2RQXA

Solution nmr structure of pmrd from klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
b'MEWWVKKVQDNASASLCRVVLQSGALEMIAEIEACRLRLREGDKLTPLADARYCLNNNPTQTLKIRNATHYSSERWTNADK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyxin B resistance protein
publication title Solution structure and phospho-PmrA recognition mode of PmrD from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Signaling protein
total genus 8
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.650 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rqxA00
4HN7A 2JSOA 2RQXA
chains in the Genus database with same CATH superfamily
5I9PA 1X9NA 1PV4A 5IODA 2A6ED 4P72A 4JI1L 1VQ6A 4L5RC 1I3QH 5E3FA 3OIPA 4RGTA 3A8KE 2WV6D 3ITPA 1H9MA 3R93A 4A3DB 1VQ8A 5C44H 5IGEA 3J81c 1SFOH 5CORA 3L7ZC 5C0XG 1YNJD 1WTPA 1VQOA 1SDFA 4EQNA 1G91A 3G6JB 4EGVA 1PTOD 2F0UA 1Y1VB 4ULLA 3E6ZX 1DXMA 4RGMA 3STBC 1GUNA 2K52A 3CHBD 2EZVA 3RUZA 3KBXA 1HTPA 3K5LA 4BY7H 1QNKA 4WRDA 3TP8A 5BR8L 3KF8A 2A5HA 4BWGB 4DV3L 1KAWA 1D1IA 4P71A 3S17H 1JWMD 3IL8A 3E0EA 1WTXA 1H9SB 2NN6G 3J80c 1JICA 3ERSX 4HJ7A 4A4IA 1QWYA 1PMRA 1BUVT 2EY2A 2CWPA 2YU9B 4R8IA 4U68A 4QUFA 4PV1C 1ASZA 1WTHA 4GN3B 1HUNA 4DV5L 1B50A 4R4IA 3UDIA 1EIHA 1X55A 4DAYA 1NTGA 2JQOA 3E9HA 5T1IA 5J3BA 1NUCA 4PZ6A 1C4QA 4JI7Q 1SRUA 3FDTA 3H0GH 4BBRB 1JR0D 1PYBA 2L12A 4X62L 2F4IA 4FP5D 1UEAB 4UDUC 2L0CA 1YJWA 1B70B 2FMCA 1SE3A 5KYLA 3ERQA 1I6HB 4JI2Q 1YHBA 3GTGH 1QCBD 4DR5L 3E0JA 2BE5C 3O13A 1PRTC 1G2TA 1VCIA 1RL2A 3I4LA 1IKMA 1FNVA 4F8MA 4R4QA 4C2MB 4A93G 3R3OA 2M9VA 1IYVA 2UXCL 1LT3D 1DONA 4F87A 2MJ8A 4OL7A 2OCEA 2DGYA 5M5XH 1EYAA 2FMMA 3BDLA 1LUZA 2CQOA 1HNZQ 1EOVA 2RKSA 2LMCB 2R7FA 2Z8LA 3X3NA 5LMNW 3A55A 5FO7B 2UXBL 5CBEE 4LUVA 2NWGA 1ILQA 2VQEL 1F9QA 4OX9L 1Q46A 3OTOQ 3MXUA 4GKJQ 2Y0SB 1NR4A 2IWHA 1VQGA 4DR4Q 5CV6A 3Q0AA 3ULJA 1G2SA 1N33L 4H44C 1BNZA 2YV5A 1XTCD 1VQAA 4B3SQ 2NVTH 3L2PA 3QOLA 1Y1WH 1GKHA 1E2VA 2RSNA 4V0BA 1GUSA 2I5LX 2E2IH 2F03A 3QO2A 5KIXA 5D3IB 3CCEA 4HJ9A 2KECA 4KJNA 1I5FA 1PH4A 1HH2P 2NTTA 4OONA 4B9WA 4C56C 2ZM6Q 1NNXA 5CGKA 3KYHC 1QILA 3IAYA 2K05A 5C4HA 3FKIB 5M9OA 2B2YC 2Q2IA 4LJZC 2BOSA 2VUMH 2J7ZA 2ZXOA 5JEAH 3F2CA 4A3FB 3PO2B 4LW1A 5IOCA 1LO5D 3NEMA 2HUGA 2PW5A 1XMOQ 4IFDJ 5M5YB 2EYLA 4PNYA 1ZXTA 4KY5A 5I2XA 1IBKL 1PRTB 2A6EC 4JI1Q 3S1NB 4IUNA 2B29A 2AMCB 1DM0B 1HJPA 3SK4A 2NN6H 5FO9B 4ODGA 2EYHA 1W6KA 1PH1A 1OXXK 2XGTA 1GOZA 1QJOA 3MFGA 4ZK9B 4OO1G 1WD1A 3SVMA 1YNJC 1EWCA 4YIJA 3KF6B 5FO8B 2BCOA 1IL8A 1FYCA 1PTOC 4YCVA 3T56B 4G7HC 3MXPA 1BQQT 1JOOA 1NSNS 1M90C 1X54A 3I90A 4K2KA 3RZDH 1ZYRC 2WAQG 3HOWG 4A3GG 1T5EA 3D6WA 5IT9E 1BVSA 4LFBL 3BDCA 1S5DD 5IE8A 4HCSA 1A3UA 1KDBA 3NP8A 2N3SA 4K5WA 5FKAC 2JA6H 5BR8Q 1EQRA 1G291 1MI2A 4DV3Q 4IUTA 3K8AA 4OEMB 4TVAB 2F0DA 3IKJA 2XIWA 1U4PA 3K7AH 3PUYA 4IPDA 4HAEA 3S1MB 2F0HA 4CDDC 1E2WA 1Z6HA 5A2QE 2F0JA 5LMNL 1HR0W 1VQ7A 1N32Q 4DV0L 2EY6A 1DYQA 3QOJA 1EIFA 2OTJA 4DV5Q 1C48A 5IT9c 2CHBD 5EKIA 2F0SA 4ZUIA 4OELB 2R7ZB 1HQRD 4DK1A 3J7AF 4A93H 2GVBA 2X69A 3HKZB 2N78A 2KHJA 4UHVA 4XYOA 2ATWA 4X62Q 1BCPC 3NUCA 3I72A 4RMFA 1EZ8A 3GTMH 3CKIB 1AZQA 1S3OA 2HIXA 3LWUA 3KUPA 3W1GA 4X66L 4IO9A 4A3IG 1GUOA 3CD6A 2ZTEA 4X3UA 3AB9A 4LF6L 2V4DA 4LNQA 4DR5Q 3KDFB 2A69D 1EIGA 2C35B 4JI5Q 2RHSB 1CHPD 4A3KG 4K5VA 2Z6KA 1LTSD 1DOLA 2EVBA 2DNEA 2KEEA 1TXYA 3J81i 3T53B 2UUAL 2AUKA 1GVPA 2K14A 3A5ZB 4DUZL 2UXCQ 1PZID 2XRQD 2B63B 4LWCA 1HZ9A 3NWTA 4DR1L 1SEBD 3KLSA 3HG9A 2WACA 1PHJA 3S16H 1K83B 1DGSA 3BDOA 1HZCA 4UP7A 2VNUD 4NPSA 2A74C 1EY5A 1ML0D 2UXBQ 5ELBA 2UXDL 2QF7A 4LFCL 3CCSA 2L1BA 4RWSC 1K8GA 2VQEQ 4B3RL 1PTOB 2QDBA 4OX9Q 1STYA 2IT1A 2K33A 2XN9C 4U673 4A3EB 4ZYSA 3J80i 3S2DH 4PQXA 1X3GA 5D3DA 2H1EA 5JJLA 4DR7L 3VDYA 1ET9A 1N33Q 3CW2C 2JA5H 2XWBB 3V05A 4EQPA 2E2JH 1FNUA 3CCVA 4RFBA 3DUZA 1CA5A 2IY5B 2TSSA 2EJFC 4QQBX 1MGSA 1HTLD 1I50H 4BY1G 2ES2A 4FF1A 2JA8B 1EEFD 1YNXA 5C4XB 3S2HH 1STAA 3Q22A 4S3SA 2B8GA 4A3BG 5KEEA 3U9OA 2SNMA 3DM3A 1XPRA 5JOBA 4PZ8A 3EJIA 4DAMA 1R9TB 1I3QB 2K32A 2JEBI 2ENBA 4DAYB 1V1OA 4Z9CB 4RHRA 2MO0A 2PCFB 3L9AX 5C44B 4A75A 4H0LC 1KABA 3HOUG 4XQJA 3BVMA 1PFMA 3K80C 1QZHA 1BCPB 3TZDA 1HR0L 4AIMA 1L2FA 2BH2A 1EFWA 1JOKA 3S15H 4LAAA 4A3MB 2V1CC 4GZYC 1DJRD 1F2ZA 1GD7A 1RODA 3TRZA 4XT3B 2JA7H 1TWHH 3UE0A 1RTNA 2K5VA 1MKHA 3K5OA 1Z7TA 4XDXA 1YHQA 2FJ2A 1I4XA 3RLNA 4DNTB 1WTWA 1N36L 1IBKQ 1P16A 4BY7B 1K8OA 5ISRA 1EOTA 4A3EG 4FF3A 2BA1A 3S17B 1SNDA 4HJAA 4LF8L 4ILWA 2HQLA 2IW3A 4WJWA 4DUYL 1G6PA 5NUCA 1C9OA 1H9JA 4P2CB 1SR3A 4IPHA 1MIUA 5CV9A 3HOVH 1I4HA 4JI4L 2XSCA 1ONLA 2DUDA 4NXML 2HQEA 4R4CA 5CBAE 2O5JC 2A73B 3M85A 2RDHA 1PA6A 3IRBA 5GAHC 2DJFC 3MFYA 4LFBQ 3VR6A 2F52A 1HNXL 2G5DA 3CRKC 1CZWA 1GO3E 1UE7A 1D2BA 4Y7NH 3H0GB 4O0AA 1DOKA 5IYDG 5FK9C 1G6ZA 3DM1A 1MJEA 3K0YA 4KY6A 1JE4A 4WJ4A 3GDEA 1HZAA 4A3IH 2WKCA 4P74A 2QILA 1F2LA 5LMNQ 3NPPA 3GQBA 4XXEA 1K0SA 1FR3A 3GTGB 2VB2X 3D31A 4C3JG 3JC66 1W6JA 4NDXA 3BVZA 2OEOA 1PH9A 2CH4A 4ID6A 3HOXG 1VQDA 1RDPD 1AZPA 2HCCA 3K58A 1DOMA 1Q1BA 2KENA 3E5SA 2C9OA 4JCVE 5JVH3 2ID0A 3PCOB 1A15A 5J39A 2VQFQ 4HEDA 5M5XB 2EJGC 5DEHA 3AYHB 3CQZH 4K2LA 2K1BA 1YZ6A 3MVVA 5E1FA 3D4RA 2HD3A 1EYGA 1L1OA 4X66Q 1YJNA 2L55A 2Z4HA 4KKTA 4LF6Q 2OWOA 2A69C 5F2DA 1TWFH 2Z6KC 2QA4A 3K5MA 4I7ZC 4DV6L 4JVZA 4FF2A 2UUAQ 1PFSA 3CP0A 2PMZB 3HP3A 4DUZQ 4B3TL 1ILPA 1V1QA 4BBSG 1MBYA 4DR1Q 3VR4A 4YWMA 2NVTB 4APVA 3FHWA 4NKLA 3PIP3 4YCUA 3GTLH 1Y1WB 2CFMA 1UE5A 3CCRA 5EAYA 4RH6A 3AFPA 4FF4A 2E2IB 1TY0A 4C3IB 2UXDQ 2JK8A 1HHVA 5KGUA 2NZ1D 1O7IA 3X3MA 2JJQA 1OXUA 1PH2A 5CMDA 4N8FA 2LKVA 3I4NH 2PMZE 3I4MB 1YVCA 3B6YA 3H91A 1GJXA 1Q7YC 4DR7Q 1I4PA 4ME5A 3PUZA 5LMUL 2UUBL 2YTXA 4PMBA 4BXXH 2JE6I 2R93G 4DKAC 2VUMB 5M3MH 1QVCA 1SN8A 4JV5Q 3A74A 3T1YL 1STHA 3D8GA 4JI8L 5C3EG 1EEID 3GTKH 5IP7H 4IN3A 3HZXA 2E74C 2CW0D 4OHJA 5IIFA 4K0KL 2LS01 4QB4A 1LTRD 1CI3M 4KY7A 1W3SA 3T16A 3C1FA 1Y8PB 1WCMG 1XPUA 1HR0Q 2UUCL 4KMUC 1GXDC 4F88A 3DLLA 3NWSA 1CUKA 1SE4A 1QG7A 2UU9L 3MZ5A 1H9KA 4QY7A 4QCLA 2NVYB 4IUUA 4IUPA 1IHZA 4LF4L 1UUPA 4EX5A 5HY6A 3MXNA 1JMCA 4UY8C 1N36Q 2JYOA 3HOZG 4CKCA 2JA6B 5IYDH 4K14A 4LF7Q 1ZYRD 3SHLA 3BVGA 3OWFA 3K7AB 3M4OH 3HGBA 4R4TA 4DUYQ 4KJOA 4MZ9A 2L15A 1TU2B 3NENA 4EQ5A 4K8IA 3HOYB 3IFTA 4JI4Q 5K36G 4NXMQ 4A3LH 2KBNA 1PFBA 4KN7C 1FNWA 4C3JH 1Q12A 1FGBD 3OPOA 2F0MA 1E1TA 4DU9A 1HNXQ 5IGGA 3RN2A 1EIYB 1IL2A 4DV2L 3NTHA 4HJ8A 1F9SA 1IBLQ 1Q8IA 1SNOA 2LXJA 2LY7A 5EPKA 1P8LA 3GV3A 3M7GA 5M3FH 3NELA 3GTMB 3C46A 4WORA 1I4GA 2Z9HA 1N9WA 5AFWA 4RHSA 2OXPA 4JW0A 4A3JH 4DK6C 1H95A 1D5ZC 3OMGA 5EQ0A 1M4VA 1BCPD 1VQIA 1CHQD 4IFDI 4C3HB 3OIQA 1U9RA 5JVG3 4LMQD 1IW7D 4A3DG 2IL8A 2RA4A 2WFWA 3K5NA 5FLMG 2PQAA 1K8MA 3OMCA 2WINB 2FHTA 3W2DA 1LTLA 5FJ8G 3Q6SA 2KHSA 3IFDA 1Y1VG 3ONAB 3VR3A 4A76A 3GTPH 5H1SE 1RCVD 2D0PA 2CQAA 1L1OC 3BZKA 2PZUA 5ELNA 1CM9A 1TS3A 4K5XA 2JN4A 4KKSA 2A68D 4XYQA 3TP5A 2NVXB 1NMFA 4UAIA 3EFXD 4HMIA 4DV6Q 3T13A 3S2DB 3SGIA 5L37A 4R8NA 1NJIC 2IHEA 3J81L 2JA5B 2F0EA 3A54A 2E2JB 4DV1L 1HPCA 2CWAA 3BZCA 3VR2A 2ALYB 2R93H 4KK7A 2RVLA 4JOIA 3OOCA 1DCZA 3GD7A 3S2HB 3MEHA 2QGQA 3JAME 4OO1I 2GVAA 1EWHA 2X6LA 4ALPA 4BBRG 3PF5A 4DR6L 5EKLA 1AE2A 2KQ3A 4IFDG 3GTJH 2EPBA 1IBMQ 1LACA 1OXTA 2F3VA 3I55A 2EY5A 4NW2A 4HIMA 1KDAA 4N9TA 3J80L 1KTKA 1AN8A 2PQEA 2VB3X 2N55A 2Q2TA 1NCVA 2PNRC 2XVSA 4QJFA 4LFAL 4AYBB 1BR9A 3VYSA 2HDMA 1N34L 2F0PA 3JAMc 3T1YQ 4JI8Q 1A63A 5BN4A 2JA7B 1TWHB 5C0XH 3GTOH 1E7ZA 5FOBB 5KRUA 4DGZA 2CW0C 5IY0A 4K0KQ 1A0IA 1VQHA 3QG1A 1SAPA 2AHOB 2J4XA 1SMYD 4JI3L 1PYWD 3U4ZA 1QVGA 5HURA 1SYBA 2EY1A 4YWLA 4KN4C 3PUVA 4Q0FA 4DV7L 2OT2A 3OW7A 3HOVB 2EYJA 2Q2HA 4AYBE 2UUCQ 1S4ZA 2WAQE 3OSOA 2Y0SG 3DWPA 1XX8A 1L1OB 3H09A 2UU9Q 3ICEA 1TWGB 1D1KA 2SOBA 1JQYD 1U4MA 4O42A 4LF4Q 1SNQA 1SYFA 3SK6A 3CRLC 5M5WH 4X3TA 4Y7NB 1EFID 3A56A 1SSOA 1BBWA 3GV6A 2OQ0A 3I7FA 2QDLA 3KLSX 2PW7A 3EN2A 4QL5A 2VZAA 4MTKA 2CH4W 2L11A 3A8IE 5G3LF 1B53A 2F4VL 1X32A 3CC7A 1LM0A 4G7ZC 2TMPA 4ZKCB 1ZEQX 1TVXA 