2RQXA

Solution nmr structure of pmrd from klebsiella pneumoniae
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MEWWVKKVQDNASASLCRVVLQSGALEMIAEIEACRLRLREGDKLTPLADARYCLNNNPTQTLKIRNATHYSSERWTNADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymyxin B resistance protein
publication title Solution structure and phospho-PmrA recognition mode of PmrD from Klebsiella pneumoniae
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Signaling protein
total genus 8
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.650 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rqxA00
4HN7A 2RQXA 2JSOA
chains in the Genus database with same CATH superfamily
1SBBB 4KY7A 1V43A 4KD4A 4MHEA 1MHWC 1DGSA 2R7ZH 2QEJC 2IHEA 4A3BB 3H6MA 1L0YB 4LF4L 5IP7H 1XMQQ 2UUCL 2XN9C 1I4GA 3A55A 2F0QA 4IUPA 3L0OA 1PH7A 2JA5B 1K83H 1V1QA 2R92G 3RMHA 4C1NI 4Y7NH 5JVG3 5IOCA 3I4LA 2JA7G 1PH3A 3IKJA 1IBKL 1BQQT 3S2HB 4UP9A 4G4KA 1E2WA 5JVH3 2AUKA 4JW0A 2DUDA 4BBRB 1P16A 4PMCA 5IT9L 3NWSA 3CQZH 1HQMC 1CM9A 5EPJA 1K73C 1IW7D 1A15A 2WP8J 3AFPA 2SNMA 2BH8A 5HGTA 1KQSA 5LMNW 5JEAH 5ELDA 4IFDH 2EPBA 1VQOA 5I2XA 3D3RA 4BA1I 1VQ5A 1I6VC 3C1FA 4PQXA 1HFGA 2FXQA 5C0XJ 3SE0A 3J81i 3NELA 4DV4Q 3VR3A 2E2DC 1IW7C 1Y1WG 3OWFA 1ZEQX 2UU9Q 1Q1BA 2EYOA 1F9SA 1E1OA 4A3GB 1PFSA 2B2VA 4GOPB 4LF8Q 1Y8OB 4BWGB 1LT5D 5JPNC 1HR0Q 1PFBA 4LMQD 5IWAQ 3M3YB 3LWUA 4R4TA 3N6RA 1S5FD 3J81c 1SROA 1HFNA 3QG1A 1CHPD 4JC0A 3KJPA 5EGTA 1N33Q 4UPAA 1TS5A 3HOYB 3SXHA 2L15A 1L2FA 5IIFA 2R6GA 1XMOL 2B2YC 2K32A 4DAYB 4OO1G 5M5XH 1YI2A 2B39A 3J80i 3PSIA 5G3LF 5LL6X 4NXML 3BZDB 1CKMA 3BS1A 4K2LA 1AP0A 2ENBA 2R7FA 1Q86C 4A93B 1U9RA 1GVPA 3HOWB 2JYOA 1EU4A 2ZJQA 2BDNA 4NB3A 3CCMA 2CKZB 5ELFA 2RCFA 4A3MG 3OMGA 1QE6A 3F2CA 3MTSA 3H3VH 2AQ2B 1EUJA 2F0JA 1QVGA 1H9SA 4LJZC 3M4YA 4FVMA 1EFWA 4DUYL 3CCLA 1EYAA 1GD7A 4BS9A 3DMUA 3L7ZC 1EY7A 1FNUA 4A3KH 2WIIB 5K5PA 5KYIA 1Z9FA 2MO1A 5C4HA 1JOQA 1EEID 2QILA 3FKIH 2B3GA 3C3LA 2ZTDA 1EY8A 4KK7A 1GUNA 4FF2A 4J8QA 4IZ8A 2AQ1B 3R3OA 1BO0A 1NR4A 1S4ZA 1VQAA 1ZKOA 3DWQA 2NZOA 5T1IA 4A75A 3VR2A 3T4AC 4XQQA 1JOKA 4HJ8A 2UXCL 3MA2B 2F03A 4RFBA 5JJKA 4OHJA 3P75A 2E5LL 5FO8B 1SDFA 5IY0A 4RCOA 2I07B 4OGQC 3IFTA 1H9JA 4RH6A 4DU9A 1EY0A 1II3A 3CCQA 3DWPA 3S9WA 2F0EA 4EQOA 4NDXA 2JA8B 1JMCA 2UUAL 3I4OA 2ZXOA 1X3FA 2JA5G 5M9OA 4LF7Q 3CCJA 3I2ZA 5M5YH 1HUMA 3G6JB 2F3VA 4DAMA 1XWEA 3GTJB 3QOJA 5M5WH 2EJMA 4YWMA 4IOCA 1KAWA 4O1NA 4A3FB 1I50H 5IYCH 1KDAA 3V2TA 3K57A 2N3SA 1PXUA 4A3JB 2JA6B 1X55A 2C35B 3Q6SA 4KLKA 1PZKD 3M4OH 4C3JB 4A3CG 1YNND 1G8ZD 1KRTA 1A3VA 2MP1A 5IYBG 3GTOB 3S1MH 2LS01 5FOBB 3QO2A 3U9SA 1F77A 4JYAQ 4A76A 1K0SA 2D0OA 4JBWA 4B3SQ 2XRQD 2VB2X 4XYOA 3Q24A 2K33A 3X3NA 4UP7A 2WB1B 3BYTB 4B3RQ 1EOVA 1X3GA 3KF8B 3PUXA 3PO3G 1K8MA 4EVOA 1YNNC 4OX9L 3EN2A 1OTCA 3F8TA 1YBYA 3L2PA 3S1QB 3BDCA 1PFNA 2MUYA 4C3IH 1UE7A 2MNAA 2VUMH 2OTJA 2EY1A 2AKWB 4N9PA 1FYCA 3CRLC 1CKOA 4JI4Q 3CCVA 1TWAB 3BYYB 4A3IB 4LWCA 4IPHA 4DR7Q 1X6OA 2UXBL 2HIXA 4F8MA 4QQBX 5AJ3L 4DV0Q 4PNYA 1CZGA 3HS0C 4AQYQ 1JT8A 4MZ9A 4DV2L 3HZXA 3T53B 3HOYG 1J6QA 4A4IA 4O2DA 5C4XG 1TWHH 3NTHA 2VQFQ 1VQBA 4A3LG 4P2CB 2XWBB 1EWHA 3M7GA 5BR8L 3FPUB 4AIMA 2JSOA 4V0BA 2A6HD 4DAVA 1FNVA 5IP9H 4DR3L 2RSNA 4MTNA 4LFBL 5CORA 5CGKA 4DV7Q 4UHVA 1WYDA 2Z1CA 4DNIA 1Q8KA 3RUZA 2JQOA 4JBMA 3RN2A 2YU9B 3T16A 1S40A 3J80E 2F4IA 3T56B 1JWUD 3RD4A 1E22A 3MXNB 1DYQA 4M1UB 4HJ7A 2KVMA 4DV3L 4RGOS 5DM63 2KCCA 4DR4L 2Z6KC 5FJ8G 1CHQD 4IFDJ 1EFID 2Z8LA 1KC8C 4LF9Q 5L37A 5F2DA 1A6XA 3OTOQ 4O0AA 1HR0W 2HDMA 2B2TA 5C3WA 3U50C 2WAQB 5EBDA 3A0JA 1QZGA 3E0EA 1G6PA 2H1EA 4RKBA 1L0WA 3EVQA 3NHHA 4RGMA 5E4WC 1CSPA 1KNAA 1CA5A 1ML0D 5C44H 4IUVA 4A3EH 3KF6B 2NZ1D 5GAGC 2Z9HA 3PQIA 2PMZB 1PLFA 1KNEA 1VQHA 1NE3A 3DM3A 3IRBA 5HY6A 2E2IB 4HIMA 4OEMB 4HIDA 1PFMA 3I4NB 3H91A 1SN8A 2RVLA 2EOTA 4J1MA 1SFOH 1BKBA 2BOSA 4GN3B 3TP7A 2K5QA 3HFZB 4FDBA 2NBFA 4JCVE 1HTLD 4DR5L 4DAYA 4I65A 1V1PB 2ZT9C 4HN7A 2J7ZA 2LY7A 4K2KA 5KIXA 3GD7A 4YHHL 5E3FA 3SEBA 5C3XA 2F3IA 3BU2A 2PYKA 4DN4M 2JA9A 1NBWA 1K8GA 4LF6Q 1SYFA 4I7ZC 1OXUA 5K36G 3FPPA 2ATWA 4GKKQ 3PCOB 1MSGA 2EYFA 1BR9A 3ND9A 3KYHC 1YHQA 1S5ED 3ND8A 3QB3A 5HURA 3MEHA 3FDTA 4JI1Q 3U4VA 5M3MG 2O5IC 2HQEA 4XT1B 4L5QA 3E5SA 1TIID 4HTHA 1WOCA 2A6ED 2VS1A 2UXDQ 2MJ8A 2CH4W 1UEBA 2UUCQ 3S2DH 3IFDA 3S14B 1PTOB 5LMUL 3S16H 1Q81C 3D6CA 4P71A 5IYDG 2B63B 1W6JA 2GN5A 4M8AA 3TQYA 1PDQA 4R4QA 1Q82C 5KGUA 1O7ZA 4X3UA 5CV9A 3LWEA 2K05A 3JC66 4PV1C 3I4MH 1BOSA 1PH9A 5IT9E 1IBLQ 3NWTA 2A6EC 3ULPA 2D5DA 4ID6A 4IO9A 2Q8IB 4BY7H 2FFKB 2NN6I 2QGQA 3A5ZB 4ULLA 5KEEA 3MVVA 2MO0A 5C0XG 2Q8TA 3J7AF 3Q23A 4A3DB 5LMNQ 2V1CC 1Q90A 4DV5L 1EL0A 3AQQA 1L1OC 1CTMA 2MHVA 1HZBA 4XTCS 5KRUA 3RZOH 5DM73 1U0LA 4CJ0B 1I3QB 4BY1B 2K75A 3OSOA 3AEVA 3BZCA 1GHKA 3PF4A 1N36L 2RHSB 4BXXG 1IXRA 2R7ZB 4FXGC 2ZJRA 2B2WA 1SNMA 3N52A 1SRUA 3R2IA 1BCPB 1IYVA 4KHPL 1TQOA 4WRDA 4AYBB 1J8IA 3Q0AA 1K83B 1OO9B 1DZ1A 1U4PA 3T13A 4PZ8A 3RLOA 2OTLA 4Y7NB 1WTWA 1H9SB 4BBSH 3S17H 1E1TA 4NXMQ 1TY2A 1SNCA 3CQZB 3BZKA 2NB0A 1I4XA 3GTMH 3MC0B 2BCOA 1LTTD 3GTPH 4QMGA 3ZYYX 4XDXA 1NMFA 4IUNA 3EROA 4JG2A 1VQJA 2B8GA 1VQNA 4RGTA 1TR5A 4HCEA 4DUYQ 4QJFA 1E24A 3CCSA 1WJJA 2WV6D 2EJGC 3TZUA 3MZ5A 4FP5D 4F88A 1QB5D 1MIUA 2M00A 4WJWA 1NAPA 2OCEA 1MI2A 1JJ2A 2RDHA 4DKAC 5CV6A 4GOPC 3K58A 3R2TA 5CBEE 1PRTB 1VDZA 1CFMA 3WOFA 1WCMH 3H0GH 3HRZC 3VR5A 1Q7YC 1B3AA 3M9BA 3URYA 5FO9B 3EFXD 1JORA 1NUCA 1B9NA 2F0NA 3TP6A 2F0GA 3OOCA 2D0PA 3HG9A 3FHWA 2O4XA 2MFIA 2NVQH 1NJIC 2UXCQ 3L3OC 2E5LQ 4RAUC 5KYLA 3JAML 5M3FG 5M5XB 3P7JA 2K6AA 4UDUC 2PI2E 4DNTB 4K5WA 3HP3A 1K3RA 3CPFA 4ZQ3A 3LX0A 3MAQA 1G91A 2UUAQ 5ELCA 4YY3Q 3HOZH 2F4VL 4K5XA 1DD2A 5ELNA 3P1HA 2CHBD 4Q5VA 2L12A 3EQLC 1C4QA 1IBMQ 4CJ2C 2NN6H 3ITPA 1VQFA 4FF3A 2R61A 2VZAA 1C48A 3D31A 3PUZA 2AHOB 4A3KB 2EVBA 2CWAA 1VS0A 4YCUA 5I6WA 3AU7A 1RKNA 5I2YA 3FKIB 3UDIA 4DNRB 5IE8A 1DOKA 3X3MA 1XNQL 1GM5A 1AH9A 1VF5C 5FLXL 3LGJA 4Z9CB 4FO2A 1HZ9A 1HZCA 1NTGA 3K7AH 4R4OA 1V1PA 4WJ3M 3MFYA 1BVSA 1S3OA 5CMDA 4QUCA 2HCCA 2RBMA 3SGIA 3P20A 1EYCA 4IQZA 2IWHA 2IW3A 2RA4A 3ERSX 3CMAA 4LFAL 1CSQA 3SK5A 3SR1A 3UE0A 1TWGH 1PYWD 2K04A 1RCVD 1YNXA 1KL9A 2EY5A 5BN4A 4X6AH 2EYPA 4JK1C 4DR2Q 2JP1A 1I94L 1ICWA 1NCVA 3HOVH 1X3PA 3EBEA 1TWCH 3I7FA 4DR1Q 1IL2A 2EJFC 1G291 5HGQA 4JI0Q 2KQ3A 2XTIA 3NSWA 5C3EG 1VMCA 2K5HA 1EU3A 3CC7A 3K81C 4L8JA 2UXBQ 5IGBA 3PUYA 2BDOA 4YIJA 4JI6L 1FGUA 5M5YB 5M5WB 2F1MA 2EYHA 1I50B 4R9WA 5J3BA 4NXNQ 3NQTA 5J39A 1N32L 1HTPA 1U4LA 4DGZA 3HOUG 4CGYB 3SVMA 2LMCB 1VQLA 2AWOA 3M4OB 3I70A 1PZID 3K59A 1JC7A 2K14A 2QCPX 4HCSA 1JR0D 1LTID 4ALPA 1XPOA 3ER0A 1J5EQ 2N78A 4IUUA 3S1MB 2VQEL 1WTXA 2R93G 2CW0D 1AEXA 2ZTCA 3M7NA 4CDEC 1M1KC 3SHLA 3PO2G 4LFBQ 1DM0B 4RCNA 2E2HH 1UAPA 3IL8A 3OHXC 4G7HC 4KTAA 4B3TL 2C9OA 1A2TA 4LFCL 1RJTA 2CW0C 2QW7A 4MNOA 3RLFA 1A0IA 4EQPA 2ZM6Q 4F7XA 1VQ6A 4C3IB 4DR4Q 2VUMB 3NTIA 1Y1WH 4CKEA 4HAEA 1CZWA 3F2DA 2E74C 3J81j 5EQ0A 5D65A 3RLNA 5IGGA 1XTDA 1EOTA 3GTLH 4I7AA 3KBXA 1Y8NB 4RHSA 4Q0FA 2LXJA 2MGSA 2B2UA 3TP5A 1OXXK 2A69D 4GN4B 2IJ0A 1B2TA 2A68D 4FF1A 4LAAA 4RKLA 2F0VA 1SYEA 1TWHB 1JCKB 2F3WA 3UDXA 1AN8A 3OWEB 1EY9A 5BN5A 1X56A 1VQPA 4HEDA 2PZTA 4OO1H 1PH8A 4K14A 3U4ZA 1TT2A 1Y8PB 1JOOA 2A68C 1YITA 4S3SA 3MXUA 3ONAB 3J80c 3C2PA 3QOLA 1G6ZA 3VDYA 3F2UA 5ISRA 4YHHQ 1Y14B 1A2UA 1ENFA 3K0XA 1FD7D 1IL8A 2JN4A 2NTSA 5DAUA 4IALA 1JICA 4H02A 1TXYA 1HH2P 4DK0A 2DJGC 4X64Q 2XSCA 1S5CD 1SJHD 1LTLA 1B53A 1YEZA 1NR2A 1K3BC 1BDOA 1TU2B 4X62L 3GTKH 5C44B 2EXDA 3S24A 4DAPA 3CMEA 4A3EB 2PNHA 3HOXG 4EX5A 3NEMA 1GUSA 1HJPA 1MBYA 1XPUA 5LL6S 2ID0A 4TQUS 3PGZA 3QR8A 4JBJA 4A3BG 1QNUA 5A35A 5LMUQ 1SFOB 5D14A 3FEWX 1VMPA 4JVZA 3K5MA 4JI5L 4DV6Q 2A1AA 5NUCA 4GZYC 1TKWB 1PH2A 3BDOA 4JI7L 1F2MA 1G2SA 1RHPA 1ASZA 1B1ZA 4J15A 1NY4A 1TS3A 3PIOA 1QVCA 5I6YA 1UE1A 1QNKA 5IYCG 2RDGA 4KJNA 3NUCA 4HJ9A 1N34L 2QDBA 4BBRG 1IZ6A 1M90C 3RR5A 4DV5Q 1ET9A 2N88A 1YHBA 5CR3A 1K8OA 1B7YB 2K01A 4N8FA 3A8JE 5JOBA 