQO A;  4A3I B;  3HKZ B;  5D14 A;  4R8I A;  3W2D A;  3SK6 A;  2EY2 A;  5C0X I;  3GP7 A;  4PNY A;  1EY5 A;  3GTJ B;  1HFG A;  4EQN A;  3X3N A;  2K05 A;  1EIH A;  1ZYR D;  3KLS X;  1H9M A;  4K14 A;  4C1N K;  2ID0 A;  3CKI B;  5FK9 C;  2E2H B;  1X32 A;  1ML0 D;  1SYB A;  1A2T A;  5E4W C;  3P1H A;  2M9V A;  5EKI A;  2OXP A;  1HTL D;  3NTI A;  1OXX K;  2F0O A;  5A2Q L;  2B39 A;  3NBI A;  2MUY A;  1EYA A;  4RKB A;  1G91 A;  1FNV A;  3GV3 A;  3K57 A;  2R93 B;  1D1K A;  2RA4 A;  1LTA D;  1DD2 A;  2F0J A;  1U4P A;  1JQY D;  1S5B D;  4KK7 A;  3GTQ B;  4KHV A;  4IFD H;  1EIG A;  3C2P A;  4LJZ C;  1WTP A;  4EGV A;  2Z4H A;  3ND9 A;  2JXM B;  2F0K A;  4KKT A;  4ZUJ A;  5IOC A;  3GO5 A;  3A8K E;  1E2V A;  1NAP A;  1STY A;  1WTW A;  3OPO A;  3T13 A;  1RTO A;  2EPB A;  2K01 A;  1XYI A;  1JOQ A;  4N9T A;  4IUT A;  3RZD B;  4C3H G;  1CK1 A;  5FLX E;  3HOX B;  3PUY A;  5CR3 A;  1F2Y A;  1S5F D;  5T1G A;  5EPK A;  4TRD A;  2EXZ A;  1EY4 A;  4O1N A;  4J1M A;  1FD7 D;  3TP6 A;  2XWB B;  3I73 A;  1PMR A;  2L4N A;  3OMG A;  1KDC A;  2LMC B;  3NTH A;  5I9P A;  1AZQ A;  3TP7 A;  4F8M A;  3NTK A;  1GUW A;  3C46 A;  4U67 3;  4R9W A;  2QCP X;  3WOF A;  4K6L A;  1Z47 A;  4C3J B;  4PMC A;  5EQ0 A;  3NE5 B;  4ID6 A;  5C4Z A;  4KD3 A;  4G4K A;  3A8I E;  4C2M B;  1RKN A;  2G9H D;  2PW5 A;  1QNK A;  1SNP A;  1SYC A;  1SDF A;  2V4D A;  3VYR A;  3V96 A;  1B53 A;  1B9N A;  3KUP A;  2HCC A;  1PTO C;  2CHB D;  1CFM A;  4KY7 A;  5KNC A;  4HTH A;  3G6J B;  5JVH 3;  5EKK A;  5M5W B;  1I4G A;  3I3C A;  3BYY B;  3T51 B;  1Q90 A;  1K8O A;  3W3A A;  2PZT A;  4BA1 I;  1PTO D;  3BDC A;  4XIG S;  1CZW A;  4F88 A;  2FIN B;  1ILP A;  2FHT A;  4A3J B;  1HUM A;  4F87 A;  1JCK B;  1TR5 A;  1ESR A;  3H6M A;  1TKW B;  4A3B B;  2K5D A;  1UNS A;  2KED A;  3T16 A;  1NUC A;  3NUC A;  5C3E B;  3MVV A;  5KYL A;  4RFB A;  5FKA C;  3DEO A;  4DK0 A;  1Q12 A;  2F3W A;  3VR2 A;  2D5D A;  4A3D B;  1OXS C;  1CA5 A;  1SJE D;  3ND8 A;  1QG7 A;  1TT2 A;  3NSW A;  3NK9 A;  1SSO A;  2YU9 B;  3RLF A;  1KDB A;  2F4I A;  3OMC A;  2WP8 J;  4KI0 A;  4NDX A;  4AYB B;  3MZ5 A;  2ICE C;  1GUN A;  2AQ3 B;  2KEC A;  3TP5 A;  4FF4 A;  3VA7 A;  3LX0 A;  1PTO F;  4O42 A;  5CMD A;  1D5Z C;  1RTN A;  1EQV A;  2JP1 A;  1C8C A;  3FPU B;  4XXE A;  2L11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...