1AEXA 2VL6A 4DF7A 2B2VA 5C5MA 5JJZA 3S1QH 1EY7A 1HUMA 2EJMA 3E9IA 2AWOA 2ZXRA 1GUGA 3FKIG 3OWEB 3J7ZC 4JBWA 2PO4A 4MN3A 5C4JH 3PO3B 2R3ZA 1V43A 4DAVA 3CQZB 2HHHL 4A3FG 3PO2G 2EDGA 1UNSA 1SJHD 3TS2A 3J81j 3I73A 5IGCA 4GN5A 1RIPA 3PIPA 1JE5A 3MTSA 3U50C 3KJPA 5IP9G 1TWFB 5ELFA 1VQBA 4TRDA 1IW7C 1H9RA 2O2LD 1FVIA 1PZKD 2DN8A 4NMZA 3OHXC 2F0GA 3G4SA 4HMJA 3SR1A 3GTQH 2ZT9C 2E2HB 1CZGA 3GTLB 3Q8DA 1S5ED 3TDQA 4HTHA 4G57A 4JBJA 2NB0A 4K6LA 2DNCA 1Q1EA 4BA1I 3CPWA 3PF4A 3VYRA 4CDEC 1RTOA 2EXZA 2R92B 5E4WC 1V8QA 3MC0B 5JJKA 1EZ6A 1E2ZA 2RF4A 2A68C 1YNND 3D4DA 3M4PA 5I4DA 1VQFA 3I4NB 3QJYA 4ZCKA 4FVMA 1YEZA 3VR5A 1IZ6A 3MXNB 3EVQA 1J5EL 2VS1A 1A62A 2A6HD 5DM63 5GAEC 3NQTA 2DJGC 2VY3A 1NY4A 4JOIC 1MSHA 2B39A 4FNFA 4CDFC 5M3MB 3LWEA 2R7ZG 1F2MA 1BDOA 1IKLA 2Q2UA 2NVQB 3F2UA 3HKZG 2I46A 4HIOA 3GTKB 3U58A 1ICWA 4DR6Q 1VQ4A 3RN5A 3NTIA 1S5CD 1FJGL 4BA2I 4DNIA 4FDBA 3WDNA 4G7OC 3SDZA 5IGBA 2EXDA 2FXQA 2B2TA 1O78A 4GNXA 4X64L 3QB3A 1D5MC 1O7ZA 4I65A 4L6TB 1TQOA 1PH8A 4JBKA 4ZRZA 4XQQA 4GLAC 3C2PA 2EQSA 3DXJC 4CJ0B 4KLKA 3DWAA 1XNQL 1EYDA 1N34Q 3T1HL 3V2TA 5IT9L 1SFOB 4E6IA 1X6OA 3EA6A 2B63G 4OO1H 5D65A 5COYA 4ZLTF 2R92G 3KFUA 2XNAC 1OXSC 3SEBA 2LXKA 3D4WA 3HOWH 4A3GH 2PQAB 1PH5A 1R4QB 1SMYC 3M4OB 2IHFA 4DV7Q 1PZJD 1VS0A 3MXGA 2HIVA 1RKNA 4KD3A 1STGA 4DXGA 2KCCA 3WOFA 4IPCA 2A8VA 2EE1A 4HN7A 4MTNA 5EPJA 2I07B 4UPAA 2F1MA 4KHVA 1F77A 2BDNA 4EQOA 5E7NA 4KD4A 5LL6S 4RGNA 2KA7A 4OWXB 1YIJA 1I4QA 5C4ZA 1HNWL 1QE6A 2JA8G 1LTGD 5M3FB 2K5DA 1C7YA 5C4XG 4AQYL 4DAPA 4DR3L 4LUZA 1X3FA 4K6DA 5E4XA 3M3YH 4R1JA 2F4VQ 1KHIA 4A3JB 3P7JA 1AH9A 2F0OA 2PZTA 1XWEA 4F7XA 5IGDA 2K5QA 5KYIA 1J6QA 2KCMA 1VF7A 1WI5A 1B3AA 1LABA 2B2VC 2Z6BA 1SYDA 3M4QA 1TR5A 5C44G 4DV0Q 2F0LA 2BH8A 1ENCA 1K9MC 4A3KH 4JG2A 2D5DA 1SROA 3J7AV 1XNRL 2HHHQ 5LHY1 4A3MG 3K6OA 1VQPA 3GTPB 1KRTA 3DWQA 4RA8A 2WB1B 4LF9L 1TKWB 1HFGA 3A8JE 4A3CG 2F0WA 2MO1A 2PZWA 3M7NA 3K59A 4BY7G 2LSSA 1B44D 1UE1A 1VQJA 4KHPL 3VYUA 2RBMA 1JJCB 4GKKL 1ENAA 3L0OA 5C3XA 1KC8C 1SLJA 5T1GA 2ZTDA 2ZJQA 4RAUC 3R2IA 4ME3A 2VW9A 1MSGA 3F1ZA 2AKWB 2D9UA 2SNSA 4AH6A 2F0QA 4CBVA 2G9HD 1MHWC 1II3A 2QKIC 3EIVA 1EQVA 3QWNA 3UDFA 1KDCA 1YBYA 1SJED 5J1ZA 2WB1E 1U4LA 1QZGA 4DN4M 1VQMA 1KQSA 1A2UA 4J6HA 3RLFA 1BXTA 3FEWX 5EKKA 4WJ3M 3G7LA 2AQ1B 3H0GG 2BDOA 4BY1H 3TP6A 3CCMA 1YNNC 3H3VI 1CT1D 1BKBA 5JJIA 3GTJB 3F8TA 3L3OC 3I91A 3TS0A 1FD7D 2SEBD 4A3BH 4LFCQ 4HCEA 3AU7A 4B3RQ 1EYCA 1J5EQ 4NB3A 1NMGA 2I5HA 1UAPA 2QEXA 2A6HC 2C5CA 3DMUA 3S14H 3BYTB 4QF4A 1JT8A 5KNDA 5CV5A 1JCKB 2RHQB 4YCWA 5K5PA 3AMUA 2EIFA 5FLXL 3HOUH 2D62A 1AP0A 3GTOB 2F3IA 1QNUA 1FJGQ 1LT6D 2NZOA 2K01A 4N8X1 5G3LD 2K50A 5CC4A 2YYZA 2B2TC 4CKEA 4QIWE 3AFQA 4HSPA 4GNXC 4X64Q 3G6EA 1QOHA 3OW2A 2JEAI 2E5LL 2PNHA 3S1RH 1L0YB 1CSPA 4A3EH 1ESFA 2RDFA 3UI2A 4DR2L 1XNQQ 1FGUA 3D6CA 5CV4A 3T1HQ 1O7LA 1EQTA 3QIAA 3W5OA 3ULPA 3G71A 4KV6A 4RG1A 1B1ZA 2JXMB 1X56A 4UP9A 1B9MA 1EWIA 2R7DA 3J81E 1VQEA 5M5WB 1Y1WG 2R61A 4LUOA 5I2YA 1J9OA 3ND8A 2HT1A 2B2WA 2FFKB 3RZDB 3CPFA 4M8AA 2KJXA 2OF1A 4X65L 2P5ZX 5DM73 2E2DC 4C3IG 3U9SA 2N8NA 4JPBW 1XMOL 2MP1A 3RMHA 3S9WA 1B7YB 3NBIA 2CKZB 1T5XD 3TQYA 1CK1A 1R9TH 3I4MG 1U0LA 1AFPA 3AQQA 2M2LA 4LF8Q 1PH7A 1WYDA 3P1HA 3S1QB 1XMQL 4R9WA 3J80E 4CKBA 2K03A 1OXVA 3BJUA 1X3QA 1SNMA 4P73A 4B9XA 1K73C 1YHAA 3BS1A 4J8QA 4HJ5A 1HNWQ 3H6MA 2VUMG 1QB5D 5C4JB 3D0FA 3HOXH 1LYLA 1WTOA 4GOPA 3NBHA 4A3MH 4AQYQ 4DR3Q 5JEAG 3GO5A 1D7QA 3RD4A 2M00A 3D3RA 4A93B 4XTCS 4A3CH 2MFIA 2MGSA 5IGFA 2WIIB 1D5XC 3KBGA 3CC2A 2NBFA 4QUCA 2HDLA 3N6RA 3SXHA 1I94L 2FINB 3A7LA 1WVLA 2I5MX 1WTVA 2Z1CA 5C6AA 1N32L 4PG3A 2CCZA 1WTRA 1CKMA 1L0XB 3LX0A 3ULLA 3GTQB 1NAPA 1XNRQ 1WTQA 2O4XA 5C0XJ 2K04A 4OXPA 4GNXB 1HXYD 3CU7A 3P20A 4BBSH 4LF9Q 5JEAJ 1CKNA 1N8RC 1CQVA 4J15A 5DLQE 2ICIA 4DNRB 1YI2A 3R2TA 4HIKA 2JA6G 2K5HA 2YTYA 4OIKA 2RDGA 4KHPQ 2A19A 3CMEA 1CSQA 3S16B 4LF5L 4GKKQ 1XYIA 2K28A 2QCPX 2A1AA 3I70A 3NK9A 1GHKA 2NZHA 4GLVB 3HOYG 5GROA 3FRPB 1IYJB 2Q8IB 2K5NA 1K28A 3UDXA 3K81C 4JI5L 3J7A5 2EYPA 3TEHB 1S40A 3MEFA 1E22A 1K8AC 4B3TQ 4J1MA 4IPGA 4K8JA 3N52A 1V1PA 5IYBG 3VA7A 2H5XA 1I50B 1BBXC 3PUXA 1RHPA 4FYDA 3KOJA 5ELEA 4HIDA 1Q3LA 4IJLA 1EY9A 5C3EH 1PH3A 2KCTA 1K3RA 2N49A 1LT4D 1Y8NB 5KNBA 4V190 1PXUA 4JI6L 3KLRA 3I56A 2ZJRA 2AWNA 4C3HG 1LT5D 1SBBB 5A35A 2D0OA 1KL9A 2XWJB 1HA5A 1LLRD 3TBIB 1A8VA 1E3PA 4Q5VA 3SK5A 1CTMA 1TWCH 5LMUQ 2UUBQ 3ND9A 1Y8OB 1WCMH 2IX1A 1TWAH 1SYGA 3CCQA 4JI0L 3PSIA 3H3VH 2EYFA 1V9PA 1NE3A 1VQCA 4IOCA 5I6YA 2YTVA 1I4RA 2KUMA 2XRSD 4HR7B 2WAQB 4DV4L 1EQQA 3HOWB 4A3GB 3RZOH 1WFQA 3F2DA 3FPPA 4C3IH 3I3CA 4YY3L 1PRTF 1D6EC 3UDGA 1SE8A 1SNCA 2HCIA 1B9NA 1LV9A 4NP5A 1J8IA 5TSSA 4GN4B 2E5LQ 3HOZH 2R6GA 2Y0SE 3I4MH 1Z9FA 3R8BA 4DR2Q 5GAGC 2EYMA 4JBMA 1Q8KA 2X6GA 4R4OA 5HGQA 1AW7A 1PVOA 1VQKA 1KRSA 3K7UC 4M1UB 4B08A 1K3BC 2JA5G 1VQLA 1AE3A 5K36H 4IURA 2J0TD 2PPBC 3T51B 2B2WC 2B8FA 3WWVA 5C3WA 1TIID 2RCFA 4X65Q 2ICEC 3GP7A 1TS2A 3M3YB 3BU2A 2JP1A 2GN5A 4FXDA 4TKOB 1JWSD 2E76C 3T4AC 1PDQA 5EJWA 1XMQQ 3CMAA 3OYYA 3PGZA 4A3IB 3CAMA 3CCLA 2F0FA 2PI2E 3FP9A 3WOEA 3TMEA 5ELDA 1EU4A 2F0KA 1GUTA 3TREA 1SMXA 1C0AA 1F9RA 2NUCA 3Q24A 1YJ9A 5ELOA 4A3KB 5CYUA 4MNOA 4ABNA 1G51A 4AYBG 4GOPC 4A3DH 3P75A 2OTLA 4PZ7A 3TP7A 1TS5A 4MIUA 3DEOA 2I0QA 2Z0SA 3MA2B 5FLMH 4DV2Q 3RNUA 2NVYH 2JA7G 1D8LA 4CDCC 3LNNA 1E0BA 3RLOA 1BF4A 3NTKA 4XIGS 2JA9A 1E1OA 1DZ1A 2H4OA 4L8JA 5FJ8H 3ER0A 3J7YW 1QUQA 4EVOA 1Y1VH 4XQNA 4RKLA 4ZQ3A 1I94Q 1S72A 4L5TA 1EL0A 4DK3C 4CJ1B 1TS4A 5KNCA 2AUJD 3HOYH 3A0JA 4I7AA 3HOVG 2OQKA 1L0WA 4NXNL 1EY4A 3PQIA 4DK0A 4H13C 2QEJC 3M4YA 1JB3A 2NTSA 3KK7A 2F3WA 3JAML 1W2BA 4MHEA 2YU9H 5CV8A 5IYBH 4H7BA 4L5QA 4DFAA 4RKBA 5I9OA 1U5KA 4G4KA 1PFNA 1STEA 2VQFL 4BY1B 4OIJA 4X3SA 1Q81C 4LF5Q 2B2UA 4CJ2C 4HSVA 3ZJYC 3H15A 1PTOF 1RD9D 1EY0A 3E3XA 4A3BB 1B3QA 1SE2A 1STBA 1STNA 4X3KA 5EBCA 4BBRH 5BN3A 1HZBA 2ZTCA 3HEJA 2KVMA 2XTIA 4IFDH 2VXWA 2N88A 4C3HH 3I8ZA 3S14B 3PIOA 1TT2A 1UE6A 2DY8A 4IJHA 2EOTA 4YWKA 5DAUA 4ZUJA 4LK1C 3UE1A 2E75C 1CKOA 1IYUA 3DEPA 2IX3A 4DXFA 3W1BA 4UP8A 3HKZE 4CHTB 2F0IA 2L5TA 2K6AA 4KHZA 1I6HH 1KNAA 3HOUB 1PLFA 1VMCA 4O1NA 4C1NI 5DNFA 4DV1Q 1VDZA 2Z4IA 4PMCA 4RCNA 1IXRA 1JWUD 3PO3G 3M9BA 1Q90A 3PMFA 1ESRA 3PUWA 4C2MH 1SYEA 4IALA 2JSOA 1H9SA 1HA6A 4TSSA 5JPMC 1LTTD 3BG3A 4YHHL 4JI6Q 1KLGD 1XTDA 4KKUA 2PYKA 4GOPB 3NBHB 4O2DA 3S1RB 1VQ9A 2NVXH 1WJJA 4JK1C 4B3ML 4KI0A 1Y69U 1JJGA 1BCPF 1ET6A 3H94A 4JYAL 1OO9B 1NBWA 4X6AH 2KOLA 1A6XA 1U4RA 3URYA 3KF8B 4LFAQ 4JI0Q 4XT1B 3I4OA 1PYSB 1A3TA 3S24A 4DV4Q 4Y52H 2L9HA 4GLXA 4JV5L 5IWAL 2Q8RE 4QGUA 4YY3Q 1MD2D 1F9PA 5CV7A 5LL6X 1Z47A 3CF5A 1XPOA 5EGTA 1VF5C 4IQZA 1T9HA 1JORA 3I4NG 3QR8A 1XXGA 1CA6A 1KAAA 4JI3Q 1GHJA 2KCNA 5A2QL 1CKNB 2O5IC 1K0RA 1CQFA 5JPNC 3BZDB 5AJ3L 3Q23A 1C8CA 1E24A 5IYCG 3NE5B 4BXXG 4OWWB 4C3JB 3U4VA 4OWTB 5M3MG 3HOXB 3DHQA 3VYTA 1X3PA 1KIXA 3FKIH 1M8AA 5FLXE 3FPUB 4RGOS 1HCZA 2D2CC 5IP7G 1F2YA 2KHIA 1WD0A 1PH6A 2K4KA 2AQ3B 1LTID 1B2TA 1BO0A 3TSSA 4A3FH 3PO2H 1O80A 4OGQC 4LF7L 2MUYA 1X3EA 3H3VC 5M5YH 3NXWA 3STBD 4DA2A 4IUQA 1V1PB 4FXGC 4POFA 3EBEA 5GQOA 1UWVA 3S1NH 5IP9H 1DD2A 1UEBA 1SNPA 4FO2A 1ICFB 1TWGH 5FLXc 1Q86C 1A3VA 1HFNA 4RCOA 1HQMC 3SE0A 4BBSB 1BBUA 3A5UA 5ELCA 2ASBA 1Y14B 1EY6A 1A2TA 3V96A 1IBLL 4KTAA 1NR2A 2IX0A 5BN5A 2B3GA 3F2BA 3JAMi 1VQNA 3NHHA 3A7AB 5HGTA 4P75A 5J22A 1XJVA 1MJCA 1OTCA 3W3AA 1X65A 4H02A 4CGYB 5I6WA 1CFMA 3HRZC 3NSWA 4JI7L 4IUVA 4JC0A 2MQHA 3C1EA 1HRJA 1JB7A 2ZJPA 4A3LG 2PI2A 3CCJA 3HS0C 1JJ2A 4NXNQ 5C5LA 5D14A 1I6VC 3MHBA 1SYCA 1EUJA 3K0XA 2MPMA 3S1MH 2NYZD 3AEVA 1WOCA 2QW7A 4JI2L 1ENFA 4TQUS 1RJTA 2BE5D 3KLWA 2R93B 1PRTD 3PO3H 2CVRA 5M3FG 2ZXPA 2F0TA 2R7ZH 2B2UC 1KXLA 1S5FD 1GM5A 5EBDA 2F0VA 4N9PA 1ZKOA 5C3EB 2KEDA 2K5WA 2SDFA 3MAQA 4A3JG 4ZKBB 4PMWA 3BYYB 3TN2A 3HFZB 2RSOA 3PV0A 1HNZL 1Q82C 3KF6A 2K75A 1JOQA 1RF2D 4IOAA 5EPLA 3NQIA 4ZAIA 4WFN3 1SXTA 2WKDA 2E8GA 4QIWB 1KD1C 1EY8A 2DY7A 3EROA 1TWCB 1FL0A 1KNEA 1WCMB 2F0NA 1TWAB 1LTBD 2K7VA 3K57A 3OTOL 2E2HH 2WP8J 3EQLC 3HKSA 3CCUA 2IPKD 4GKJL 2RCNA 3FVQA 2MNAA 1B8AA 4L5SA 4DR4L 3VA5A 3FMCA 1EU3A 2L4NA 3RZOB 2WB1G 2B63H 3TZUA 3CXCA 2R92H 5C0XI 4YHHQ 4B3SL 5GADC 3C3LA 1YITA 3S15B 1G8ZD 1QVFA 3HOZB 2LFNA 1LTAD 1K83H 2EYOA 2MHVA 4B3MQ 1VMPA 3PIO3 1IBML 4JYAQ 2RQXA 5CR3A 2G9DA 4DPGA 4L63B 2BA0A 1PTOH 1R4PB 1QUQB 5IYCH 1KLUD 2AQ2B 4GS3A 5JAVA 1S5BD 2ZM6L 2IJ0A 4POGA 4IZ8A 2NN6I 1TY2A 4BS9A 1M1KC 1VQ5A 5IWAQ 2Q8TA 2NVQH 3LGJA 3MWYW 4QMGA 3CC4A 3RR5A 1ASYA 1JC7A 1GUWA 2B2YA 3ZYYX 3I2ZA 1O7YA 3SK8A 2JA8H 3KDFA 1B4OA 1BOSA 4C1NK 5C4XH 2GA4B 3KJOA 3G48A 4FXKC 5AJ3Q