1BF4A 3A8IE 4A3CH 3UE1A 2Q2IA 4QGUA 1EQTA 5IYBH 2I5LX 4RGNA 2KHJA 5AFWA 5EJWA 3AYHB 3G6EA 1PTOD 1FVIA 1QCBD 1SSOA 3E9IA 3NBHA 1B9MA 4GKJQ 4IPDA 1XXGA 4X65Q 4GNXA 2K52A 1N36Q 2VNUD 4DXFA 4ME3A 4A3GG 2IHFA 2EE1A 1SJED 1S5BD 3PO3H 3S2DB 4C3IG 3S16B 4KHPQ 4C3HH 4P73A 1SE8A 3NPPA 3SK6A 1HA5A 1PTOC 3VYRA 5CV5A 2DNCA 2A19A 1GUGA 1C8CA 2L0CA 1ILPA 5IT9c 3I4MB 1KIXA 3W1GA 1LUZA 3OYYA 1DCZA 2IY5B 4BY7B 2F0HA 2R3ZA 1XMQL 2M9VA 2XNAC 2OEOA 5I9PA 4HJ5A 1VQ9A 1F9PA 1ESRA 1E2ZA 2LFNA 2WKCA 4V190 4DF7A 4A93G 1RIPA 3HOWG 3NTKA 3UDGA 4HIKA 2K5NA 1SMXA 2B2VC 2Y0SB 3RZOB 5C4XH 2FINB 4WJ4A 4B3ML 3NXWA 4A3LH 3KLWA 3PIO3 3HKZB 4DFAA 5C0XI 1BCPD 2DJFC 4ZAIA 1VQ4A 2WB1E 1WTQA 1SEBD 5CYUA 5FLMG 2F0LA 3I73A 3H15A 4UY8C 1HPCA 2A6HC 2EYJA 1O7IA 3CRKC 3VR4A 5JEAJ 2B2UC 3UI2A 4ZKBB 1R4PB 4YWLA 3DUZA 2F0TA 3GTQH 1Y69U 1KHIA 1BCPC 2DY7A 2UU9L 4J6HA 5EPKA 1FGBD 1GOZA 1U4RA 3JAME 4RA8A 2UUBL 4OIKA 5FJ8H 2MPMA 1DXMA 1WI5A 2ICIA 3A8KE 1Y1VH 2DN8A 1Q46A 4BBSB 1NNXA 1LACA 3S17B 4RMFA 4K0KQ 2PW5A 1I5FA 4KKTA 2XRSD 2Z0SA 3GDEA 1RTOA 3KOJA 5CBAE 4QUFA 1N33L 3GTMB 4DK3C 2NTTA 3GTPB 2KECA 2JA8G 4C1NK 2DY8A 1HNXL 1STNA 4KY5A 1EIYB 1T5XD 1P8LA 1EYGA 1PRTD 4KMUC 4ZUJA 4FXDA 4A3FG 2HQLA 5FLXE 2CH4A 4NW2A 1EQQA 4RHRA 1WTOA 2JA6G 4A3JG 2VB3X 1EZ6A 3AMUA 4C3JG 1D7QA 3FP9A 2N49A 2CWPA 4R8IA 1CKNB 1WCMB 1YIJA 3H0GB 4IOAA 1X3QA 1PRTC 4PMWA 3T1YQ 2DGYA 4IJLA 1XNRL 2K50A 4LFAQ 2NZHA 2WAQE 2NVTH 2NVQB 5K36H 1FNWA 1PVOA 1H9RA 4IN3A 4P75A 4WORA 4U68A 5H1SE 1PMRA 1SYBA 2WB1G 1AE3A 1D1IA 1I94Q 1D1KA 3K5NA 2PMZE 1RD9D 1EWIA 5TSSA 4LF4Q 1Q8IA 1PH4A 2AUJD 2KCNA 5M3MH 3HGBA 4ME5A 1ENAA 3TRZA 3U58A 3HOZB 2BA1A 4JI6Q 4A3IG 4JV5L 1FR3A 3H3VC 3TS0A 3ERQA 4XIGS 3OIQA 3DEOA 1LTGD 1IBKQ 2NVXH 4IPCA 4Y52H 4XQNA 2HT1A 3I4MG 5IYDH 1IHZA 4P72A 3IAYA 3DLLA 3PMFA 2PCFB 5JJLA 3W5OA 4JI8L 2XWJB 1HNZL 1F2ZA 3RZDB 2JEBI 1KLGD 3F2BA 2KCTA 3K7AB 1HA6A 3R93A 1B44D 2BE5D 1HZAA 4H13C 3CKIB 5ELEA 5FKAC 2NYZD 1LT6D 1STEA 5T1GA 1OXSC 2PQAA 1TWGB 4N8X1 5JPMC 1I4QA 1AW7A 3EA6A 1IYJB 1ENCA 3HKSA 4LFCQ 3CC4A 1HNWL 2ZTEA 4HMJA 2F0OA 3HOVB 2BE5C 3KK7A 3EIVA 3KLSX 1TWCB 3KLSA 3J7ZC 3KLRA 3BJUA 5GADC 2CFMA 2HHHL 2XVSA 4F87A 3NENA 2K5VA 2Z6BA 1JJCB 4BXXH 4H0LC 2WAQG 4MIUA 2H4OA 5C4JH 2RKSA 4XQJA 1WTRA 2MQHA 1XMOQ 3CC2A 1PV4A 1I6HH 1PH5A 1I4HA 5I4DA 3OPOA 3UDFA 1FJGL 1YVCA 4JI4L 1EYDA 3TP8A 2C5CA 4DR7L 1X65A 1HQRD 4PMBA 3I4NG 4OWTB 2DNEA 4FNFA 3E3XA 1LYLA 5G3LD 4AQYL 1VQ7A 2IT1A 3J81L 3SDZA 1V8QA 5KNCA 1VQDA 4JI2L 2I46A 2E2JH 3KJOA 2E2HB 1SE3A 2OQKA 2Q2TA 1YHAA 2K4KA 2VQFL 1QILA 2B2TC 3CD6A 4E6IA 3D4WA 1MKHA 3DM1A 1SXTA 1T9HA 1VQMA 1JQYD 5EKLA 5E1FA 1SMYD 2I5MX 2ICEC 3NQIA 3BVMA 1NMGA 3CAMA 4DV7L 3O13A 3GTGH 4QCLA 1G2TA 3G48A 3E0JA 1Y1WB 3U9OA 4IFDI 2F0SA 3C1EA 1TY0A 1WCMG 1RODA 2PW7A 1SYDA 3GTLB 1SMYC 4AYBE 3L9AX 2CVRA 3VR6A 4L6TB 2EY2A 3I3CA 3J80L 1LABA 1O80A 5IODA 1BUVT 3GO5A 1TS4A 2WKDA 3OTOL 1STHA 2L1BA 2OXPA 1MD2D 3RN5A 5IGFA 5JJZA 1QJOA 1S5DD 3TEHB 1GUOA 4HR7B 3WOEA 1LT3D 5M3FH 4LF5L 2EYLA 2M2LA 1XYIA 2B63G 3I8ZA 2OQ0A 4JI3L 3PUWA 1ILQA 3LNNA 4JI7Q 3CHBD 1TWFH 2EY6A 5CV4A 1E0BA 3I90A 1PA6A 2PNRC 2AWNA 5A2QL 2D2CC 2FHTA 3E9HA 3FRPB 1HRJA 1EEFD 4ZUIA 1SNPA 1K0RA 2KA7A 4ZK9B 3NBHB 1H95A 1A63A 2F52A 4GNXB 3DHQA 1M8AA 5IGDA 3S1RH 1HUNA 3VA5A 4LK1C 2Z4HA 4A3DG 5GROA 2O2LD 3S15H 1STYA 2P5ZX 2YV5A 2ZXPA 3H3VI 1SR3A 4QB4A 2NWGA 3I56A 1GXDC 4C2MH 1BBXC 1LTBD 4ZYSA 4IUQA 4DXGA 1U4MA 4N9TA 4OX9Q 3GTKB 4L5TA 2I5HA 4GKKL 4BY1G 1CKNA 4KJOA 1SLJA 1TS2A 5FO7B 1B8AA 1D2BA 1IKMA 2NVYH 2R7ZG 3V96A 5IP7G 1QVFA 3KDFA 5D3DA 1JJGA 4C56C 4QIWB 1Z6HA 4AYBG 4ZLTF 5AJ3Q 3G4SA 2KHSA 2HIVA 4FYDA 1QUQA 2VL6A 4DV2Q 4K8IA 4U673 1AFPA 2UXDL 2ALYB 1IYUA 4QF4A 5C3EH 2TSSA 2R92H 1CQVA 2FMMA 1D6EC 1RF2D 3D4RA 1Q3LA 3D8GA 3CP0A 2HD3A 2JA7H 2PZWA 5BR8Q 1R9TH 4X66L 2LSSA 1H9KA 3VA7A 4DR3Q 4K5VA 3HOUH 3PV0A 3OW2A 1T5EA 1IBLL 3MHBA 4APVA 4KN4C 2B2WC 2EXZA 4B3MQ 5JEAG 3K7UC 4IFDG 2V4DA 2F0WA 2QA4A 4XT3B 1GUWA 2K1BA 1Z47A 5JAVA 3I91A 5JJIA 2R93H 1W3SA 4UAIA 5LMNL 1LLRD 3PO2H 3EJIA 4DV3Q 4OELB 1BBUA 1KAAA 4O42A 1Z7TA 3TMEA 1JB7A 5CV7A 3PO3B 3STBD 4LNQA 1CI3M 4C3HB 1YJWA 3K8AA 2B29A 3GV3A 2OT2A 2YTYA 2UUBQ 4QIWE 4R8NA 2X6LA 1KDCA 4BA2I 2ZXRA 3STBC 4KY6A 4QY7A 1C7YA 1XPRA 2IX0A 3CF5A 5GAEC 1F2LA 1DOLA 4DPGA 3J7AV 4DR6L 3D0FA 4L5RC 1K9MC 3NP8A 1LO5D 1E2VA 2Z6KA 4DUZL 2A69C 3T1HL 4DR5Q 1O7LA 5EKKA 4G7ZC 1HCZA 5DNFA 5C4XB 3QIAA 3ZJYC 3ULLA 4B9WA 1HNXQ 4L63B 1WTVA 4GLVB 1EWCA 1B4OA 2EDGA 1ICFB 2WINB 3JAMi 1EY4A 1KLUD 4A3MH 1QG7A 1KABA 4A3KG 1WTPA 2J4XA 2IX3A 3B6YA 1WD1A 1UUPA 4DK6C 2A5HA 3FKIG 3D6WA 2L11A 1UNSA 2PI2A 3GTQB 1J9OA 3K80C 2KOLA 1V9PA 2QF7A 1EY5A 3W1BA 3JAMc 1XNRQ 5ELBA 4CDFC 1XJVA 3S1NH 1CUKA 2I0QA 3E6ZX 1CQFA 1Y1VB 2IPKD 3MXGA 4GLAC 4CBVA 2NUCA 1F2YA 1XX8A 4OWWB 2A73B 2QEXA 4G57A 4JBKA 1LTAD 1UEAB 2XGTA 1ESFA 1AZPA 2PPBC 1X9NA 1VQCA 3HOXH 3W3AA 1SNQA 3SK4A 1F9RA 1LT4D 4CDCC 2BH2A 4JV5Q 1YJ9A 4A3BH 2QDLA 1A8VA 3Q22A 5FLXc 1MGSA 3ULJA 2JJQA 5DLQE 2PQAB 2BA0A 2RSOA 3MFGA 2JA5H 4GLXA 4YY3L 4JI8Q 3MXPA 1HNZQ 2F0FA 5I9OA 1SAPA 1IBML 1H9MA 2E75C 4FXKC 2OWOA 4IJHA 2KCMA 1CA6A 3W2DA 3S2HH 3DWAA 3M85A 4DV1L 1KDBA 1KTKA 4BBRH 2F0IA 2NVTB 2EIFA 5GAHC 2AQ3B 4IUTA 1W2BA 5C6AA 5KNBA 1C9OA 1HNWQ 1UE5A 2Z4IA 5COYA 2F0UA 1VQ8A 1ASYA 1ONLA 3BVZA 2EQSA 2HHHQ 1WD0A 1E3PA 1EZ8A 5M3MB 1JWMD 2VUMG 4ILWA 4LUOA 2QKIC 4HJAA 4X3KA 1B50A 4TVAB 4C3HG 1EQVA 1L1OA 4DR2L 1N8RC 4A3GH 1BXTA 1GO3E 4PZ7A 3NBIA 2SNSA 4DR1L 1D5XC 3M3YH 2NVXB 5E4XA 4PG3A 4OXPA 2G9HD 3F1ZA 1D5MC 4JI0L 4UP8A 1FJGQ 3TN2A 2KEEA 3J81E 3A5UA 2F0KA 5C4ZA 3A7LA 3HOYH 4X3TA 1A62A 3K5OA 1V1OA 4RG1A 2RQXA 2RDFA 1PH1A 4NXNL 5IP9G 4JI2Q 1M4VA 4YCVA 2Q2HA 1ZYRD 4KD3A 3TREA 2F0PA 1UWVA 2RHQB 3Q8DA 3GP7A 4A93H 4KI0A 2N8NA 3HOWH 1J5EL 3QWNA 3OMCA 4CJ1B 1X54A 1X3EA 3VYUA 1KRSA 1N9WA 1ZYRC 3AB9A 1ZXTA 2XIWA 1A3UA 3I72A 4IPGA 2CQAA 4R1JA 1GHJA 5IGEA 4DV4L 4B9XA 4X3SA 5FLMH 1SNOA 4KKUA 3TBIB 4HMIA 5CV8A 1KXLA 1I4PA 4ZCKA 4FF4A 5C4JB 2ZM6L 4LF8L 3DXJC 1UE6A 2Q8RE 4CKBA 2CCZA 1I6HB 1HR0L 3K5LA 5IWAL 4OONA 5C44G 4A3EG 3DEPA 2GVAA 5GQOA 1Y1VG 3D4DA 4CDDC 2JXMB 2ASBA 2Q2UA 5IGCA 2A74C 2VY3A 4XXEA 3TSSA 4KN7C 2LKVA 1B3QA 2L4NA 4ODGA 2F4VQ 5EPLA 4LF5Q 4KHZA 3GQBA 4GOPA 4YCWA 2D9UA 2KBNA 5A2QE 2O5JC 4JI3Q 2E2JB 3CPWA 2A8VA 2F0MA 2Y0SE 1DONA 1MJCA 1CT1D 1YZ6A 4TSSA 1STBA 1PH6A 1JE4A 2E8GA 1G51A 4B08A 3HKZE 2PQEA 2HDLA 2L9HA 2JA8H 1BNZA 1LTRD 1AE2A 2SOBA 1XNQQ 3TDQA 1GJXA 2K03A 4EGVA 4JOIA 3GTGB 4LUZA 4YWKA 4NP5A 3GTJH 1K28A 1W6KA 4EQNA 4NPSA 4A3FH 1GUTA 3A7AB 2KENA 1VQIA 2JA6H 4A3JH 3KDFB 4TKOB 1O7YA 5D3IB 3A56A 3ICEA 3J7A5 4LUVA 4C3JH 1SE4A 1I4RA 3GTOH 1NSNS 2D62A 5J1ZA 3K0YA 1QUQB 2YYZA 4EQ5A 5EKIA 2IL8A 4NMZA 4X64L 1YNJD 1EIGA 1R4QB 5DEHA 4PZ6A 5E7NA 1OXVA 1A3TA 2EYMA 2PZUA 5M3FB 3S1QH 1SYGA 4OWXB 1WFQA 1LTSD 5KNDA 4P74A 2F0DA 1YNJC 1TWFB 1N32Q 1X32A 1O78A 4ZRZA 2KUMA 2VXWA 4KKSA 1EY6A 4BY7G 4WFN3 1TWAH 4A3IH 2G9DA 1PHJA 2WACA 3QJYA 4LF7L 2VQEQ 4DV6L 4HSVA 4X66Q 4NKLA 2K28A 2YTXA 1DOMA 3S1RB 4GNXC 3S15B 3KBGA 3PUVA 5C0XH 3T51B 3WDNA 4CHTB 4C2MB 3TZDA 4AH6A 2Y0SG 3CCEA 3A54A 4HIOA 4R4CA 1PYSB 1EIFA 3HKZG 4LW1A 4B3TQ 1B70B 1S72A 3SK8A 4JYAL 1ET6A 3PIPA 2SDFA 4B3SL 1PTOF 1CK1A 2NVYB 1SNDA 1MJEA 2CQOA 2WFWA 1LV9A 1EQRA 4B3RL 1OXTA 2YU9H 2EZVA 2JE6I 3GV6A 4CKCA 1VQGA 3R8BA 4H44C 4GKJL 4K6LA 4X65L 2KHIA 2X69A 3FVQA 2L55A 3CU7A 5C3EB 3BVGA 2R92B 3KUPA 4K6DA 4KHVA 3M4QA 4BBSG 2AMCB 3CW2C 3V05A 1JB3A 3KF8A 4KV6A 4OL7A 2JA7B 1RTNA 4DR6Q 1R9TB 4DV0L 2FJ2A 4RWSC 1HXYD 2FMCA 1L0XB 3HOUB 4DUZQ 1EIHA 3T1HQ 3G7LA 1VQKA 2B8FA 1AZQA 3CCRA 4ZKCB 3NE5B 4GS3A 5ELOA 2E2IH 3M4PA 1JWSD 5C5LA 3I4NH 1SYCA 2HCIA 4H7BA 2R93B 3WWVA 1D8LA 4HSPA 2R7DA 1LM0A 3PO2B 4XYQA 2ES2A 2B2YA 2N55A 4R4IA 5FK9C 3MWYW 1BCPF 1VCIA 2K5WA 5LHY1 3CCUA 4POGA 5CC4A 2H5XA 1PYBA 1MSHA 2RF4A 2G5DA 4POFA 2ZJPA 3H0GG 2GA4B 1STAA 3CXCA 1WTHA 4X62Q 4GN5A 2K5DA 1PZJD 2SEBD 3PIP3 1U5KA 4OIJA 2PO4A 1DJRD 1KD1C 3BG3A 2K7VA 1Q12A 4LF9L 2LXKA 1VF7A 1JE5A 1RDPD 2RCNA 1IKLA 3A74A 4L5SA 2VW9A 3HEJA 2YTVA 3MXNA 3OIPA 3J7YW 4JI5Q 1F9QA 1SE2A 5C5MA 3HOZG 1BBWA 1XTCD 3KFUA 4JOIC 4DA2A 3MEFA 4K0KL 2NN6G 3OW7A 2JK8A 3S14H 2OF1A 1VQEA 3AFQA 2HUGA 5J22A 4A3MB 1PTOH 4QL5A 3C46A 2JEAI 2B63H 1WVLA 1N34Q 2KJXA 1QOHA 2L5TA 3H94A 1PRTF 4IURA 3G71A 3KF6A 4MTKA 1RL2A 4ABNA 3RNUA 4OO1I 2E76C 1QWYA 3TS2A 1E7ZA 2KEDA 2X6GA 1K8AC 1C0AA 4DV1Q 2GVBA 4G7OC 3FMCA 5BN3A 1QZHA 1FL0A 5EAYA 3S1NB 2J0TD 4DK1A 5EBCA 3H09A 4LF6L 4A3DH 4K8JA 3I55A 1L1OB 3RZDH 3VYTA 3VYSA 4JPBW 1D5ZC 2TMPA 4TRDA 3T1YL 1TVXA 3NK9A 3HOVG 1Q1EA 4MN3A 3BDLA 1HHVA 1GKHA 1YJNA 3HOXB 4JI1L 3K6OA 1I3QH 1STGA 2IX1A 4BY1H 3PF5A
