2RRUA

Solution structure of the uba omain of p62 and its interaction with ubiquitin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the UBA omain of p62 and its interaction with ubiquitin
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Sequestosome-1
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2rruA00
1F4IA 4HEOA 2MJ5B 1TTEA 1VDLA 1YLAA 1VEKA 1WIVA 3GLIE 2DKLA 2ZTDA 1OAIA 4F2LA 1OQYA 3H4JA 1IFYA 2JY7A 3GLGE 2H5XA 1DO0A 2KNVA 2JNHA 1GO5A 1VG5A 3IECA 2KNZA 1ZMWA 3K9OA 1WR1B 1AIPC 2DNAA 2K9DA 1HJPA 1ZMUA 1IXSA 3F92A 2DZLA 4F1IA 1NV8A 2JP7A 1WHCA 1P3QQ 1XB2B 2MROB 3MMPA 2L4EA 2LVPC 1R4GA 3FE3A 2LVAA 2KHHA 2BWBA 2HAKA 2K0BX 2WZJA 1OKSA 2LVQD 4UN2B 1HT1E 2JY5A 2QHOB 3GLHE 1EFUB 1G3IA 1T43A 1E94E 1DO2A 2QNJA 4DBGB 1MN3A 1T6OA 2DAIA 1C7YA 2EJSA 2OOAA 2B3TA 2OOBA 3LCUA 1DV0A 1Y8GA 3LCVB 1WGNA 2OO9A 2CWBA 1VQ1A 2JUJA 3IHPA 1HT2E 1V92A 4GEWA 2DHYA 3B89A 1HQYE 2DAEA 2JY6B 1G4AE 1NV9A 2MR9A 1VEJA 1IM2A 3E46A 2LTUA 4WP2A 1OTRA 2BWEA 2R0IA 1CUKA 1UFZA 3E21A 2G3QA 1A5TA 2DAGA 2L2DA 3GLFE 1ZV1A 4G3OA 2JZ1A 2JY8A 4R71A 2RRUA 1WGLA 2QSFX 2CP8A 2DI0A 1VEGA 4Q7JA 3T6PA 5DFLA 3K9PA 1PGYA 2MGWA 2EKKA 2ZTCA 2HWJA 2L4FA 2JZ0A 1BVSA 1G41A 2KNAA 1Q02A 5JI2E 3FRHA 3BBZA 2EKFA 1SG9A 1TR8A 1XXHE 2DENA 2DAKA 2LVOC 1KYIA 2LBCA 2O25A 2DAMA 1WJ7A 2LVNC 1JR3E 1QZEA 3FRIA 1ZMVA
chains in the Genus database with same CATH superfamily
2MJ5B 2UXBM 1MJGM 4QOSA 4S12A 1WIVA 3GLIE 4AG6A 1I4WA 1H6UA 3H4JA 1IFYA 3U6DA 3VLFB 3W0LB 4W5WA 1AUAA 4M0DA 4JI4M 3OTOM 1D2NA 3AV0A 4P16A 4DV1M 4GRIA 2XH9A 1SXJD 5EP1A 3KOZE 3PNVA 3PXGA 3DZDA 4FWHA 4DV2M 5EP2A 2KNZA 4GIPA 2UUAM 2JWSA 4K0KM 4I81A 4R3DA 4RF0A 3U6MA 2CRUA 1HJPA 1ZMUA 2W82A 1IXSA 4L8RC 2CHQA 3FUTA 2YFQA 2L09A 1IN8A 3K8ZA 4LZZA 5EP3A 3RE8A 2R18A 3GP1A 4AI6A 3I51A 1P3QQ 4HLQA 4AKHA 3L29A 2MROB 2LVPC 1GABA 5EXTA 3TWKA 3E4RA 1JQJC 4Z8XA 3SBJA 2LVQD 4G4OA 1OFHA 1L2CA 2XZFA 1IBLM 4DR6M 1HNZM 3GLHE 2LNHC 4B7FA 4IBFA 4M9XA 1EFUB 1Z59A 2V1CA 3I4YA 3KOWE 2YR0A 1D0KA 2K6BA 4DV3M 2LHGA 2XFTA 3I04M 4KHPM 5EXPA 4FW9A 4DBGB 1IN5A 5EXSA 1NNUC 2CV1A 4AKGA 1L8QA 2AHMA 5FLXS 5KQ8A 1C7YA 3U6OA 1IXSB 4L15A 2XSZA 5FTNA 3PNYA 3D8BA 1I94M 4OVZB 2EJSA 3AOGA 3GLHA 5ITQA 2B3TA 2OOBA 3FUVA 3CF0A 3LQQA 3PVSA 1Y8GA 3GRRA 1QAMA 3GPYA 1GVNA 2OO9A 2CWBA 4LFAM 2JUJA 3IHPA 4KO8A 2L7IA 4GEWA 3M6AA 4FWGA 3AJIB 1NV9A 