2RR14

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rr1400
1MQTD 2HWB4 1K5MD 1POV0 1R084 1VBD4 2RS34 1HRI4 1AL24 1RUI4 1VRH4 1RUJ4 2RR14 1VBA4 2RMU4 1PVC4 2HWC4 3JBG4 1D4M4 1R094 1RUG4 1RUF4 1AR74 2R064 3JD74 1VBB4 4RHV4 2RS54 1Z7S4 2RM24 2RS14 1AR94 1RUD4 1PO14 1AR84 1RUC4 1RVF4 1VBE4 1PIV4 1BEV4 2R074 1EV14 1NA1D 1RMU4 1VBC4 1PO24 4GB34 4Q4V4 4Q4Y4 1COV4 1RUE4 1OOPD 4Q4X4 1ASJ4 1RUH4 1NCQD 2R044 2X5ID 4PDWD 1H8TD 1AR64 3J8F4 1HXS4 1EAH4 4Q4W4 1RHI4 2PLV4 1HRV4
chains in the Genus database with same CATH superfamily
4YTMA 2RS34 3SFDA 1VRH4 4YTPA 1PVC4 1R094 1RUG4 1RUF4 1AR74 2PYJA 1VBB4 1NEKA 3AE3A 3P4QA 4YSXA 4YSYA 1BEV4 2R074 4Q4V4 3AE7A 1PO24 1XHXA 1ASJ4 2R7FA 2R044 1PIV4 4YT0A 2FBWA 1MQTD 3P4PA 5C3JA 3AE1A 3AEBA 3AE2A 1ZP0A 1KF6A 2RMU4 2RR14 2WS3A 3JBG4 3AE6A 2WQYA 2R064 4YSZA 3JD74 1XI1A 2PZSA 1KFYA 1L0VA 1YQ3A 1PO14 1AR84 3ABVA 4Q4Y4 3CIRA 2WDVA 1COV4 3VR8A 1OOPD 1RUH4 3AE9A 1NCQD 2H88A 4PDWD 2ACZA 1AR64 1HXS4 3AE8A 4Q4W4 1RHI4 3P4SA 1HRV4 2HWB4 1POV0 3SUCA 4YTNA 1XHZA 1RUI4 1RUJ4 3VRBA 2HWC4 2WU2A 2PW9A 3VR9A 3VRAA 4RHV4 2RS54 1Z7S4 3AE5A 2RM24 2RS14 2WDRA 5C2TA 1VBE4 3AE4A 3AEAA 1RUE4 1ZOYA 2X5ID 4YXDA 1VBA4 1H8TD 3GQHA 3AEEA 1K5MD 3FI7A 1R084 3AECA 1VBD4 3AEGA 1HRI4 1AL24 1YQ4A 3AEDA 1NENA 3AEFA 2H89A 3GQKA 2WP9A 1D4M4 2WDQA 3P4RA 1AR94 1RUD4 2EX3A 3SFEA 1RVF4 2WU5A 1EV14 1NA1D 1RMU4 1VBC4 4GB34 2B76A 4Q4X4 2PYLA 4KX6A 2PY5A 3J8F4 1RUC4 1EAH4 2PLV4
chains in the Genus database with same CATH topology
1MQTD 2HWB4 1K5MD 1POV0 1R084 1VBD4 2RS34 1HRI4 1AL24 1RUI4 1VRH4 1RUJ4 2RR14 1VBA4 2RMU4 1PVC4 2HWC4 3JBG4 1D4M4 1R094 1RUG4 1RUF4 1AR74 2R064 3JD74 1VBB4 4RHV4 2RS54 1Z7S4 2RM24 2RS14 1AR94 1RUD4 1PO14 1AR84 1RUC4 1RVF4 1VBE4 1PIV4 1BEV4 2R074 1EV14 1NA1D 1RMU4 1VBC4 1PO24 4GB34 4Q4V4 4Q4Y4 1COV4 1RUE4 1OOPD 4Q4X4 1ASJ4 1RUH4 1NCQD 2R044 2X5ID 4PDWD 1H8TD 1AR64 3J8F4 1HXS4 1EAH4 4Q4W4 1RHI4 2PLV4 1HRV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQT D;  2HWB 4;  1K5M D;  1POV 0;  1R08 4;  1VBD 4;  2RS3 4;  1HRI 4;  1AL2 4;  1RUI 4;  1VRH 4;  1RUJ 4;  2RR1 4;  1VBA 4;  2RMU 4;  1PVC 4;  2HWC 4;  3JBG 4;  1D4M 4;  1R09 4;  1RUG 4;  1RUF 4;  1AR7 4;  2R06 4;  3JD7 4;  1VBB 4;  4RHV 4;  2RS5 4;  1Z7S 4;  2RM2 4;  2RS1 4;  1AR9 4;  1RUD 4;  1PO1 4;  1AR8 4;  1RUC 4;  1RVF 4;  1VBE 4;  1PIV 4;  1BEV 4;  2R07 4;  1EV1 4;  1NA1 D;  1RMU 4;  1VBC 4;  1PO2 4;  4GB3 4;  4Q4V 4;  4Q4Y 4;  1COV 4;  1RUE 4;  1OOP D;  4Q4X 4;  1ASJ 4;  1RUH 4;  1NCQ D;  2R04 4;  2X5I D;  4PDW D;  1H8T D;  1AR6 4;  3J8F 4;  1HXS 4;  1EAH 4;  4Q4W 4;  1RHI 4;  2PLV 4;  1HRV 4; 