chains in the Genus database with same CATH topology
5I9PA 5IODA 2A6ED 5E3FA 3OIPA 4RGTA 3A8KE 2WV6D 3ITPA 1H9MA 3R93A 4A3DB 5IGEA 5CORA 3L7ZC 5C0XG 1YNJD 1WTPA 1SDFA 4EQNA 1G91A 3G6JB 4EGVA 1PTOD 2F0UA 1Y1VB 4ULLA 3E6ZX 1DXMA 4RGMA 1GUNA 3CHBD 2EZVA 3RUZA 3KBXA 1HTPA 3K5LA 1QNKA 4WRDA 3TP8A 3KF8A 2A5HA 4BWGB 1D1IA 1JWMD 3IL8A 1WTXA 1H9SB 2NN6G 1JICA 1QWYA 1PMRA 1BUVT 2EY2A 2YU9B 4R8IA 4U68A 4QUFA 4PV1C 1HUNA 1B50A 1EIHA 4DAYA 5T1IA 1NUCA 1C4QA 3FDTA 4BBRB 1JR0D 2L12A 2F4IA 4FP5D 1UEAB 4UDUC 2L0CA 2FMCA 1SE3A 5KYLA 3ERQA 1I6HB 1QCBD 3E0JA 2BE5C 3O13A 1PRTC 1G2TA 1VCIA 3I4LA 1IKMA 1FNVA 4F8MA 4C2MB 3R3OA 2M9VA 1IYVA 1DONA 1LT3D 4F87A 2MJ8A 4OL7A 1EYAA 2FMMA 3BDLA 2RKSA 2LMCB 2Z8LA 3X3NA 3A55A 5FO7B 5CBEE 2NWGA 1ILQA 1F9QA 3MXUA 2Y0SB 1NR4A 2IWHA 5CV6A 3Q0AA 1G2SA 4H44C 1BNZA 1XTCD 3QOLA 1E2VA 2RSNA 4V0BA 1GUSA 2F03A 3QO2A 5KIXA 5D3IB 2KECA 4KJNA 2NTTA 4B9WA 4C56C 5CGKA 1QILA 3IAYA 2K05A 5C4HA 3FKIB 5M9OA 2B2YC 4LJZC 2BOSA 2J7ZA 2ZXOA 5JEAH 4A3FB 3PO2B 5IOCA 1LO5D 2HUGA 2PW5A 4IFDJ 5M5YB 2EYLA 4PNYA 1ZXTA 4KY5A 5I2XA 1PRTB 2A6EC 3S1NB 4IUNA 1DM0B 3SK4A 2NN6H 5FO9B 4ODGA 2EYHA 1W6KA 1OXXK 1GOZA 1QJOA 3MFGA 4ZK9B 4OO1G 1WD1A 3SVMA 1YNJC 1EWCA 4YIJA 5FO8B 2BCOA 1IL8A 1FYCA 1PTOC 3T56B 4G7HC 3MXPA 1BQQT 1JOOA 1NSNS 3I90A 4K2KA 1ZYRC 1T5EA 3D6WA 5IT9E 3BDCA 1S5DD 4HCSA 1A3UA 1KDBA 3NP8A 4K5WA 5FKAC 1G291 1MI2A 4IUTA 2F0DA 3IKJA 2XIWA 1U4PA 3PUYA 4HAEA 3S1MB 2F0HA 1E2WA 1Z6HA 5A2QE 2F0JA 2EY6A 1DYQA 3QOJA 1C48A 2CHBD 5EKIA 2F0SA 4ZUIA 2R7ZB 1HQRD 4DK1A 3J7AF 2X69A 3HKZB 4XYOA 1BCPC 3NUCA 3I72A 1EZ8A 3CKIB 1AZQA 3LWUA 3KUPA 1GUOA 4X3UA 3AB9A 2V4DA 2A69D 1EIGA 1CHPD 4K5VA 1LTSD 1DOLA 2EVBA 2DNEA 2KEEA 3T53B 2AUKA 1PZID 2XRQD 2B63B 3NWTA 1SEBD 3KLSA 3HG9A 2WACA 1K83B 3BDOA 2VNUD 2A74C 1EY5A 1ML0D 5ELBA 2QF7A 2L1BA 4RWSC 1PTOB 2QDBA 1STYA 2IT1A 2K33A 2XN9C 4U673 4A3EB 4ZYSA 4PQXA 5D3DA 2H1EA 1ET9A 2XWBB 3V05A 4EQPA 1FNUA 1CA5A 4RFBA 3DUZA 2TSSA 2EJFC 1MGSA 1HTLD 4FF1A 2JA8B 1EEFD 5C4XB 1STAA 3Q22A 4S3SA 2B8GA 5KEEA 3U9OA 2SNMA 5JOBA 3EJIA 1R9TB 1I3QB 2K32A 2JEBI 2ENBA 1V1OA 4Z9CB 4RHRA 2PCFB 3L9AX 5C44B 4H0LC 1KABA 4XQJA 3BVMA 1PFMA 1BCPB 3TZDA 1JOKA 4LAAA 4A3MB 4GZYC 1DJRD 1F2ZA 1RODA 4XT3B 1RTNA 3K5OA 1Z7TA 4XDXA 2FJ2A 1I4XA 4DNTB 1WTWA 4BY7B 1K8OA 5ISRA 1EOTA 4FF3A 2BA1A 3S17B 1SNDA 4ILWA 2IW3A 4WJWA 5NUCA 1H9JA 4P2CB 5CV9A 1I4HA 2XSCA 1ONLA 2HQEA 2O5JC 5CBAE 2A73B 3M85A 2RDHA 3MFYA 3VR6A 3CRKC 1CZWA 1D2BA 3H0GB 1DOKA 5FK9C 1G6ZA 3DM1A 3K0YA 4KY6A 1JE4A 2WKCA 2QILA 1F2LA 3NPPA 3GQBA 4XXEA 1FR3A 3GTGB 2VB2X 3D31A 4C3JG 1W6JA 4NDXA 3BVZA 2OEOA 4ID6A 1RDPD 1AZPA 2HCCA 3K58A 1DOMA 1Q1BA 3E5SA 2C9OA 5JVH3 2ID0A 1A15A 5J39A 4HEDA 5M5XB 2EJGC 5DEHA 4K2LA 2K1BA 3MVVA 5E1FA 3D4RA 2L55A 2Z4HA 4KKTA 2A69C 5F2DA 3K5MA 4I7ZC 4FF2A 2PMZB 3HP3A 1ILPA 1MBYA 3VR4A 2NVTB 4NKLA 3PIP3 1Y1WB 4RH6A 4FF4A 2E2IB 1TY0A 4C3IB 1HHVA 5KGUA 2NZ1D 3X3MA 1OXUA 5CMDA 2LKVA 3I4MB 3H91A 1GJXA 1I4PA 4ME5A 3PUZA 4PMBA 2JE6I 2VUMB 1STHA 3D8GA 1EEID 4IN3A 3HZXA 2E74C 2CW0D 4OHJA 5IIFA 2LS01 4QB4A 1LTRD 1CI3M 4KY7A 3T16A 3C1FA 1Y8PB 4KMUC 1GXDC 4F88A 3NWSA 1SE4A 1QG7A 3MZ5A 1H9KA 4QCLA 2NVYB 4IUUA 4IUPA 1IHZA 1UUPA 3MXNA 2JYOA 4CKCA 2JA6B 4K14A 1ZYRD 3SHLA 3BVGA 3OWFA 3K7AB 3HGBA 4KJOA 1TU2B 4K8IA 3HOYB 3IFTA 5K36G 1PFBA 4KN7C 1FNWA 1Q12A 1FGBD 3OPOA 2F0MA 4DU9A 5IGGA 3NTHA 1F9SA 1Q8IA 1SNOA 2LY7A 5EPKA 3GV3A 3M7GA 3GTMB 3C46A 4WORA 1I4GA 5AFWA 4RHSA 2OXPA 1D5ZC 3OMGA 5EQ0A 1M4VA 1BCPD 1CHQD 4IFDI 4C3HB 3OIQA 1U9RA 5JVG3 4LMQD 1IW7D 2IL8A 2RA4A 3K5NA 1K8MA 3OMCA 2WINB 2FHTA 3W2DA 3Q6SA 2KHSA 3IFDA 3VR3A 3ONAB 1RCVD 2CQAA 2PZUA 1CM9A 1TS3A 4K5XA 4KKSA 2A68D 4XYQA 3TP5A 2NVXB 4UAIA 3EFXD 4HMIA 3T13A 3S2DB 4R8NA 3J81L 2JA5B 2F0EA 3A54A 2E2JB 1HPCA 3VR2A 4KK7A 2RVLA 3OOCA 1DCZA 3GD7A 3S2HB 3MEHA 3JAME 4OO1I 1EWHA 2X6LA 5EKLA 2KQ3A 4IFDG 2EPBA 1LACA 1OXTA 2F3VA 2EY5A 4NW2A 1KDAA 4N9TA 3J80L 1KTKA 1AN8A 2PQEA 2VB3X 2N55A 1NCVA 2PNRC 2XVSA 4AYBB 1BR9A 3VYSA 2HDMA 2F0PA 5BN4A 2JA7B 1TWHB 5C0XH 5FOBB 5KRUA 4DGZA 2CW0C 3QG1A 1SAPA 2J4XA 1SMYD 1PYWD 5HURA 1SYBA 2EY1A 4KN4C 3PUVA 4Q0FA 2OT2A 3OW7A 3HOVB 2EYJA 1S4ZA 3OSOA 3DWPA 1XX8A 3H09A 1TWGB 1D1KA 2SOBA 1JQYD 1U4MA 4O42A 1SNQA 1SYFA 3SK6A 3CRLC 4X3TA 4Y7NB 1EFID 3A56A 1SSOA 3GV6A 3KLSX 2PW7A 2L11A 3A8IE 5G3LF 1B53A 1X32A 4G7ZC 2TMPA 4ZKCB 1ZEQX 1TVXA 1AEXA 4DF7A 2B2VA 5C5MA 5JJZA 1EY7A 1HUMA 2EJMA 2AWOA 1GUGA 2ZXRA 3OWEB 4JBWA 2PO4A 4MN3A 3PO3B 2R3ZA 1V43A 4DAVA 3CQZB 2EDGA 1UNSA 1SJHD 3I73A 5IGCA 3MTSA 1TWFB 5ELFA 4TRDA 1IW7C 1H9RA 2O2LD 1PZKD 4NMZA 2DN8A 3OHXC 2F0GA 4HMJA 3SR1A 2ZT9C 2E2HB 1CZGA 3GTLB 1S5ED 3TDQA 4HTHA 4G57A 2NB0A 4K6LA 2DNCA 1Q1EA 4BA1I 3VYRA 1RTOA 2EXZA 2R92B 5E4WC 1V8QA 3MC0B 1EZ6A 1E2ZA 2A68C 1YNND 3D4DA 5I4DA 3I4NB 3QJYA 4FVMA 3VR5A 3EVQA 2A6HD 5DM63 3NQTA 1MSHA 2B39A 4FNFA 5M3MB 3LWEA 1F2MA 1BDOA 1IKLA 2NVQB 3F2UA 2I46A 3GTKB 1ICWA 3NTIA 1S5CD 4BA2I 3WDNA 4G7OC 3SDZA 5IGBA 2B2TA 1O78A 3QB3A 1D5MC 1O7ZA 4I65A 4L6TB 1TQOA 4ZRZA 4XQQA 3C2PA 3DXJC 4CJ0B 3DWAA 1EYDA 3V2TA 5IT9L 1SFOB 4E6IA 3EA6A 4OO1H 5D65A 5COYA 4ZLTF 2XNAC 1OXSC 3SEBA 3D4WA 1R4QB 1SMYC 3M4OB 1PZJD 3MXGA 1RKNA 4KD3A 1STGA 4DXGA 2KCCA 3WOFA 2EE1A 4HN7A 5EPJA 2I07B 2F1MA 4KHVA 1F77A 2BDNA 4EQOA 4KD4A 5LL6S 4RGNA 2KA7A 1I4QA 5C4ZA 1QE6A 1LTGD 5M3FB 2K5DA 4DAPA 4K6DA 5E4XA 4A3JB 3P7JA 2F0OA 2PZTA 1XWEA 4F7XA 5IGDA 2K5QA 5KYIA 1VF7A 1B3AA 1LABA 2B2VC 1SYDA 1TR5A 2F0LA 1ENCA 2D5DA 3J7AV 5LHY1 3K6OA 3GTPB 3DWQA 4RA8A 2WB1B 1TKWB 1HFGA 3A8JE 2F0WA 2PZWA 3M7NA 3K59A 1B44D 3VYUA 2RBMA 1ENAA 5C3XA 5T1GA 4RAUC 3R2IA 1MSGA 2D9UA 2SNSA 2F0QA 4CBVA 2G9HD 1II3A 2QKIC 1EQVA 3QWNA 1KDCA 1SJED 5J1ZA 1U4LA 4DN4M 1A2UA 4J6HA 3RLFA 1BXTA 3FEWX 5EKKA 3G7LA 2AQ1B 2BDOA 3TP6A 1YNNC 1CT1D 3GTJB 3L3OC 3I91A 1FD7D 2SEBD 4HCEA 3AU7A 1EYCA 1UAPA 2A6HC 2C5CA 3DMUA 3BYTB 4QF4A 5KNDA 5CV5A 1JCKB 5K5PA 3AMUA 5FLXL 2D62A 1AP0A 3GTOB 1QNUA 1LT6D 2K01A 5G3LD 5CC4A 2YYZA 2B2TC 4CKEA 4HSPA 1QOHA 2JEAI 1L0YB 1ESFA 2RDFA 3UI2A 5CV4A 3D6CA 1O7LA 1EQTA 3QIAA 4KV6A 1B1ZA 2JXMB 1B9MA 3J81E 5M5WB 2R61A 5I2YA 1J9OA 3ND8A 2B2WA 2FFKB 3RZDB 4M8AA 2KJXA 2OF1A 5DM73 4C3IG 2E2DC 3U9SA 2MP1A 3RMHA 3S9WA 3NBIA 1T5XD 1CK1A 1AFPA 2M2LA 3P1HA 3S1QB 4R9WA 3J80E 4CKBA 2K03A 1OXVA 1X3QA 4B9XA 1SNMA 3BS1A 4J8QA 3H6MA 1QB5D 5C4JB 1WTOA 3NBHA 5JEAG 3GO5A 3RD4A 2M00A 3D3RA 4A93B 4XTCS 2MGSA 5IGFA 2WIIB 1D5XC 3KBGA 2NBFA 4QUCA 2HDLA 3N6RA 3SXHA 2FINB 3A7LA 1WVLA 1WTVA 2Z1CA 5C6AA 1WTRA 1L0XB 3LX0A 3GTQB 1NAPA 1WTQA 2O4XA 5C0XJ 2K04A 1HXYD 3CU7A 3P20A 5JEAJ 1CQVA 2ICIA 4DNRB 3R2TA 4OIKA 2RDGA 3S16B 1XYIA 2K28A 2QCPX 3I70A 3NK9A 1GHKA 3FRPB 2Q8IB 2EYPA 4J1MA 4K8JA 3N52A 1V1PA 3VA7A 1I50B 1BBXC 3PUXA 1RHPA 4FYDA 5ELEA 1Q3LA 1EY9A 1LT4D 1Y8NB 5KNBA 4V190 1PXUA 3KLRA 2AWNA 4C3HG 1LT5D 1SBBB 5A35A 2XWJB 1HA5A 1LLRD 3TBIB 4Q5VA 3SK5A 1CTMA 3ND9A 1Y8OB 2IX1A 1SYGA 2EYFA 3S15B 5I6YA 1I4RA 2KUMA 2XRSD 4HR7B 2WAQB 3HOWB 4A3GB 3FPPA 3I3CA 1PRTF 1D6EC 1SNCA 2HCIA 1B9NA 1LV9A 4NP5A 1J8IA 5TSSA 2R6GA 3R8BA 2EYMA 2X6GA 1AW7A 4M1UB 4B08A 5K36H 4IURA 2J0TD 2PPBC 3T51B 2B2WC 2B8FA 5C3WA 1TIID 2ICEC 3GP7A 1TS2A 3M3YB 2JP1A 4FXDA 4TKOB 1JWSD 2E76C 3T4AC 1PDQA 5EJWA 4A3IB 2F0FA 3WOEA 3TMEA 5ELDA 1EU4A 2F0KA 1GUTA 1F9RA 2NUCA 3Q24A 4A3KB 5CYUA 4ABNA 3P75A 3TP7A 1TS5A 4MIUA 3DEOA 3MA2B 3LNNA 