3IG8A 3KOYE 1K3WA 2LTUA 2BWEA 1CUKA 1QUSA 1UFZA 2Z7JA 5DYIA 2CE7A 2D7HA 3QYBA 1NO1A 1ZQ9A 4AW4A 1NSFA 3GLFE 3AL0C 1ZV1A 2JZ1A 3LW5F 3IG5A 3VFDA 3AFHA 1DGHA 3TPZA 2EA0A 3L27A 2DI0A 4JXJA 4Q7JA 5IWAM 5DYGA 1EE8A 1GLNA 2ZTCA 1L1ZA 3NBIA 2JZ0A 2Y20A 1BVSA 2ZAOA 2F5OA 4G6ZA 3R9XB 2XEPA 4L6V6 4LF4M 2F4VM 1TH4A 1SG9A 4I8OA 3GLFA 3GLGB 5FTLA 1DGGA 3NWLA 3J27B 3KSJA 1QZMA 3DFZA 3FYDA 4WURA 2R4JA 2O25A 3EIHA 3UJNA 3AKZA 4DR2M 1PJSA 3T38A 2C5RA 2LVNC 1QZEA 2WSFF 4LF5M 2DHRA 2BJVA 3SMSA 1MU5A 2FOIC 4HEOA 5ITXE 1XNQM 4FD2A 3C3EA 1L1TA 1X37A 1VEKA 2HCBA 2BNKA 1GL6A 4GMQA 2ZTDA 4GITA 2F5QA 4RNAA 4F2LA 4I5SA 1OQYA 1QDTA 4QHSA 3CGWA 3ZH9B 4IBDA 1IY2A 2JY7A 5BR8M 2R62A 3GLGE 4G4RA 3KS8A 4QOZC 3TL4X 5KQDA 3MK6A 3L26A 1JB0F 4QNRA 8CATA 2XGNA 3HJ8A 3A46A 1NHGC 2H5XA 1K3XA 1FJGM 3HWSA 4LJAA 4GC9A 3FUWA 1XMQM 1IXRC 4GHLA 1G71A 3GO8A 4JI7M 3GLIB 1GO5A 3FUXA 2R4EA 3QWLA 3IECA 2XFSA 3HHWA 1R7RA 1PRBA 1D0LA 2EO2A 3ILKA 2K9DA 4ZPXA 3ZC7B 3HGIA 2F5PA 3THGA 2CHGA 1J09A 3VDPA 1WHCA 1XB2B 1KSFX 2KRUA 3FUUA 2HL7A 3SATA 1YSYA 1IBKM 3A45A 2KHHA 1OFIA 2WZJA 1GJTA 1OKSA 1V33A 1JR3D 2HKJA 4UN2B 3GQ5A 1XC8A 2LH0A 4QNMA 4X65M 4NRVA 2DVWB 2L6OA 2DXIA 5JI3E 1G3IA 4NL4H 3FKEA 3AOEA 1T43A 4R7GA 5F3WA 4CHTB 2Y0TA 2VDBB 4IBBA 3NBXX 4LZJA 1MN3A 3UGJA 5L8RF 1QANA 2VQFM 1NY6A 2P5TA 2DAIA 1G59A 4LCBA 3W67A 2YQZA 3JAMS 3SAVA 5ITUA 4IBKA 1QUTA 1V34A 3K92A 4NXNM 4B3RM 3LCUA 1DV0A 2C96A 2QZ4A 3J81S 5ITRA 3H4MA 4IBIA 4IJEA 3K1JA 3KDSE 3GPUA 4NSOB 2HHHM 2RGOA 3M0EA 5LMNM 2O01F 4DV0M 2KDLA 2VQEM 1VQ1A 3SYKA 3LVVA 1HT2E 4QHTA 4M0WA 2DZNB 4LF8M 2DHYA 1QAOA 2QENA 4FVMA 1G4AE 2MR9A 1VEJA 5DNYA 1N34M 2KZUA 4GKJM 2DWZB 5FTKA 2FNAA 4DV5M 4FCTA 1TDHA 2QPAA 2DAGA 4Y28F 3U60B 3SHGB 1QAQA 2G5GX 2R65A 3J7BA 4L16A 1NVMA 2RRUA 1ZAEA 2VF7A 1HNXM 1IY0A 2DWNA 4P17A 3Q8GA 1VEGA 3K9PA 4CIZA 2EKKA 4OU7A 2HWJA 1PJTA 2R44A 3FTCA 3UK6A 3U6PA 3TWMA 1W5TA 1LV7A 4ITQA 2M5ZA 1DGHB 5IT9S 4LRTA 1NNJA 2KNAA 3L25A 1Q02A 4JI0M 1J7KA 3DOAA 5JI2E 4JI1M 3FRHA 4IIWA 3GRUA 3BBZA 1R5LA 1TF0B 2CV2A 1Q3BA 2UXCM 3A42A 4EIWA 2CUZA 4MH0E 2ZM6M 2A5YB 2FS1A 4IBEA 4II7A 4JN6A 4M9ZA 3UMMA 4IBGA 1GL7A 3HHZA 5GKNA 4LJ8A 4X62M 2LBCA 4LJ5A 1N75A 4RF1A 3T1YM 2UU9M 1W5SA 4JI3M 3LVWA 3FRIA 3E46A 3HU2A 2C9CA 1TTEA 5KPZA 1YLAA 4DV6M 4FCWA 3C9PA 1N36M 1NHWC 1NJGA 3FTDA 2DKLA 1OAIA 1GJSA 1IN6A 1LTMA 1Z5CA 3EIEA 5E26A 