2RRUA

Solution structure of the uba omain of p62 and its interaction with ubiquitin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title Crystal structure of the UBA omain of p62 and its interaction with ubiquitin
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2rruA00
2DAMA 1WGLA 1A5TA 3LCVB 1WJ7A 1G4AE 2MJ5B 2K9DA 2OOAA 2KHHA 1OKSA 2LTUA 2QNJA 3FE3A 1MN3A 2CP8A 3H4JA 2WZJA 1NV8A 1ZMVA 1PGYA 1EFUB 1KYIA 5JI2E 2G3QA 1QZEA 3IHPA 2L4FA 1T43A 3GLHE 4GEWA 4DBGB 2L4EA 1WR1B 1HT1E 2JY6B 3K9OA 2MGWA 1E94E 4F1IA 2RRUA 1OAIA 1VEKA 2DKLA 2DHYA 1C7YA 2JY7A 2OOBA 2R0IA 2JY8A 1Q02A 3MMPA 1F4IA 1CUKA 2B3TA 2DAIA 2EKKA 2CWBA 2JZ0A 1WGNA 1IFYA 2LVNC 3T6PA 1Y8GA 2DAKA 2JNHA 2KNVA 4R71A 1VDLA 2DENA 2LVOC 2JZ1A 5DFLA 2LVPC 1ZMWA 2LVQD 1G41A 1TTEA 1VEJA 4F2LA 2HAKA 3IECA 1WHCA 2KNAA 1OQYA 3E46A 2JY5A 3FRIA 1XXHE 1UFZA 2OO9A 2MR9A 1DO0A 2DAGA 4Q7JA 1IXSA 2BWBA 2ZTDA 2JUJA 1HT2E 2BWEA 2DI0A 2L2DA 1ZV1A 1G3IA 2HWJA 1OTRA 1VG5A 3GLFE 3K9PA 2DAEA 2O25A 1R4GA 1VQ1A 1GO5A 1AIPC 4G3OA 2K0BX 1V92A 3GLIE 1TR8A 2JP7A 1YLAA 3GLGE 4WP2A 1T6OA 2DNAA 2EJSA 4UN2B 1NV9A 3E21A 1HQYE 1HJPA 2QSFX 2MROB 1ZMUA 1BVSA 1P3QQ 1DO2A 3LCUA 2EKFA 1VEGA 2LVAA 2QHOB 3B89A 1WIVA 1IM2A 2DZLA 4HEOA 3FRHA 1DV0A 1SG9A 2KNZA 1XB2B 1JR3E 3BBZA 3F92A 2H5XA 2LBCA 2ZTCA
chains in the Genus database with same CATH superfamily
2DAMA 2Z3XA 2MH8A 1WJ7A 1G4AE 3MK6A 1Z6TA 1IN7A 2J7NA 4L78A 2KHHA 4QHTA 1OKSA 1NVMA 1OAOC 3VKHA 3AKZA 1QUSA 1AUAA 3GLIB 1K82A 3V76A 2WZJA 3VFDA 5IT9S 1J09A 1EFUB 3AV0A 1KYIA 2D7HA 5JI2E 3J7AS 1QZEA 3CTWB 4NXMM 5EXTA 4KT0F 4GEWA 2BNKA 3HKPA 1NSFA 3KSXA 3PVSA 3KOXE 5H37D 1N75A 5KPRA 2AHMA 1E9SA 2JY6B 4AKGA 2FNAA 4CJ6A 1TGUA 1SXJE 1E94E 1JR3A 2JWSA 2XH9A 4M9ZA 2ZM6M 3CF0A 2XZFA 1G59A 2UUBM 5LMNM 1FNNA 3W67A 1DGGA 2G5GX 3J81S 2QBYA 3HWSA 4GC9A 4R7GA 5LMUM 1L2CA 2JY8A 3TQSA 4AG5A 2JZ0A 1GLNA 4D82A 1QAMA 1WGNA 1XMOM 4OW0A 2DAKA 4LZZA 2JNHA 2EO2A 1R2ZA 2XFTA 3OTOM 2FE8A 4CGYB 3AOGA 2JZ1A 2Z4RA 5DFLA 5FLXS 2FFJA 4MB7A 4ANRA 4DR1M 2KA6B 3SAWA 1TTEA 4F2LA 2UXBM 4G4OA 1QDTA 4AZFA 8CATA 2KNAA 1OQYA 3DOAA 4P16A 4B7HA 3GO8A 5BR8M 2JY5A 3FRIA 3U6CA 1XXHE 2KDLA 1UFZA 1Z59A 5ITXE 3PNYA 4Q7JA 1IXSA 1NY6A 1QDRA 4GH9A 3RFWA 5JI3E 5ITRA 2ZTDA 4XBOA 3KOYE 2JUJA 1OIZA 1TH3A 2OPFA 5DYGA 3T38A 2UXCM 5ITTA 2R46A 2HHHM 1GL6A 1MU5A 3FUVA 4OX9M 4NSOB 1PJJA 2O25A 3VDUA 4CHTB 4BBAA 4WW0A 3U6MA 4W5WA 3UGJA 1Z5CA 4DUZM 3SASA 2DWMA 2JP7A 4YHHM 1QANA 4L8RC 1IN8A 1DGHA 1TDHA 1YLAA 3GRUA 1GJTA 1GL7A 2UU9M 4LJ4A 4WP2A 1T6OA 2G8LA 4HL4A 4DV0M 4DV2M 3KOWE 1IY0A 1RU3A 4OVZA 2QSFX 1QAOA 1L2DA 2YNMD 2CV0A 3U6QA 2ZBKB 4GIPA 4FW9A 2I7NA 1L8QA 3HHXA 4MGKE 2CV2A 