chains in the Genus database with same CATH topology
1SBBB 4KY7A 1V43A 4KD4A 4MHEA 2QEJC 4A3BB 3H6MA 1L0YB 2XN9C 1I4GA 3A55A 2F0QA 4IUPA 2JA5B 3RMHA 4C1NI 5JVG3 5IOCA 3I4LA 3IKJA 1BQQT 3S2HB 4G4KA 1E2WA 5JVH3 2AUKA 4BBRB 4PMCA 5IT9L 3NWSA 1HQMC 1CM9A 5EPJA 1IW7D 1A15A 2WP8J 2SNMA 5HGTA 5JEAH 5ELDA 4IFDH 2EPBA 5I2XA 3D3RA 4BA1I 1I6VC 3C1FA 4PQXA 1HFGA 5C0XJ 3SE0A 3VR3A 2E2DC 1IW7C 3OWFA 1ZEQX 1Q1BA 2EYOA 1F9SA 4A3GB 2B2VA 1Y8OB 4BWGB 1LT5D 5JPNC 3M3YB 1PFBA 4LMQD 3LWUA 3N6RA 1S5FD 1HFNA 3QG1A 1CHPD 5EGTA 1TS5A 3HOYB 3SXHA 5IIFA 2R6GA 2B2YC 2K32A 4OO1G 2B39A 5G3LF 5LL6X 3BZDB 3BS1A 4K2LA 1AP0A 2ENBA 4A93B 1U9RA 3HOWB 2JYOA 1EU4A 2BDNA 5ELFA 3OMGA 1QE6A 3MTSA 2AQ2B 2F0JA 1H9SA 4LJZC 3M4YA 4FVMA 1EYAA 4BS9A 3DMUA 3L7ZC 1EY7A 1FNUA 2WIIB 5K5PA 5KYIA 5C4HA 1JOQA 1EEID 2QILA 3C3LA 1EY8A 4KK7A 1GUNA 4FF2A 4J8QA 4IZ8A 2AQ1B 3R3OA 1BO0A 1NR4A 1S4ZA 1ZKOA 5T1IA 3DWQA 3VR2A 3T4AC 4XQQA 1JOKA 3MA2B 2F03A 4RFBA 4OHJA 3P75A 5FO8B 1SDFA 4RCOA 2I07B 4OGQC 3IFTA 1H9JA 4RH6A 4DU9A 1EY0A 1II3A 3DWPA 3S9WA 2F0EA 4EQOA 4NDXA 2JA8B 2ZXOA 5M9OA 1HUMA 3G6JB 2F3VA 1XWEA 3GTJB 3QOJA 2EJMA 4O1NA 4A3FB 1KDAA 3V2TA 3K57A 2JA6B 1PXUA 4A3JB 3Q6SA 1PZKD 4C3JB 1YNND 1G8ZD 1A3VA 2MP1A 3GTOB 2LS01 5FOBB 3QO2A 3U9SA 1F77A 4JBWA 2XRQD 2VB2X 4XYOA 3Q24A 2K33A 3X3NA 2WB1B 3BYTB 3PUXA 1K8MA 4EVOA 1YNNC 3S1QB 3BDCA 1PFNA 2MUYA 2EY1A 4N9PA 1FYCA 3CRLC 1TWAB 3BYYB 4A3IB 4F8MA 4PNYA 1CZGA 3HS0C 3HZXA 3T53B 3NTHA 4P2CB 2XWBB 1EWHA 3M7GA 3FPUB 2JSOA 4V0BA 2A6HD 4DAVA 1FNVA 2RSNA 5CORA 5CGKA 2Z1CA 3RUZA 2YU9B 3T16A 3J80E 2F4IA 3T56B 1JWUD 3RD4A 1DYQA 4M1UB 2KVMA 4RGOS 5DM63 2KCCA 1CHQD 4IFDJ 1EFID 2Z8LA 5F2DA 1A6XA 2HDMA 2B2TA 5C3WA 2WAQB 5EBDA 2H1EA 4RKBA 3EVQA 3NHHA 4RGMA 5E4WC 1KNAA 1CA5A 1ML0D 4IUVA 2NZ1D 2PMZB 1PLFA 1KNEA 2E2IB 1PFMA 3I4NB 3H91A 2RVLA 2EOTA 4J1MA 2BOSA 3TP7A 2K5QA 2NBFA 1HTLD 4DAYA 4I65A 1V1PB 2ZT9C 4HN7A 2J7ZA 2LY7A 4K2KA 5KIXA 3GD7A 5E3FA 3SEBA 5C3XA 2PYKA 4DN4M 1SYFA 4I7ZC 1OXUA 5K36G 3FPPA 1MSGA 2EYFA 1BR9A 3ND9A 1S5ED 3ND8A 3QB3A 5HURA 3MEHA 3FDTA 2O5IC 2HQEA 4XT1B 3E5SA 1TIID 4HTHA 2A6ED 2MJ8A 3S14B 3IFDA 1PTOB 3D6CA 2B63B 1W6JA 4M8AA 1PDQA 5KGUA 1O7ZA 4X3UA 5CV9A 3LWEA 2K05A 4PV1C 1BOSA 5IT9E 3NWTA 2A6EC 2D5DA 4ID6A 2Q8IB 2FFKB 2NN6I 4ULLA 5KEEA 3MVVA 5C0XG 2Q8TA 3J7AF 3Q23A 4A3DB 1Q90A 1EL0A 1CTMA 2MHVA 4XTCS 5KRUA 5DM73 4CJ0B 1I3QB 4BY1B 3OSOA 1GHKA 2R7ZB 4FXGC 2B2WA 1SNMA 3N52A 3R2IA 1BCPB 1IYVA 1TQOA 4WRDA 4AYBB 1J8IA 3Q0AA 1K83B 1OO9B 1DZ1A 1U4PA 3T13A 4Y7NB 1WTWA 1H9SB 1TY2A 1SNCA 3CQZB 2NB0A 1I4XA 3MC0B 2BCOA 1LTTD 4QMGA 3ZYYX 4XDXA 4IUNA 3EROA 2B8GA 4RGTA 1TR5A 4HCEA 2WV6D 2EJGC 3TZUA 3MZ5A 4FP5D 4F88A 1QB5D 2M00A 4WJWA 1NAPA 1MI2A 2RDHA 5CV6A 3K58A 3R2TA 5CBEE 1PRTB 1VDZA 1CFMA 3WOFA 3HRZC 3VR5A 1B3AA 3URYA 5FO9B 1JORA 3EFXD 1NUCA 1B9NA 2F0NA 3TP6A 2F0GA 3OOCA 3HG9A 2O4XA 3L3OC 4RAUC 5KYLA 3JAML 5M5XB 3P7JA 2K6AA 4UDUC 4DNTB 4K5WA 3HP3A 4ZQ3A 3LX0A 3MAQA 1G91A 5ELCA 4K5XA 1DD2A 3P1HA 2CHBD 4Q5VA 2L12A 3EQLC 1C4QA 4CJ2C 2NN6H 3ITPA 4FF3A 2R61A 1C48A 3D31A 3PUZA 4A3KB 2EVBA 5I6WA 3AU7A 1RKNA 5I2YA 3FKIB 4DNRB 1DOKA 3X3MA 1VF5C 5FLXL 4Z9CB 4FO2A 1V1PA 3MFYA 5CMDA 4QUCA 2HCCA 2RBMA 3P20A 1EYCA 4IQZA 2IWHA 2IW3A 2RA4A 3SK5A 3SR1A 1PYWD 2K04A 1RCVD 2EY5A 5BN4A 2EYPA 4JK1C 2JP1A 1ICWA 1NCVA 1X3PA 2EJFC 1G291 2KQ3A 3NSWA 1VMCA 1EU3A 4L8JA 5IGBA 3PUYA 2BDOA 4YIJA 5M5YB 5M5WB 2F1MA 2EYHA 1I50B 4R9WA 3NQTA 5J39A 1HTPA 1U4LA 4DGZA 4CGYB 3SVMA 2LMCB 2AWOA 3M4OB 3I70A 1PZID 3K59A 1JC7A 2QCPX 4HCSA 1JR0D 1LTID 3S1MB 4IUUA 1WTXA 2CW0D 1AEXA 3M7NA 3SHLA 1DM0B 4RCNA 1UAPA 3IL8A 3OHXC 4G7HC 4KTAA 2C9OA 1A2TA 1RJTA 2CW0C 3RLFA 4EQPA 4F7XA 4C3IB 2VUMB 3NTIA 4CKEA 4HAEA 1CZWA 2E74C 5EQ0A 5D65A 5IGGA 1EOTA 3KBXA 1Y8NB 4RHSA 4Q0FA 2MGSA 3TP5A 2B2UA 1OXXK 2A69D 2IJ0A 1B2TA 2A68D 4FF1A 4LAAA 4RKLA 2F0VA 1SYEA 1TWHB 1JCKB 2F3WA 1AN8A 3OWEB 1EY9A 5BN5A 4HEDA 2PZTA 4OO1H 4K14A 1TT2A 1Y8PB 1JOOA 2A68C 4S3SA 3MXUA 3ONAB 3C2PA 3QOLA 1G6ZA 3F2UA 5ISRA 1A2UA 1ENFA 1FD7D 1IL8A 2NTSA 5DAUA 4IALA 1JICA 4DK0A 2XSCA 1S5CD 1SJHD 1B53A 1NR2A 1BDOA 1TU2B 5C44B 4A3EB 4DAPA 1GUSA 1MBYA 5LL6S 2ID0A 4TQUS 1QNUA 5A35A 1SFOB 5D14A 3FEWX 1VMPA 3K5MA 5NUCA 4GZYC 1TKWB 3BDOA 1F2MA 1G2SA 1RHPA 1B1ZA 1TS3A 5I6YA 1QNKA 2RDGA 4KJNA 3NUCA 2QDBA 1ET9A 2N88A 5CR3A 1K8OA 2K01A 3A8JE 5JOBA 1BF4A 3A8IE 1EQTA 4RGNA 5AFWA 5EJWA 1PTOD 1QCBD 1SSOA 3NBHA 1B9MA 1XXGA 2VNUD 4DXFA 2EE1A 1SJED 1S5BD 3S2DB 4C3IG 3S16B 3NPPA 3SK6A 1HA5A 1PTOC 3VYRA 5CV5A 2DNCA 1GUGA 1C8CA 2L0CA 1ILPA 3I4MB 1DCZA 4BY7B 2F0HA 2R3ZA 2M9VA 2XNAC 2OEOA 5I9PA 1F9PA 1ESRA 1E2ZA 2LFNA 2WKCA 4V190 4DF7A 3NTKA 2B2VC 2Y0SB 3RZOB 2FINB 3NXWA 3PIO3 3HKZB 4DFAA 5C0XI 1BCPD 4ZAIA 1WTQA 1SEBD 5CYUA 2F0LA 3I73A 1HPCA 2A6HC 2EYJA 3CRKC 3VR4A 5JEAJ 2B2UC 3UI2A 4ZKBB 1R4PB 3DUZA 2F0TA 1Y69U 1BCPC 2DY7A 4J6HA 5EPKA 1FGBD 1GOZA 1U4RA 3JAME 4RA8A 4OIKA 2MPMA 1DXMA 2ICIA 3A8KE 2DN8A 4BBSB 1LACA 3S17B 2PW5A 4KKTA 2XRSD 1RTOA 5CBAE 4QUFA 3GTMB 2NTTA 3GTPB 2KECA 4C1NK 2DY8A 1STNA 4KY5A 1T5XD 1PRTD 4KMUC 4ZUJA 4FXDA 5FLXE 4NW2A 4RHRA 1WTOA 2VB3X 1EZ6A 3AMUA 4C3JG 4R8IA 1WCMB 3H0GB 1X3QA 1PRTC 4PMWA 2NVQB 5K36H 1FNWA 1H9RA 4IN3A 4WORA 4U68A 1PMRA 1SYBA 1D1IA 1D1KA 3K5NA 1RD9D 5TSSA 1Q8IA 2AUJD 2KCNA 3HGBA 4ME5A 1ENAA 3HOZB 2BA1A 1FR3A 3H3VC 3ERQA 4XIGS 3OIQA 3DEOA 1LTGD 4XQNA 1IHZA 3IAYA 3PMFA 2PCFB 2XWJB 1F2ZA 3RZDB 2JEBI 1KLGD 3K7AB 1HA6A 3R93A 1B44D 2BE5D 4H13C 3CKIB 5ELEA 5FKAC 2NYZD 1LT6D 1STEA 5T1GA 1OXSC 1TWGB 5JPMC 1I4QA 1AW7A 3EA6A 1ENCA 4HMJA 2F0OA 3HOVB 2BE5C 3KK7A 3KLSX 1TWCB 3KLSA 3KLRA 2XVSA 4F87A 4H0LC 4MIUA 2H4OA 2RKSA 4XQJA 1WTRA 1I4HA 5I4DA 3OPOA 1EYDA 3TP8A 2C5CA 1HQRD 4PMBA 2DNEA 4FNFA 5G3LD 2IT1A 3J81L 3SDZA 1V8QA 5KNCA 2I46A 2E2HB 1SE3A 1QILA 2B2TC 4E6IA 3D4WA 3DM1A 1SXTA 1JQYD 5EKLA 5E1FA 1SMYD 2ICEC 3NQIA 3BVMA 3O13A 4QCLA 1G2TA 3E0JA 1Y1WB 3U9OA 4IFDI 2F0SA 3C1EA 1TY0A 1RODA 2PW7A 1SYDA 3GTLB 1SMYC 3L9AX 2CVRA 3VR6A 4L6TB 2EY2A 3I3CA 3J80L 1LABA 1O80A 5IODA 1BUVT 3GO5A 1TS4A 2WKDA 1STHA 2L1BA 2OXPA 1MD2D 5IGFA 5JJZA 1QJOA 1S5DD 1GUOA 4HR7B 3WOEA 1LT3D 2EYLA 2M2LA 1XYIA 3I8ZA 3PUWA 1ILQA 3LNNA 3CHBD 2EY6A 5CV4A 1E0BA 3I90A 2PNRC 2AWNA 5A2QL 2D2CC 2FHTA 1HRJA 3FRPB 1EEFD 4ZUIA 1SNPA 2KA7A 4ZK9B 3DHQA 1M8AA 5IGDA 1HUNA 3VA5A 4LK1C 2Z4HA 2O2LD 1STYA 2ZXPA 4QB4A 2NWGA 1GXDC 1BBXC 1LTBD 4ZYSA 4IUQA 4DXGA 1U4MA 4N9TA 3GTKB 4KJOA 1TS2A 5FO7B 1D2BA 1IKMA 3V96A 5D3DA 4C56C 4QIWB 1Z6HA 4ZLTF 2KHSA 4FYDA 4K8IA 4U673 1AFPA 1IYUA 4QF4A 2TSSA 1CQVA 2FMMA 1D6EC 1RF2D 3D4RA 1Q3LA 3D8GA 2PZWA 1H9KA 3VA7A 4K5VA 3PV0A 1T5EA 3MHBA 4KN4C 2B2WC 2EXZA 5JEAG 4IFDG 2V4DA 2F0WA 4XT3B 1GUWA 2K1BA 1Z47A 5JAVA 3I91A 4UAIA 1LLRD 3EJIA 1KAAA 4O42A 1Z7TA 3TMEA 5CV7A 3PO3B 1CI3M 4C3HB 3GV3A 2OT2A 4R8NA 2X6LA 1KDCA 4BA2I 2ZXRA 4KY6A 2IX0A 1F2LA 1DOLA 3J7AV 3NP8A 1LO5D 1E2VA 2A69C 1O7LA 5EKKA 4G7ZC 1HCZA 5DNFA 5C4XB 3QIAA 4B9WA 4L63B 1WTVA 1EWCA 1B4OA 2EDGA 2WINB 1EY4A 1KLUD 1QG7A 1KABA 1WTPA 2J4XA 2IX3A 1WD1A 1UUPA 2A5HA 3D6WA 2L11A 1UNSA 3GTQB 1J9OA 2KOLA 2QF7A 1EY5A 5ELBA 3E6ZX 1CQFA 1Y1VB 2IPKD 3MXGA 4CBVA 2NUCA 1F2YA 1XX8A 2A73B 4G57A 1LTAD 1UEAB 1ESFA 1AZPA 2PPBC 3W3AA 1SNQA 3SK4A 1F9RA 1LT4D 3Q22A 1MGSA 2BA0A 2RSOA 3MFGA 3MXPA 2F0FA 5I9OA 1SAPA 1H9MA 2E75C 4FXKC 1CA6A 3W2DA 3DWAA 3M85A 1KDBA 