5IREB 2Y21A 2ZANA 2XSZD 3HU1A 1IQPA 2I7NA 3BXWA 2CEAA 3L2AA 3KP0E 4KT0F 1SXJE 3VKGA 4JYAM 2J7NA 3C3DA 1E9RA 4NSRA 1R2YA 1DO0A 1HR0M 4B3TM 4AQYM 2KNVA 2JNHA 7CATA 4AG5A 1XMOM 3W68A 3K9OA 3WHKA 2I7PA 3M7GA 2DNAA 3QYEA 4D82A 1E9SA 2X4AA 3F92A 2QBYB 2DZLA 4A3VB 4LGYA 3HU3A 4DUZM 2KZSA 3J2PB 1KFVA 2UUCM 2CV0A 1SXJA 3GRVA 3UZUA 2F5NA 1TH3A 4D81A 1EIJA 4DR4M 3MMPA 4DUYM 2BJWA 1R4GA 1XXHB 3FE3A 2LVAA 2X8AA 4IBJA 2BWBA 2HAKA 4DR3M 2K0BX 1L2DA 1N78A 3B7QA 4M9SA 3U6EA 2FH0A 3VKHA 4LF6M 4PCZA 1TDZA 1IXZA 4ANRA 4CJ6A 4JI2M 4GC5A 5EXXA 2R46A 3FTEA 3CTWB 2C99A 1E94E 1DO2A 3B74A 1QVRA 4LJ7A 3GLGA 1TH2A 1Z5BA 3HKPA 3BOSA 4RKUF 2WSEF 5EP4A 5ITYA 4LFCM 2VIIA 2FFJA 2LWXA 2Z4SA 1N77A 4IJFA 3HHXA 4DR1M 4MGHA 2H1RA 3ZCBB 2OOAA 4HL4A 3D8LA 4TUWA 2C98A 2YNMD 3LCVB 3KP1E 1WGNA 1D0MA 4CGYB 4XK8F 4KLNA 4D80A 1V92A 4MB7A 2D7EA 1HQYE 4B7HA 3U6CA 4XGIA 3CF2A 3U6LA 1IM2A 3GLFB 4NRWA 1XNRM 2R0IA 1QDRA 3JR4A 4JI6M 2G3QA 4X64M 1A5TA 2XLJA 4DV7M 3AOEC 4G3OA 2JY8A 4MM3B 4R71A 3U61B 2R45A 1WGLA 2QSFX 4KODA 3LMMA 4G4NA 4BLCA 1G8PA 5DFLA 1PGYA 3DA1A 4FCVA 5FSWA 2XF3A 1YUBA 4LY6A 1T3TA 2KXEA 3T1HM 3SC3A 1XXHE 3MHVC 2WSCF 4JI5M 1PJQA 4LJ4A 3SARA 2ZBKB 4LGMA 2VF8A 3SAUA 2DAKA 3GPPA 2OPFA 3LQRA 1K82A 1OIPA 3VDUA 1FNNA 4LFBM 1N33M 3B9PA 1IY1A 3U5ZA 4XBOA 2R6FA 3SMPA 5LMUM 2V6ZM 5EJCA 5EQTA 3R8FA 1J5EM 1F4IA 1VDLA 2OQ4A 4DR7M 4MGKE 4PDGA 2UUBM 2CFOA 1WXQA 1XXHA 4JI8M 1DGFA 3U61A 3U60A 2L7HA 2RGHA 5KO3A 2N35A 2Y0QA 1SXJB 4IBCA 1XWIA 3WHLA 2QQ8A 4LF9M 1IN7A 1HQCA 3FD9A 3I01M 3W0FA 2LXEA 3U6SA 4AKIA 3VK7A 3GPXA 1YE9A 2X49A 5FTMA 2E5LM 1VG5A 5KPRA 3JR5A 2V1UA 4GH9A 4NC6A 1ZMWA 1SXJC 2QCUA 5E6JA 1WR1B 1AIPC 3CF6E 1TGUA 3GQ3A 3KSXA 1R6BX 1L2BA 3I4VA 1HNWM 2J7OA 2Z8YM 2DWLA 1UM8A 3HJQA 1S3SA 2G8LA 3ZQJA 4YHHM 2EUCA 4MGIE 4F1IA 2JXNA 1NV8A 2JP7A 1XHBA 3KVWA 3KFUG 1E32A 1OIZA 2KRKA 1RU3A 2QP9X 1NJFA 4L4UA 5H37D 3SAWA 1IBMM 3RGSA 4LG2A 1MX0A 1GKIA 2L4EA 4X66M 1OAOC 3PFIA 1Q39A 1NY5A 1Z6TA 4JV5M 3VK8A 4LJ6A 2C9OA 2D7GA 1HT1E 3HX3A 3TQSA 3SFZA 4B7GA 3RFWA 3RGPA 2JY5A 2QHOB 3HZJA 1Q3CA 2DZOB 3Q8XA 2Z4RA 4PT5A 1N32M 2KW0A 2QNJA 3SYLA 4DV4M 3J80S 3GRYA 4PD2A 3B7NA 4DR5M 3FTFA 1T6OA 1C1KA 3HJSA 2F5SA 4NOOB 2K47A 3KXEC 2UXDM 3KS4A 4MGYE 4B08A 5ITTA 4GKKM 3KW6A 2QBYA 5FTJA 2FE8A 4Z6YA 1QYRA 4B3SM 2M60A 3T15A 2RKOA 3TE6A 4PDIA 3C58A 3QAUA 4CISA 5ITXA 3MJ5A 5C1BA 1VDDA 