1P3QQ 3B9PA 2LVAA 3L26A 3U6SA 4M9XA 3M0EA 3C3EA 4JXJA 5C1BA 3KOZE 3UK6A 4M0DA 4PD2A 3SHGB 2O01F 3UMMA 3DZDA 3A42A 4AKHA 3B74A 3GRVA 4M9SA 1XC8A 1QUTA 4PT5A 2F5OA 4B7GA 4LJ6A 2KNZA 4QNRA 3GLIA 5EXSA 1JR3E 3BBZA 2Y20A 3SAUA 2XGNA 3TE6A 2K47A 1V33A 3HX3A 4FWHA 3Q8GA 1IY2A 3LCVB 2K9DA 7CATA 2R44A 2QNJA 3WHLA 5ITQA 2P5TA 2DVWB 3H4JA 5C18A 3L2AA 3I51A 3L29A 4RKUF 4DV3M 3W68A 1ZMVA 1HNWM 2CEAA 1Z5BA 4D81A 4BB9A 2G3QA 3E4RA 2DZNB 5ITUA 4JI7M 4X65M 1T43A 1QYRA 4LRTA 2L4EA 4CIZA 2DXIA 3GPPA 4GKJM 1LV7A 1NNJA 1MX0A 1SXJC 4I4LA 4JN6A 4G4RA 1DGFA 2RRUA 3SMSA 1VEKA 2RGHA 1I4WA 4MGIE 4IJEA 4NRVA 2R4EA 3D8BA 5FSWA 2DHYA 4IBKA 3SBJA 4GHLA 1MJGM 4DV6M 3CGWA 3TWMA 1F4IA 3ZC7B 4QNMA 1Q3CA 1CUKA 2B3TA 1IY1A 2FH0A 1IFYA 2N35A 3PXGA 3THGA 1NO1A 2LHCA 3SYLA 4GITA 3FTFA 4NRWA 2M60A 3GRYA 3J80S 2LVOC 1IN5A 2LVPC 2RKOA 4R3DA 4IBCA 1Q39A 3BOSA 1W5SA 4M0WA 3TPZA 1J7KA 2NQ8C 2HAKA 4I81A 4IBFA 4GHAA 5F3WA 4KO8A 4AW4A 3T1HM 4HLQA 3J7BA 4JI4M 4LJ5A 1T3TA 2OO9A 4LF5M 5FTJA 1DO0A 1NHWC 2GQFA 3HU3A 4DR4M 2FOIC 2BWBA 1K3XA 2D7GA 2CHQA 3LMMA 5FTNA 1GKIA 4A3VB 2V1UA 1OJLA 2VDBB 1G3IA 1NNUC 2ERCA 1L1ZA 4LRSA 2V1CA 2JA2A 4L6V6 4LF4M 1L1TA 1V34A 1R4GA 1DGBA 1VQ1A 2F5QA 1NJFA 1AIPC 1GO5A 1Q3BA 2F5NA 1V92A 3GLIE 4DV7M 3KDSE 3I4VA 3ZQJA 3LW5F 2DWNA 2KZUA 5KQDA 4I8OA 3VLFB 4JI3M 4LJ7A 2R6FA 1R5LA 2X4AA 3U6DA 4KLNA 3B7ZA 5KPTA 1G8PA 2WSFF 3CF2A 1ZMUA 2UUAM 3WHKA 3UJNA 4WURA 3TWLA 3M6AA 1DO2A 2WSCF 3I4YA 2BJWA 3LCUA 4RF0A 5L8RF 1PRBA 3SC3A 3R8FA 1EIJA 4ITQA 1H6UA 1HQCA 2QENA 3NWLA 3ILKA 3HZJA 4LZJA 4KODA 3HU1A 5BPVA 3U6OA 3GLHB 4KHPM 3AOEA 3KS4A 2CRUA 4HEOA 1DV0A 2LWXA 4AKIA 3FRHA 4MGYE 2CHGA 4JI1M 4IIWA 5IREB 2R18A 2LHGA 5A2QS 1XB2B 4IBJA 2RGOA 3PFIA 4IJFA 5IWAM 4DR2M 3UZUA 1TF0B 2H1RA 2C98A 1XHBA 2ZTCA 3A98B 3FTDA 1WGLA 4Z8XA 5KQ8A 4NXNM 1A5TA 3SFZA 3GLFB 4DV4M 2ZAMA 3U61B 1ORYB 3I01M 2CUZA 1C1KA 1QQWA 2LTUA 3SHFA 3FE3A 4EIWA 1MN3A 2CP8A 4L15A 1L2BA 4I5SA 2UXDM 1D0MA 1NV8A 2X49A 1PGYA 3GPXA 3GLGB 1QZMA 2W82A 1PM5A 3IHPA 3J2PB 4LF7M 3Q8XA 2DWZB 4B3SM 3GLHE 2EUCA 1NY5A 1HT1E 1N36M 3GP1A 3GRRA 1K3WA 1XNQM 1TH4A 3VK8A 1D2NA 1OAIA 2XFSA 5FTKA 3VDPA 3BXWA 3KFUG 4FCWA 3C3DA 2F5PA 2R62A 5EXXA 2JY7A 2R0IA 1Q02A 2ZAOA 2M5ZA 2Z7JA 2EKKA 3HHWA 4G4NA 1N78A 3ZCBB 2CHVA 3TL4X 2HL7A 3LVWA 4NC6A 3LQRA 1VDLA 4GMQA 4OU7A 4REZA 1R7RA 4QOZC 2LVQD 1GJSA 1G41A 1R6BX 1VEJA 2DZOB 3QAUA 4JI2M 1IN6A 3SARA 2KRKA 1OFHA 3R9XB 3HGIA 3QYBA 3T1YM 3IG5A 3W0FA 1PJQA 3E46A 2DHRA 4IBGA 5EP2A 2VQEM 2FS1A 2HKJA 3KSJA 3U6EA 4B3MM 3KP1E 1XNRM 4LJAA 3A46A 1QVRA 1YE9A 2XF3A 3FUTA 1HT2E 2DI0A 3D8LA 2VQFM 2L2DA 1ZV1A 1GABA 4DR3M 2E5LM 1VG5A 4PCZA 1IN4A 2LXEA 3K9PA 4IBIA 1NJGA 