1KTKA 2F0IA 2NVTB 2AQ3B 4IUTA 5C6AA 5KNBA 2Z4IA 5COYA 2F0UA 1ONLA 3BVZA 1WD0A 1EZ8A 5M3MB 1JWMD 4ILWA 2QKIC 4X3KA 1B50A 4C3HG 1EQVA 1BXTA 3NBIA 2SNSA 1D5XC 2NVXB 5E4XA 2G9HD 1D5MC 3TN2A 2KEEA 3J81E 2F0KA 5C4ZA 3A7LA 4X3TA 3K5OA 1V1OA 2RQXA 2RDFA 1M4VA 1ZYRD 4KD3A 2F0PA 3GP7A 4KI0A 3QWNA 3OMCA 4CJ1B 3VYUA 3AB9A 1ZYRC 1ZXTA 2XIWA 1A3UA 3I72A 2CQAA 1GHJA 5IGEA 4B9XA 4X3SA 1SNOA 4KKUA 3TBIB 4HMIA 5CV8A 1I4PA 4FF4A 5C4JB 3DXJC 2Q8RE 4CKBA 1I6HB 3K5LA 3DEPA 3D4DA 2JXMB 5IGCA 2A74C 4XXEA 3TSSA 4KN7C 2LKVA 4ODGA 2L4NA 5EPLA 4KHZA 3GQBA 2D9UA 2O5JC 5A2QE 2E2JB 2F0MA 1DONA 1CT1D 4TSSA 1STBA 1JE4A 4B08A 2HDLA 2PQEA 2L9HA 1BNZA 1LTRD 2SOBA 3TDQA 1GJXA 2K03A 4EGVA 3GTGB 4NP5A 1W6KA 4EQNA 1GUTA 3A7AB 4TKOB 1O7YA 5D3IB 3A56A 1SE4A 1I4RA 1NSNS 2D62A 5J1ZA 3K0YA 2YYZA 5EKIA 2IL8A 4NMZA 1YNJD 1EIGA 1R4QB 5DEHA 1OXVA 1A3TA 2EYMA 2PZUA 5M3FB 1SYGA 1LTSD 5KNDA 2F0DA 1YNJC 1TWFB 1X32A 1O78A 4ZRZA 2KUMA 2VXWA 4KKSA 1EY6A 4WFN3 2G9DA 2WACA 3QJYA 4HSVA 4NKLA 2K28A 1DOMA 3S1RB 3S15B 3KBGA 3PUVA 5C0XH 3T51B 3WDNA 4CHTB 4C2MB 3TZDA 3A54A 3SK8A 1ET6A 2SDFA 1PTOF 1CK1A 2NVYB 1SNDA 1LV9A 1OXTA 2EZVA 2JE6I 3GV6A 4CKCA 3R8BA 4H44C 4K6LA 2X69A 3FVQA 2L55A 3CU7A 5C3EB 3BVGA 2R92B 3KUPA 4K6DA 4KHVA 3V05A 1JB3A 3KF8A 4KV6A 4OL7A 2JA7B 1RTNA 1R9TB 2FJ2A 4RWSC 1HXYD 2FMCA 1L0XB 3HOUB 1EIHA 3G7LA 2B8FA 1AZQA 4ZKCB 3NE5B 1JWSD 5C5LA 1SYCA 2HCIA 4H7BA 2R93B 4HSPA 3PO2B 4XYQA 2B2YA 2N55A 5FK9C 3MWYW 1BCPF 1VCIA 2K5WA 5LHY1 5CC4A 1MSHA 2GA4B 1STAA 2K5DA 1PZJD 2SEBD 3PIP3 4OIJA 2PO4A 1DJRD 3BG3A 2K7VA 1Q12A 1VF7A 1RDPD 1IKLA 3HEJA 3MXNA 3OIPA 3J7YW 1F9QA 1SE2A 5C5MA 1XTCD 4DA2A 2NN6G 3OW7A 2OF1A 4A3MB 2HUGA 5J22A 3C46A 1PTOH 2JEAI 1WVLA 2KJXA 1QOHA 2L5TA 3H94A 1PRTF 4IURA 4OO1I 4ABNA 2E76C 1QWYA 2KEDA 2X6GA 4G7OC 3FMCA 5BN3A 3S1NB 2J0TD 4DK1A 5EBCA 3H09A 4K8JA 3VYTA 3VYSA 1D5ZC 2TMPA 4TRDA 1TVXA 3NK9A 1Q1EA 4MN3A 3BDLA 1HHVA 3HOXB 3K6OA 2IX1A 1STGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HN7 A;  2RQX A;  2JSO A; 
#chains in the Genus database with same CATH topology
 1SBB B;  4KY7 A;  1V43 A;  4KD4 A;  4MHE A;  1MHW C;  1DGS A;  2R7Z H;  2QEJ C;  2IHE A;  4A3B B;  3H6M A;  1L0Y B;  4LF4 L;  5IP7 H;  1XMQ Q;  2UUC L;  2XN9 C;  1I4G A;  3A55 A;  2F0Q A;  4IUP A;  3L0O A;  1PH7 A;  2JA5 B;  1K83 H;  1V1Q A;  2R92 G;  3RMH A;  4C1N I;  4Y7N H;  5JVG 3;  5IOC A;  3I4L A;  2JA7 G;  1PH3 A;  3IKJ A;  1IBK L;  1BQQ T;  3S2H B;  4UP9 A;  4G4K A;  1E2W A;  5JVH 3;  2AUK A;  4JW0 A;  2DUD A;  4BBR B;  1P16 A;  4PMC A;  5IT9 L;  3NWS A;  3CQZ H;  1HQM C;  1CM9 A;  5EPJ A;  1K73 C;  1IW7 D;  1A15 A;  2WP8 J;  3AFP A;  2SNM A;  2BH8 A;  5HGT A;  1KQS A;  5LMN W;  5JEA H;  5ELD A;  4IFD H;  2EPB A;  1VQO A;  5I2X A;  3D3R A;  4BA1 I;  1VQ5 A;  1I6V C;  3C1F A;  4PQX A;  1HFG A;  2FXQ A;  5C0X J;  3SE0 A;  3J81 i;  3NEL A;  4DV4 Q;  3VR3 A;  2E2D C;  1IW7 C;  1Y1W G;  3OWF A;  1ZEQ X;  2UU9 Q;  1Q1B A;  2EYO A;  1F9S A;  1E1O A;  4A3G B;  1PFS A;  2B2V A;  4GOP B;  4LF8 Q;  1Y8O B;  4BWG B;  1LT5 D;  5JPN C;  1HR0 Q;  1PFB A;  4LMQ D;  5IWA Q;  3M3Y B;  3LWU A;  4R4T A;  3N6R A;  1S5F D;  3J81 c;  1SRO A;  1HFN A;  3QG1 A;  1CHP D;  4JC0 A;  3KJP A;  5EGT A;  1N33 Q;  4UPA A;  1TS5 A;  3HOY B;  3SXH A;  2L15 A;  1L2F A;  5IIF A;  2R6G A;  1XMO L;  2B2Y C;  2K32 A;  4DAY B;  4OO1 G;  5M5X H;  1YI2 A;  2B39 A;  3J80 i;  3PSI A;  5G3L F;  5LL6 X;  4NXM L;  3BZD B;  1CKM A;  3BS1 A;  4K2L A;  1AP0 A;  2ENB A;  2R7F A;  1Q86 C;  4A93 B;  1U9R A;  1GVP A;  3HOW B;  2JYO A;  1EU4 A;  2ZJQ A;  2BDN A;  4NB3 A;  3CCM A;  2CKZ B;  5ELF A;  2RCF A;  4A3M G;  3OMG A;  1QE6 A;  3F2C A;  3MTS A;  3H3V H;  2AQ2 B;  1EUJ A;  2F0J A;  1QVG A;  1H9S A;  4LJZ C;  3M4Y A;  4FVM A;  1EFW A;  4DUY L;  3CCL A;  1EYA A;  1GD7 A;  4BS9 A;  3DMU A;  3L7Z C;  1EY7 A;  1FNU A;  4A3K H;  2WII B;  5K5P A;  5KYI A;  1Z9F A;  2MO1 A;  5C4H A;  1JOQ A;  1EEI D;  2QIL A;  3FKI H;  2B3G A;  3C3L A;  2ZTD A;  1EY8 A;  4KK7 A;  1GUN A;  4FF2 A;  4J8Q A;  4IZ8 A;  2AQ1 B;  3R3O A;  1BO0 A;  1NR4 A;  1S4Z A;  1VQA A;  1ZKO A;  3DWQ A;  2NZO A;  5T1I A;  4A75 A;  3VR2 A;  3T4A C;  4XQQ A;  1JOK A;  4HJ8 A;  2UXC L;  3MA2 B;  2F03 A;  4RFB A;  5JJK A;  4OHJ A;  3P75 A;  2E5L L;  5FO8 B;  1SDF A;  5IY0 A;  4RCO A;  2I07 B;  4OGQ C;  3IFT A;  1H9J A;  4RH6 A;  4DU9 A;  1EY0 A;  1II3 A;  3CCQ A;  3DWP A;  3S9W A;  2F0E A;  4EQO A;  4NDX A;  2JA8 B;  1JMC A;  2UUA L;  3I4O A;  2ZXO A;  1X3F A;  2JA5 G;  5M9O A;  4LF7 Q;  3CCJ A;  3I2Z A;  5M5Y H;  1HUM A;  3G6J B;  2F3V A;  4DAM A;  1XWE A;  3GTJ B;  3QOJ A;  5M5W H;  2EJM A;  4YWM A;  4IOC A;  1KAW A;  4O1N A;  4A3F B;  1I50 H;  5IYC H;  1KDA A;  3V2T A;  3K57 A;  2N3S A;  1PXU A;  4A3J B;  2JA6 B;  1X55 A;  2C35 B;  3Q6S A;  4KLK A;  1PZK D;  3M4O H;  4C3J B;  4A3C G;  1YNN D;  1G8Z D;  1KRT A;  1A3V A;  2MP1 A;  5IYB G;  3GTO B;  3S1M H;  2LS0 1;  5FOB B;  3QO2 A;  3U9S A;  1F77 A;  4JYA Q;  4A76 A;  1K0S A;  2D0O A;  4JBW A;  4B3S Q;  2XRQ D;  2VB2 X;  4XYO A;  3Q24 A;  2K33 A;  3X3N A;  4UP7 A;  2WB1 B;  3BYT B;  4B3R Q;  1EOV A;  1X3G A;  3KF8 B;  3PUX A;  3PO3 G;  1K8M A;  4EVO A;  1YNN C;  4OX9 L;  3EN2 A;  1OTC A;  3F8T A;  1YBY A;  3L2P A;  3S1Q B;  3BDC A;  1PFN A;  2MUY A;  4C3I H;  1UE7 A;  2MNA A;  2VUM H;  2OTJ A;  2EY1 A;  2AKW B;  4N9P A;  1FYC A;  3CRL C;  1CKO A;  4JI4 Q;  3CCV A;  1TWA B;  3BYY B;  4A3I B;  4LWC A;  4IPH A;  4DR7 Q;  1X6O A;  2UXB L;  2HIX A;  4F8M A;  4QQB X;  5AJ3 L;  4DV0 Q;  4PNY A;  1CZG A;  3HS0 C;  4AQY Q;  1JT8 A;  4MZ9 A;  4DV2 L;  3HZX A;  3T53 B;  3HOY G;  1J6Q A;  4A4I A;  4O2D A;  5C4X G;  1TWH H;  3NTH A;  2VQF Q;  1VQB A;  4A3L G;  4P2C B;  2XWB B;  1EWH A;  3M7G A;  5BR8 L;  3FPU B;  4AIM A;  2JSO A;  4V0B A;  2A6H D;  4DAV A;  1FNV A;  5IP9 H;  4DR3 L;  2RSN A;  4MTN A;  4LFB L;  5COR A;  5CGK A;  4DV7 Q;  4UHV A;  1WYD A;  2Z1C A;  4DNI A;  1Q8K A;  3RUZ A;  2JQO A;  4JBM A;  3RN2 A;  2YU9 B;  3T16 A;  1S40 A;  3J80 E;  2F4I A;  3T56 B;  1JWU D;  3RD4 A;  1E22 A;  3MXN B;  1DYQ A;  4M1U B;  4HJ7 A;  2KVM A;  4DV3 L;  4RGO S;  5DM6 3;  2KCC A;  4DR4 L;  2Z6K C;  5FJ8 G;  1CHQ D;  4IFD J;  1EFI D;  2Z8L A;  1KC8 C;  4LF9 Q;  5L37 A;  5F2D A;  1A6X A;  3OTO Q;  4O0A A;  1HR0 W;  2HDM A;  2B2T A;  5C3W A;  3U50 C;  2WAQ B;  5EBD A;  3A0J A;  1QZG A;  3E0E A;  1G6P A;  2H1E A;  4RKB A;  1L0W A;  3EVQ A;  3NHH A;  4RGM A;  5E4W C;  1CSP A;  1KNA A;  1CA5 A;  1ML0 D;  5C44 H;  4IUV A;  4A3E H;  3KF6 B;  2NZ1 D;  5GAG C;  2Z9H A;  3PQI A;  2PMZ B;  1PLF A;  1KNE A;  1VQH A;  1NE3 A;  3DM3 A;  3IRB A;  5HY6 A;  2E2I B;  4HIM A;  4OEM B;  4HID A;  1PFM A;  3I4N B;  3H91 A;  1SN8 A;  2RVL A;  2EOT A;  4J1M A;  1SFO H;  1BKB A;  2BOS A;  4GN3 B;  3TP7 A;  2K5Q A;  3HFZ B;  4FDB A;  2NBF A;  4JCV E;  1HTL D;  4DR5 L;  4DAY A;  4I65 A;  1V1P B;  2ZT9 C;  4HN7 A;  2J7Z A;  2LY7 A;  4K2K A;  5KIX A;  3GD7 A;  4YHH L;  5E3F A;  3SEB A;  5C3X A;  2F3I A;  3BU2 A;  2PYK A;  4DN4 M;  2JA9 A;  1NBW A;  1K8G A;  4LF6 Q;  1SYF A;  4I7Z C;  1OXU A;  5K36 G;  3FPP A;  2ATW A;  4GKK Q;  3PCO B;  1MSG A;  2EYF A;  1BR9 A;  3ND9 A;  3KYH C;  1YHQ A;  1S5E D;  3ND8 A;  3QB3 A;  5HUR A;  3MEH A;  3FDT A;  4JI1 Q;  3U4V A;  5M3M G;  2O5I C;  2HQE A;  4XT1 B;  4L5Q A;  3E5S A;  1TII D;  4HTH A;  1WOC A;  2A6E D;  2VS1 A;  2UXD Q;  2MJ8 A;  2CH4 W;  1UEB A;  2UUC Q;  3S2D H;  3IFD A;  3S14 B;  1PTO B;  5LMU L;  3S16 H;  1Q81 C;  3D6C A;  4P71 A;  5IYD G;  2B63 B;  1W6J A;  2GN5 A;  4M8A A;  3TQY A;  1PDQ A;  4R4Q A;  1Q82 C;  5KGU A;  1O7Z A;  4X3U A;  5CV9 A;  3LWE A;  2K05 A;  3JC6 6;  4PV1 C;  3I4M H;  1BOS A;  1PH9 A;  5IT9 E;  1IBL Q;  3NWT A;  2A6E C;  3ULP A;  2D5D A;  4ID6 A;  4IO9 A;  2Q8I B;  4BY7 H;  2FFK B;  2NN6 I;  2QGQ A;  3A5Z B;  4ULL A;  5KEE A;  3MVV A;  2MO0 A;  5C0X G;  2Q8T