2KEBA 2ZAMA 4GHAA 4L78A 2DWMA 3V76A 3B89A 1DGBA 2DAEA 2JY6B 3K2LA 5A2QS 4LRSA 4AZFA 4OW0A 3TWLA 5C18A 4WP2A 1OTRA 2NQ8C 5IZ7D 3E21A 4I4LA 2GQFA 2GNOA 2L2DA 4BBAA 4FWDA 4OX9M 1IN4A 4REZA 2JA2A 3GLHB 3U6QA 4OVZA 5KPTA 4B3MM 2O5RA 2CP8A 1R2ZA 3E9SA 2CHVA 3T6PA 5BPVA 1PJIA 2LHCA 3SHFA 1Z5AA 3U5ZB 2MGWA 4WW0A 2L4FA 3GQ4A 3B7ZA 2APLA 2J5YA 4LF7M 3J7AS 1JR3A 1G41A 3HHYA 1OJLA 4NXMM 4BB9A 3GLIA 2EKFA 1TR8A 2DENA 3L28A 2MH8A 3A98B 1PM5A 4G4QA 3FYCA 2Z3XA 2Q2EB 3SASA 2ERCA 4MGZE 2XZUA 3KOXE 2LVOC 1ORYB 1KYIA 1PJJA 2DAMA 1WJ7A 3HY5A 4YY3M 1QQWA 1JR3E 2KA6B 4LJ9A 1ZMVA
chains in the Genus database with same CATH topology
1F4IA 4HEOA 2MJ5B 1TTEA 1VDLA 1YLAA 1VEKA 1WIVA 3GLIE 2DKLA 2ZTDA 1OAIA 4F2LA 1OQYA 3H4JA 1IFYA 2JY7A 3GLGE 2H5XA 1DO0A 2KNVA 2JNHA 1GO5A 1VG5A 3IECA 2KNZA 1ZMWA 3K9OA 1WR1B 1AIPC 2DNAA 2K9DA 1HJPA 1ZMUA 1IXSA 3F92A 2DZLA 4F1IA 1NV8A 2JP7A 1WHCA 1P3QQ 1XB2B 2MROB 3MMPA 2L4EA 2LVPC 1R4GA 3FE3A 2LVAA 2KHHA 2BWBA 2HAKA 2K0BX 2WZJA 1OKSA 2LVQD 4UN2B 1HT1E 2JY5A 2QHOB 3GLHE 1EFUB 1G3IA 1T43A 1E94E 1DO2A 2QNJA 4DBGB 1MN3A 1T6OA 2DAIA 1C7YA 2EJSA 2OOAA 2B3TA 2OOBA 3LCUA 1DV0A 1Y8GA 3LCVB 1WGNA 2OO9A 2CWBA 1VQ1A 2JUJA 3IHPA 1HT2E 1V92A 4GEWA 2DHYA 3B89A 1HQYE 2DAEA 2JY6B 1G4AE 1NV9A 2MR9A 1VEJA 1IM2A 3E46A 2LTUA 4WP2A 1OTRA 2BWEA 2R0IA 1CUKA 1UFZA 3E21A 2G3QA 1A5TA 2DAGA 2L2DA 3GLFE 1ZV1A 4G3OA 2JZ1A 2JY8A 4R71A 2RRUA 1WGLA 2QSFX 2CP8A 2DI0A 1VEGA 4Q7JA 3T6PA 5DFLA 3K9PA 1PGYA 2MGWA 2EKKA 2ZTCA 2HWJA 2L4FA 2JZ0A 1BVSA 1G41A 2KNAA 1Q02A 5JI2E 3FRHA 3BBZA 2EKFA 1SG9A 1TR8A 1XXHE 2DENA 2DAKA 2LVOC 1KYIA 2LBCA 2O25A 2DAMA 1WJ7A 2LVNC 1JR3E 1QZEA 3FRIA 1ZMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4I A;  4HEO A;  2MJ5 B;  1TTE A;  1VDL A;  1YLA A;  1VEK A;  1WIV A;  3GLI E;  2DKL A;  2ZTD A;  1OAI A;  4F2L A;  1OQY A;  3H4J A;  1IFY A;  2JY7 A;  3GLG E;  2H5X A;  1DO0 A;  2KNV A;  2JNH A;  1GO5 A;  1VG5 A;  3IEC A;  2KNZ A;  1ZMW A;  3K9O A;  1WR1 B;  1AIP C;  2DNA A;  2K9D A;  1HJP A;  1ZMU A;  1IXS A;  3F92 A;  2DZL A;  4F1I A;  1NV8 A;  2JP7 A;  1WHC A;  1P3Q Q;  1XB2 B;  2MRO B;  3MMP A;  2L4E A;  2LVP C;  1R4G A;  3FE3 A;  2LVA A;  2KHH A;  2BWB A;  2HAK A;  2K0B X;  2WZJ A;  1OKS A;  2LVQ D;  4UN2 B;  1HT1 E;  2JY5 A;  2QHO B;  3GLH E;  1EFU B;  1G3I A;  1T43 A;  1E94 E;  1DO2 A;  2QNJ A;  4DBG