1E0BA 1BF4A 3NTKA 4XIGS 1DZ1A 2H4OA 4L8JA 3J7YW 4EVOA 4XQNA 4RKLA 4ZQ3A 1EL0A 4CJ1B 1TS4A 5KNCA 2AUJD 1EY4A 4DK0A 4H13C 2QEJC 3M4YA 1JB3A 2NTSA 3KK7A 2F3WA 3JAML 4MHEA 5CV8A 4H7BA 4DFAA 4RKBA 5I9OA 4G4KA 1PFNA 1STEA 4BY1B 4OIJA 4X3SA 2B2UA 4CJ2C 4HSVA 1PTOF 1RD9D 1EY0A 4A3BB 1SE2A 1STBA 1STNA 4X3KA 5EBCA 5BN3A 3HEJA 2KVMA 4IFDH 2VXWA 2N88A 3S14B 3I8ZA 1TT2A 2DY8A 2EOTA 5DAUA 4ZUJA 4LK1C 2E75C 1IYUA 3DEPA 2IX3A 4DXFA 4CHTB 2F0IA 2L5TA 2K6AA 4KHZA 1KNAA 3HOUB 1PLFA 1VMCA 4O1NA 4C1NI 5DNFA 1VDZA 2Z4IA 4PMCA 4RCNA 1JWUD 1Q90A 3PMFA 1ESRA 3PUWA 1SYEA 4IALA 2JSOA 1H9SA 1HA6A 4TSSA 5JPMC 1LTTD 3BG3A 1KLGD 4KKUA 2PYKA 3S1RB 4JK1C 4KI0A 1Y69U 1BCPF 1ET6A 3H94A 1OO9B 2KOLA 1A6XA 1U4RA 3URYA 4XT1B 1A3TA 2L9HA 2Q8RE 1MD2D 1F9PA 5CV7A 5LL6X 1Z47A 5EGTA 1VF5C 4IQZA 1JORA 1XXGA 1CA6A 1KAAA 1GHJA 2KCNA 5A2QL 2O5IC 1CQFA 5JPNC 3BZDB 3Q23A 1C8CA 3NE5B 4C3JB 3HOXB 3DHQA 3VYTA 1X3PA 1M8AA 5FLXE 3FPUB 4RGOS 1HCZA 2D2CC 1F2YA 1WD0A 2AQ3B 1LTID 1B2TA 1BO0A 3TSSA 1O80A 4OGQC 2MUYA 3H3VC 3NXWA 4DA2A 4IUQA 1V1PB 4FXGC 1DD2A 1SNPA 4FO2A 1A3VA 1HFNA 4RCOA 1HQMC 3SE0A 4BBSB 5ELCA 1EY6A 1A2TA 3V96A 4KTAA 1NR2A 2IX0A 5BN5A 3NHHA 3A7AB 5HGTA 5J22A 3W3AA 4CGYB 5I6WA 1CFMA 3HRZC 3NSWA 4IUVA 3C1EA 1HRJA 3HS0C 5C5LA 5D14A 1I6VC 1SYCA 3MHBA 2MPMA 2NYZD 1ENFA 4TQUS 1RJTA 2BE5D 2R93B 1PRTD 2CVRA 2ZXPA 2F0TA 2B2UC 1S5FD 5EBDA 2F0VA 4N9PA 1ZKOA 5C3EB 2KEDA 2K5WA 2SDFA 3MAQA 4ZKBB 4PMWA 3BYYB 3TN2A 2RSOA 3PV0A 1JOQA 1RF2D 5EPLA 3NQIA 4ZAIA 4WFN3 1SXTA 2WKDA 4QIWB 1EY8A 2DY7A 3EROA 1TWCB 1KNEA 1WCMB 2F0NA 1TWAB 1LTBD 2K7VA 3K57A 2WP8J 3EQLC 2IPKD 3FVQA 3VA5A 3FMCA 1EU3A 2L4NA 3RZOB 3TZUA 5C0XI 3C3LA 1G8ZD 3HOZB 2LFNA 1LTAD 2EYOA 2MHVA 1VMPA 3PIO3 2RQXA 5CR3A 2G9DA 4L63B 2BA0A 1PTOH 1R4PB 1KLUD 2AQ2B 5JAVA 1S5BD 2IJ0A 4IZ8A 2NN6I 1TY2A 4BS9A 2Q8TA 3MWYW 4QMGA 1JC7A 1GUWA 2B2YA 3ZYYX 1O7YA 3SK8A 1B4OA 1BOSA 4C1NK 2GA4B 4FXKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HN7 A;  2JSO A;  2RQX A; 
#chains in the Genus database with same CATH topology
 5I9P A;  1X9N A;  1PV4 A;  5IOD A;  2A6E D;  4P72 A;  4JI1 L;  1VQ6 A;  4L5R C;  1I3Q H;  5E3F A;  3OIP A;  4RGT A;  3A8K E;  2WV6 D;  3ITP A;  1H9M A;  3R93 A;  4A3D B;  1VQ8 A;  5C44 H;  5IGE A;  3J81 c;  1SFO H;  5COR A;  3L7Z C;  5C0X G;  1YNJ D;  1WTP A;  1VQO A;  1SDF A;  4EQN A;  1G91 A;  3G6J B;  4EGV A;  1PTO D;  2F0U A;  1Y1V B;  4ULL A;  3E6Z X;  1DXM A;  4RGM A;  3STB C;  1GUN A;  2K52 A;  3CHB D;  2EZV A;  3RUZ A;  3KBX A;  1HTP A;  3K5L A;  4BY7 H;  1QNK A;  4WRD A;  3TP8 A;  5BR8 L;  3KF8 A;  2A5H A;  4BWG B;  4DV3 L;  1KAW A;  1D1I A;  4P71 A;  3S17 H;  1JWM D;  3IL8 A;  3E0E A;  1WTX A;  1H9S B;  2NN6 G;  3J80 c;  1JIC A;  3ERS X;  4HJ7 A;  4A4I A;  1QWY A;  1PMR A;  1BUV T;  2EY2 A;  2CWP A;  2YU9 B;  4R8I A;  4U68 A;  4QUF A;  4PV1 C;  1ASZ A;  1WTH A;  4GN3 B;  1HUN A;  4DV5 L;  1B50 A;  4R4I A;  3UDI A;  1EIH A;  1X55 A;  4DAY A;  1NTG A;  2JQO A;  3E9H A;  5T1I A;  5J3B A;  1NUC A;  4PZ6 A;  1C4Q A;  4JI7 Q;  1SRU A;  3FDT A;  3H0G H;  4BBR B;  1JR0 D;  1PYB A;  2L12 A;  4X62 L;  2F4I A;  4FP5 D;  1UEA B;  4UDU C;  2L0C A;  1YJW A;  1B70 B;  2FMC A;  1SE3 A;  5KYL A;  3ERQ A;  1I6H B;  4JI2 Q;  1YHB A;  3GTG H;  1QCB D;  4DR5 L;  3E0J A;  2BE5 C;  3O13 A;  1PRT C;  1G2T A;  1VCI A;  1RL2 A;  3I4L A;  1IKM A;  1FNV A;  4F8M A;  4R4Q A;  4C2M B;  4A93 G;  3R3O A;  2M9V A;  1IYV A;  2UXC L;  1LT3 D;  1DON A;  4F87 A;  2MJ8 A;  4OL7 A;  2OCE A;  2DGY A;  5M5X H;  1EYA A;  2FMM A;  3BDL A;  1LUZ A;  2CQO A;  1HNZ Q;  1EOV A;  2RKS A;  2LMC B;  2R7F A;  2Z8L A;  3X3N A;  5LMN W;  3A55 A;  5FO7 B;  2UXB L;  5CBE E;  4LUV A;  2NWG A;  1ILQ A;  2VQE L;  1F9Q A;  4OX9 L;  1Q46 A;  3OTO Q;  3MXU A;  4GKJ Q;  2Y0S B;  1NR4 A;  2IWH A;  1VQG A;  4DR4 Q;  5CV6 A;  3Q0A A;  3ULJ A;  1G2S A;  1N33 L;  4H44 C;  1BNZ A;  2YV5 A;  1XTC D;  1VQA A;  4B3S Q;  2NVT H;  3L2P A;  3QOL A;  1Y1W H;  1GKH A;  1E2V A;  2RSN A;  4V0B A;  1GUS A;  2I5L X;  2E2I H;  2F03 A;  3QO2 A;  5KIX A;  5D3I B;  3CCE A;  4HJ9 A;  2KEC A;  4KJN A;  1I5F A;  1PH4 A;  1HH2 P;  2NTT A;  4OON A;  4B9W A;  4C56 C;  2ZM6 Q;  1NNX A;  5CGK A;  3KYH C;  1QIL A;  3IAY A;  2K05 A;  5C4H A;  3FKI B;  5M9O A;  2B2Y C;  2Q2I A;  4LJZ C;  2BOS A;  2VUM H;  2J7Z A;  2ZXO A;  5JEA H;  3F2C A;  4A3F B;  3PO2 B;  4LW1 A;  5IOC A;  1LO5 D;  3NEM A;  2HUG A;  2PW5 A;  1XMO Q;  4IFD J;  5M5Y B;  2EYL A;  4PNY A;  1ZXT A;  4KY5 A;  5I2X A;  1IBK L;  1PRT B;  2A6E C;  4JI1 Q;  3S1N B;  4IUN A;  2B29 A;  2AMC B;  1DM0 B;  1HJP A;  3SK4 A;  2NN6 H;  5FO9 B;  4ODG A;  2EYH A;  1W6K A;  1PH1 A;  1OXX K;  2XGT A;  1GOZ A;  1QJO A;  3MFG A;  4ZK9 B;  4OO1 G;  1WD1 A;  3SVM A;  1YNJ C;  1EWC A;  4YIJ A;  3KF6 B;  5FO8 B;  2BCO A;  1IL8 A;  1FYC A;  1PTO C;  4YCV A;  3T56 B;  4G7H C;  3MXP A;  1BQQ T;  1JOO A;  1NSN S;  1M90 C;  1X54 A;  3I90 A;  4K2K A;  3RZD H;  1ZYR C;  2WAQ G;  3HOW G;  4A3G G;  1T5E A;  3D6W A;  5IT9 E;  1BVS A;  4LFB L;  3BDC A;  1S5D D;  5IE8 A;  4HCS A;  1A3U A;  1KDB A;  3NP8 A;  2N3S A;  4K5W A;  5FKA C;  2JA6 H;  5BR8 Q;  1EQR A;  1G29 1;  1MI2 A;  4DV3 Q;  4IUT A;  3K8A A;  4OEM B;  4TVA B;  2F0D A;  3IKJ A;  2XIW A;  1U4P A;  3K7A H;  3PUY A;  4IPD A;  4HAE A;  3S1M B;  2F0H A;  4CDD C;  1E2W A;  1Z6H A;  5A2Q E;  2F0J A;  5LMN L;  1HR0 W;  1VQ7 A;  1N32 Q;  4DV0 L;  2EY6 A;  1DYQ A;  3QOJ A;  1EIF A;  2OTJ A;  4DV5 Q;  1C48 A;  5IT9 c;  2CHB D;  5EKI A;  2F0S A;  4ZUI A;  4OEL B;  2R7Z B;  1HQR D;  4DK1 A;  3J7A F;  4A93 H;  2GVB A;  2X69 A;  3HKZ B;  2N78 A;  2KHJ A;  4UHV A;  4XYO A;  2ATW A;  4X62 Q;  1BCP C;  3NUC A;  3I72 A;  4RMF A;  1EZ8 A;  3GTM H;  3CKI B;  1AZQ A;  1S3O A;  2HIX A;  3LWU A;  3KUP A;  3W1G A;  4X66 L;  4IO9 A;  4A3I G;  1GUO A;  3CD6 A;  2ZTE A;  4X3U A;  3AB9 A;  4LF6 L;  2V4D A;  4LNQ A;  4DR5 Q;  3KDF B;  2A69 D;  1EIG A;  2C35 B;  4JI5 Q;  2RHS B;  1CHP D;  4A3K G;  4K5V A;  2Z6K A;  1LTS D;  1DOL A;  2EVB A;  2DNE A;  2KEE A;  1TXY A;  3J81 i;  3T53 B;  2UUA L;  2AUK A;  1GVP A;  2K14 A;  3A5Z B;  4DUZ L;  2UXC Q;  1PZI D;  2XRQ D;  2B63 B;  4LWC A;  1HZ9 A;  3NWT A;  4DR1 L;  1SEB D;  3KLS A;  3HG9 A;  2WAC A;  1PHJ A;  3S16 H;  1K83 B;  1DGS A;  3BDO A;  1HZC A;  4UP7 A;  2VNU D;  4NPS A;  2A74 C;  1EY5 A;  1ML0 D;  2UXB Q;  5ELB A;  2UXD L;  2QF7 A;  4LFC L;  3CCS A;  2L1B A;  4RWS C;  1K8G A;  2VQE Q;  4B3R L;  1PTO B;  2QDB A;  4OX9 Q;  1STY A;  2IT1 A;  2K33 A;  2XN9 C;  4U67 3;  4A3E B;  4ZYS A;  3J80 i;  3S2D H;  4PQX A;  1X3G A;  5D3D A;  2H1E A;  5JJL A;  4DR7 L;  3VDY A;  1ET9 A;  1N33 Q;  3CW2 C;  2JA5 H;  2XWB B;  3V05 A;  4EQP A;  2E2J H;  1FNU A;  3CCV A;  4RFB A;  3DUZ A;  1CA5 A;  2IY5 B;  2TSS A;  2EJF C;  4QQB X;  1MGS A;  1HTL D;  1I50 H;  4BY1 G;  2ES2 A;  4FF1 A;  2JA8 B;  1EEF D;  1YNX A;  5C4X B;  3S2H H;  1STA A;  3Q22 A;  4S3S A;  2B8G A;  4A3B G;  5KEE A;  3U9O A;  2SNM A;  3DM3 A;  1XPR A;  5JOB A;  4PZ8 A;  3EJI A;  4DAM A;  1R9T B;  1I3Q B;  2K32 A;  2JEB I;  2ENB A;  4DAY B;  1V1O A;  4Z9C B;  4RHR A;  2MO0 A;  2PCF B;  3L9A X;  5C44 B;  4A75 A;  4H0L C;  1KAB A;  3HOU G;  4XQJ A;  3BVM A;  1PFM A;  3K80 C;  1QZH A;  1BCP B;  3TZD A;  1HR0 L;  4AIM A;  1L2F A;  2BH2 A;  1EFW A;  1JOK A;  3S15 H;  4LAA A;  4A3M B;  2V1C C;  4GZY C;  1DJR D;  1F2Z A;  1GD7 A;  1ROD A;  3TRZ A;  4XT3 B;  2JA7 H;  1TWH H;  3UE0 A;  1RTN A;  2K5V A;  1MKH A;  3K5O A;  1Z7T A;  4XDX A;  1YHQ A;  2FJ2 A;  1I4X A;  3RLN A;  4DNT B;  1WTW A;  1N36 L;  1IBK Q;  1P16 A;  4BY7 B;  1K8O A;  5ISR A;  1EOT A;  4A3E G;  4FF3 A;  2BA1 A;  3S17 B;  1SND A;  4HJA A;  4LF8 L;  4ILW A;  2HQL A;  2IW3 A;  4WJW A;  4DUY L;  1G6P A;  5NUC A;  1C9O A;  1H9J A;  4P2C B;  1SR3 A;  4IPH A;  1MIU A;  5CV9 A;  3HOV H;  1I4H A;  4JI4 L;  2XSC A;  1ONL A;  2DUD A;  4NXM L;  