A;  3J7A F;  3Q23 A;  4A3D B;  5LMN Q;  2V1C C;  1Q90 A;  4DV5 L;  1EL0 A;  3AQQ A;  1L1O C;  1CTM A;  2MHV A;  1HZB A;  4XTC S;  5KRU A;  3RZO H;  5DM7 3;  1U0L A;  4CJ0 B;  1I3Q B;  4BY1 B;  2K75 A;  3OSO A;  3AEV A;  3BZC A;  1GHK A;  3PF4 A;  1N36 L;  2RHS B;  4BXX G;  1IXR A;  2R7Z B;  4FXG C;  2ZJR A;  2B2W A;  1SNM A;  3N52 A;  1SRU A;  3R2I A;  1BCP B;  1IYV A;  4KHP L;  1TQO A;  4WRD A;  4AYB B;  1J8I A;  3Q0A A;  1K83 B;  1OO9 B;  1DZ1 A;  1U4P A;  3T13 A;  4PZ8 A;  3RLO A;  2OTL A;  4Y7N B;  1WTW A;  1H9S B;  4BBS H;  3S17 H;  1E1T A;  4NXM Q;  1TY2 A;  1SNC A;  3CQZ B;  3BZK A;  2NB0 A;  1I4X A;  3GTM H;  3MC0 B;  2BCO A;  1LTT D;  3GTP H;  4QMG A;  3ZYY X;  4XDX A;  1NMF A;  4IUN A;  3ERO A;  4JG2 A;  1VQJ A;  2B8G A;  1VQN A;  4RGT A;  1TR5 A;  4HCE A;  4DUY Q;  4QJF A;  1E24 A;  3CCS A;  1WJJ A;  2WV6 D;  2EJG C;  3TZU A;  3MZ5 A;  4FP5 D;  4F88 A;  1QB5 D;  1MIU A;  2M00 A;  4WJW A;  1NAP A;  2OCE A;  1MI2 A;  1JJ2 A;  2RDH A;  4DKA C;  5CV6 A;  4GOP C;  3K58 A;  3R2T A;  5CBE E;  1PRT B;  1VDZ A;  1CFM A;  3WOF A;  1WCM H;  3H0G H;  3HRZ C;  3VR5 A;  1Q7Y C;  1B3A A;  3M9B A;  3URY A;  5FO9 B;  3EFX D;  1JOR A;  1NUC A;  1B9N A;  2F0N A;  3TP6 A;  2F0G A;  3OOC A;  2D0P A;  3HG9 A;  3FHW A;  2O4X A;  2MFI A;  2NVQ H;  1NJI C;  2UXC Q;  3L3O C;  2E5L Q;  4RAU C;  5KYL A;  3JAM L;  5M3F G;  5M5X B;  3P7J A;  2K6A A;  4UDU C;  2PI2 E;  4DNT B;  4K5W A;  3HP3 A;  1K3R A;  3CPF A;  4ZQ3 A;  3LX0 A;  3MAQ A;  1G91 A;  2UUA Q;  5ELC A;  4YY3 Q;  3HOZ H;  2F4V L;  4K5X A;  1DD2 A;  5ELN A;  3P1H A;  2CHB D;  4Q5V A;  2L12 A;  3EQL C;  1C4Q A;  1IBM Q;  4CJ2 C;  2NN6 H;  3ITP A;  1VQF A;  4FF3 A;  2R61 A;  2VZA A;  1C48 A;  3D31 A;  3PUZ A;  2AHO B;  4A3K B;  2EVB A;  2CWA A;  1VS0 A;  4YCU A;  5I6W A;  3AU7 A;  1RKN A;  5I2Y A;  3FKI B;  3UDI A;  4DNR B;  5IE8 A;  1DOK A;  3X3M A;  1XNQ L;  1GM5 A;  1AH9 A;  1VF5 C;  5FLX L;  3LGJ A;  4Z9C B;  4FO2 A;  1HZ9 A;  1HZC A;  1NTG A;  3K7A H;  4R4O A;  1V1P A;  4WJ3 M;  3MFY A;  1BVS A;  1S3O A;  5CMD A;  4QUC A;  2HCC A;  2RBM A;  3SGI A;  3P20 A;  1EYC A;  4IQZ A;  2IWH A;  2IW3 A;  2RA4 A;  3ERS X;  3CMA A;  4LFA L;  1CSQ A;  3SK5 A;  3SR1 A;  3UE0 A;  1TWG H;  1PYW D;  2K04 A;  1RCV D;  1YNX A;  1KL9 A;  2EY5 A;  5BN4 A;  4X6A H;  2EYP A;  4JK1 C;  4DR2 Q;  2JP1 A;  1I94 L;  1ICW A;  1NCV A;  3HOV H;  1X3P A;  3EBE A;  1TWC H;  3I7F A;  4DR1 Q;  1IL2 A;  2EJF C;  1G29 1;  5HGQ A;  4JI0 Q;  2KQ3 A;  2XTI A;  3NSW A;  5C3E G;  1VMC A;  2K5H A;  1EU3 A;  3CC7 A;  3K81 C;  4L8J A;  2UXB Q;  5IGB A;  3PUY A;  2BDO A;  4YIJ A;  4JI6 L;  1FGU A;  5M5Y B;  5M5W B;  2F1M A;  2EYH A;  1I50 B;  4R9W A;  5J3B A;  4NXN Q;  3NQT A;  5J39 A;  1N32 L;  1HTP A;  1U4L A;  4DGZ A;  3HOU G;  4CGY B;  3SVM A;  2LMC B;  1VQL A;  2AWO A;  3M4O B;  3I70 A;  1PZI D;  3K59 A;  1JC7 A;  2K14 A;  2QCP X;  4HCS A;  1JR0 D;  1LTI D;  4ALP A;  1XPO A;  3ER0 A;  1J5E Q;  2N78 A;  4IUU A;  3S1M B;  2VQE L;  1WTX A;  2R93 G;  2CW0 D;  1AEX A;  2ZTC A;  3M7N A;  4CDE C;  1M1K C;  3SHL A;  3PO2 G;  4LFB Q;  1DM0 B;  4RCN A;  2E2H H;  1UAP A;  3IL8 A;  3OHX C;  4G7H C;  4KTA A;  4B3T L;  2C9O A;  1A2T A;  4LFC L;  1RJT A;  2CW0 C;  2QW7 A;  4MNO A;  3RLF A;  1A0I A;  4EQP A;  2ZM6 Q;  4F7X A;  1VQ6 A;  4C3I B;  4DR4 Q;  2VUM B;  3NTI A;  1Y1W H;  4CKE A;  4HAE A;  1CZW A;  3F2D A;  2E74 C;  3J81 j;  5EQ0 A;  5D65 A;  3RLN A;  5IGG A;  1XTD A;  1EOT A;  3GTL H;  4I7A A;  3KBX A;  1Y8N B;  4RHS A;  4Q0F A;  2LXJ A;  2MGS A;  2B2U A;  3TP5 A;  1OXX K;  2A69 D;  4GN4 B;  2IJ0 A;  1B2T A;  2A68 D;  4FF1 A;  4LAA A;  4RKL A;  2F0V A;  1SYE A;  1TWH B;  1JCK B;  2F3W A;  3UDX A;  1AN8 A;  3OWE B;  1EY9 A;  5BN5 A;  1X56 A;  1VQP A;  4HED A;  2PZT A;  4OO1 H;  1PH8 A;  4K14 A;  3U4Z A;  1TT2 A;  1Y8P B;  1JOO A;  2A68 C;  1YIT A;  4S3S A;  3MXU A;  3ONA B;  3J80 c;  3C2P A;  3QOL A;  1G6Z A;  3VDY A;  3F2U A;  5ISR A;  4YHH Q;  1Y14 B;  1A2U A;  1ENF A;  3K0X A;  1FD7 D;  1IL8 A;  2JN4 A;  2NTS A;  5DAU A;  4IAL A;  1JIC A;  4H02 A;  1TXY A;  1HH2 P;  4DK0 A;  2DJG C;  4X64 Q;  2XSC A;  1S5C D;  1SJH D;  1LTL A;  1B53 A;  1YEZ A;  1NR2 A;  1K3B C;  1BDO A;  1TU2 B;  4X62 L;  3GTK H;  5C44 B;  2EXD A;  3S24 A;  4DAP A;  3CME A;  4A3E B;  2PNH A;  3HOX G;  4EX5 A;  3NEM A;  1GUS A;  1HJP A;  1MBY A;  1XPU A;  5LL6 S;  2ID0 A;  4TQU S;  3PGZ A;  3QR8 A;  4JBJ A;  4A3B G;  1QNU A;  5A35 A;  5LMU Q;  1SFO B;  5D14 A;  3FEW X;  1VMP A;  4JVZ A;  3K5M A;  4JI5 L;  4DV6 Q;  2A1A A;  5NUC A;  4GZY C;  1TKW B;  1PH2 A;  3BDO A;  4JI7 L;  1F2M A;  1G2S A;  1RHP A;  1ASZ A;  1B1Z A;  4J15 A;  1NY4 A;  1TS3 A;  3PIO A;  1QVC A;  5I6Y A;  1UE1 A;  1QNK A;  5IYC G;  2RDG A;  4KJN A;  3NUC A;  4HJ9 A;  1N34 L;  2QDB A;  4BBR G;  1IZ6 A;  1M90 C;  3RR5 A;  4DV5 Q;  1ET9 A;  2N88 A;  1YHB A;  5CR3 A;  1K8O A;  1B7Y B;  2K01 A;  4N8F A;  3A8J E;  5JOB A;  1BF4 A;  3A8I E;  4A3C H;  3UE1 A;  2Q2I A;  4QGU A;  1EQT A;  5IYB H;  2I5L X;  4RGN A;  2KHJ A;  5AFW A;  5EJW A;  3AYH B;  3G6E A;  1PTO D;  1FVI A;  1QCB D;  1SSO A;  3E9I A;  3NBH A;  1B9M A;  4GKJ Q;  4IPD A;  1XXG A;  4X65 Q;  4GNX A;  2K52 A;  1N36 Q;  2VNU D;  4DXF A;  4ME3 A;  4A3G G;  2IHF A;  2EE1 A;  1SJE D;  1S5B D;  3PO3 H;  3S2D B;  4C3I G;  3S16 B;  4KHP Q;  4C3H H;  4P73 A;  1SE8 A;  3NPP A;  3SK6 A;  1HA5 A;  1PTO C;  3VYR A;  5CV5 A;  2DNC A;  2A19 A;  1GUG A;  1C8C A;  2L0C A;  1ILP A;  5IT9 c;  3I4M B;  1KIX A;  3W1G A;  1LUZ A;  3OYY A;  1DCZ A;  2IY5 B;  4BY7 B;  2F0H A;  2R3Z A;  1XMQ L;  2M9V A;  2XNA C;  2OEO A;  5I9P A;  4HJ5 A;  1VQ9 A;  1F9P A;  1ESR A;  1E2Z A;  2LFN A;  2WKC A;  4V19 0;  4DF7 A;  4A93 G;  1RIP A;  3HOW G;  3NTK A;  3UDG A;  4HIK A;  2K5N A;  1SMX A;  2B2V C;  2Y0S B;  3RZO B;  5C4X H;  2FIN B;  4WJ4 A;  4B3M L;  3NXW A;  4A3L H;  3KLW A;  3PIO 3;  3HKZ B;  4DFA A;  5C0X I;  1BCP D;  2DJF C;  4ZAI A;  1VQ4 A;  2WB1 E;  1WTQ A;  1SEB D;  5CYU A;  5FLM G;  2F0L A;  3I73 A;  3H15 A;  4UY8 C;  1HPC A;  2A6H C;  2EYJ A;  1O7I A;  3CRK C;  3VR4 A;  5JEA J;  2B2U C;  3UI2 A;  4ZKB B;  1R4P B;  4YWL A;  3DUZ A;  2F0T A;  3GTQ H;  1Y69 U;  1KHI A;  1BCP C;  2DY7 A;  2UU9 L;  4J6H A;  5EPK A;  1FGB D;  1GOZ A;  1U4R A;  3JAM E;  4RA8 A;  2UUB L;  4OIK A;  5FJ8 H;  2MPM A;  1DXM A;  1WI5 A;  2ICI A;  3A8K E;  1Y1V H;  2DN8 A;  1Q46 A;  4BBS B;  1NNX A;  1LAC A;  3S17 B;  4RMF A;  4K0K Q;  2PW5 A;  1I5F A;  4KKT A;  2XRS D;  2Z0S A;  3GDE A;  1RTO A;  3KOJ A;  5CBA E;  4QUF A;  1N33 L;  3GTM B;  4DK3 C;  2NTT A;  3GTP B;  2KEC A;  2JA8 G;  4C1N K;  2DY8 A;  1HNX L;  1STN A;  4KY5 A;  1EIY B;  1T5X D;  1P8L A;  1EYG A;  1PRT D;  4KMU C;  4ZUJ A;  4FXD A;  4A3F G;  2HQL A;  5FLX E;  2CH4 A;  4NW2 A;  1EQQ A;  4RHR A;  1WTO A;  2JA6 G;  4A3J G;  2VB3 X;  1EZ6 A;  3AMU A;  4C3J G;  1D7Q A;  3FP9 A;  2N49 A;  2CWP A;  4R8I A;  1CKN B;  1WCM B;  1YIJ A;  3H0G B;  4IOA A;  1X3Q A;  1PRT C;  4PMW A;  3T1Y Q;  2DGY A;  4IJL A;  1XNR L;  2K50 A;  4LFA Q;  2NZH A;  2WAQ E;  2NVT H;  2NVQ B;  5K36 H;  1FNW A;  1PVO A;  1H9R A;  4IN3 A;  4P75 A;  4WOR A;  4U68 A;  5H1S E;  1PMR A;  1SYB A;  2WB1 G;  1AE3 A;  1D1I A;  1I94 Q;  1D1K A;  3K5N A;  2PMZ E;  1RD9 D;  1EWI A;  5TSS A;  4LF4 Q;  1Q8I A;  1PH4 A;  2AUJ D;  2KCN A;  5M3M H;  3HGB A;  4ME5 A;  1ENA A;  3TRZ A;  3U58 A;  3HOZ B;  2BA1 A;  4JI6 Q;  4A3I G;  4JV5 L;  1FR3 A;  3H3V C;  3TS0 A;  3ERQ A;  4XIG S;  3OIQ A;  3DEO A;  1LTG D;  1IBK Q;  2NVX H;  4IPC A;  4Y52 H;  4XQN A;  2HT1 A;  3I4M G;  5IYD H;  1IHZ A;  4P72 A;  3IAY A;  3DLL A;  3PMF A;  2PCF B;  5JJL A;  3W5O A;  4JI8 L;  2XWJ B;  1HNZ L;  1F2Z A;  3RZD B;  2JEB I;  1KLG D;  3F2B A;  2KCT A;  3K7A B;  1HA6 A;  3R93 A;  1B44 D;  2BE5 D;  1HZA A;  4H13 C;  3CKI B;  5ELE A;  5FKA C;  2NYZ D;  