3QWLA 3RGPA 2DAEA 3RE8A 2KW0A 3HHYA 4G6ZA 4X66M 2DWLA 1E9RA 4GC5A 3FUWA 3VKGA 4G3OA 1W5TA 3FYCA 1N77A 5ITYA 2WSEF 3SMPA 2JXNA 4DV5M 4FVMA 3FUXA 5KO3A 1NHGC 4L4UA 1PJTA 1SXJD 1SXJB 1J5EM 2Q2EB 5EP4A 2DNAA 2EJSA 3EIEA 3GLHA 3LQQA 1FJGM 1HQYE 4GRIA 4FWDA 1HJPA 4LY6A 1N34M 3U60B 4TUWA 3TWKA 5FTMA 2MROB 4FCTA 4B3TM 2C9CA 3B7QA 2EA0A 4NSRA 3NBIA 3K8ZA 2R4JA 3K1JA 5E6JA 3K92A 3HJQA 3J27B 1R2YA 4FD2A 5DYIA 1IXZA 2EKFA 4Y28F 3L25A 5EP1A 4QOSA 4AI6A 2VIIA 2LH0A 2QHOB 3U5ZB 3GLFA 3E9SA 3U61A 4AQYM 4K0KM 2BJVA 1EE8A 3FUUA 1QAQA 1IM2A 1VDDA 1ZAEA 1XXHB 4IBBA 4DR5M 1TDZA 2CFOA 3SYKA 3JR4A 4ZPXA 3HHZA 2GNOA 4IBDA 4S12A 3GQ4A 1X37A 2QQ8A 4B7FA 3U6LA 1KSFX 1XWIA 3GLGA 2XSZD 2X8AA 2L7HA 1JB0F 2D7EA 4LFCM 1PJIA 2LNHC 2K6BA 2MJ5B 3VK7A 3DA1A 4JI0M 2OOAA 3PNVA 1OIPA 5GKNA 4GKKM 1D0LA 2QZ4A 1PJSA 1YUBA 4JI6M 4B3RM 3AL0C 2YFQA 4L16A 3GQ5A 1LTMA 2VF8A 3GQ3A 3HJ8A 2QCUA 3C58A 1HNZM 3AFHA 4DR6M 4AG6A 4JI8M 2L7IA 2L4FA 3KXEC 3KP0E 3QYEA 2C96A 3W0LB 2KRUA 4DBGB 2Y0QA 1WR1B 3L27A 4LJ9A 4MH0E 4JI5M 5EQTA 3SAVA 4LF9M 3HJSA 1Z5AA 2J7OA 3K9OA 2MGWA 4II7A 4F1IA 2L09A 2DKLA 3RGSA 4MM3B 1IBKM 3B7NA 2CE7A 1IXRC 4P17A 4DV1M 3FD9A 5EXPA 1TH2A 2KEBA 1C7YA 2OOBA 2VF7A 2Y21A 2Z4SA 3MMPA 2DAIA 1N32M 2Y0TA 2CWBA 5DNYA 3GPYA 2LVNC 4DUYM 3T6PA 1Y8GA 4IBEA 2L6OA 4DR7M 2KNVA 4PDGA 4R71A 1I94M 2R65A 3GPUA 2DENA 2XZUA 1JR3D 5EP3A 3JR5A 3AJIB 4CISA 2Z8YM 1ZMWA 5KPZA 3T15A 3FTCA 2YR0A 4QHSA 3LVVA 4FWGA 3IECA 1WHCA 2V6ZM 1XMQM 4RF1A 2QBYB 3HU2A 3A45A 3SATA 3H4MA 4LGMA 2MR9A 4JYAM 3I04M 2DAGA 4PDIA 3KW6A 2HCBA 4BLCA 1SXJA 4NOOB 2BWEA 3CF6E 2QPAA 4LFAM 3GLFE 2HWJA 1OTRA 3AOEC 2R45A 5IZ7D 2F5SA 3U6PA 2KZSA 1YSYA 3DFZA 2C99A 3U60A 2CV1A 4X64M 3MJ5A 1WXQA 4XK8F 2K0BX 3K2LA 4LJ8A 1E32A 4MGZE 4MGHA 4B08A 2ZANA 1TR8A 3FYDA 1IXSB 1JQJC 2J5YA 2XEPA 3IG8A 4NL4H 3ZH9B 1UM8A 2I7PA 2QP9X 3GLGE 4G4QA 3KS8A 1IQPA 3FKEA 1HR0M 3U5ZA 5E26A 4JV5M 1D0KA 2KXEA 4UN2B 1NV9A 3E21A 1GVNA 2A5YB 5FTLA 1XXHA 2C9OA 2O5RA 1BVSA 3JAMS 4D80A 4LF8M 5ITXA 3MHVC 1OFIA 1DGHB 1ZQ9A 1VEGA 2APLA 3KVWA 2XSZA 2UUCM 1G71A 4LG2A 5EJCA 1N33M 4LFBM 3FTEA 4RNAA 1S3SA 4OVZB 3B89A 2OQ4A 3NBXX 1WIVA 2DZLA 4XGIA 2C5RA 2F4VM 2YQZA 2XLJA 1SG9A 4YY3M 1IBMM 3M7GA 4LGYA 3HY5A 4LF6M 4FCVA 3C9PA 3L28A 1IBLM 3EIHA 4LCBA 4X62M 3F92A 2H5XA 2LBCA 1KFVA 1HNXM 4Z6YA
chains in the Genus database with same CATH topology