B;  1MN3 A;  1T6O A;  2DAI A;  1C7Y A;  2EJS A;  2OOA A;  2B3T A;  2OOB A;  3LCU A;  1DV0 A;  1Y8G A;  3LCV B;  1WGN A;  2OO9 A;  2CWB A;  1VQ1 A;  2JUJ A;  3IHP A;  1HT2 E;  1V92 A;  4GEW A;  2DHY A;  3B89 A;  1HQY E;  2DAE A;  2JY6 B;  1G4A E;  1NV9 A;  2MR9 A;  1VEJ A;  1IM2 A;  3E46 A;  2LTU A;  4WP2 A;  1OTR A;  2BWE A;  2R0I A;  1CUK A;  1UFZ A;  3E21 A;  2G3Q A;  1A5T A;  2DAG A;  2L2D A;  3GLF E;  1ZV1 A;  4G3O A;  2JZ1 A;  2JY8 A;  4R71 A;  2RRU A;  1WGL A;  2QSF X;  2CP8 A;  2DI0 A;  1VEG A;  4Q7J A;  3T6P A;  5DFL A;  3K9P A;  1PGY A;  2MGW A;  2EKK A;  2ZTC A;  2HWJ A;  2L4F A;  2JZ0 A;  1BVS A;  1G41 A;  2KNA A;  1Q02 A;  5JI2 E;  3FRH A;  3BBZ A;  2EKF A;  1SG9 A;  1TR8 A;  1XXH E;  2DEN A;  2DAK A;  2LVO C;  1KYI A;  2LBC A;  2O25 A;  2DAM A;  1WJ7 A;  2LVN C;  1JR3 E;  1QZE A;  3FRI A;  1ZMV A; 
#chains in the Genus database with same CATH topology
 2MJ5 B;  2UXB M;  1MJG M;  4QOS A;  4S12 A;  1WIV A;  3GLI E;  4AG6 A;  1I4W A;  1H6U A;  3H4J A;  1IFY A;  3U6D A;  3VLF B;  3W0L B;  4W5W A;  1AUA A;  4M0D A;  4JI4 M;  3OTO M;  1D2N A;  3AV0 A;  4P16 A;  4DV1 M;  4GRI A;  2XH9 A;  1SXJ D;  5EP1 A;  3KOZ E;  3PNV A;  3PXG A;  3DZD A;  4FWH A;  4DV2 M;  5EP2 A;  2KNZ A;  4GIP A;  2UUA M;  2JWS A;  4K0K M;  4I81 A;  4R3D A;  4RF0 A;  3U6M A;  2CRU A;  1HJP A;  1ZMU A;  2W82 A;  1IXS A;  4L8R C;  2CHQ A;  3FUT A;  2YFQ A;  2L09 A;  1IN8 A;  3K8Z A;  4LZZ A;  5EP3 A;  3RE8 A;  2R18 A;  3GP1 A;  4AI6 A;  3I51 A;  1P3Q Q;  4HLQ A;  4AKH A;  3L29 A;  2MRO B;  2LVP C;  1GAB A;  5EXT A;  3TWK A;  3E4R A;  1JQJ C;  4Z8X A;  3SBJ A;  2LVQ D;  4G4O A;  1OFH A;  1L2C A;  2XZF A;  1IBL M;  4DR6 M;  1HNZ M;  3GLH E;  2LNH C;  4B7F A;  4IBF A;  4M9X A;  1EFU B;  1Z59 A;  2V1C A;  3I4Y A;  3KOW E;  2YR0 A;  1D0K A;  2K6B A;  4DV3 M;  2LHG A;  2XFT A;  3I04 M;  4KHP M;  5EXP A;  4FW9 A;  4DBG B;  1IN5 A;  5EXS A;  1NNU C;  2CV1 A;  4AKG A;  1L8Q A;  2AHM A;  5FLX S;  5KQ8 A;  1C7Y A;  3U6O A;  1IXS B;  4L15 A;  2XSZ A;  5FTN A;  3PNY A;  3D8B A;  1I94 M;  4OVZ B;  2EJS A;  3AOG A;  3GLH A;  5ITQ A;  2B3T A;  2OOB A;  3FUV A;  3CF0 A;  3LQQ A;  3PVS A;  1Y8G A;  3GRR A;  1QAM A;  3GPY A;  1GVN A;  2OO9 A;  2CWB A;  4LFA M;  2JUJ A;  3IHP A;  4KO8 A;  2L7I A;  4GEW A;  3M6A A;  4FWG A;  3AJI B;  1NV9 A;  3IG8 A;  