2HQE A;  4R4C A;  5CBA E;  2O5J C;  2A73 B;  3M85 A;  2RDH A;  1PA6 A;  3IRB A;  5GAH C;  2DJF C;  3MFY A;  4LFB Q;  3VR6 A;  2F52 A;  1HNX L;  2G5D A;  3CRK C;  1CZW A;  1GO3 E;  1UE7 A;  1D2B A;  4Y7N H;  3H0G B;  4O0A A;  1DOK A;  5IYD G;  5FK9 C;  1G6Z A;  3DM1 A;  1MJE A;  3K0Y A;  4KY6 A;  1JE4 A;  4WJ4 A;  3GDE A;  1HZA A;  4A3I H;  2WKC A;  4P74 A;  2QIL A;  1F2L A;  5LMN Q;  3NPP A;  3GQB A;  4XXE A;  1K0S A;  1FR3 A;  3GTG B;  2VB2 X;  3D31 A;  4C3J G;  3JC6 6;  1W6J A;  4NDX A;  3BVZ A;  2OEO A;  1PH9 A;  2CH4 A;  4ID6 A;  3HOX G;  1VQD A;  1RDP D;  1AZP A;  2HCC A;  3K58 A;  1DOM A;  1Q1B A;  2KEN A;  3E5S A;  2C9O A;  4JCV E;  5JVH 3;  2ID0 A;  3PCO B;  1A15 A;  5J39 A;  2VQF Q;  4HED A;  5M5X B;  2EJG C;  5DEH A;  3AYH B;  3CQZ H;  4K2L A;  2K1B A;  1YZ6 A;  3MVV A;  5E1F A;  3D4R A;  2HD3 A;  1EYG A;  1L1O A;  4X66 Q;  1YJN A;  2L55 A;  2Z4H A;  4KKT A;  4LF6 Q;  2OWO A;  2A69 C;  5F2D A;  1TWF H;  2Z6K C;  2QA4 A;  3K5M A;  4I7Z C;  4DV6 L;  4JVZ A;  4FF2 A;  2UUA Q;  1PFS A;  3CP0 A;  2PMZ B;  3HP3 A;  4DUZ Q;  4B3T L;  1ILP A;  1V1Q A;  4BBS G;  1MBY A;  4DR1 Q;  3VR4 A;  4YWM A;  2NVT B;  4APV A;  3FHW A;  4NKL A;  3PIP 3;  4YCU A;  3GTL H;  1Y1W B;  2CFM A;  1UE5 A;  3CCR A;  5EAY A;  4RH6 A;  3AFP A;  4FF4 A;  2E2I B;  1TY0 A;  4C3I B;  2UXD Q;  2JK8 A;  1HHV A;  5KGU A;  2NZ1 D;  1O7I A;  3X3M A;  2JJQ A;  1OXU A;  1PH2 A;  5CMD A;  4N8F A;  2LKV A;  3I4N H;  2PMZ E;  3I4M B;  1YVC A;  3B6Y A;  3H91 A;  1GJX A;  1Q7Y C;  4DR7 Q;  1I4P A;  4ME5 A;  3PUZ A;  5LMU L;  2UUB L;  2YTX A;  4PMB A;  4BXX H;  2JE6 I;  2R93 G;  4DKA C;  2VUM B;  5M3M H;  1QVC A;  1SN8 A;  4JV5 Q;  3A74 A;  3T1Y L;  1STH A;  3D8G A;  4JI8 L;  5C3E G;  1EEI D;  3GTK H;  5IP7 H;  4IN3 A;  3HZX A;  2E74 C;  2CW0 D;  4OHJ A;  5IIF A;  4K0K L;  2LS0 1;  4QB4 A;  1LTR D;  1CI3 M;  4KY7 A;  1W3S A;  3T16 A;  3C1F A;  1Y8P B;  1WCM G;  1XPU A;  1HR0 Q;  2UUC L;  4KMU C;  1GXD C;  4F88 A;  3DLL A;  3NWS A;  1CUK A;  1SE4 A;  1QG7 A;  2UU9 L;  3MZ5 A;  1H9K A;  4QY7 A;  4QCL A;  2NVY B;  4IUU A;  4IUP A;  1IHZ A;  4LF4 L;  1UUP A;  4EX5 A;  5HY6 A;  3MXN A;  1JMC A;  4UY8 C;  1N36 Q;  2JYO A;  3HOZ G;  4CKC A;  2JA6 B;  5IYD H;  4K14 A;  4LF7 Q;  1ZYR D;  3SHL A;  3BVG A;  3OWF A;  3K7A B;  3M4O H;  3HGB A;  4R4T A;  4DUY Q;  4KJO A;  4MZ9 A;  2L15 A;  1TU2 B;  3NEN A;  4EQ5 A;  4K8I A;  3HOY B;  3IFT A;  4JI4 Q;  5K36 G;  4NXM Q;  4A3L H;  2KBN A;  1PFB A;  4KN7 C;  1FNW A;  4C3J H;  1Q12 A;  1FGB D;  3OPO A;  2F0M A;  1E1T A;  4DU9 A;  1HNX Q;  5IGG A;  3RN2 A;  1EIY B;  1IL2 A;  4DV2 L;  3NTH A;  4HJ8 A;  1F9S A;  1IBL Q;  1Q8I A;  1SNO A;  2LXJ A;  2LY7 A;  5EPK A;  1P8L A;  3GV3 A;  3M7G A;  5M3F H;  3NEL A;  3GTM B;  3C46 A;  4WOR A;  1I4G A;  2Z9H A;  1N9W A;  5AFW A;  4RHS A;  2OXP A;  4JW0 A;  4A3J H;  4DK6 C;  1H95 A;  1D5Z C;  3OMG A;  5EQ0 A;  1M4V A;  1BCP D;  1VQI A;  1CHQ D;  4IFD I;  4C3H B;  3OIQ A;  1U9R A;  5JVG 3;  4LMQ D;  1IW7 D;  4A3D G;  2IL8 A;  2RA4 A;  2WFW A;  3K5N A;  5FLM G;  2PQA A;  1K8M A;  3OMC A;  2WIN B;  2FHT A;  3W2D A;  1LTL A;  5FJ8 G;  3Q6S A;  2KHS A;  3IFD A;  1Y1V G;  3ONA B;  3VR3 A;  4A76 A;  3GTP H;  5H1S E;  1RCV D;  2D0P A;  2CQA A;  1L1O C;  3BZK A;  2PZU A;  5ELN A;  1CM9 A;  1TS3 A;  4K5X A;  2JN4 A;  4KKS A;  2A68 D;  4XYQ A;  3TP5 A;  2NVX B;  1NMF A;  4UAI A;  3EFX D;  4HMI A;  4DV6 Q;  3T13 A;  3S2D B;  3SGI A;  5L37 A;  4R8N A;  1NJI C;  2IHE A;  3J81 L;  2JA5 B;  2F0E A;  3A54 A;  2E2J B;  4DV1 L;  1HPC A;  2CWA A;  3BZC A;  3VR2 A;  2ALY B;  2R93 H;  4KK7 A;  2RVL A;  4JOI A;  3OOC A;  1DCZ A;  3GD7 A;  3S2H B;  3MEH A;  2QGQ A;  3JAM E;  4OO1 I;  2GVA A;  1EWH A;  2X6L A;  4ALP A;  4BBR G;  3PF5 A;  4DR6 L;  5EKL A;  1AE2 A;  2KQ3 A;  4IFD G;  3GTJ H;  2EPB A;  1IBM Q;  1LAC A;  1OXT A;  2F3V A;  3I55 A;  2EY5 A;  4NW2 A;  4HIM A;  1KDA A;  4N9T A;  3J80 L;  1KTK A;  1AN8 A;  2PQE A;  2VB3 X;  2N55 A;  2Q2T A;  1NCV A;  2PNR C;  2XVS A;  4QJF A;  4LFA L;  4AYB B;  1BR9 A;  3VYS A;  2HDM A;  1N34 L;  2F0P A;  3JAM c;  3T1Y Q;  4JI8 Q;  1A63 A;  5BN4 A;  2JA7 B;  1TWH B;  5C0X H;  3GTO H;  1E7Z A;  5FOB B;  5KRU A;  4DGZ A;  2CW0 C;  5IY0 A;  4K0K Q;  1A0I A;  1VQH A;  3QG1 A;  1SAP A;  2AHO B;  2J4X A;  1SMY D;  4JI3 L;  1PYW D;  3U4Z A;  1QVG A;  5HUR A;  1SYB A;  2EY1 A;  4YWL A;  4KN4 C;  3PUV A;  4Q0F A;  4DV7 L;  2OT2 A;  3OW7 A;  3HOV B;  2EYJ A;  2Q2H A;  4AYB E;  2UUC Q;  1S4Z A;  2WAQ E;  3OSO A;  2Y0S G;  3DWP A;  1XX8 A;  1L1O B;  3H09 A;  2UU9 Q;  3ICE A;  1TWG B;  1D1K A;  2SOB A;  1JQY D;  1U4M A;  4O42 A;  4LF4 Q;  1SNQ A;  1SYF A;  3SK6 A;  3CRL C;  5M5W H;  4X3T A;  4Y7N B;  1EFI D;  3A56 A;  1SSO A;  1BBW A;  3GV6 A;  2OQ0 A;  3I7F A;  2QDL A;  3KLS X;  2PW7 A;  3EN2 A;  4QL5 A;  2VZA A;  4MTK A;  2CH4 W;  2L11 A;  3A8I E;  5G3L F;  1B53 A;  2F4V L;  1X32 A;  3CC7 A;  1LM0 A;  4G7Z C;  2TMP A;  4ZKC B;  1ZEQ X;  1TVX A;  1AEX A;  2VL6 A;  4DF7 A;  2B2V A;  5C5M A;  5JJZ A;  3S1Q H;  1EY7 A;  1HUM A;  2EJM A;  3E9I A;  2AWO A;  2ZXR A;  1GUG A;  3FKI G;  3OWE B;  3J7Z C;  4JBW A;  2PO4 A;  4MN3 A;  5C4J H;  3PO3 B;  2R3Z A;  1V43 A;  4DAV A;  3CQZ B;  2HHH L;  4A3F G;  3PO2 G;  2EDG A;  1UNS A;  1SJH D;  3TS2 A;  3J81 j;  3I73 A;  5IGC A;  4GN5 A;  1RIP A;  3PIP A;  1JE5 A;  3MTS A;  3U50 C;  3KJP A;  5IP9 G;  1TWF B;  5ELF A;  1VQB A;  4TRD A;  1IW7 C;  1H9R A;  2O2L D;  1FVI A;  1PZK D;  2DN8 A;  4NMZ A;  3OHX C;  2F0G A;  3G4S A;  4HMJ A;  3SR1 A;  3GTQ H;  2ZT9 C;  2E2H B;  1CZG A;  3GTL B;  3Q8D A;  1S5E D;  3TDQ A;  4HTH A;  4G57 A;  4JBJ A;  2NB0 A;  4K6L A;  2DNC A;  1Q1E A;  4BA1 I;  3CPW A;  3PF4 A;  3VYR A;  4CDE C;  1RTO A;  2EXZ A;  2R92 B;  5E4W C;  1V8Q A;  3MC0 B;  5JJK A;  1EZ6 A;  1E2Z A;  2RF4 A;  2A68 C;  1YNN D;  3D4D A;  3M4P A;  5I4D A;  1VQF A;  3I4N B;  3QJY A;  4ZCK A;  4FVM A;  1YEZ A;  3VR5 A;  1IZ6 A;  3MXN B;  3EVQ A;  1J5E L;  2VS1 A;  1A62 A;  2A6H D;  5DM6 3;  5GAE C;  3NQT A;  2DJG C;  2VY3 A;  1NY4 A;  4JOI C;  1MSH A;  2B39 A;  4FNF A;  4CDF C;  5M3M B;  3LWE A;  2R7Z G;  1F2M A;  1BDO A;  1IKL A;  2Q2U A;  2NVQ B;  3F2U A;  3HKZ G;  2I46 A;  4HIO A;  3GTK B;  3U58 A;  1ICW A;  4DR6 Q;  1VQ4 A;  3RN5 A;  3NTI A;  1S5C D;  1FJG L;  4BA2 I;  4DNI A;  4FDB A;  3WDN A;  4G7O C;  3SDZ A;  5IGB A;  2EXD A;  2FXQ A;  2B2T A;  1O78 A;  4GNX A;  4X64 L;  3QB3 A;  1D5M C;  1O7Z A;  4I65 A;  4L6T B;  1TQO A;  1PH8 A;  4JBK A;  4ZRZ A;  4XQQ A;  4GLA C;  3C2P A;  2EQS A;  3DXJ C;  4CJ0 B;  4KLK A;  3DWA A;  1XNQ L;  1EYD A;  1N34 Q;  3T1H L;  3V2T A;  5IT9 L;  1SFO B;  4E6I A;  1X6O A;  3EA6 A;  2B63 G;  4OO1 H;  5D65 A;  5COY A;  4ZLT F;  2R92 G;  3KFU A;  2XNA C;  1OXS C;  3SEB A;  2LXK A;  3D4W A;  3HOW H;  4A3G H;  2PQA B;  1PH5 A;  1R4Q B;  1SMY C;  3M4O B;  2IHF A;  4DV7 Q;  1PZJ D;  1VS0 A;  3MXG A;  2HIV A;  1RKN A;  4KD3 A;  1STG A;  4DXG A;  2KCC A;  3WOF A;  4IPC A;  2A8V A;  2EE1 A;  4HN7 A;  4MTN A;  5EPJ A;  2I07 B;  4UPA A;  2F1M A;  4KHV A;  1F77 A;  2BDN A;  4EQO A;  5E7N A;  4KD4 A;  5LL6 S;  4RGN A;  2KA7 A;  4OWX B;  1YIJ A;  1I4Q A;  5C4Z A;  1HNW L;  1QE6 A;  2JA8 G;  1LTG D;  5M3F B;  2K5D A;  1C7Y A;  5C4X G;  4AQY L;  4DAP A;  4DR3 L;  4LUZ A;  1X3F A;  4K6D A;  5E4X A;  3M3Y H;  4R1J A;  2F4V Q;  1KHI A;  4A3J B;  3P7J A;  1AH9 A;  2F0O A;  2PZT A;  1XWE A;  4F7X A;  5IGD A;  2K5Q A;  5KYI A;  1J6Q A;  2KCM A;  1VF7 A;  1WI5 A;  1B3A A;  1LAB A;  2B2V C;  2Z6B A;  1SYD A;  3M4Q A;  1TR5 A;  5C44 G;  4DV0 Q;  2F0L A;  2BH8 A;  1ENC A;  1K9M C;  4A3K H;  4JG2 A;  2D5D A;  1SRO A;  3J7A V;  1XNR L;  2HHH Q;  5LHY 1;  4A3M G;  3K6O A;  1VQP A;  3GTP B;  1KRT A;  3DWQ A;  4RA8 A;  2WB1 B;  4LF9 L;  1TKW B;  1HFG A;  3A8J E;  4A3C G;  2F0W A;  2MO1 A;  2PZW A;  3M7N A;  