2DAMA 1WGLA 1A5TA 3LCVB 1WJ7A 1G4AE 2MJ5B 2K9DA 2OOAA 2KHHA 1OKSA 2LTUA 2QNJA 3FE3A 1MN3A 2CP8A 3H4JA 2WZJA 1NV8A 1ZMVA 1PGYA 1EFUB 1KYIA 5JI2E 2G3QA 1QZEA 3IHPA 2L4FA 1T43A 3GLHE 4GEWA 4DBGB 2L4EA 1WR1B 1HT1E 2JY6B 3K9OA 2MGWA 1E94E 4F1IA 2RRUA 1OAIA 1VEKA 2DKLA 2DHYA 1C7YA 2JY7A 2OOBA 2R0IA 2JY8A 1Q02A 3MMPA 1F4IA 1CUKA 2B3TA 2DAIA 2EKKA 2CWBA 2JZ0A 1WGNA 1IFYA 2LVNC 3T6PA 1Y8GA 2DAKA 2JNHA 2KNVA 4R71A 1VDLA 2DENA 2LVOC 2JZ1A 5DFLA 2LVPC 1ZMWA 2LVQD 1G41A 1TTEA 1VEJA 4F2LA 2HAKA 3IECA 1WHCA 2KNAA 1OQYA 3E46A 2JY5A 3FRIA 1XXHE 1UFZA 2OO9A 2MR9A 1DO0A 2DAGA 4Q7JA 1IXSA 2BWBA 2ZTDA 2JUJA 1HT2E 2BWEA 2DI0A 2L2DA 1ZV1A 1G3IA 2HWJA 1OTRA 1VG5A 3GLFE 3K9PA 2DAEA 2O25A 1R4GA 1VQ1A 1GO5A 1AIPC 4G3OA 2K0BX 1V92A 3GLIE 1TR8A 2JP7A 1YLAA 3GLGE 4WP2A 1T6OA 2DNAA 2EJSA 4UN2B 1NV9A 3E21A 1HQYE 1HJPA 2QSFX 2MROB 1ZMUA 1BVSA 1P3QQ 1DO2A 3LCUA 2EKFA 1VEGA 2LVAA 2QHOB 3B89A 1WIVA 1IM2A 2DZLA 4HEOA 3FRHA 1DV0A 1SG9A 2KNZA 1XB2B 1JR3E 3BBZA 3F92A 2H5XA 2LBCA 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAM A;  1WGL A;  1A5T A;  3LCV B;  1WJ7 A;  1G4A E;  2MJ5 B;  2K9D A;  2OOA A;  2KHH A;  1OKS A;  2LTU A;  2QNJ A;  3FE3 A;  1MN3 A;  2CP8 A;  3H4J A;  2WZJ A;  1NV8 A;  1ZMV A;  1PGY A;  1EFU B;  1KYI A;  5JI2 E;  2G3Q A;  1QZE A;  3IHP A;  2L4F A;  1T43 A;  3GLH E;  4GEW A;  4DBG B;  2L4E A;  1WR1 B;  1HT1 E;  2JY6 B;  3K9O A;  2MGW A;  1E94 E;  4F1I A;  2RRU A;  1OAI A;  1VEK A;  2DKL A;  2DHY A;  1C7Y A;  2JY7 A;  2OOB A;  2R0I A;  2JY8 A;  1Q02 A;  3MMP A;  1F4I A;  1CUK A;  2B3T A;  2DAI A;  2EKK A;  2CWB A;  2JZ0 A;  1WGN A;  1IFY A;  2LVN C;  3T6P A;  1Y8G A;  2DAK A;  2JNH A;  2KNV A;  4R71 A;  1VDL A;  2DEN A;  2LVO C;  2JZ1 A;  5DFL A;  2LVP C;  1ZMW A;  2LVQ D;  1G41 A;  1TTE A;  1VEJ A;  4F2L A;  2HAK A;  3IEC A;  1WHC A;  2KNA A;  1OQY A;  3E46 A;  2JY5 A;  3FRI A;  1XXH E;  1UFZ A;  2OO9 A;  2MR9 A;  1DO0 A;  2DAG A;  4Q7J A;  1IXS A;  2BWB A;  2ZTD A;  2JUJ A;  1HT2 E;  2BWE A;  2DI0 A;  2L2D A;  1ZV1 A;  1G3I A;  2HWJ A;  1OTR A;  1VG5 A;  3GLF E;  3K9P A;  2DAE A;  2O25 A;  1R4G A;  1VQ1 A;  1GO5 A;  1AIP C;  4G3O A;  2K0B X;  1V92 A;  3GLI E;  1TR8 A;  2JP7 A;  1YLA A;  3GLG E;  4WP2 A;  1T6O A;  2DNA A;  2EJS A;  4UN2 B;  1NV9 A;  3E21 A;  1HQY E;  1HJP A;  2QSF X;  2MRO B;  1ZMU A;  1BVS A;  1P3Q Q;  1DO2 A;  3LCU A;  2EKF A;  1VEG A;  2LVA A;  2QHO B;  3B89 A;  1WIV A;  1IM2 A;  2DZL A;  4HEO A;  3FRH A;  1DV0 A;  1SG9 A;  2KNZ A;  1XB2 B;  1JR3 E;  3BBZ A;  3F92 A;  2H5X A;  2LBC A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 2DAM A;  2Z3X A;  2MH8 A;  1WJ7 A;  1G4A E;  3MK6 A;  1Z6T A;  1IN7 A;  2J7N A;  4L78 A;  2KHH A;  4QHT A;  1OKS A;  1NVM A;  1OAO C;  3VKH A;  3AKZ A;  1QUS A;  1AUA A;  3GLI B;  1K82 A;  3V76 A;  2WZJ A;  3VFD A;  5IT9 S;  1J09 A;  1EFU B;  3AV0 A;  1KYI A;  2D7H A;  5JI2 E;  3J7A S;  1QZE A;  3CTW B;  4NXM M;  5EXT A;  4KT0 F;  4GEW A;  