3KOY E;  1K3W A;  2LTU A;  2BWE A;  1CUK A;  1QUS A;  1UFZ A;  2Z7J A;  5DYI A;  2CE7 A;  2D7H A;  3QYB A;  1NO1 A;  1ZQ9 A;  4AW4 A;  1NSF A;  3GLF E;  3AL0 C;  1ZV1 A;  2JZ1 A;  3LW5 F;  3IG5 A;  3VFD A;  3AFH A;  1DGH A;  3TPZ A;  2EA0 A;  3L27 A;  2DI0 A;  4JXJ A;  4Q7J A;  5IWA M;  5DYG A;  1EE8 A;  1GLN A;  2ZTC A;  1L1Z A;  3NBI A;  2JZ0 A;  2Y20 A;  1BVS A;  2ZAO A;  2F5O A;  4G6Z A;  3R9X B;  2XEP A;  4L6V 6;  4LF4 M;  2F4V M;  1TH4 A;  1SG9 A;  4I8O A;  3GLF A;  3GLG B;  5FTL A;  1DGG A;  3NWL A;  3J27 B;  3KSJ A;  1QZM A;  3DFZ A;  3FYD A;  4WUR A;  2R4J A;  2O25 A;  3EIH A;  3UJN A;  3AKZ A;  4DR2 M;  1PJS A;  3T38 A;  2C5R A;  2LVN C;  1QZE A;  2WSF F;  4LF5 M;  2DHR A;  2BJV A;  3SMS A;  1MU5 A;  2FOI C;  4HEO A;  5ITX E;  1XNQ M;  4FD2 A;  3C3E A;  1L1T A;  1X37 A;  1VEK A;  2HCB A;  2BNK A;  1GL6 A;  4GMQ A;  2ZTD A;  4GIT A;  2F5Q A;  4RNA A;  4F2L A;  4I5S A;  1OQY A;  1QDT A;  4QHS A;  3CGW A;  3ZH9 B;  4IBD A;  1IY2 A;  2JY7 A;  5BR8 M;  2R62 A;  3GLG E;  4G4R A;  3KS8 A;  4QOZ C;  3TL4 X;  5KQD A;  3MK6 A;  3L26 A;  1JB0 F;  4QNR A;  8CAT A;  2XGN A;  3HJ8 A;  3A46 A;  1NHG C;  2H5X A;  1K3X A;  1FJG M;  3HWS A;  4LJA A;  4GC9 A;  3FUW A;  1XMQ M;  1IXR C;  4GHL A;  1G71 A;  3GO8 A;  4JI7 M;  3GLI B;  1GO5 A;  3FUX A;  2R4E A;  3QWL A;  3IEC A;  2XFS A;  3HHW A;  1R7R A;  1PRB A;  1D0L A;  2EO2 A;  3ILK A;  2K9D A;  4ZPX A;  3ZC7 B;  3HGI A;  2F5P A;  3THG A;  2CHG A;  1J09 A;  3VDP A;  1WHC A;  1XB2 B;  1KSF X;  2KRU A;  3FUU A;  2HL7 A;  3SAT A;  1YSY A;  1IBK M;  3A45 A;  2KHH A;  1OFI A;  2WZJ A;  1GJT A;  1OKS A;  1V33 A;  1JR3 D;  2HKJ A;  4UN2 B;  3GQ5 A;  1XC8 A;  2LH0 A;  4QNM A;  4X65 M;  4NRV A;  2DVW B;  2L6O A;  2DXI A;  5JI3 E;  1G3I A;  4NL4 H;  3FKE A;  3AOE A;  1T43 A;  4R7G A;  5F3W A;  4CHT B;  2Y0T A;  2VDB B;  4IBB A;  3NBX X;  4LZJ A;  1MN3 A;  3UGJ A;  5L8R F;  1QAN A;  2VQF M;  1NY6 A;  2P5T A;  2DAI A;  1G59 A;  4LCB A;  3W67 A;  2YQZ A;  3JAM S;  3SAV A;  5ITU A;  4IBK A;  1QUT A;  1V34 A;  3K92 A;  4NXN M;  4B3R M;  3LCU A;  1DV0 A;  2C96 A;  2QZ4 A;  3J81 S;  5ITR A;  3H4M A;  4IBI A;  4IJE A;  3K1J A;  3KDS E;  3GPU A;  4NSO B;  2HHH M;  2RGO A;  3M0E A;  5LMN M;  2O01 F;  4DV0 M;  2KDL A;  2VQE M;  1VQ1 A;  3SYK A;  3LVV A;  1HT2 E;  4QHT A;  4M0W A;  2DZN