1LT6 D;  1STE A;  5T1G A;  1OXS C;  2PQA A;  1TWG B;  4N8X 1;  5JPM C;  1I4Q A;  1AW7 A;  3EA6 A;  1IYJ B;  1ENC A;  3HKS A;  4LFC Q;  3CC4 A;  1HNW L;  2ZTE A;  4HMJ A;  2F0O A;  3HOV B;  2BE5 C;  3KK7 A;  3EIV A;  3KLS X;  1TWC B;  3KLS A;  3J7Z C;  3KLR A;  3BJU A;  5GAD C;  2CFM A;  2HHH L;  2XVS A;  4F87 A;  3NEN A;  2K5V A;  2Z6B A;  1JJC B;  4BXX H;  4H0L C;  2WAQ G;  4MIU A;  2H4O A;  5C4J H;  2RKS A;  4XQJ A;  1WTR A;  2MQH A;  1XMO Q;  3CC2 A;  1PV4 A;  1I6H H;  1PH5 A;  1I4H A;  5I4D A;  3OPO A;  3UDF A;  1FJG L;  1YVC A;  4JI4 L;  1EYD A;  3TP8 A;  2C5C A;  4DR7 L;  1X65 A;  1HQR D;  4PMB A;  3I4N G;  4OWT B;  2DNE A;  4FNF A;  3E3X A;  1LYL A;  5G3L D;  4AQY L;  1VQ7 A;  2IT1 A;  3J81 L;  3SDZ A;  1V8Q A;  5KNC A;  1VQD A;  4JI2 L;  2I46 A;  2E2J H;  3KJO A;  2E2H B;  1SE3 A;  2OQK A;  2Q2T A;  1YHA A;  2K4K A;  2VQF L;  1QIL A;  2B2T C;  3CD6 A;  4E6I A;  3D4W A;  1MKH A;  3DM1 A;  1SXT A;  1T9H A;  1VQM A;  1JQY D;  5EKL A;  5E1F A;  1SMY D;  2I5M X;  2ICE C;  3NQI A;  3BVM A;  1NMG A;  3CAM A;  4DV7 L;  3O13 A;  3GTG H;  4QCL A;  1G2T A;  3G48 A;  3E0J A;  1Y1W B;  3U9O A;  4IFD I;  2F0S A;  3C1E A;  1TY0 A;  1WCM G;  1ROD A;  2PW7 A;  1SYD A;  3GTL B;  1SMY C;  4AYB E;  3L9A X;  2CVR A;  3VR6 A;  4L6T B;  2EY2 A;  3I3C A;  3J80 L;  1LAB A;  1O80 A;  5IOD A;  1BUV T;  3GO5 A;  1TS4 A;  2WKD A;  3OTO L;  1STH A;  2L1B A;  2OXP A;  1MD2 D;  3RN5 A;  5IGF A;  5JJZ A;  1QJO A;  1S5D D;  3TEH B;  1GUO A;  4HR7 B;  3WOE A;  1LT3 D;  5M3F H;  4LF5 L;  2EYL A;  2M2L A;  1XYI A;  2B63 G;  3I8Z A;  2OQ0 A;  4JI3 L;  3PUW A;  1ILQ A;  3LNN A;  4JI7 Q;  3CHB D;  1TWF H;  2EY6 A;  5CV4 A;  1E0B A;  3I90 A;  1PA6 A;  2PNR C;  2AWN A;  5A2Q L;  2D2C C;  2FHT A;  3E9H A;  3FRP B;  1HRJ A;  1EEF D;  4ZUI A;  1SNP A;  1K0R A;  2KA7 A;  4ZK9 B;  3NBH B;  1H95 A;  1A63 A;  2F52 A;  4GNX B;  3DHQ A;  1M8A A;  5IGD A;  3S1R H;  1HUN A;  3VA5 A;  4LK1 C;  2Z4H A;  4A3D G;  5GRO A;  2O2L D;  3S15 H;  1STY A;  2P5Z X;  2YV5 A;  2ZXP A;  3H3V I;  1SR3 A;  4QB4 A;  2NWG A;  3I56 A;  1GXD C;  4C2M H;  1BBX C;  1LTB D;  4ZYS A;  4IUQ A;  4DXG A;  1U4M A;  4N9T A;  4OX9 Q;  3GTK B;  4L5T A;  2I5H A;  4GKK L;  4BY1 G;  1CKN A;  4KJO A;  1SLJ A;  1TS2 A;  5FO7 B;  1B8A A;  1D2B A;  1IKM A;  2NVY H;  2R7Z G;  3V96 A;  5IP7 G;  1QVF A;  3KDF A;  5D3D A;  1JJG A;  4C56 C;  4QIW B;  1Z6H A;  4AYB G;  4ZLT F;  5AJ3 Q;  3G4S A;  2KHS A;  2HIV A;  4FYD A;  1QUQ A;  2VL6 A;  4DV2 Q;  4K8I A;  4U67 3;  1AFP A;  2UXD L;  2ALY B;  1IYU A;  4QF4 A;  5C3E H;  2TSS A;  2R92 H;  1CQV A;  2FMM A;  1D6E C;  1RF2 D;  3D4R A;  1Q3L A;  3D8G A;  3CP0 A;  2HD3 A;  2JA7 H;  2PZW A;  5BR8 Q;  1R9T H;  4X66 L;  2LSS A;  1H9K A;  3VA7 A;  4DR3 Q;  4K5V A;  3HOU H;  3PV0 A;  3OW2 A;  1T5E A;  1IBL L;  3MHB A;  4APV A;  4KN4 C;  2B2W C;  2EXZ A;  4B3M Q;  5JEA G;  3K7U C;  4IFD G;  2V4D A;  2F0W A;  2QA4 A;  4XT3 B;  1GUW A;  2K1B A;  1Z47 A;  5JAV A;  3I91 A;  5JJI A;  2R93 H;  1W3S A;  4UAI A;  5LMN L;  1LLR D;  3PO2 H;  3EJI A;  4DV3 Q;  4OEL B;  1BBU A;  1KAA A;  4O42 A;  1Z7T A;  3TME A;  1JB7 A;  5CV7 A;  3PO3 B;  3STB D;  4LNQ A;  1CI3 M;  4C3H B;  1YJW A;  3K8A A;  2B29 A;  3GV3 A;  2OT2 A;  2YTY A;  2UUB Q;  4QIW E;  4R8N A;  2X6L A;  1KDC A;  4BA2 I;  2ZXR A;  3STB C;  4KY6 A;  4QY7 A;  1C7Y A;  1XPR A;  2IX0 A;  3CF5 A;  5GAE C;  1F2L A;  1DOL A;  4DPG A;  3J7A V;  4DR6 L;  3D0F A;  4L5R C;  1K9M C;  3NP8 A;  1LO5 D;  1E2V A;  2Z6K A;  4DUZ L;  2A69 C;  3T1H L;  4DR5 Q;  1O7L A;  5EKK A;  4G7Z C;  1HCZ A;  5DNF A;  5C4X B;  3QIA A;  3ZJY C;  3ULL A;  4B9W A;  1HNX Q;  4L63 B;  1WTV A;  4GLV B;  1EWC A;  1B4O A;  2EDG A;  1ICF B;  2WIN B;  3JAM i;  1EY4 A;  1KLU D;  4A3M H;  1QG7 A;  1KAB A;  4A3K G;  1WTP A;  2J4X A;  2IX3 A;  3B6Y A;  1WD1 A;  1UUP A;  4DK6 C;  2A5H A;  3FKI G;  3D6W A;  2L11 A;  1UNS A;  2PI2 A;  3GTQ B;  1J9O A;  3K80 C;  2KOL A;  1V9P A;  2QF7 A;  1EY5 A;  3W1B A;  3JAM c;  1XNR Q;  5ELB A;  4CDF C;  1XJV A;  3S1N H;  1CUK A;  2I0Q A;  3E6Z X;  1CQF A;  1Y1V B;  2IPK D;  3MXG A;  4GLA C;  4CBV A;  2NUC A;  1F2Y A;  1XX8 A;  4OWW B;  2A73 B;  2QEX A;  4G57 A;  4JBK A;  1LTA D;  1UEA B;  2XGT A;  1ESF A;  1AZP A;  2PPB C;  1X9N A;  1VQC A;  3HOX H;  3W3A A;  1SNQ A;  3SK4 A;  1F9R A;  1LT4 D;  4CDC C;  2BH2 A;  4JV5 Q;  1YJ9 A;  4A3B H;  2QDL A;  1A8V A;  3Q22 A;  5FLX c;  1MGS A;  3ULJ A;  2JJQ A;  5DLQ E;  2PQA B;  2BA0 A;  2RSO A;  3MFG A;  2JA5 H;  4GLX A;  4YY3 L;  4JI8 Q;  3MXP A;  1HNZ Q;  2F0F A;  5I9O A;  1SAP A;  1IBM L;  1H9M A;  2E75 C;  4FXK C;  2OWO A;  4IJH A;  2KCM A;  1CA6 A;  3W2D A;  3S2H H;  3DWA A;  3M85 A;  4DV1 L;  1KDB A;  1KTK A;  4BBR H;  2F0I A;  2NVT B;  2EIF A;  5GAH C;  2AQ3 B;  4IUT A;  1W2B A;  5C6A A;  5KNB A;  1C9O A;  1HNW Q;  1UE5 A;  2Z4I A;  5COY A;  2F0U A;  1VQ8 A;  1ASY A;  1ONL A;  3BVZ A;  2EQS A;  2HHH Q;  1WD0 A;  1E3P A;  1EZ8 A;  5M3M B;  1JWM D;  2VUM G;  4ILW A;  4LUO A;  2QKI C;  4HJA A;  4X3K A;  1B50 A;  4TVA B;  4C3H G;  1EQV A;  1L1O A;  4DR2 L;  1N8R C;  4A3G H;  1BXT A;  1GO3 E;  4PZ7 A;  3NBI A;  2SNS A;  4DR1 L;  1D5X C;  3M3Y H;  2NVX B;  5E4X A;  4PG3 A;  4OXP A;  2G9H D;  3F1Z A;  1D5M C;  4JI0 L;  4UP8 A;  1FJG Q;  3TN2 A;  2KEE A;  3J81 E;  3A5U A;  2F0K A;  5C4Z A;  3A7L A;  3HOY H;  4X3T A;  1A62 A;  3K5O A;  1V1O A;  4RG1 A;  2RQX A;  2RDF A;  1PH1 A;  4NXN L;  5IP9 G;  4JI2 Q;  1M4V A;  4YCV A;  2Q2H A;  1ZYR D;  4KD3 A;  3TRE A;  2F0P A;  1UWV A;  2RHQ B;  3Q8D A;  3GP7 A;  4A93 H;  4KI0 A;  2N8N A;  3HOW H;  1J5E L;  3QWN A;  3OMC A;  4CJ1 B;  1X54 A;  1X3E A;  3VYU A;  1KRS A;  1N9W A;  1ZYR C;  3AB9 A;  1ZXT A;  2XIW A;  1A3U A;  3I72 A;  4IPG A;  2CQA A;  4R1J A;  1GHJ A;  5IGE A;  4DV4 L;  4B9X A;  4X3S A;  5FLM H;  1SNO A;  4KKU A;  3TBI B;  4HMI A;  5CV8 A;  1KXL A;  1I4P A;  4ZCK A;  4FF4 A;  5C4J B;  2ZM6 L;  4LF8 L;  3DXJ C;  1UE6 A;  2Q8R E;  4CKB A;  2CCZ A;  1I6H B;  1HR0 L;  3K5L A;  5IWA L;  4OON A;  5C44 G;  4A3E G;  3DEP A;  2GVA A;  5GQO A;  1Y1V G;  3D4D A;  4CDD C;  2JXM B;  2ASB A;  2Q2U A;  5IGC A;  2A74 C;  2VY3 A;  4XXE A;  3TSS A;  4KN7 C;  2LKV A;  1B3Q A;  2L4N A;  4ODG A;  2F4V Q;  5EPL A;  4LF5 Q;  4KHZ A;  3GQB A;  4GOP A;  4YCW A;  2D9U A;  2KBN A;  5A2Q E;  2O5J C;  4JI3 Q;  2E2J B;  3CPW A;  2A8V A;  2F0M A;  2Y0S E;  1DON A;  1MJC A;  1CT1 D;  1YZ6 A;  4TSS A;  1STB A;  1PH6 A;  1JE4 A;  2E8G A;  1G51 A;  4B08 A;  3HKZ E;  2PQE A;  2HDL A;  2L9H A;  2JA8 H;  1BNZ A;  1LTR D;  1AE2 A;  2SOB A;  1XNQ Q;  3TDQ A;  1GJX A;  2K03 A;  4EGV A;  4JOI A;  3GTG B;  4LUZ A;  4YWK A;  4NP5 A;  3GTJ H;  1K28 A;  1W6K A;  4EQN A;  4NPS A;  4A3F H;  1GUT A;  3A7A B;  2KEN A;  1VQI A;  2JA6 H;  4A3J H;  3KDF B;  4TKO B;  1O7Y A;  5D3I B;  3A56 A;  3ICE A;  3J7A 5;  4LUV A;  4C3J H;  1SE4 A;  1I4R A;  3GTO H;  1NSN S;  2D62 A;  5J1Z A;  3K0Y A;  1QUQ B;  2YYZ A;  4EQ5 A;  5EKI A;  2IL8 A;  4NMZ A;  4X64 L;  1YNJ D;  1EIG A;  1R4Q B;  5DEH A;  4PZ6 A;  5E7N A;  1OXV A;  1A3T A;  2EYM A;  2PZU A;  5M3F B;  3S1Q H;  1SYG A;  4OWX B;  1WFQ A;  1LTS D;  5KND A;  4P74 A;  2F0D A;  1YNJ C;  1TWF B;  1N32 Q;  1X32 A;  1O78 A;  4ZRZ A;  2KUM A;  2VXW A;  4KKS A;  1EY6 A;  4BY7 G;  4WFN 3;  1TWA H;  4A3I H;  2G9D A;  1PHJ A;  2WAC A;  3QJY A;  4LF7 L;  2VQE Q;  4DV6 L;  4HSV A;  4X66 Q;  4NKL A;  2K28 A;  2YTX A;  1DOM A;  3S1R B;  4GNX C;  3S15 B;  3KBG A;  3PUV A;  5C0X H;  3T51 B;  3WDN A;  4CHT B;  4C2M B;  3TZD A;  4AH6 A;  2Y0S G;  3CCE A;  3A54 A;  4HIO A;  4R4C A;  1PYS B;  1EIF A;  3HKZ G;  4LW1 A;  4B3T Q;  1B70 B;  1S72 A;  3SK8 A;  4JYA L;  1ET6 A;  3PIP A;  2SDF A;  4B3S L;  1PTO F;  1CK1 A;  2NVY B;  1SND A;  1MJE A;  2CQO A;  2WFW A;  1LV9 A;  1EQR A;  4B3R L;  1OXT A;  2YU9 H;  2EZV A;  2JE6 I;  3GV6 