2BNK A;  3HKP A;  1NSF A;  3KSX A;  3PVS A;  3KOX E;  5H37 D;  1N75 A;  5KPR A;  2AHM A;  1E9S A;  2JY6 B;  4AKG A;  2FNA A;  4CJ6 A;  1TGU A;  1SXJ E;  1E94 E;  1JR3 A;  2JWS A;  2XH9 A;  4M9Z A;  2ZM6 M;  3CF0 A;  2XZF A;  1G59 A;  2UUB M;  5LMN M;  1FNN A;  3W67 A;  1DGG A;  2G5G X;  3J81 S;  2QBY A;  3HWS A;  4GC9 A;  4R7G A;  5LMU M;  1L2C A;  2JY8 A;  3TQS A;  4AG5 A;  2JZ0 A;  1GLN A;  4D82 A;  1QAM A;  1WGN A;  1XMO M;  4OW0 A;  2DAK A;  4LZZ A;  2JNH A;  2EO2 A;  1R2Z A;  2XFT A;  3OTO M;  2FE8 A;  4CGY B;  3AOG A;  2JZ1 A;  2Z4R A;  5DFL A;  5FLX S;  2FFJ A;  4MB7 A;  4ANR A;  4DR1 M;  2KA6 B;  3SAW A;  1TTE A;  4F2L A;  2UXB M;  4G4O A;  1QDT A;  4AZF A;  8CAT A;  2KNA A;  1OQY A;  3DOA A;  4P16 A;  4B7H A;  3GO8 A;  5BR8 M;  2JY5 A;  3FRI A;  3U6C A;  1XXH E;  2KDL A;  1UFZ A;  1Z59 A;  5ITX E;  3PNY A;  4Q7J A;  1IXS A;  1NY6 A;  1QDR A;  4GH9 A;  3RFW A;  5JI3 E;  5ITR A;  2ZTD A;  4XBO A;  3KOY E;  2JUJ A;  1OIZ A;  1TH3 A;  2OPF A;  5DYG A;  3T38 A;  2UXC M;  5ITT A;  2R46 A;  2HHH M;  1GL6 A;  1MU5 A;  3FUV A;  4OX9 M;  4NSO B;  1PJJ A;  2O25 A;  3VDU A;  4CHT B;  4BBA A;  4WW0 A;  3U6M A;  4W5W A;  3UGJ A;  1Z5C A;  4DUZ M;  3SAS A;  2DWM A;  2JP7 A;  4YHH M;  1QAN A;  4L8R C;  1IN8 A;  1DGH A;  1TDH A;  1YLA A;  3GRU A;  1GJT A;  1GL7 A;  2UU9 M;  4LJ4 A;  4WP2 A;  1T6O A;  2G8L A;  4HL4 A;  4DV0 M;  4DV2 M;  3KOW E;  1IY0 A;  1RU3 A;  4OVZ A;  2QSF X;  1QAO A;  1L2D A;  2YNM D;  2CV0 A;  3U6Q A;  2ZBK B;  4GIP A;  4FW9 A;  2I7N A;  1L8Q A;  3HHX A;  4MGK E;  2CV2 A;  1P3Q Q;  3B9P A;  2LVA A;  3L26 A;  3U6S A;  4M9X A;  3M0E A;  3C3E A;  4JXJ A;  5C1B A;  3KOZ E;  3UK6 A;  4M0D A;  4PD2 A;  3SHG B;  2O01 F;  3UMM A;  3DZD A;  3A42 A;  4AKH A;  3B74 A;  3GRV A;  4M9S A;  1XC8 A;  1QUT A;  4PT5 A;  2F5O A;  4B7G A;  4LJ6 A;  2KNZ A;  4QNR A;  3GLI A;  5EXS A;  1JR3 E;  3BBZ A;  2Y20 A;  3SAU A;  2XGN A;  3TE6 A;  2K47 A;  1V33 A;  3HX3 A;  4FWH A;  3Q8G A;  1IY2 A;  3LCV B;  2K9D A;  7CAT A;  2R44 A;  2QNJ A;  3WHL A;  5ITQ A;  2P5T A;  2DVW B;  3H4J A;  5C18 A;  3L2A A;  3I51 A;  3L29 A;  4RKU F;  4DV3 M;  3W68 A;  1ZMV A;  1HNW M;  2CEA A;  1Z5B A;  4D81 A;  4BB9 A;  2G3Q A;  3E4R A;  2DZN B;  5ITU A;  4JI7 M;  4X65 M;  1T43 A;  1QYR A;  4LRT A;  2L4E A;  4CIZ A;  2DXI A;  3GPP A;  4GKJ M;  1LV7 A;  1NNJ A;  1MX0 A;  1SXJ C;  4I4L A;  4JN6 A;  4G4R A;  1DGF A;  2RRU A;  3SMS A;  1VEK A;  2RGH A;  1I4W A;  4MGI E;  4IJE A;  4NRV A;  2R4E A;  3D8B A;  5FSW A;  2DHY A;  4IBK A;  3SBJ A;  4GHL A;  1MJG M;  4DV6 M;  3CGW A;  3TWM A;  1F4I A;  3ZC7 B;  4QNM A;  1Q3C A;  1CUK