3K59 A;  4BY7 G;  2LSS A;  1B44 D;  1UE1 A;  1VQJ A;  4KHP L;  3VYU A;  2RBM A;  1JJC B;  4GKK L;  1ENA A;  3L0O A;  5C3X A;  1KC8 C;  1SLJ A;  5T1G A;  2ZTD A;  2ZJQ A;  4RAU C;  3R2I A;  4ME3 A;  2VW9 A;  1MSG A;  3F1Z A;  2AKW B;  2D9U A;  2SNS A;  4AH6 A;  2F0Q A;  4CBV A;  2G9H D;  1MHW C;  1II3 A;  2QKI C;  3EIV A;  1EQV A;  3QWN A;  3UDF A;  1KDC A;  1YBY A;  1SJE D;  5J1Z A;  2WB1 E;  1U4L A;  1QZG A;  4DN4 M;  1VQM A;  1KQS A;  1A2U A;  4J6H A;  3RLF A;  1BXT A;  3FEW X;  5EKK A;  4WJ3 M;  3G7L A;  2AQ1 B;  3H0G G;  2BDO A;  4BY1 H;  3TP6 A;  3CCM A;  1YNN C;  3H3V I;  1CT1 D;  1BKB A;  5JJI A;  3GTJ B;  3F8T A;  3L3O C;  3I91 A;  3TS0 A;  1FD7 D;  2SEB D;  4A3B H;  4LFC Q;  4HCE A;  3AU7 A;  4B3R Q;  1EYC A;  1J5E Q;  4NB3 A;  1NMG A;  2I5H A;  1UAP A;  2QEX A;  2A6H C;  2C5C A;  3DMU A;  3S14 H;  3BYT B;  4QF4 A;  1JT8 A;  5KND A;  5CV5 A;  1JCK B;  2RHQ B;  4YCW A;  5K5P A;  3AMU A;  2EIF A;  5FLX L;  3HOU H;  2D62 A;  1AP0 A;  3GTO B;  2F3I A;  1QNU A;  1FJG Q;  1LT6 D;  2NZO A;  2K01 A;  4N8X 1;  5G3L D;  2K50 A;  5CC4 A;  2YYZ A;  2B2T C;  4CKE A;  4QIW E;  3AFQ A;  4HSP A;  4GNX C;  4X64 Q;  3G6E A;  1QOH A;  3OW2 A;  2JEA I;  2E5L L;  2PNH A;  3S1R H;  1L0Y B;  1CSP A;  4A3E H;  1ESF A;  2RDF A;  3UI2 A;  4DR2 L;  1XNQ Q;  1FGU A;  3D6C A;  5CV4 A;  3T1H Q;  1O7L A;  1EQT A;  3QIA A;  3W5O A;  3ULP A;  3G71 A;  4KV6 A;  4RG1 A;  1B1Z A;  2JXM B;  1X56 A;  4UP9 A;  1B9M A;  1EWI A;  2R7D A;  3J81 E;  1VQE A;  5M5W B;  1Y1W G;  2R61 A;  4LUO A;  5I2Y A;  1J9O A;  3ND8 A;  2HT1 A;  2B2W A;  2FFK B;  3RZD B;  3CPF A;  4M8A A;  2KJX A;  2OF1 A;  4X65 L;  2P5Z X;  5DM7 3;  2E2D C;  4C3I G;  3U9S A;  2N8N A;  4JPB W;  1XMO L;  2MP1 A;  3RMH A;  3S9W A;  1B7Y B;  3NBI A;  2CKZ B;  1T5X D;  3TQY A;  1CK1 A;  1R9T H;  3I4M G;  1U0L A;  1AFP A;  3AQQ A;  2M2L A;  4LF8 Q;  1PH7 A;  1WYD A;  3P1H A;  3S1Q B;  1XMQ L;  4R9W A;  3J80 E;  4CKB A;  2K03 A;  1OXV A;  3BJU A;  1X3Q A;  1SNM A;  4P73 A;  4B9X A;  1K73 C;  1YHA A;  3BS1 A;  4J8Q A;  4HJ5 A;  1HNW Q;  3H6M A;  2VUM G;  1QB5 D;  5C4J B;  3D0F A;  3HOX H;  1LYL A;  1WTO A;  4GOP A;  3NBH A;  4A3M H;  4AQY Q;  4DR3 Q;  5JEA G;  3GO5 A;  1D7Q A;  3RD4 A;  2M00 A;  3D3R A;  4A93 B;  4XTC S;  4A3C H;  2MFI A;  2MGS A;  5IGF A;  2WII B;  1D5X C;  3KBG A;  3CC2 A;  2NBF A;  4QUC A;  2HDL A;  3N6R A;  3SXH A;  1I94 L;  2FIN B;  3A7L A;  1WVL A;  2I5M X;  1WTV A;  2Z1C A;  5C6A A;  1N32 L;  4PG3 A;  2CCZ A;  1WTR A;  1CKM A;  1L0X B;  3LX0 A;  3ULL A;  3GTQ B;  1NAP A;  1XNR Q;  1WTQ A;  2O4X A;  5C0X J;  2K04 A;  4OXP A;  4GNX B;  1HXY D;  3CU7 A;  3P20 A;  4BBS H;  4LF9 Q;  5JEA J;  1CKN A;  1N8R C;  1CQV A;  4J15 A;  5DLQ E;  2ICI A;  4DNR B;  1YI2 A;  3R2T A;  4HIK A;  2JA6 G;  2K5H A;  2YTY A;  4OIK A;  2RDG A;  4KHP Q;  2A19 A;  3CME A;  1CSQ A;  3S16 B;  4LF5 L;  4GKK Q;  1XYI A;  2K28 A;  2QCP X;  2A1A A;  3I70 A;  3NK9 A;  1GHK A;  2NZH A;  4GLV B;  3HOY G;  5GRO A;  3FRP B;  1IYJ B;  2Q8I B;  2K5N A;  1K28 A;  3UDX A;  3K81 C;  4JI5 L;  3J7A 5;  2EYP A;  3TEH B;  1S40 A;  3MEF A;  1E22 A;  1K8A C;  4B3T Q;  4J1M A;  4IPG A;  4K8J A;  3N52 A;  1V1P A;  5IYB G;  3VA7 A;  2H5X A;  1I50 B;  1BBX C;  3PUX A;  1RHP A;  4FYD A;  3KOJ A;  5ELE A;  4HID A;  1Q3L A;  4IJL A;  1EY9 A;  5C3E H;  1PH3 A;  2KCT A;  1K3R A;  2N49 A;  1LT4 D;  1Y8N B;  5KNB A;  4V19 0;  1PXU A;  4JI6 L;  3KLR A;  3I56 A;  2ZJR A;  2AWN A;  4C3H G;  1LT5 D;  1SBB B;  5A35 A;  2D0O A;  1KL9 A;  2XWJ B;  1HA5 A;  1LLR D;  3TBI B;  1A8V A;  1E3P A;  4Q5V A;  3SK5 A;  1CTM A;  1TWC H;  5LMU Q;  2UUB Q;  3ND9 A;  1Y8O B;  1WCM H;  2IX1 A;  1TWA H;  1SYG A;  3CCQ A;  4JI0 L;  3PSI A;  3H3V H;  2EYF A;  1V9P A;  1NE3 A;  1VQC A;  4IOC A;  5I6Y A;  2YTV A;  1I4R A;  2KUM A;  2XRS D;  4HR7 B;  2WAQ B;  4DV4 L;  1EQQ A;  3HOW B;  4A3G B;  3RZO H;  1WFQ A;  3F2D A;  3FPP A;  4C3I H;  3I3C A;  4YY3 L;  1PRT F;  1D6E C;  3UDG A;  1SE8 A;  1SNC A;  2HCI A;  1B9N A;  1LV9 A;  4NP5 A;  1J8I A;  5TSS A;  4GN4 B;  2E5L Q;  3HOZ H;  2R6G A;  2Y0S E;  3I4M H;  1Z9F A;  3R8B A;  4DR2 Q;  5GAG C;  2EYM A;  4JBM A;  1Q8K A;  2X6G A;  4R4O A;  5HGQ A;  1AW7 A;  1PVO A;  1VQK A;  1KRS A;  3K7U C;  4M1U B;  4B08 A;  1K3B C;  2JA5 G;  1VQL A;  1AE3 A;  5K36 H;  4IUR A;  2J0T D;  2PPB C;  3T51 B;  2B2W C;  2B8F A;  3WWV A;  5C3W A;  1TII D;  2RCF A;  4X65 Q;  2ICE C;  3GP7 A;  1TS2 A;  3M3Y B;  3BU2 A;  2JP1 A;  2GN5 A;  4FXD A;  4TKO B;  1JWS D;  2E76 C;  3T4A C;  1PDQ A;  5EJW A;  1XMQ Q;  3CMA A;  3OYY A;  3PGZ A;  4A3I B;  3CAM A;  3CCL A;  2F0F A;  2PI2 E;  3FP9 A;  3WOE A;  3TME A;  5ELD A;  1EU4 A;  2F0K A;  1GUT A;  3TRE A;  1SMX A;  1C0A A;  1F9R A;  2NUC A;  3Q24 A;  1YJ9 A;  5ELO A;  4A3K B;  5CYU A;  4MNO A;  4ABN A;  1G51 A;  4AYB G;  4GOP C;  4A3D H;  3P75 A;  2OTL A;  4PZ7 A;  3TP7 A;  1TS5 A;  4MIU A;  3DEO A;  2I0Q A;  2Z0S A;  3MA2 B;  5FLM H;  4DV2 Q;  3RNU A;  2NVY H;  2JA7 G;  1D8L A;  4CDC C;  3LNN A;  1E0B A;  3RLO A;  1BF4 A;  3NTK A;  4XIG S;  2JA9 A;  1E1O A;  1DZ1 A;  2H4O A;  4L8J A;  5FJ8 H;  3ER0 A;  3J7Y W;  1QUQ A;  4EVO A;  1Y1V H;  4XQN A;  4RKL A;  4ZQ3 A;  1I94 Q;  1S72 A;  4L5T A;  1EL0 A;  4DK3 C;  4CJ1 B;  1TS4 A;  5KNC A;  2AUJ D;  3HOY H;  3A0J A;  4I7A A;  3HOV G;  2OQK A;  1L0W A;  4NXN L;  1EY4 A;  3PQI A;  4DK0 A;  4H13 C;  2QEJ C;  3M4Y A;  1JB3 A;  2NTS A;  3KK7 A;  2F3W A;  3JAM L;  1W2B A;  4MHE A;  2YU9 H;  5CV8 A;  5IYB H;  4H7B A;  4L5Q A;  4DFA A;  4RKB A;  5I9O A;  1U5K A;  4G4K A;  1PFN A;  1STE A;  2VQF L;  4BY1 B;  4OIJ A;  4X3S A;  1Q81 C;  4LF5 Q;  2B2U A;  4CJ2 C;  4HSV A;  3ZJY C;  3H15 A;  1PTO F;  1RD9 D;  1EY0 A;  3E3X A;  4A3B B;  1B3Q A;  1SE2 A;  1STB A;  1STN A;  4X3K A;  5EBC A;  4BBR H;  5BN3 A;  1HZB A;  2ZTC A;  3HEJ A;  2KVM A;  2XTI A;  4IFD H;  2VXW A;  2N88 A;  4C3H H;  3I8Z A;  3S14 B;  3PIO A;  1TT2 A;  1UE6 A;  2DY8 A;  4IJH A;  2EOT A;  4YWK A;  5DAU A;  4ZUJ A;  4LK1 C;  3UE1 A;  2E75 C;  1CKO A;  1IYU A;  3DEP A;  2IX3 A;  4DXF A;  3W1B A;  4UP8 A;  3HKZ E;  4CHT B;  2F0I A;  2L5T A;  2K6A A;  4KHZ A;  1I6H H;  1KNA A;  3HOU B;  1PLF A;  1VMC A;  4O1N A;  4C1N I;  5DNF A;  4DV1 Q;  1VDZ A;  2Z4I A;  4PMC A;  4RCN A;  1IXR A;  1JWU D;  3PO3 G;  3M9B A;  1Q90 A;  3PMF A;  1ESR A;  3PUW A;  4C2M H;  1SYE A;  4IAL A;  2JSO A;  1H9S A;  1HA6 A;  4TSS A;  5JPM C;  1LTT D;  3BG3 A;  4YHH L;  4JI6 Q;  1KLG D;  1XTD A;  4KKU A;  2PYK A;  4GOP B;  3NBH B;  4O2D A;  3S1R B;  1VQ9 A;  2NVX H;  1WJJ A;  4JK1 C;  4B3M L;  4KI0 A;  1Y69 U;  1JJG A;  1BCP F;  1ET6 A;  3H94 A;  4JYA L;  1OO9 B;  1NBW A;  4X6A H;  2KOL A;  1A6X A;  1U4R A;  3URY A;  3KF8 B;  4LFA Q;  4JI0 Q;  4XT1 B;  3I4O A;  1PYS B;  1A3T A;  3S24 A;  4DV4 Q;  4Y52 H;  2L9H A;  4GLX A;  4JV5 L;  5IWA L;  2Q8R E;  4QGU A;  4YY3 Q;  1MD2 D;  1F9P A;  5CV7 A;  5LL6 X;  1Z47 A;  3CF5 A;  1XPO A;  5EGT A;  1VF5 C;  4IQZ A;  1T9H A;  1JOR A;  3I4N G;  3QR8 A;  1XXG A;  1CA6 A;  1KAA A;  4JI3 Q;  1GHJ A;  2KCN A;  5A2Q L;  1CKN B;  2O5I C;  1K0R A;  1CQF A;  5JPN C;  3BZD B;  5AJ3 L;  3Q23 A;  1C8C A;  1E24 A;  5IYC G;  3NE5 B;  4BXX G;  4OWW B;  4C3J B;  3U4V A;  4OWT B;  5M3M G;  3HOX B;  3DHQ A;  3VYT A;  1X3P A;  1KIX A;  3FKI H;  1M8A A;  5FLX E;  3FPU B;  4RGO S;  1HCZ A;  2D2C C;  5IP7 G;  1F2Y A;  2KHI A;  1WD0 A;  1PH6 A;  2K4K A;  2AQ3 B;  1LTI D;  1B2T A;  1BO0 A;  3TSS A;  4A3F H;  3PO2 H;  1O80 A;  4OGQ C;  4LF7 L;  2MUY A;  1X3E A;  3H3V C;  5M5Y H;  3NXW A;  3STB D;  4DA2 A;  4IUQ A;  1V1P B;  4FXG C;  4POF A;  3EBE A;  5GQO A;  1UWV A;  3S1N H;  5IP9 H;  1DD2 A;  1UEB A;  1SNP A;  4FO2 A;  1ICF B;  1TWG H;  5FLX c;  1Q86 C;  1A3V A;  1HFN A;  4RCO A;  1HQM C;  3SE0 A;  4BBS B;  1BBU A;  3A5U A;  5ELC A;  2ASB A;  1Y14 B;  1EY6 A;  