2RR14

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rr1400
1ASJ4 1RUG4 1COV4 1MQTD 1VBA4 1R094 1HRV4 2PLV4 1VBE4 1AR64 2RS54 2R064 1EAH4 1RUE4 1H8TD 1RUJ4 1K5MD 1VBB4 1Z7S4 3JBG4 3J8F4 1RUC4 1EV14 1PIV4 1PO14 1VBC4 2X5ID 3JD74 1VBD4 1NCQD 1AR94 1HXS4 1PO24 4GB34 1VRH4 2RM24 4Q4Y4 1R084 1OOPD 2HWB4 1AR74 1PVC4 1HRI4 2RR14 2R044 2RS14 4RHV4 2HWC4 1RUD4 1RUH4 1RMU4 2RMU4 1AL24 1RHI4 1BEV4 1POV0 4Q4X4 1RUF4 2R074 4Q4W4 1AR84 1D4M4 2RS34 4Q4V4 4PDWD 1NA1D 1RUI4 1RVF4
chains in the Genus database with same CATH superfamily
3AEAA 1VBE4 2EX3A 2RS54 3AE5A 2R7FA 3VR9A 3J8F4 1EV14 2FBWA 3SFDA 3JD74 3AEDA 1HXS4 3VRBA 1NEKA 1VRH4 2HWB4 2RR14 2H89A 2WQYA 2WS3A 2WU5A 2WP9A 3FI7A 2HWC4 2RMU4 1RUH4 4Q4X4 3P4PA 1AR84 4YSZA 3P4SA 4Q4V4 4PDWD 2R044 3CIRA 2PYJA 1RUG4 3AEGA 1VBA4 1HRV4 2PLV4 2PZSA 3AECA 2WDQA 1RUJ4 3GQKA 1PIV4 1VBC4 2X5ID 3SUCA 1NCQD 1AR94 1PO24 4GB34 3GQHA 1R084 2WU2A 1PVC4 1HRI4 2B76A 1XHZA 4RHV4 1RUD4 1RMU4 1AL24 1RHI4 2PYLA 1YQ3A 1L0VA 4YSXA 1K5MD 3AE4A 1ASJ4 1COV4 1KFYA 1R094 4YSYA 3AE2A 2R064 3P4QA 1RUE4 2ACZA 1H8TD 1Z7S4 1RUC4 5C2TA 3AEFA 1PO14 2H88A 4YTPA 4YT0A 2RM24 3AE6A 2RS14 1XI1A 3P4RA 1BEV4 1POV0 3AE7A 2PW9A 2RS34 1RUI4 3AE9A 3AE1A 1XHXA 1MQTD 5C3JA 1AR64 1ZP0A 1EAH4 1NENA 1VBB4 3JBG4 3VRAA 3AE8A 2WDRA 3AEBA 3AE3A 4KX6A 3AEEA 1VBD4 3ABVA 3VR8A 4Q4Y4 1OOPD 1KF6A 1YQ4A 1AR74 3SFEA 4YXDA 4YTNA 1ZOYA 1RUF4 2R074 4Q4W4 1D4M4 4YTMA 2PY5A 1NA1D 2WDVA 1RVF4
chains in the Genus database with same CATH topology
1ASJ4 1RUG4 1COV4 1MQTD 1VBA4 1R094 1HRV4 2PLV4 1VBE4 1AR64 2RS54 2R064 1EAH4 1RUE4 1H8TD 1RUJ4 1K5MD 1VBB4 1Z7S4 3JBG4 3J8F4 1RUC4 1EV14 1PIV4 1PO14 1VBC4 2X5ID 3JD74 1VBD4 1NCQD 1AR94 1HXS4 1PO24 4GB34 1VRH4 2RM24 4Q4Y4 1R084 1OOPD 2HWB4 1AR74 1PVC4 1HRI4 2RR14 2R044 2RS14 4RHV4 2HWC4 1RUD4 1RUH4 1RMU4 2RMU4 1AL24 1RHI4 1BEV4 1POV0 4Q4X4 1RUF4 2R074 4Q4W4 1AR84 1D4M4 2RS34 4Q4V4 4PDWD 1NA1D 1RUI4 1RVF4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASJ 4;  1RUG 4;  1COV 4;  1MQT D;  1VBA 4;  1R09 4;  1HRV 4;  2PLV 4;  1VBE 4;  1AR6 4;  2RS5 4;  2R06 4;  1EAH 4;  1RUE 4;  1H8T D;  1RUJ 4;  1K5M D;  1VBB 4;  1Z7S 4;  3JBG 4;  3J8F 4;  1RUC 4;  1EV1 4;  1PIV 4;  1PO1 4;  1VBC 4;  2X5I D;  3JD7 4;  1VBD 4;  1NCQ D;  1AR9 4;  1HXS 4;  1PO2 4;  4GB3 4;  1VRH 4;  2RM2 4;  4Q4Y 4;  1R08 4;  1OOP D;  2HWB 4;  1AR7 4;  1PVC 4;  1HRI 4;  2RR1 4;  2R04 4;  2RS1 4;  4RHV 4;  2HWC 4;  1RUD 4;  1RUH 4;  1RMU 4;  2RMU 4;  1AL2 4;  1RHI 4;  1BEV 4;  1POV 0;  4Q4X 4;  1RUF 4;  2R07 4;  4Q4W 4;  1AR8 4;  1D4M 4;  2RS3 4;  4Q4V 4;  4PDW D;  1NA1 D;  1RUI 4;  1RVF 4; 