A;  2B3T A;  1IY1 A;  2FH0 A;  1IFY A;  2N35 A;  3PXG A;  3THG A;  1NO1 A;  2LHC A;  3SYL A;  4GIT A;  3FTF A;  4NRW A;  2M60 A;  3GRY A;  3J80 S;  2LVO C;  1IN5 A;  2LVP C;  2RKO A;  4R3D A;  4IBC A;  1Q39 A;  3BOS A;  1W5S A;  4M0W A;  3TPZ A;  1J7K A;  2NQ8 C;  2HAK A;  4I81 A;  4IBF A;  4GHA A;  5F3W A;  4KO8 A;  4AW4 A;  3T1H M;  4HLQ A;  3J7B A;  4JI4 M;  4LJ5 A;  1T3T A;  2OO9 A;  4LF5 M;  5FTJ A;  1DO0 A;  1NHW C;  2GQF A;  3HU3 A;  4DR4 M;  2FOI C;  2BWB A;  1K3X A;  2D7G A;  2CHQ A;  3LMM A;  5FTN A;  1GKI A;  4A3V B;  2V1U A;  1OJL A;  2VDB B;  1G3I A;  1NNU C;  2ERC A;  1L1Z A;  4LRS A;  2V1C A;  2JA2 A;  4L6V 6;  4LF4 M;  1L1T A;  1V34 A;  1R4G A;  1DGB A;  1VQ1 A;  2F5Q A;  1NJF A;  1AIP C;  1GO5 A;  1Q3B A;  2F5N A;  1V92 A;  3GLI E;  4DV7 M;  3KDS E;  3I4V A;  3ZQJ A;  3LW5 F;  2DWN A;  2KZU A;  5KQD A;  4I8O A;  3VLF B;  4JI3 M;  4LJ7 A;  2R6F A;  1R5L A;  2X4A A;  3U6D A;  4KLN A;  3B7Z A;  5KPT A;  1G8P A;  2WSF F;  3CF2 A;  1ZMU A;  2UUA M;  3WHK A;  3UJN A;  4WUR A;  3TWL A;  3M6A A;  1DO2 A;  2WSC F;  3I4Y A;  2BJW A;  3LCU A;  4RF0 A;  5L8R F;  1PRB A;  3SC3 A;  3R8F A;  1EIJ A;  4ITQ A;  1H6U A;  1HQC A;  2QEN A;  3NWL A;  3ILK A;  3HZJ A;  4LZJ A;  4KOD A;  3HU1 A;  5BPV A;  3U6O A;  3GLH B;  4KHP M;  3AOE A;  3KS4 A;  2CRU A;  4HEO A;  1DV0 A;  2LWX A;  4AKI A;  3FRH A;  4MGY E;  2CHG A;  4JI1 M;  4IIW A;  5IRE B;  2R18 A;  2LHG A;  5A2Q S;  1XB2 B;  4IBJ A;  2RGO A;  3PFI A;  4IJF A;  5IWA M;  4DR2 M;  3UZU A;  1TF0 B;  2H1R A;  2C98 A;  1XHB A;  2ZTC A;  3A98 B;  3FTD A;  1WGL A;  4Z8X A;  5KQ8 A;  4NXN M;  1A5T A;  3SFZ A;  3GLF B;  4DV4 M;  2ZAM A;  3U61 B;  1ORY B;  3I01 M;  2CUZ A;  1C1K A;  1QQW A;  2LTU A;  3SHF A;  3FE3 A;  4EIW A;  1MN3 A;  2CP8 A;  4L15 A;  1L2B A;  4I5S A;  2UXD M;  1D0M A;  1NV8 A;  2X49 A;  1PGY A;  3GPX A;  3GLG B;  1QZM A;  2W82 A;  1PM5 A;  3IHP A;  3J2P B;  4LF7 M;  3Q8X A;  2DWZ B;  4B3S M;  3GLH E;  2EUC A;  1NY5 A;  1HT1 E;  1N36 M;  3GP1 A;  3GRR A;  1K3W A;  1XNQ M;  1TH4 A;  3VK8 A;  1D2N A;  1OAI A;  2XFS A;  5FTK A;  3VDP A;  3BXW A;  3KFU G;  4FCW A;  3C3D A;  2F5P A;  2R62 A;  5EXX A;  2JY7 A;  2R0I A;  1Q02 A;  2ZAO A;  2M5Z A;  2Z7J A;  2EKK A;  3HHW A;  4G4N A;  1N78 A;  3ZCB B;  2CHV A;  3TL4 X;  2HL7 A;  3LVW A;  4NC6 A;  3LQR A;  1VDL A;  4GMQ A;  4OU7 A;  4REZ A;  1R7R A;  4QOZ C;  2LVQ D;  1GJS A;  1G41 A;  1R6B X;  1VEJ A;  2DZO B;  3QAU A;  4JI2 M;  1IN6 A;  3SAR A;  2KRK A;  1OFH A;  3R9X B;  3HGI A;  3QYB A;  3T1Y M;  3IG5 A;  3W0F A;  1PJQ A;  3E46 A;  2DHR A;  4IBG A;  5EP2 A;  2VQE M;  2FS1 A;  2HKJ A;  