1A2T A;  3V96 A;  1IBL L;  4KTA A;  1NR2 A;  2IX0 A;  5BN5 A;  2B3G A;  3F2B A;  3JAM i;  1VQN A;  3NHH A;  3A7A B;  5HGT A;  4P75 A;  5J22 A;  1XJV A;  1MJC A;  1OTC A;  3W3A A;  1X65 A;  4H02 A;  4CGY B;  5I6W A;  1CFM A;  3HRZ C;  3NSW A;  4JI7 L;  4IUV A;  4JC0 A;  2MQH A;  3C1E A;  1HRJ A;  1JB7 A;  2ZJP A;  4A3L G;  2PI2 A;  3CCJ A;  3HS0 C;  1JJ2 A;  4NXN Q;  5C5L A;  5D14 A;  1I6V C;  3MHB A;  1SYC A;  1EUJ A;  3K0X A;  2MPM A;  3S1M H;  2NYZ D;  3AEV A;  1WOC A;  2QW7 A;  4JI2 L;  1ENF A;  4TQU S;  1RJT A;  2BE5 D;  3KLW A;  2R93 B;  1PRT D;  3PO3 H;  2CVR A;  5M3F G;  2ZXP A;  2F0T A;  2R7Z H;  2B2U C;  1KXL A;  1S5F D;  1GM5 A;  5EBD A;  2F0V A;  4N9P A;  1ZKO A;  5C3E B;  2KED A;  2K5W A;  2SDF A;  3MAQ A;  4A3J G;  4ZKB B;  4PMW A;  3BYY B;  3TN2 A;  3HFZ B;  2RSO A;  3PV0 A;  1HNZ L;  1Q82 C;  3KF6 A;  2K75 A;  1JOQ A;  1RF2 D;  4IOA A;  5EPL A;  3NQI A;  4ZAI A;  4WFN 3;  1SXT A;  2WKD A;  2E8G A;  4QIW B;  1KD1 C;  1EY8 A;  2DY7 A;  3ERO A;  1TWC B;  1FL0 A;  1KNE A;  1WCM B;  2F0N A;  1TWA B;  1LTB D;  2K7V A;  3K57 A;  3OTO L;  2E2H H;  2WP8 J;  3EQL C;  3HKS A;  3CCU A;  2IPK D;  4GKJ L;  2RCN A;  3FVQ A;  2MNA A;  1B8A A;  4L5S A;  4DR4 L;  3VA5 A;  3FMC A;  1EU3 A;  2L4N A;  3RZO B;  2WB1 G;  2B63 H;  3TZU A;  3CXC A;  2R92 H;  5C0X I;  4YHH Q;  4B3S L;  5GAD C;  3C3L A;  1YIT A;  3S15 B;  1G8Z D;  1QVF A;  3HOZ B;  2LFN A;  1LTA D;  1K83 H;  2EYO A;  2MHV A;  4B3M Q;  1VMP A;  3PIO 3;  1IBM L;  4JYA Q;  2RQX A;  5CR3 A;  2G9D A;  4DPG A;  4L63 B;  2BA0 A;  1PTO H;  1R4P B;  1QUQ B;  5IYC H;  1KLU D;  2AQ2 B;  4GS3 A;  5JAV A;  1S5B D;  2ZM6 L;  2IJ0 A;  4POG A;  4IZ8 A;  2NN6 I;  1TY2 A;  4BS9 A;  1M1K C;  1VQ5 A;  5IWA Q;  2Q8T A;  2NVQ H;  3LGJ A;  3MWY W;  4QMG A;  3CC4 A;  3RR5 A;  1ASY A;  1JC7 A;  1GUW A;  2B2Y A;  3ZYY X;  3I2Z A;  1O7Y A;  3SK8 A;  2JA8 H;  3KDF A;  1B4O A;  1BOS A;  4C1N K;  5C4X H;  2GA4 B;  3KJO A;  3G48 A;  4FXK C;  5AJ3 Q; 
#chains in the Genus database with same CATH homology
 5I9P A;  5IOD A;  2A6E D;  5E3F A;  3OIP A;  4RGT A;  3A8K E;  2WV6 D;  3ITP A;  1H9M A;  3R93 A;  4A3D B;  5IGE A;  5COR A;  3L7Z C;  5C0X G;  1YNJ D;  1WTP A;  1SDF A;  4EQN A;  1G91 A;  3G6J B;  4EGV A;  1PTO D;  2F0U A;  1Y1V B;  4ULL A;  3E6Z X;  1DXM A;  4RGM A;  1GUN A;  3CHB D;  2EZV A;  3RUZ A;  3KBX A;  1HTP A;  3K5L A;  1QNK A;  4WRD A;  3TP8 A;  3KF8 A;  2A5H A;  4BWG B;  1D1I A;  1JWM D;  3IL8 A;  1WTX A;  1H9S B;  2NN6 G;  1JIC A;  1QWY A;  1PMR A;  1BUV T;  2EY2 A;  2YU9 B;  4R8I A;  4U68 A;  4QUF A;  4PV1 C;  1HUN A;  1B50 A;  1EIH A;  4DAY A;  5T1I A;  1NUC A;  1C4Q A;  3FDT A;  4BBR B;  1JR0 D;  2L12 A;  2F4I A;  4FP5 D;  1UEA B;  4UDU C;  2L0C A;  2FMC A;  1SE3 A;  5KYL A;  3ERQ A;  1I6H B;  1QCB D;  3E0J A;  2BE5 C;  3O13 A;  1PRT C;  1G2T A;  1VCI A;  3I4L A;  1IKM A;  1FNV A;  4F8M A;  4C2M B;  3R3O A;  2M9V A;  1IYV A;  1DON A;  1LT3 D;  4F87 A;  2MJ8 A;  4OL7 A;  1EYA A;  2FMM A;  3BDL A;  2RKS A;  2LMC B;  2Z8L A;  3X3N A;  3A55 A;  5FO7 B;  5CBE E;  2NWG A;  1ILQ A;  1F9Q A;  3MXU A;  2Y0S B;  1NR4 A;  2IWH A;  5CV6 A;  3Q0A A;  1G2S A;  4H44 C;  1BNZ A;  1XTC D;  3QOL A;  1E2V A;  2RSN A;  4V0B A;  1GUS A;  2F03 A;  3QO2 A;  5KIX A;  5D3I B;  2KEC A;  4KJN A;  2NTT A;  4B9W A;  4C56 C;  5CGK A;  1QIL A;  3IAY A;  2K05 A;  5C4H A;  3FKI B;  5M9O A;  2B2Y C;  4LJZ C;  2BOS A;  2J7Z A;  2ZXO A;  5JEA H;  4A3F B;  3PO2 B;  5IOC A;  1LO5 D;  2HUG A;  2PW5 A;  4IFD J;  5M5Y B;  2EYL A;  4PNY A;  1ZXT A;  4KY5 A;  5I2X A;  1PRT B;  2A6E C;  3S1N B;  4IUN A;  1DM0 B;  3SK4 A;  2NN6 H;  5FO9 B;  4ODG A;  2EYH A;  1W6K A;  1OXX K;  1GOZ A;  1QJO A;  3MFG A;  4ZK9 B;  4OO1 G;  1WD1 A;  3SVM A;  1YNJ C;  1EWC A;  4YIJ A;  5FO8 B;  2BCO A;  1IL8 A;  1FYC A;  1PTO C;  3T56 B;  4G7H C;  3MXP A;  1BQQ T;  1JOO A;  1NSN S;  3I90 A;  4K2K A;  1ZYR C;  1T5E A;  3D6W A;  5IT9 E;  3BDC A;  1S5D D;  4HCS A;  1A3U A;  1KDB A;  3NP8 A;  4K5W A;  5FKA C;  1G29 1;  1MI2 A;  4IUT A;  2F0D A;  3IKJ A;  2XIW A;  1U4P A;  3PUY A;  4HAE A;  3S1M B;  2F0H A;  1E2W A;  1Z6H A;  5A2Q E;  2F0J A;  2EY6 A;  1DYQ A;  3QOJ A;  1C48 A;  2CHB D;  5EKI A;  2F0S A;  4ZUI A;  2R7Z B;  1HQR D;  4DK1 A;  3J7A F;  2X69 A;  3HKZ B;  4XYO A;  1BCP C;  3NUC A;  3I72 A;  1EZ8 A;  3CKI B;  1AZQ A;  3LWU A;  3KUP A;  1GUO A;  4X3U A;  3AB9 A;  2V4D A;  2A69 D;  1EIG A;  1CHP D;  4K5V A;  1LTS D;  1DOL A;  2EVB A;  2DNE A;  2KEE A;  3T53 B;  2AUK A;  1PZI D;  2XRQ D;  2B63 B;  3NWT A;  1SEB D;  3KLS A;  3HG9 A;  2WAC A;  1K83 B;  3BDO A;  2VNU D;  2A74 C;  1EY5 A;  1ML0 D;  5ELB A;  2QF7 A;  2L1B A;  4RWS C;  1PTO B;  2QDB A;  1STY A;  2IT1 A;  2K33 A;  2XN9 C;  4U67 3;  4A3E B;  4ZYS A;  4PQX A;  5D3D A;  2H1E A;  1ET9 A;  2XWB B;  3V05 A;  4EQP A;  1FNU A;  1CA5 A;  4RFB A;  3DUZ A;  2TSS A;  2EJF C;  1MGS A;  1HTL D;  4FF1 A;  2JA8 B;  1EEF D;  5C4X B;  1STA A;  3Q22 A;  4S3S A;  2B8G A;  5KEE A;  3U9O A;  2SNM A;  5JOB A;  3EJI A;  1R9T B;  1I3Q B;  2K32 A;  2JEB I;  2ENB A;  1V1O A;  4Z9C B;  4RHR A;  2PCF B;  3L9A X;  5C44 B;  4H0L C;  1KAB A;  4XQJ A;  3BVM A;  1PFM A;  1BCP B;  3TZD A;  1JOK A;  4LAA A;  4A3M B;  4GZY C;  1DJR D;  1F2Z A;  1ROD A;  4XT3 B;  1RTN A;  3K5O A;  1Z7T A;  4XDX A;  2FJ2 A;  1I4X A;  4DNT B;  1WTW A;  4BY7 B;  1K8O A;  5ISR A;  1EOT A;  4FF3 A;  2BA1 A;  3S17 B;  1SND A;  4ILW A;  2IW3 A;  4WJW A;  5NUC A;  1H9J A;  4P2C B;  5CV9 A;  1I4H A;  2XSC A;  1ONL A;  2HQE A;  2O5J C;  5CBA E;  2A73 B;  3M85 A;  2RDH A;  3MFY A;  3VR6 A;  3CRK C;  1CZW A;  1D2B A;  3H0G B;  1DOK A;  5FK9 C;  1G6Z A;  3DM1 A;  3K0Y A;  4KY6 A;  1JE4 A;  2WKC A;  2QIL A;  1F2L A;  3NPP A;  3GQB A;  4XXE A;  1FR3 A;  3GTG B;  2VB2 X;  3D31 A;  4C3J G;  1W6J A;  4NDX A;  3BVZ A;  2OEO A;  4ID6 A;  1RDP D;  1AZP A;  2HCC A;  3K58 A;  1DOM A;  1Q1B A;  3E5S A;  2C9O A;  5JVH 3;  2ID0 A;  1A15 A;  5J39 A;  4HED A;  5M5X B;  2EJG C;  5DEH A;  4K2L A;  2K1B A;  3MVV A;  5E1F A;  3D4R A;  2L55 A;  2Z4H A;  4KKT A;  2A69 C;  5F2D A;  3K5M A;  4I7Z C;  4FF2 A;  2PMZ B;  3HP3 A;  1ILP A;  1MBY A;  3VR4 A;  2NVT B;  4NKL A;  3PIP 3;  1Y1W B;  4RH6 A;  4FF4 A;  2E2I B;  1TY0 A;  4C3I B;  1HHV A;  5KGU A;  2NZ1 D;  3X3M A;  1OXU A;  5CMD A;  2LKV A;  3I4M B;  3H91 A;  1GJX A;  1I4P A;  4ME5 A;  3PUZ A;  4PMB A;  2JE6 I;  2VUM B;  1STH A;  3D8G A;  1EEI D;  4IN3 A;  3HZX A;  2E74 C;  2CW0 D;  4OHJ A;  5IIF A;  2LS0 1;  4QB4 A;  1LTR D;  1CI3 M;  4KY7 A;  3T16 A;  3C1F A;  1Y8P B;  4KMU C;  1GXD C;  4F88 A;  3NWS A;  1SE4 A;  1QG7 A;  3MZ5 A;  1H9K A;  4QCL A;  2NVY B;  4IUU A;  4IUP A;  1IHZ A;  1UUP A;  3MXN A;  2JYO A;  4CKC A;  2JA6 B;  4K14 A;  1ZYR D;  3SHL A;  3BVG A;  3OWF A;  3K7A B;  3HGB A;  4KJO A;  1TU2 B;  4K8I A;  3HOY B;  3IFT A;  5K36 G;  1PFB A;  4KN7 C;  1FNW A;  1Q12 A;  1FGB D;  3OPO A;  2F0M A;  4DU9 A;  5IGG A;  3NTH A;  1F9S A;  1Q8I A;  1SNO A;  2LY7 A;  5EPK A;  3GV3 A;  3M7G A;  3GTM B;  3C46 A;  4WOR A;  1I4G A;  5AFW A;  4RHS A;  2OXP A;  1D5Z C;  3OMG A;  5EQ0 A;  1M4V A;  1BCP D;  1CHQ D;  4IFD I;  4C3H B;  3OIQ A;  1U9R A;  5JVG 3;  4LMQ D;  1IW7 D;  2IL8 A;  2RA4 A;  3K5N A;  1K8M A;  3OMC A;  2WIN B;  2FHT A;  3W2D A;  3Q6S A;  2KHS A;  3IFD A;  3VR3 A;  3ONA B;  1RCV D;  2CQA A;  2PZU A;  1CM9 A;  1TS3 A;  4K5X A;  4KKS A;  2A68 D;  4XYQ A;  3TP5 A;  2NVX B;  4UAI A;  3EFX D;  4HMI A;  3T13 A;  3S2D B;  4R8N A;  3J81 L;  2JA5 B;  2F0E A;  3A54 A;  2E2J B;  1HPC A;  3VR2 A;  4KK7 A;  2RVL A;  3OOC A;  1DCZ A;  3GD7 A;  3S2H B;  3MEH A;  3JAM E;  4OO1 I;  1EWH A;  2X6L A;  5EKL A;  2KQ3 A;  4IFD G;  2EPB A;  1LAC A;  1OXT A;  2F3V A;  2EY5 A;  4NW2 A;  1KDA A;  4N9T A;  3J80 L;  1KTK A;  1AN8 A;  2PQE A;  2VB3 X;  2N55 A;  1NCV A;  2PNR C;  2XVS