A;  4CKC A;  1VQG A;  3R8B A;  4H44 C;  4GKJ L;  4K6L A;  4X65 L;  2KHI A;  2X69 A;  3FVQ A;  2L55 A;  3CU7 A;  5C3E B;  3BVG A;  2R92 B;  3KUP A;  4K6D A;  4KHV A;  3M4Q A;  4BBS G;  2AMC B;  3CW2 C;  3V05 A;  1JB3 A;  3KF8 A;  4KV6 A;  4OL7 A;  2JA7 B;  1RTN A;  4DR6 Q;  1R9T B;  4DV0 L;  2FJ2 A;  4RWS C;  1HXY D;  2FMC A;  1L0X B;  3HOU B;  4DUZ Q;  1EIH A;  3T1H Q;  3G7L A;  1VQK A;  2B8F A;  1AZQ A;  3CCR A;  4ZKC B;  3NE5 B;  4GS3 A;  5ELO A;  2E2I H;  3M4P A;  1JWS D;  5C5L A;  3I4N H;  1SYC A;  2HCI A;  4H7B A;  2R93 B;  3WWV A;  1D8L A;  4HSP A;  2R7D A;  1LM0 A;  3PO2 B;  4XYQ A;  2ES2 A;  2B2Y A;  2N55 A;  4R4I A;  5FK9 C;  3MWY W;  1BCP F;  1VCI A;  2K5W A;  5LHY 1;  3CCU A;  4POG A;  5CC4 A;  2H5X A;  1PYB A;  1MSH A;  2RF4 A;  2G5D A;  4POF A;  2ZJP A;  3H0G G;  2GA4 B;  1STA A;  3CXC A;  1WTH A;  4X62 Q;  4GN5 A;  2K5D A;  1PZJ D;  2SEB D;  3PIP 3;  1U5K A;  4OIJ A;  2PO4 A;  1DJR D;  1KD1 C;  3BG3 A;  2K7V A;  1Q12 A;  4LF9 L;  2LXK A;  1VF7 A;  1JE5 A;  1RDP D;  2RCN A;  1IKL A;  3A74 A;  4L5S A;  2VW9 A;  3HEJ A;  2YTV A;  3MXN A;  3OIP A;  3J7Y W;  4JI5 Q;  1F9Q A;  1SE2 A;  5C5M A;  3HOZ G;  1BBW A;  1XTC D;  3KFU A;  4JOI C;  4DA2 A;  3MEF A;  4K0K L;  2NN6 G;  3OW7 A;  2JK8 A;  3S14 H;  2OF1 A;  1VQE A;  3AFQ A;  2HUG A;  5J22 A;  4A3M B;  1PTO H;  4QL5 A;  3C46 A;  2JEA I;  2B63 H;  1WVL A;  1N34 Q;  2KJX A;  1QOH A;  2L5T A;  3H94 A;  1PRT F;  4IUR A;  3G71 A;  3KF6 A;  4MTK A;  1RL2 A;  4ABN A;  3RNU A;  4OO1 I;  2E76 C;  1QWY A;  3TS2 A;  1E7Z A;  2KED A;  2X6G A;  1K8A C;  1C0A A;  4DV1 Q;  2GVB A;  4G7O C;  3FMC A;  5BN3 A;  1QZH A;  1FL0 A;  5EAY A;  3S1N B;  2J0T D;  4DK1 A;  5EBC A;  3H09 A;  4LF6 L;  4A3D H;  4K8J A;  3I55 A;  1L1O B;  3RZD H;  3VYT A;  3VYS A;  4JPB W;  1D5Z C;  2TMP A;  4TRD A;  3T1Y L;  1TVX A;  3NK9 A;  3HOV G;  1Q1E A;  4MN3 A;  3BDL A;  1HHV A;  1GKH A;  1YJN A;  3HOX B;  4JI1 L;  3K6O A;  1I3Q H;  1STG A;  2IX1 A;  4BY1 H;  3PF5 A; 
#chains in the Genus database with same CATH homology
 1SBB B;  4KY7 A;  1V43 A;  4KD4 A;  4MHE A;  2QEJ C;  4A3B B;  3H6M A;  1L0Y B;  2XN9 C;  1I4G A;  3A55 A;  2F0Q A;  4IUP A;  2JA5 B;  3RMH A;  4C1N I;  5JVG 3;  5IOC A;  3I4L A;  3IKJ A;  1BQQ T;  3S2H B;  4G4K A;  1E2W A;  5JVH 3;  2AUK A;  4BBR B;  4PMC A;  5IT9 L;  3NWS A;  1HQM C;  1CM9 A;  5EPJ A;  1IW7 D;  1A15 A;  2WP8 J;  2SNM A;  5HGT A;  5JEA H;  5ELD A;  4IFD H;  2EPB A;  5I2X A;  3D3R A;  4BA1 I;  1I6V C;  3C1F A;  4PQX A;  1HFG A;  5C0X J;  3SE0 A;  3VR3 A;  2E2D C;  1IW7 C;  3OWF A;  1ZEQ X;  1Q1B A;  2EYO A;  1F9S A;  4A3G B;  2B2V A;  1Y8O B;  4BWG B;  1LT5 D;  5JPN C;  3M3Y B;  1PFB A;  4LMQ D;  3LWU A;  3N6R A;  1S5F D;  1HFN A;  3QG1 A;  1CHP D;  5EGT A;  1TS5 A;  3HOY B;  3SXH A;  5IIF A;  2R6G A;  2B2Y C;  2K32 A;  4OO1 G;  2B39 A;  5G3L F;  5LL6 X;  3BZD B;  3BS1 A;  4K2L A;  1AP0 A;  2ENB A;  4A93 B;  1U9R A;  3HOW B;  2JYO A;  1EU4 A;  2BDN A;  5ELF A;  3OMG A;  1QE6 A;  3MTS A;  2AQ2 B;  2F0J A;  1H9S A;  4LJZ C;  3M4Y A;  4FVM A;  1EYA A;  4BS9 A;  3DMU A;  3L7Z C;  1EY7 A;  1FNU A;  2WII B;  5K5P A;  5KYI A;  5C4H A;  1JOQ A;  1EEI D;  2QIL A;  3C3L A;  1EY8 A;  4KK7 A;  1GUN A;  4FF2 A;  4J8Q A;  4IZ8 A;  2AQ1 B;  3R3O A;  1BO0 A;  1NR4 A;  1S4Z A;  1ZKO A;  5T1I A;  3DWQ A;  3VR2 A;  3T4A C;  4XQQ A;  1JOK A;  3MA2 B;  2F03 A;  4RFB A;  4OHJ A;  3P75 A;  5FO8 B;  1SDF A;  4RCO A;  2I07 B;  4OGQ C;  3IFT A;  1H9J A;  4RH6 A;  4DU9 A;  1EY0 A;  1II3 A;  3DWP A;  3S9W A;  2F0E A;  4EQO A;  4NDX A;  2JA8 B;  2ZXO A;  5M9O A;  1HUM A;  3G6J B;  2F3V A;  1XWE A;  3GTJ B;  3QOJ A;  2EJM A;  4O1N A;  4A3F B;  1KDA A;  3V2T A;  3K57 A;  2JA6 B;  1PXU A;  4A3J B;  3Q6S A;  1PZK D;  4C3J B;  1YNN D;  1G8Z D;  1A3V A;  2MP1 A;  3GTO B;  2LS0 1;  5FOB B;  3QO2 A;  3U9S A;  1F77 A;  4JBW A;  2XRQ D;  2VB2 X;  4XYO A;  3Q24 A;  2K33 A;  3X3N A;  2WB1 B;  3BYT B;  3PUX A;  1K8M A;  4EVO A;  1YNN C;  3S1Q B;  3BDC A;  1PFN A;  2MUY A;  2EY1 A;  4N9P A;  1FYC A;  3CRL C;  1TWA B;  3BYY B;  4A3I B;  4F8M A;  4PNY A;  1CZG A;  3HS0 C;  3HZX A;  3T53 B;  3NTH A;  4P2C B;  2XWB B;  1EWH A;  3M7G A;  3FPU B;  2JSO A;  4V0B A;  2A6H D;  4DAV A;  1FNV A;  2RSN A;  5COR A;  5CGK A;  2Z1C A;  3RUZ A;  2YU9 B;  3T16 A;  3J80 E;  2F4I A;  3T56 B;  1JWU D;  3RD4 A;  1DYQ A;  4M1U B;  2KVM A;  4RGO S;  5DM6 3;  2KCC A;  1CHQ D;  4IFD J;  1EFI D;  2Z8L A;  5F2D A;  1A6X A;  2HDM A;  2B2T A;  5C3W A;  2WAQ B;  5EBD A;  2H1E A;  4RKB A;  3EVQ A;  3NHH A;  4RGM A;  5E4W C;  1KNA A;  1CA5 A;  1ML0 D;  4IUV A;  2NZ1 D;  2PMZ B;  1PLF A;  1KNE A;  2E2I B;  1PFM A;  3I4N B;  3H91 A;  2RVL A;  2EOT A;  4J1M A;  2BOS A;  3TP7 A;  2K5Q A;  2NBF A;  1HTL D;  4DAY A;  4I65 A;  1V1P B;  2ZT9 C;  4HN7 A;  2J7Z A;  2LY7 A;  4K2K A;  5KIX A;  3GD7 A;  5E3F A;  3SEB A;  5C3X A;  2PYK A;  4DN4 M;  1SYF A;  4I7Z C;  1OXU A;  5K36 G;  3FPP A;  1MSG A;  2EYF A;  1BR9 A;  3ND9 A;  1S5E D;  3ND8 A;  3QB3 A;  5HUR A;  3MEH A;  3FDT A;  2O5I C;  2HQE A;  4XT1 B;  3E5S A;  1TII D;  4HTH A;  2A6E D;  2MJ8 A;  3S14 B;  3IFD A;  1PTO B;  3D6C A;  2B63 B;  1W6J A;  4M8A A;  1PDQ A;  5KGU A;  1O7Z A;  4X3U A;  5CV9 A;  3LWE A;  2K05 A;  4PV1 C;  1BOS A;  5IT9 E;  3NWT A;  2A6E C;  2D5D A;  4ID6 A;  2Q8I B;  2FFK B;  2NN6 I;  4ULL A;  5KEE A;  3MVV A;  5C0X G;  2Q8T A;  3J7A F;  3Q23 A;  4A3D B;  1Q90 A;  1EL0 A;  1CTM A;  2MHV A;  4XTC S;  5KRU A;  5DM7 3;  4CJ0 B;  1I3Q B;  4BY1 B;  3OSO A;  1GHK A;  2R7Z B;  4FXG C;  2B2W A;  1SNM A;  3N52 A;  3R2I A;  1BCP B;  1IYV A;  1TQO A;  4WRD A;  4AYB B;  1J8I A;  3Q0A A;  1K83 B;  1OO9 B;  1DZ1 A;  1U4P A;  3T13 A;  4Y7N B;  1WTW A;  1H9S B;  1TY2 A;  1SNC A;  3CQZ B;  2NB0 A;  1I4X A;  3MC0 B;  2BCO A;  1LTT D;  4QMG A;  3ZYY X;  4XDX A;  4IUN A;  3ERO A;  2B8G A;  4RGT A;  1TR5 A;  4HCE A;  2WV6 D;  2EJG C;  3TZU A;  3MZ5 A;  4FP5 D;  4F88 A;  1QB5 D;  2M00 A;  4WJW A;  1NAP A;  1MI2 A;  2RDH A;  5CV6 A;  3K58 A;  3R2T A;  5CBE E;  1PRT B;  1VDZ A;  1CFM A;  3WOF A;  3HRZ C;  3VR5 A;  1B3A A;  3URY A;  5FO9 B;  1JOR A;  3EFX D;  1NUC A;  1B9N A;  2F0N A;  3TP6 A;  2F0G A;  3OOC A;  3HG9 A;  2O4X A;  3L3O C;  4RAU C;  5KYL A;  3JAM L;  5M5X B;  3P7J A;  2K6A A;  4UDU C;  4DNT B;  4K5W A;  3HP3 A;  4ZQ3 A;  3LX0 A;  3MAQ A;  1G91 A;  5ELC A;  4K5X A;  1DD2 A;  3P1H A;  2CHB D;  4Q5V A;  2L12 A;  3EQL C;  1C4Q A;  4CJ2 C;  2NN6 H;  3ITP A;  4FF3 A;  2R61 A;  1C48 A;  3D31 A;  3PUZ A;  4A3K B;  2EVB A;  5I6W A;  3AU7 A;  1RKN A;  5I2Y A;  3FKI B;  4DNR B;  1DOK A;  3X3M A;  1VF5 C;  5FLX L;  4Z9C B;  4FO2 A;  1V1P A;  3MFY A;  5CMD A;  4QUC A;  2HCC A;  2RBM A;  3P20 A;  1EYC A;  4IQZ A;  2IWH A;  2IW3 A;  2RA4 A;  3SK5 A;  3SR1 A;  1PYW D;  2K04 A;  1RCV D;  2EY5 A;  5BN4 A;  2EYP A;  4JK1 C;  2JP1 A;  1ICW A;  1NCV A;  1X3P A;  2EJF C;  1G29 1;  2KQ3 A;  3NSW A;  1VMC A;  1EU3 A;  4L8J A;  5IGB A;  3PUY A;  2BDO A;  4YIJ A;  5M5Y B;  5M5W B;  2F1M A;  2EYH A;  1I50 B;  4R9W A;  3NQT A;  5J39 A;  1HTP A;  1U4L A;  4DGZ A;  4CGY B;  3SVM A;  2LMC B;  2AWO A;  3M4O B;  3I70 A;  1PZI D;  3K59 A;  1JC7 A;  2QCP X;  4HCS A;  1JR0 D;  1LTI D;  3S1M B;  4IUU A;  1WTX A;  2CW0 D;  1AEX A;  3M7N A;  3SHL A;  1DM0 B;  4RCN A;  1UAP A;  3IL8 A;  3OHX C;  4G7H C;  4KTA A;  2C9O A;  1A2T A;  1RJT A;  2CW0 C;  3RLF A;  4EQP A;  4F7X A;  4C3I B;  2VUM B;  3NTI A;  4CKE A;  4HAE A;  1CZW A;  2E74 C;  5EQ0 A;  5D65 A;  5IGG A;  1EOT A;  3KBX A;  1Y8N B;  4RHS A;  4Q0F A;  2MGS A;  3TP5 A;  2B2U A;  1OXX K;  2A69 D;  2IJ0 A;  1B2T A;  2A68 D;  4FF1 A;  4LAA A;  4RKL A;  2F0V A;  1SYE A;  1TWH B;  1JCK B;  2F3W A;  1AN8 A;  3OWE B;  1EY9 A;  5BN5 A;  4HED A;  2PZT A;  4OO1 H;  4K14 A;  1TT2 A;  1Y8P B;  1JOO A;  2A68 C;  4S3S A;  3MXU A;  3ONA B;  