3KSJ A;  3U6E A;  4B3M M;  3KP1 E;  1XNR M;  4LJA A;  3A46 A;  1QVR A;  1YE9 A;  2XF3 A;  3FUT A;  1HT2 E;  2DI0 A;  3D8L A;  2VQF M;  2L2D A;  1ZV1 A;  1GAB A;  4DR3 M;  2E5L M;  1VG5 A;  4PCZ A;  1IN4 A;  2LXE A;  3K9P A;  4IBI A;  1NJG A;  3QWL A;  3RGP A;  2DAE A;  3RE8 A;  2KW0 A;  3HHY A;  4G6Z A;  4X66 M;  2DWL A;  1E9R A;  4GC5 A;  3FUW A;  3VKG A;  4G3O A;  1W5T A;  3FYC A;  1N77 A;  5ITY A;  2WSE F;  3SMP A;  2JXN A;  4DV5 M;  4FVM A;  3FUX A;  5KO3 A;  1NHG C;  4L4U A;  1PJT A;  1SXJ D;  1SXJ B;  1J5E M;  2Q2E B;  5EP4 A;  2DNA A;  2EJS A;  3EIE A;  3GLH A;  3LQQ A;  1FJG M;  1HQY E;  4GRI A;  4FWD A;  1HJP A;  4LY6 A;  1N34 M;  3U60 B;  4TUW A;  3TWK A;  5FTM A;  2MRO B;  4FCT A;  4B3T M;  2C9C A;  3B7Q A;  2EA0 A;  4NSR A;  3NBI A;  3K8Z A;  2R4J A;  3K1J A;  5E6J A;  3K92 A;  3HJQ A;  3J27 B;  1R2Y A;  4FD2 A;  5DYI A;  1IXZ A;  2EKF A;  4Y28 F;  3L25 A;  5EP1 A;  4QOS A;  4AI6 A;  2VII A;  2LH0 A;  2QHO B;  3U5Z B;  3GLF A;  3E9S A;  3U61 A;  4AQY M;  4K0K M;  2BJV A;  1EE8 A;  3FUU A;  1QAQ A;  1IM2 A;  1VDD A;  1ZAE A;  1XXH B;  4IBB A;  4DR5 M;  1TDZ A;  2CFO A;  3SYK A;  3JR4 A;  4ZPX A;  3HHZ A;  2GNO A;  4IBD A;  4S12 A;  3GQ4 A;  1X37 A;  2QQ8 A;  4B7F A;  3U6L A;  1KSF X;  1XWI A;  3GLG A;  2XSZ D;  2X8A A;  2L7H A;  1JB0 F;  2D7E A;  4LFC M;  1PJI A;  2LNH C;  2K6B A;  2MJ5 B;  3VK7 A;  3DA1 A;  4JI0 M;  2OOA A;  3PNV A;  1OIP A;  5GKN A;  4GKK M;  1D0L A;  2QZ4 A;  1PJS A;  1YUB A;  4JI6 M;  4B3R M;  3AL0 C;  2YFQ A;  4L16 A;  3GQ5 A;  1LTM A;  2VF8 A;  3GQ3 A;  3HJ8 A;  2QCU A;  3C58 A;  1HNZ M;  3AFH A;  4DR6 M;  4AG6 A;  4JI8 M;  2L7I A;  2L4F A;  3KXE C;  3KP0 E;  3QYE A;  2C96 A;  3W0L B;  2KRU A;  4DBG B;  2Y0Q A;  1WR1 B;  3L27 A;  4LJ9 A;  4MH0 E;  4JI5 M;  5EQT A;  3SAV A;  4LF9 M;  3HJS A;  1Z5A A;  2J7O A;  3K9O A;  2MGW A;  4II7 A;  4F1I A;  2L09 A;  2DKL A;  3RGS A;  4MM3 B;  1IBK M;  3B7N A;  2CE7 A;  1IXR C;  4P17 A;  4DV1 M;  3FD9 A;  5EXP A;  1TH2 A;  2KEB A;  1C7Y A;  2OOB A;  2VF7 A;  2Y21 A;  2Z4S A;  3MMP A;  2DAI A;  1N32 M;  2Y0T A;  2CWB A;  5DNY A;  3GPY A;  2LVN C;  4DUY M;  3T6P A;  1Y8G A;  4IBE A;  2L6O A;  4DR7 M;  2KNV A;  4PDG A;  4R71 A;  1I94 M;  2R65 A;  3GPU A;  2DEN A;  2XZU A;  1JR3 D;  5EP3 A;  3JR5 A;  3AJI B;  4CIS A;  2Z8Y M;  1ZMW A;  5KPZ A;  3T15 A;  3FTC A;  2YR0 A;  4QHS A;  3LVV A;  4FWG A;  3IEC A;  1WHC A;  2V6Z M;  1XMQ M;  4RF1 A;  2QBY B;  3HU2 A;  3A45 A;  3SAT A;  3H4M A;  4LGM A;  2MR9 A;  4JYA M;  3I04 M;  2DAG A;  4PDI A;  3KW6 A;  2HCB A;  4BLC A;  1SXJ A;  4NOO B;  2BWE A;  3CF6 E;  2QPA A;  4LFA M;  3GLF