A;  4AYB B;  1BR9 A;  3VYS A;  2HDM A;  2F0P A;  5BN4 A;  2JA7 B;  1TWH B;  5C0X H;  5FOB B;  5KRU A;  4DGZ A;  2CW0 C;  3QG1 A;  1SAP A;  2J4X A;  1SMY D;  1PYW D;  5HUR A;  1SYB A;  2EY1 A;  4KN4 C;  3PUV A;  4Q0F A;  2OT2 A;  3OW7 A;  3HOV B;  2EYJ A;  1S4Z A;  3OSO A;  3DWP A;  1XX8 A;  3H09 A;  1TWG B;  1D1K A;  2SOB A;  1JQY D;  1U4M A;  4O42 A;  1SNQ A;  1SYF A;  3SK6 A;  3CRL C;  4X3T A;  4Y7N B;  1EFI D;  3A56 A;  1SSO A;  3GV6 A;  3KLS X;  2PW7 A;  2L11 A;  3A8I E;  5G3L F;  1B53 A;  1X32 A;  4G7Z C;  2TMP A;  4ZKC B;  1ZEQ X;  1TVX A;  1AEX A;  4DF7 A;  2B2V A;  5C5M A;  5JJZ A;  1EY7 A;  1HUM A;  2EJM A;  2AWO A;  1GUG A;  2ZXR A;  3OWE B;  4JBW A;  2PO4 A;  4MN3 A;  3PO3 B;  2R3Z A;  1V43 A;  4DAV A;  3CQZ B;  2EDG A;  1UNS A;  1SJH D;  3I73 A;  5IGC A;  3MTS A;  1TWF B;  5ELF A;  4TRD A;  1IW7 C;  1H9R A;  2O2L D;  1PZK D;  4NMZ A;  2DN8 A;  3OHX C;  2F0G A;  4HMJ A;  3SR1 A;  2ZT9 C;  2E2H B;  1CZG A;  3GTL B;  1S5E D;  3TDQ A;  4HTH A;  4G57 A;  2NB0 A;  4K6L A;  2DNC A;  1Q1E A;  4BA1 I;  3VYR A;  1RTO A;  2EXZ A;  2R92 B;  5E4W C;  1V8Q A;  3MC0 B;  1EZ6 A;  1E2Z A;  2A68 C;  1YNN D;  3D4D A;  5I4D A;  3I4N B;  3QJY A;  4FVM A;  3VR5 A;  3EVQ A;  2A6H D;  5DM6 3;  3NQT A;  1MSH A;  2B39 A;  4FNF A;  5M3M B;  3LWE A;  1F2M A;  1BDO A;  1IKL A;  2NVQ B;  3F2U A;  2I46 A;  3GTK B;  1ICW A;  3NTI A;  1S5C D;  4BA2 I;  3WDN A;  4G7O C;  3SDZ A;  5IGB A;  2B2T A;  1O78 A;  3QB3 A;  1D5M C;  1O7Z A;  4I65 A;  4L6T B;  1TQO A;  4ZRZ A;  4XQQ A;  3C2P A;  3DXJ C;  4CJ0 B;  3DWA A;  1EYD A;  3V2T A;  5IT9 L;  1SFO B;  4E6I A;  3EA6 A;  4OO1 H;  5D65 A;  5COY A;  4ZLT F;  2XNA C;  1OXS C;  3SEB A;  3D4W A;  1R4Q B;  1SMY C;  3M4O B;  1PZJ D;  3MXG A;  1RKN A;  4KD3 A;  1STG A;  4DXG A;  2KCC A;  3WOF A;  2EE1 A;  4HN7 A;  5EPJ A;  2I07 B;  2F1M A;  4KHV A;  1F77 A;  2BDN A;  4EQO A;  4KD4 A;  5LL6 S;  4RGN A;  2KA7 A;  1I4Q A;  5C4Z A;  1QE6 A;  1LTG D;  5M3F B;  2K5D A;  4DAP A;  4K6D A;  5E4X A;  4A3J B;  3P7J A;  2F0O A;  2PZT A;  1XWE A;  4F7X A;  5IGD A;  2K5Q A;  5KYI A;  1VF7 A;  1B3A A;  1LAB A;  2B2V C;  1SYD A;  1TR5 A;  2F0L A;  1ENC A;  2D5D A;  3J7A V;  5LHY 1;  3K6O A;  3GTP B;  3DWQ A;  4RA8 A;  2WB1 B;  1TKW B;  1HFG A;  3A8J E;  2F0W A;  2PZW A;  3M7N A;  3K59 A;  1B44 D;  3VYU A;  2RBM A;  1ENA A;  5C3X A;  5T1G A;  4RAU C;  3R2I A;  1MSG A;  2D9U A;  2SNS A;  2F0Q A;  4CBV A;  2G9H D;  1II3 A;  2QKI C;  1EQV A;  3QWN A;  1KDC A;  1SJE D;  5J1Z A;  1U4L A;  4DN4 M;  1A2U A;  4J6H A;  3RLF A;  1BXT A;  3FEW X;  5EKK A;  3G7L A;  2AQ1 B;  2BDO A;  3TP6 A;  1YNN C;  1CT1 D;  3GTJ B;  3L3O C;  3I91 A;  1FD7 D;  2SEB D;  4HCE A;  3AU7 A;  1EYC A;  1UAP A;  2A6H C;  2C5C A;  3DMU A;  3BYT B;  4QF4 A;  5KND A;  5CV5 A;  1JCK B;  5K5P A;  3AMU A;  5FLX L;  2D62 A;  1AP0 A;  3GTO B;  1QNU A;  1LT6 D;  2K01 A;  5G3L D;  5CC4 A;  2YYZ A;  2B2T C;  4CKE A;  4HSP A;  1QOH A;  2JEA I;  1L0Y B;  1ESF A;  2RDF A;  3UI2 A;  5CV4 A;  3D6C A;  1O7L A;  1EQT A;  3QIA A;  4KV6 A;  1B1Z A;  2JXM B;  1B9M A;  3J81 E;  5M5W B;  2R61 A;  5I2Y A;  1J9O A;  3ND8 A;  2B2W A;  2FFK B;  3RZD B;  4M8A A;  2KJX A;  2OF1 A;  5DM7 3;  4C3I G;  2E2D C;  3U9S A;  2MP1 A;  3RMH A;  3S9W A;  3NBI A;  1T5X D;  1CK1 A;  1AFP A;  2M2L A;  3P1H A;  3S1Q B;  4R9W A;  3J80 E;  4CKB A;  2K03 A;  1OXV A;  1X3Q A;  4B9X A;  1SNM A;  3BS1 A;  4J8Q A;  3H6M A;  1QB5 D;  5C4J B;  1WTO A;  3NBH A;  5JEA G;  3GO5 A;  3RD4 A;  2M00 A;  3D3R A;  4A93 B;  4XTC S;  2MGS A;  5IGF A;  2WII B;  1D5X C;  3KBG A;  2NBF A;  4QUC A;  2HDL A;  3N6R A;  3SXH A;  2FIN B;  3A7L A;  1WVL A;  1WTV A;  2Z1C A;  5C6A A;  1WTR A;  1L0X B;  3LX0 A;  3GTQ B;  1NAP A;  1WTQ A;  2O4X A;  5C0X J;  2K04 A;  1HXY D;  3CU7 A;  3P20 A;  5JEA J;  1CQV A;  2ICI A;  4DNR B;  3R2T A;  4OIK A;  2RDG A;  3S16 B;  1XYI A;  2K28 A;  2QCP X;  3I70 A;  3NK9 A;  1GHK A;  3FRP B;  2Q8I B;  2EYP A;  4J1M A;  4K8J A;  3N52 A;  1V1P A;  3VA7 A;  1I50 B;  1BBX C;  3PUX A;  1RHP A;  4FYD A;  5ELE A;  1Q3L A;  1EY9 A;  1LT4 D;  1Y8N B;  5KNB A;  4V19 0;  1PXU A;  3KLR A;  2AWN A;  4C3H G;  1LT5 D;  1SBB B;  5A35 A;  2XWJ B;  1HA5 A;  1LLR D;  3TBI B;  4Q5V A;  3SK5 A;  1CTM A;  3ND9 A;  1Y8O B;  2IX1 A;  1SYG A;  2EYF A;  3S15 B;  5I6Y A;  1I4R A;  2KUM A;  2XRS D;  4HR7 B;  2WAQ B;  3HOW B;  4A3G B;  3FPP A;  3I3C A;  1PRT F;  1D6E C;  1SNC A;  2HCI A;  1B9N A;  1LV9 A;  4NP5 A;  1J8I A;  5TSS A;  2R6G A;  3R8B A;  2EYM A;  2X6G A;  1AW7 A;  4M1U B;  4B08 A;  5K36 H;  4IUR A;  2J0T D;  2PPB C;  3T51 B;  2B2W C;  2B8F A;  5C3W A;  1TII D;  2ICE C;  3GP7 A;  1TS2 A;  3M3Y B;  2JP1 A;  4FXD A;  4TKO B;  1JWS D;  2E76 C;  3T4A C;  1PDQ A;  5EJW A;  4A3I B;  2F0F A;  3WOE A;  3TME A;  5ELD A;  1EU4 A;  2F0K A;  1GUT A;  1F9R A;  2NUC A;  3Q24 A;  4A3K B;  5CYU A;  4ABN A;  3P75 A;  3TP7 A;  1TS5 A;  4MIU A;  3DEO A;  3MA2 B;  3LNN A;  1E0B A;  1BF4 A;  3NTK A;  4XIG S;  1DZ1 A;  2H4O A;  4L8J A;  3J7Y W;  4EVO A;  4XQN A;  4RKL A;  4ZQ3 A;  1EL0 A;  4CJ1 B;  1TS4 A;  5KNC A;  2AUJ D;  1EY4 A;  4DK0 A;  4H13 C;  2QEJ C;  3M4Y A;  1JB3 A;  2NTS A;  3KK7 A;  2F3W A;  3JAM L;  4MHE A;  5CV8 A;  4H7B A;  4DFA A;  4RKB A;  5I9O A;  4G4K A;  1PFN A;  1STE A;  4BY1 B;  4OIJ A;  4X3S A;  2B2U A;  4CJ2 C;  4HSV A;  1PTO F;  1RD9 D;  1EY0 A;  4A3B B;  1SE2 A;  1STB A;  1STN A;  4X3K A;  5EBC A;  5BN3 A;  3HEJ A;  2KVM A;  4IFD H;  2VXW A;  2N88 A;  3S14 B;  3I8Z A;  1TT2 A;  2DY8 A;  2EOT A;  5DAU A;  4ZUJ A;  4LK1 C;  2E75 C;  1IYU A;  3DEP A;  2IX3 A;  4DXF A;  4CHT B;  2F0I A;  2L5T A;  2K6A A;  4KHZ A;  1KNA A;  3HOU B;  1PLF A;  1VMC A;  4O1N A;  4C1N I;  5DNF A;  1VDZ A;  2Z4I A;  4PMC A;  4RCN A;  1JWU D;  1Q90 A;  3PMF A;  1ESR A;  3PUW A;  1SYE A;  4IAL A;  2JSO A;  1H9S A;  1HA6 A;  4TSS A;  5JPM C;  1LTT D;  3BG3 A;  1KLG D;  4KKU A;  2PYK A;  3S1R B;  4JK1 C;  4KI0 A;  1Y69 U;  1BCP F;  1ET6 A;  3H94 A;  1OO9 B;  2KOL A;  1A6X A;  1U4R A;  3URY A;  4XT1 B;  1A3T A;  2L9H A;  2Q8R E;  1MD2 D;  1F9P A;  5CV7 A;  5LL6 X;  1Z47 A;  5EGT A;  1VF5 C;  4IQZ A;  1JOR A;  1XXG A;  1CA6 A;  1KAA A;  1GHJ A;  2KCN A;  5A2Q L;  2O5I C;  1CQF A;  5JPN C;  3BZD B;  3Q23 A;  1C8C A;  3NE5 B;  4C3J B;  3HOX B;  3DHQ A;  3VYT A;  1X3P A;  1M8A A;  5FLX E;  3FPU B;  4RGO S;  1HCZ A;  2D2C C;  1F2Y A;  1WD0 A;  2AQ3 B;  1LTI D;  1B2T A;  1BO0 A;  3TSS A;  1O80 A;  4OGQ C;  2MUY A;  3H3V C;  3NXW A;  4DA2 A;  4IUQ A;  1V1P B;  4FXG C;  1DD2 A;  1SNP A;  4FO2 A;  1A3V A;  1HFN A;  4RCO A;  1HQM C;  3SE0 A;  4BBS B;  5ELC A;  1EY6 A;  1A2T A;  3V96 A;  4KTA A;  1NR2 A;  2IX0 A;  5BN5 A;  3NHH A;  3A7A B;  5HGT A;  5J22 A;  3W3A A;  4CGY B;  5I6W A;  1CFM A;  3HRZ C;  3NSW A;  4IUV A;  3C1E A;  1HRJ A;  3HS0 C;  5C5L A;  5D14 A;  1I6V C;  1SYC A;  3MHB A;  2MPM A;  2NYZ D;  1ENF A;  4TQU S;  1RJT A;  2BE5 D;  2R93 B;  1PRT D;  2CVR A;  2ZXP A;  2F0T A;  2B2U C;  1S5F D;  5EBD A;  2F0V A;  4N9P A;  1ZKO A;  5C3E B;  2KED A;  2K5W A;  2SDF A;  3MAQ A;  4ZKB B;  4PMW A;  3BYY B;  3TN2 A;  2RSO A;  3PV0 A;  1JOQ A;  1RF2 D;  5EPL A;  3NQI A;  4ZAI A;  4WFN 3;  1SXT A;  2WKD A;  4QIW B;  1EY8 A;  2DY7 A;  3ERO A;  1TWC B;  1KNE A;  1WCM B;  2F0N A;  1TWA B;  1LTB D;  2K7V A;  3K57 A;  2WP8 J;  3EQL C;  2IPK D;  3FVQ A;  3VA5 A;  3FMC A;  1EU3 A;  2L4N A;  3RZO B;  3TZU A;  5C0X I;  3C3L A;  1G8Z D;  3HOZ B;  2LFN A;  1LTA D;  2EYO A;  2MHV A;  1VMP A;  3PIO 3;  2RQX A;  5CR3 A;  2G9D A;  4L63 B;  2BA0 A;  1PTO H;  1R4P B;  1KLU D;  2AQ2 B;  5JAV A;  1S5B D;  2IJ0 A;  4IZ8 A;  2NN6 I;  1TY2 A;  4BS9 A;  2Q8T A;  3MWY W;  4QMG A;  1JC7 A;  1GUW A;  2B2Y A;  3ZYY X;  1O7Y A;  3SK8 A;  1B4O A;  1BOS A;  4C1N K;  2GA4 B;  4FXK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...