B;  4LF8 M;  2DHY A;  1QAO A;  2QEN A;  4FVM A;  1G4A E;  2MR9 A;  1VEJ A;  5DNY A;  1N34 M;  2KZU A;  4GKJ M;  2DWZ B;  5FTK A;  2FNA A;  4DV5 M;  4FCT A;  1TDH A;  2QPA A;  2DAG A;  4Y28 F;  3U60 B;  3SHG B;  1QAQ A;  2G5G X;  2R65 A;  3J7B A;  4L16 A;  1NVM A;  2RRU A;  1ZAE A;  2VF7 A;  1HNX M;  1IY0 A;  2DWN A;  4P17 A;  3Q8G A;  1VEG A;  3K9P A;  4CIZ A;  2EKK A;  4OU7 A;  2HWJ A;  1PJT A;  2R44 A;  3FTC A;  3UK6 A;  3U6P A;  3TWM A;  1W5T A;  1LV7 A;  4ITQ A;  2M5Z A;  1DGH B;  5IT9 S;  4LRT A;  1NNJ A;  2KNA A;  3L25 A;  1Q02 A;  4JI0 M;  1J7K A;  3DOA A;  5JI2 E;  4JI1 M;  3FRH A;  4IIW A;  3GRU A;  3BBZ A;  1R5L A;  1TF0 B;  2CV2 A;  1Q3B A;  2UXC M;  3A42 A;  4EIW A;  2CUZ A;  4MH0 E;  2ZM6 M;  2A5Y B;  2FS1 A;  4IBE A;  4II7 A;  4JN6 A;  4M9Z A;  3UMM A;  4IBG A;  1GL7 A;  3HHZ A;  5GKN A;  4LJ8 A;  4X62 M;  2LBC A;  4LJ5 A;  1N75 A;  4RF1 A;  3T1Y M;  2UU9 M;  1W5S A;  4JI3 M;  3LVW A;  3FRI A;  3E46 A;  3HU2 A;  2C9C A;  1TTE A;  5KPZ A;  1YLA A;  4DV6 M;  4FCW A;  3C9P A;  1N36 M;  1NHW C;  1NJG A;  3FTD A;  2DKL A;  1OAI A;  1GJS A;  1IN6 A;  1LTM A;  1Z5C A;  3EIE A;  5E26 A;  5IRE B;  2Y21 A;  2ZAN A;  2XSZ D;  3HU1 A;  1IQP A;  2I7N A;  3BXW A;  2CEA A;  3L2A A;  3KP0 E;  4KT0 F;  1SXJ E;  3VKG A;  4JYA M;  2J7N A;  3C3D A;  1E9R A;  4NSR A;  1R2Y A;  1DO0 A;  1HR0 M;  4B3T M;  4AQY M;  2KNV A;  2JNH A;  7CAT A;  4AG5 A;  1XMO M;  3W68 A;  3K9O A;  3WHK A;  2I7P A;  3M7G A;  2DNA A;  3QYE A;  4D82 A;  1E9S A;  2X4A A;  3F92 A;  2QBY B;  2DZL A;  4A3V B;  4LGY A;  3HU3 A;  4DUZ M;  2KZS A;  3J2P B;  1KFV A;  2UUC M;  2CV0 A;  1SXJ A;  3GRV A;  3UZU A;  2F5N A;  1TH3 A;  4D81 A;  1EIJ A;  4DR4 M;  3MMP A;  4DUY M;  2BJW A;  1R4G A;  1XXH B;  3FE3 A;  2LVA A;  2X8A A;  4IBJ A;  2BWB A;  2HAK A;  4DR3 M;  2K0B X;  1L2D A;  1N78 A;  3B7Q A;  4M9S A;  3U6E A;  2FH0 A;  3VKH A;  4LF6 M;  4PCZ A;  1TDZ A;  1IXZ A;  4ANR A;  4CJ6 A;  4JI2 M;  4GC5 A;  5EXX A;  2R46 A;  3FTE A;  3CTW B;  2C99 A;  1E94 E;  1DO2 A;  3B74 A;  1QVR A;  4LJ7 A;  3GLG A;  1TH2 A;  1Z5B A;  3HKP A;  3BOS A;  4RKU F;  2WSE F;  5EP4 A;  5ITY A;  4LFC M;  2VII A;  2FFJ A;  2LWX A;  2Z4S A;  1N77 A;  4IJF A;  3HHX A;  4DR1 M;  4MGH A;  2H1R A;  3ZCB B;  2OOA A;  4HL4 A;  3D8L A;  4TUW A;  2C98 A;  2YNM D;  3LCV B;  3KP1 