E;  2HWJ A;  1OTR A;  3AOE C;  2R45 A;  5IZ7 D;  2F5S A;  3U6P A;  2KZS A;  1YSY A;  3DFZ A;  2C99 A;  3U60 A;  2CV1 A;  4X64 M;  3MJ5 A;  1WXQ A;  4XK8 F;  2K0B X;  3K2L A;  4LJ8 A;  1E32 A;  4MGZ E;  4MGH A;  4B08 A;  2ZAN A;  1TR8 A;  3FYD A;  1IXS B;  1JQJ C;  2J5Y A;  2XEP A;  3IG8 A;  4NL4 H;  3ZH9 B;  1UM8 A;  2I7P A;  2QP9 X;  3GLG E;  4G4Q A;  3KS8 A;  1IQP A;  3FKE A;  1HR0 M;  3U5Z A;  5E26 A;  4JV5 M;  1D0K A;  2KXE A;  4UN2 B;  1NV9 A;  3E21 A;  1GVN A;  2A5Y B;  5FTL A;  1XXH A;  2C9O A;  2O5R A;  1BVS A;  3JAM S;  4D80 A;  4LF8 M;  5ITX A;  3MHV C;  1OFI A;  1DGH B;  1ZQ9 A;  1VEG A;  2APL A;  3KVW A;  2XSZ A;  2UUC M;  1G71 A;  4LG2 A;  5EJC A;  1N33 M;  4LFB M;  3FTE A;  4RNA A;  1S3S A;  4OVZ B;  3B89 A;  2OQ4 A;  3NBX X;  1WIV A;  2DZL A;  4XGI A;  2C5R A;  2F4V M;  2YQZ A;  2XLJ A;  1SG9 A;  4YY3 M;  1IBM M;  3M7G A;  4LGY A;  3HY5 A;  4LF6 M;  4FCV A;  3C9P A;  3L28 A;  1IBL M;  3EIH A;  4LCB A;  4X62 M;  3F92 A;  2H5X A;  2LBC A;  1KFV A;  1HNX M;  4Z6Y A; 
#chains in the Genus database with same CATH homology
 2DAM A;  1WGL A;  1A5T A;  3LCV B;  1WJ7 A;  1G4A E;  2MJ5 B;  2K9D A;  2OOA A;  2KHH A;  1OKS A;  2LTU A;  2QNJ A;  3FE3 A;  1MN3 A;  2CP8 A;  3H4J A;  2WZJ A;  1NV8 A;  1ZMV A;  1PGY A;  1EFU B;  1KYI A;  5JI2 E;  2G3Q A;  1QZE A;  3IHP A;  2L4F A;  1T43 A;  3GLH E;  4GEW A;  4DBG B;  2L4E A;  1WR1 B;  1HT1 E;  2JY6 B;  3K9O A;  2MGW A;  1E94 E;  4F1I A;  2RRU A;  1OAI A;  1VEK A;  2DKL A;  2DHY A;  1C7Y A;  2JY7 A;  2OOB A;  2R0I A;  2JY8 A;  1Q02 A;  3MMP A;  1F4I A;  1CUK A;  2B3T A;  2DAI A;  2EKK A;  2CWB A;  2JZ0 A;  1WGN A;  1IFY A;  2LVN C;  3T6P A;  1Y8G A;  2DAK A;  2JNH A;  2KNV A;  4R71 A;  1VDL A;  2DEN A;  2LVO C;  2JZ1 A;  5DFL A;  2LVP C;  1ZMW A;  2LVQ D;  1G41 A;  1TTE A;  1VEJ A;  4F2L A;  2HAK A;  3IEC A;  1WHC A;  2KNA A;  1OQY A;  3E46 A;  2JY5 A;  3FRI A;  1XXH E;  1UFZ A;  2OO9 A;  2MR9 A;  1DO0 A;  2DAG A;  4Q7J A;  1IXS A;  2BWB A;  2ZTD A;  2JUJ A;  1HT2 E;  2BWE A;  2DI0 A;  2L2D A;  1ZV1 A;  1G3I A;  2HWJ A;  1OTR A;  1VG5 A;  3GLF E;  3K9P A;  2DAE A;  2O25 A;  1R4G A;  1VQ1 A;  1GO5 A;  1AIP C;  4G3O A;  2K0B X;  1V92 A;  3GLI E;  1TR8 A;  2JP7 A;  1YLA A;  3GLG E;  4WP2 A;  1T6O A;  2DNA A;  2EJS A;  4UN2 B;  1NV9 A;  3E21 A;  1HQY E;  1HJP A;  2QSF X;  2MRO B;  1ZMU A;  1BVS A;  1P3Q Q;  1DO2 A;  3LCU A;  2EKF A;  1VEG A;  2LVA A;  2QHO B;  3B89 A;  1WIV A;  1IM2 A;  2DZL A;  4HEO A;  3FRH A;  1DV0 A;  1SG9 A;  2KNZ A;  1XB2 B;  1JR3 E;  3BBZ A;  3F92 A;  2H5X A;  2LBC A;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...