#chains in the Genus database with same CATH topology
 4YTM A;  2RS3 4;  3SFD A;  1VRH 4;  4YTP A;  1PVC 4;  1R09 4;  1RUG 4;  1RUF 4;  1AR7 4;  2PYJ A;  1VBB 4;  1NEK A;  3AE3 A;  3P4Q A;  4YSX A;  4YSY A;  1BEV 4;  2R07 4;  4Q4V 4;  3AE7 A;  1PO2 4;  1XHX A;  1ASJ 4;  2R7F A;  2R04 4;  1PIV 4;  4YT0 A;  2FBW A;  1MQT D;  3P4P A;  5C3J A;  3AE1 A;  3AEB A;  3AE2 A;  1ZP0 A;  1KF6 A;  2RMU 4;  2RR1 4;  2WS3 A;  3JBG 4;  3AE6 A;  2WQY A;  2R06 4;  4YSZ A;  3JD7 4;  1XI1 A;  2PZS A;  1KFY A;  1L0V A;  1YQ3 A;  1PO1 4;  1AR8 4;  3ABV A;  4Q4Y 4;  3CIR A;  2WDV A;  1COV 4;  3VR8 A;  1OOP D;  1RUH 4;  3AE9 A;  1NCQ D;  2H88 A;  4PDW D;  2ACZ A;  1AR6 4;  1HXS 4;  3AE8 A;  4Q4W 4;  1RHI 4;  3P4S A;  1HRV 4;  2HWB 4;  1POV 0;  3SUC A;  4YTN A;  1XHZ A;  1RUI 4;  1RUJ 4;  3VRB A;  2HWC 4;  2WU2 A;  2PW9 A;  3VR9 A;  3VRA A;  4RHV 4;  2RS5 4;  1Z7S 4;  3AE5 A;  2RM2 4;  2RS1 4;  2WDR A;  5C2T A;  1VBE 4;  3AE4 A;  3AEA A;  1RUE 4;  1ZOY A;  2X5I D;  4YXD A;  1VBA 4;  1H8T D;  3GQH A;  3AEE A;  1K5M D;  3FI7 A;  1R08 4;  3AEC A;  1VBD 4;  3AEG A;  1HRI 4;  1AL2 4;  1YQ4 A;  3AED A;  1NEN A;  3AEF A;  2H89 A;  3GQK A;  2WP9 A;  1D4M 4;  2WDQ A;  3P4R A;  1AR9 4;  1RUD 4;  2EX3 A;  3SFE A;  1RVF 4;  2WU5 A;  1EV1 4;  1NA1 D;  1RMU 4;  1VBC 4;  4GB3 4;  2B76 A;  4Q4X 4;  2PYL A;  4KX6 A;  2PY5 A;  3J8F 4;  1RUC 4;  1EAH 4;  2PLV 4; 
#chains in the Genus database with same CATH homology
 1MQT D;  2HWB 4;  1K5M D;  1POV 0;  1R08 4;  1VBD 4;  2RS3 4;  1HRI 4;  1AL2 4;  1RUI 4;  1VRH 4;  1RUJ 4;  2RR1 4;  1VBA 4;  2RMU 4;  1PVC 4;  2HWC 4;  3JBG 4;  1D4M 4;  1R09 4;  1RUG 4;  1RUF 4;  1AR7 4;  2R06 4;  3JD7 4;  1VBB 4;  4RHV 4;  2RS5 4;  1Z7S 4;  2RM2 4;  2RS1 4;  1AR9 4;  1RUD 4;  1PO1 4;  1AR8 4;  1RUC 4;  1RVF 4;  1VBE 4;  1PIV 4;  1BEV 4;  2R07 4;  1EV1 4;  1NA1 D;  1RMU 4;  1VBC 4;  1PO2 4;  4GB3 4;  4Q4V 4;  4Q4Y 4;  1COV 4;  1RUE 4;  1OOP D;  4Q4X 4;  1ASJ 4;  1RUH 4;  1NCQ D;  2R04 4;  2X5I D;  4PDW D;  1H8T D;  1AR6 4;  3J8F 4;  1HXS 4;  1EAH 4;  4Q4W 4;  1RHI 4;  2PLV 4;  1HRV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...