#chains in the Genus database with same CATH topology
 3AEA A;  1VBE 4;  2EX3 A;  2RS5 4;  3AE5 A;  2R7F A;  3VR9 A;  3J8F 4;  1EV1 4;  2FBW A;  3SFD A;  3JD7 4;  3AED A;  1HXS 4;  3VRB A;  1NEK A;  1VRH 4;  2HWB 4;  2RR1 4;  2H89 A;  2WQY A;  2WS3 A;  2WU5 A;  2WP9 A;  3FI7 A;  2HWC 4;  2RMU 4;  1RUH 4;  4Q4X 4;  3P4P A;  1AR8 4;  4YSZ A;  3P4S A;  4Q4V 4;  4PDW D;  2R04 4;  3CIR A;  2PYJ A;  1RUG 4;  3AEG A;  1VBA 4;  1HRV 4;  2PLV 4;  2PZS A;  3AEC A;  2WDQ A;  1RUJ 4;  3GQK A;  1PIV 4;  1VBC 4;  2X5I D;  3SUC A;  1NCQ D;  1AR9 4;  1PO2 4;  4GB3 4;  3GQH A;  1R08 4;  2WU2 A;  1PVC 4;  1HRI 4;  2B76 A;  1XHZ A;  4RHV 4;  1RUD 4;  1RMU 4;  1AL2 4;  1RHI 4;  2PYL A;  1YQ3 A;  1L0V A;  4YSX A;  1K5M D;  3AE4 A;  1ASJ 4;  1COV 4;  1KFY A;  1R09 4;  4YSY A;  3AE2 A;  2R06 4;  3P4Q A;  1RUE 4;  2ACZ A;  1H8T D;  1Z7S 4;  1RUC 4;  5C2T A;  3AEF A;  1PO1 4;  2H88 A;  4YTP A;  4YT0 A;  2RM2 4;  3AE6 A;  2RS1 4;  1XI1 A;  3P4R A;  1BEV 4;  1POV 0;  3AE7 A;  2PW9 A;  2RS3 4;  1RUI 4;  3AE9 A;  3AE1 A;  1XHX A;  1MQT D;  5C3J A;  1AR6 4;  1ZP0 A;  1EAH 4;  1NEN A;  1VBB 4;  3JBG 4;  3VRA A;  3AE8 A;  2WDR A;  3AEB A;  3AE3 A;  4KX6 A;  3AEE A;  1VBD 4;  3ABV A;  3VR8 A;  4Q4Y 4;  1OOP D;  1KF6 A;  1YQ4 A;  1AR7 4;  3SFE A;  4YXD A;  4YTN A;  1ZOY A;  1RUF 4;  2R07 4;  4Q4W 4;  1D4M 4;  4YTM A;  2PY5 A;  1NA1 D;  2WDV A;  1RVF 4; 
#chains in the Genus database with same CATH homology
 1ASJ 4;  1RUG 4;  1COV 4;  1MQT D;  1VBA 4;  1R09 4;  1HRV 4;  2PLV 4;  1VBE 4;  1AR6 4;  2RS5 4;  2R06 4;  1EAH 4;  1RUE 4;  1H8T D;  1RUJ 4;  1K5M D;  1VBB 4;  1Z7S 4;  3JBG 4;  3J8F 4;  1RUC 4;  1EV1 4;  1PIV 4;  1PO1 4;  1VBC 4;  2X5I D;  3JD7 4;  1VBD 4;  1NCQ D;  1AR9 4;  1HXS 4;  1PO2 4;  4GB3 4;  1VRH 4;  2RM2 4;  4Q4Y 4;  1R08 4;  1OOP D;  2HWB 4;  1AR7 4;  1PVC 4;  1HRI 4;  2RR1 4;  2R04 4;  2RS1 4;  4RHV 4;  2HWC 4;  1RUD 4;  1RUH 4;  1RMU 4;  2RMU 4;  1AL2 4;  1RHI 4;  1BEV 4;  1POV 0;  4Q4X 4;  1RUF 4;  2R07 4;  4Q4W 4;  1AR8 4;  1D4M 4;  2RS3 4;  4Q4V 4;  4PDW D;  1NA1 D;  1RUI 4;  1RVF 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...