3C2P A;  3QOL A;  1G6Z A;  3F2U A;  5ISR A;  1A2U A;  1ENF A;  1FD7 D;  1IL8 A;  2NTS A;  5DAU A;  4IAL A;  1JIC A;  4DK0 A;  2XSC A;  1S5C D;  1SJH D;  1B53 A;  1NR2 A;  1BDO A;  1TU2 B;  5C44 B;  4A3E B;  4DAP A;  1GUS A;  1MBY A;  5LL6 S;  2ID0 A;  4TQU S;  1QNU A;  5A35 A;  1SFO B;  5D14 A;  3FEW X;  1VMP A;  3K5M A;  5NUC A;  4GZY C;  1TKW B;  3BDO A;  1F2M A;  1G2S A;  1RHP A;  1B1Z A;  1TS3 A;  5I6Y A;  1QNK A;  2RDG A;  4KJN A;  3NUC A;  2QDB A;  1ET9 A;  2N88 A;  5CR3 A;  1K8O A;  2K01 A;  3A8J E;  5JOB A;  1BF4 A;  3A8I E;  1EQT A;  4RGN A;  5AFW A;  5EJW A;  1PTO D;  1QCB D;  1SSO A;  3NBH A;  1B9M A;  1XXG A;  2VNU D;  4DXF A;  2EE1 A;  1SJE D;  1S5B D;  3S2D B;  4C3I G;  3S16 B;  3NPP A;  3SK6 A;  1HA5 A;  1PTO C;  3VYR A;  5CV5 A;  2DNC A;  1GUG A;  1C8C A;  2L0C A;  1ILP A;  3I4M B;  1DCZ A;  4BY7 B;  2F0H A;  2R3Z A;  2M9V A;  2XNA C;  2OEO A;  5I9P A;  1F9P A;  1ESR A;  1E2Z A;  2LFN A;  2WKC A;  4V19 0;  4DF7 A;  3NTK A;  2B2V C;  2Y0S B;  3RZO B;  2FIN B;  3NXW A;  3PIO 3;  3HKZ B;  4DFA A;  5C0X I;  1BCP D;  4ZAI A;  1WTQ A;  1SEB D;  5CYU A;  2F0L A;  3I73 A;  1HPC A;  2A6H C;  2EYJ A;  3CRK C;  3VR4 A;  5JEA J;  2B2U C;  3UI2 A;  4ZKB B;  1R4P B;  3DUZ A;  2F0T A;  1Y69 U;  1BCP C;  2DY7 A;  4J6H A;  5EPK A;  1FGB D;  1GOZ A;  1U4R A;  3JAM E;  4RA8 A;  4OIK A;  2MPM A;  1DXM A;  2ICI A;  3A8K E;  2DN8 A;  4BBS B;  1LAC A;  3S17 B;  2PW5 A;  4KKT A;  2XRS D;  1RTO A;  5CBA E;  4QUF A;  3GTM B;  2NTT A;  3GTP B;  2KEC A;  4C1N K;  2DY8 A;  1STN A;  4KY5 A;  1T5X D;  1PRT D;  4KMU C;  4ZUJ A;  4FXD A;  5FLX E;  4NW2 A;  4RHR A;  1WTO A;  2VB3 X;  1EZ6 A;  3AMU A;  4C3J G;  4R8I A;  1WCM B;  3H0G B;  1X3Q A;  1PRT C;  4PMW A;  2NVQ B;  5K36 H;  1FNW A;  1H9R A;  4IN3 A;  4WOR A;  4U68 A;  1PMR A;  1SYB A;  1D1I A;  1D1K A;  3K5N A;  1RD9 D;  5TSS A;  1Q8I A;  2AUJ D;  2KCN A;  3HGB A;  4ME5 A;  1ENA A;  3HOZ B;  2BA1 A;  1FR3 A;  3H3V C;  3ERQ A;  4XIG S;  3OIQ A;  3DEO A;  1LTG D;  4XQN A;  1IHZ A;  3IAY A;  3PMF A;  2PCF B;  2XWJ B;  1F2Z A;  3RZD B;  2JEB I;  1KLG D;  3K7A B;  1HA6 A;  3R93 A;  1B44 D;  2BE5 D;  4H13 C;  3CKI B;  5ELE A;  5FKA C;  2NYZ D;  1LT6 D;  1STE A;  5T1G A;  1OXS C;  1TWG B;  5JPM C;  1I4Q A;  1AW7 A;  3EA6 A;  1ENC A;  4HMJ A;  2F0O A;  3HOV B;  2BE5 C;  3KK7 A;  3KLS X;  1TWC B;  3KLS A;  3KLR A;  2XVS A;  4F87 A;  4H0L C;  4MIU A;  2H4O A;  2RKS A;  4XQJ A;  1WTR A;  1I4H A;  5I4D A;  3OPO A;  1EYD A;  3TP8 A;  2C5C A;  1HQR D;  4PMB A;  2DNE A;  4FNF A;  5G3L D;  2IT1 A;  3J81 L;  3SDZ A;  1V8Q A;  5KNC A;  2I46 A;  2E2H B;  1SE3 A;  1QIL A;  2B2T C;  4E6I A;  3D4W A;  3DM1 A;  1SXT A;  1JQY D;  5EKL A;  5E1F A;  1SMY D;  2ICE C;  3NQI A;  3BVM A;  3O13 A;  4QCL A;  1G2T A;  3E0J A;  1Y1W B;  3U9O A;  4IFD I;  2F0S A;  3C1E A;  1TY0 A;  1ROD A;  2PW7 A;  1SYD A;  3GTL B;  1SMY C;  3L9A X;  2CVR A;  3VR6 A;  4L6T B;  2EY2 A;  3I3C A;  3J80 L;  1LAB A;  1O80 A;  5IOD A;  1BUV T;  3GO5 A;  1TS4 A;  2WKD A;  1STH A;  2L1B A;  2OXP A;  1MD2 D;  5IGF A;  5JJZ A;  1QJO A;  1S5D D;  1GUO A;  4HR7 B;  3WOE A;  1LT3 D;  2EYL A;  2M2L A;  1XYI A;  3I8Z A;  3PUW A;  1ILQ A;  3LNN A;  3CHB D;  2EY6 A;  5CV4 A;  1E0B A;  3I90 A;  2PNR C;  2AWN A;  5A2Q L;  2D2C C;  2FHT A;  1HRJ A;  3FRP B;  1EEF D;  4ZUI A;  1SNP A;  2KA7 A;  4ZK9 B;  3DHQ A;  1M8A A;  5IGD A;  1HUN A;  3VA5 A;  4LK1 C;  2Z4H A;  2O2L D;  1STY A;  2ZXP A;  4QB4 A;  2NWG A;  1GXD C;  1BBX C;  1LTB D;  4ZYS A;  4IUQ A;  4DXG A;  1U4M A;  4N9T A;  3GTK B;  4KJO A;  1TS2 A;  5FO7 B;  1D2B A;  1IKM A;  3V96 A;  5D3D A;  4C56 C;  4QIW B;  1Z6H A;  4ZLT F;  2KHS A;  4FYD A;  4K8I A;  4U67 3;  1AFP A;  1IYU A;  4QF4 A;  2TSS A;  1CQV A;  2FMM A;  1D6E C;  1RF2 D;  3D4R A;  1Q3L A;  3D8G A;  2PZW A;  1H9K A;  3VA7 A;  4K5V A;  3PV0 A;  1T5E A;  3MHB A;  4KN4 C;  2B2W C;  2EXZ A;  5JEA G;  4IFD G;  2V4D A;  2F0W A;  4XT3 B;  1GUW A;  2K1B A;  1Z47 A;  5JAV A;  3I91 A;  4UAI A;  1LLR D;  3EJI A;  1KAA A;  4O42 A;  1Z7T A;  3TME A;  5CV7 A;  3PO3 B;  1CI3 M;  4C3H B;  3GV3 A;  2OT2 A;  4R8N A;  2X6L A;  1KDC A;  4BA2 I;  2ZXR A;  4KY6 A;  2IX0 A;  1F2L A;  1DOL A;  3J7A V;  3NP8 A;  1LO5 D;  1E2V A;  2A69 C;  1O7L A;  5EKK A;  4G7Z C;  1HCZ A;  5DNF A;  5C4X B;  3QIA A;  4B9W A;  4L63 B;  1WTV A;  1EWC A;  1B4O A;  2EDG A;  2WIN B;  1EY4 A;  1KLU D;  1QG7 A;  1KAB A;  1WTP A;  2J4X A;  2IX3 A;  1WD1 A;  1UUP A;  2A5H A;  3D6W A;  2L11 A;  1UNS A;  3GTQ B;  1J9O A;  2KOL A;  2QF7 A;  1EY5 A;  5ELB A;  3E6Z X;  1CQF A;  1Y1V B;  2IPK D;  3MXG A;  4CBV A;  2NUC A;  1F2Y A;  1XX8 A;  2A73 B;  4G57 A;  1LTA D;  1UEA B;  1ESF A;  1AZP A;  2PPB C;  3W3A A;  1SNQ A;  3SK4 A;  1F9R A;  1LT4 D;  3Q22 A;  1MGS A;  2BA0 A;  2RSO A;  3MFG A;  3MXP A;  2F0F A;  5I9O A;  1SAP A;  1H9M A;  2E75 C;  4FXK C;  1CA6 A;  3W2D A;  3DWA A;  3M85 A;  1KDB A;  1KTK A;  2F0I A;  2NVT B;  2AQ3 B;  4IUT A;  5C6A A;  5KNB A;  2Z4I A;  5COY A;  2F0U A;  1ONL A;  3BVZ A;  1WD0 A;  1EZ8 A;  5M3M B;  1JWM D;  4ILW A;  2QKI C;  4X3K A;  1B50 A;  4C3H G;  1EQV A;  1BXT A;  3NBI A;  2SNS A;  1D5X C;  2NVX B;  5E4X A;  2G9H D;  1D5M C;  3TN2 A;  2KEE A;  3J81 E;  2F0K A;  5C4Z A;  3A7L A;  4X3T A;  3K5O A;  1V1O A;  2RQX A;  2RDF A;  1M4V A;  1ZYR D;  4KD3 A;  2F0P A;  3GP7 A;  4KI0 A;  3QWN A;  3OMC A;  4CJ1 B;  3VYU A;  3AB9 A;  1ZYR C;  1ZXT A;  2XIW A;  1A3U A;  3I72 A;  2CQA A;  1GHJ A;  5IGE A;  4B9X A;  4X3S A;  1SNO A;  4KKU A;  3TBI B;  4HMI A;  5CV8 A;  1I4P A;  4FF4 A;  5C4J B;  3DXJ C;  2Q8R E;  4CKB A;  1I6H B;  3K5L A;  3DEP A;  3D4D A;  2JXM B;  5IGC A;  2A74 C;  4XXE A;  3TSS A;  4KN7 C;  2LKV A;  4ODG A;  2L4N A;  5EPL A;  4KHZ A;  3GQB A;  2D9U A;  2O5J C;  5A2Q E;  2E2J B;  2F0M A;  1DON A;  1CT1 D;  4TSS A;  1STB A;  1JE4 A;  4B08 A;  2HDL A;  2PQE A;  2L9H A;  1BNZ A;  1LTR D;  2SOB A;  3TDQ A;  1GJX A;  2K03 A;  4EGV A;  3GTG B;  4NP5 A;  1W6K A;  4EQN A;  1GUT A;  3A7A B;  4TKO B;  1O7Y A;  5D3I B;  3A56 A;  1SE4 A;  1I4R A;  1NSN S;  2D62 A;  5J1Z A;  3K0Y A;  2YYZ A;  5EKI A;  2IL8 A;  4NMZ A;  1YNJ D;  1EIG A;  1R4Q B;  5DEH A;  1OXV A;  1A3T A;  2EYM A;  2PZU A;  5M3F B;  1SYG A;  1LTS D;  5KND A;  2F0D A;  1YNJ C;  1TWF B;  1X32 A;  1O78 A;  4ZRZ A;  2KUM A;  2VXW A;  4KKS A;  1EY6 A;  4WFN 3;  2G9D A;  2WAC A;  3QJY A;  4HSV A;  4NKL A;  2K28 A;  1DOM A;  3S1R B;  3S15 B;  3KBG A;  3PUV A;  5C0X H;  3T51 B;  3WDN A;  4CHT B;  4C2M B;  3TZD A;  3A54 A;  3SK8 A;  1ET6 A;  2SDF A;  1PTO F;  1CK1 A;  2NVY B;  1SND A;  1LV9 A;  1OXT A;  2EZV A;  2JE6 I;  3GV6 A;  4CKC A;  3R8B A;  4H44 C;  4K6L A;  2X69 A;  3FVQ A;  2L55 A;  3CU7 A;  5C3E B;  3BVG A;  2R92 B;  3KUP A;  4K6D A;  4KHV A;  3V05 A;  1JB3 A;  3KF8 A;  4KV6 A;  4OL7 A;  2JA7 B;  1RTN A;  1R9T B;  2FJ2 A;  4RWS C;  1HXY D;  2FMC A;  1L0X B;  3HOU B;  1EIH A;  3G7L A;  2B8F A;  1AZQ A;  4ZKC B;  3NE5 B;  1JWS D;  5C5L A;  1SYC A;  2HCI A;  4H7B A;  2R93 B;  4HSP A;  3PO2 B;  4XYQ A;  2B2Y A;  2N55 A;  5FK9 C;  3MWY W;  1BCP F;  1VCI A;  2K5W A;  5LHY 1;  5CC4 A;  1MSH A;  2GA4 B;  1STA A;  2K5D A;  1PZJ D;  2SEB D;  3PIP 3;  4OIJ A;  2PO4 A;  1DJR D;  3BG3 A;  2K7V A;  1Q12 A;  1VF7 A;  1RDP D;  1IKL A;  3HEJ A;  3MXN A;  3OIP A;  3J7Y W;  1F9Q A;  1SE2 A;  5C5M A;  1XTC D;  4DA2 A;  2NN6 G;  3OW7 A;  2OF1 A;  4A3M B;  2HUG A;  5J22 A;  3C46 A;  1PTO H;  2JEA I;  1WVL A;  2KJX A;  1QOH A;  2L5T A;  3H94 A;  1PRT F;  4IUR A;  4OO1 I;  4ABN A;  2E76 C;  1QWY A;  2KED A;  2X6G A;  4G7O C;  3FMC A;  5BN3 A;  3S1N B;  2J0T D;  4DK1 A;  5EBC A;  3H09 A;  4K8J A;  3VYT A;  3VYS A;  1D5Z C;  2TMP A;  4TRD A;  1TVX A;  3NK9 A;  1Q1E A;  4MN3 A;  3BDL A;  1HHV A;  3HOX B;  3K6O A;  2IX1 A;  1STG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...