E;  1WGN A;  1D0M A;  4CGY B;  4XK8 F;  4KLN A;  4D80 A;  1V92 A;  4MB7 A;  2D7E A;  1HQY E;  4B7H A;  3U6C A;  4XGI A;  3CF2 A;  3U6L A;  1IM2 A;  3GLF B;  4NRW A;  1XNR M;  2R0I A;  1QDR A;  3JR4 A;  4JI6 M;  2G3Q A;  4X64 M;  1A5T A;  2XLJ A;  4DV7 M;  3AOE C;  4G3O A;  2JY8 A;  4MM3 B;  4R71 A;  3U61 B;  2R45 A;  1WGL A;  2QSF X;  4KOD A;  3LMM A;  4G4N A;  4BLC A;  1G8P A;  5DFL A;  1PGY A;  3DA1 A;  4FCV A;  5FSW A;  2XF3 A;  1YUB A;  4LY6 A;  1T3T A;  2KXE A;  3T1H M;  3SC3 A;  1XXH E;  3MHV C;  2WSC F;  4JI5 M;  1PJQ A;  4LJ4 A;  3SAR A;  2ZBK B;  4LGM A;  2VF8 A;  3SAU A;  2DAK A;  3GPP A;  2OPF A;  3LQR A;  1K82 A;  1OIP A;  3VDU A;  1FNN A;  4LFB M;  1N33 M;  3B9P A;  1IY1 A;  3U5Z A;  4XBO A;  2R6F A;  3SMP A;  5LMU M;  2V6Z M;  5EJC A;  5EQT A;  3R8F A;  1J5E M;  1F4I A;  1VDL A;  2OQ4 A;  4DR7 M;  4MGK E;  4PDG A;  2UUB M;  2CFO A;  1WXQ A;  1XXH A;  4JI8 M;  1DGF A;  3U61 A;  3U60 A;  2L7H A;  2RGH A;  5KO3 A;  2N35 A;  2Y0Q A;  1SXJ B;  4IBC A;  1XWI A;  3WHL A;  2QQ8 A;  4LF9 M;  1IN7 A;  1HQC A;  3FD9 A;  3I01 M;  3W0F A;  2LXE A;  3U6S A;  4AKI A;  3VK7 A;  3GPX A;  1YE9 A;  2X49 A;  5FTM A;  2E5L M;  1VG5 A;  5KPR A;  3JR5 A;  2V1U A;  4GH9 A;  4NC6 A;  1ZMW A;  1SXJ C;  2QCU A;  5E6J A;  1WR1 B;  1AIP C;  3CF6 E;  1TGU A;  3GQ3 A;  3KSX A;  1R6B X;  1L2B A;  3I4V A;  1HNW M;  2J7O A;  2Z8Y M;  2DWL A;  1UM8 A;  3HJQ A;  1S3S A;  2G8L A;  3ZQJ A;  4YHH M;  2EUC A;  4MGI E;  4F1I A;  2JXN A;  1NV8 A;  2JP7 A;  1XHB A;  3KVW A;  3KFU G;  1E32 A;  1OIZ A;  2KRK A;  1RU3 A;  2QP9 X;  1NJF A;  4L4U A;  5H37 D;  3SAW A;  1IBM M;  3RGS A;  4LG2 A;  1MX0 A;  1GKI A;  2L4E A;  4X66 M;  1OAO C;  3PFI A;  1Q39 A;  1NY5 A;  1Z6T A;  4JV5 M;  3VK8 A;  4LJ6 A;  2C9O A;  2D7G A;  1HT1 E;  3HX3 A;  3TQS A;  3SFZ A;  4B7G A;  3RFW A;  3RGP A;  2JY5 A;  2QHO B;  3HZJ A;  1Q3C A;  2DZO B;  3Q8X A;  2Z4R A;  4PT5 A;  1N32 M;  2KW0 A;  2QNJ A;  3SYL A;  4DV4 M;  3J80 S;  3GRY A;  4PD2 A;  3B7N A;  4DR5 M;  3FTF A;  1T6O A;  1C1K A;  3HJS A;  2F5S A;  4NOO B;  2K47 A;  3KXE C;  2UXD M;  3KS4 A;  4MGY E;  4B08 A;  5ITT A;  4GKK M;  3KW6 A;  2QBY A;  5FTJ A;  2FE8 A;  4Z6Y A;  1QYR A;  4B3S M;  2M60 A;  3T15 A;  2RKO A;  3TE6 A;  4PDI A;  3C58 A;  3QAU A;  4CIS A;  5ITX A;  3MJ5 A;  5C1B A;  1VDD A;  2KEB A;  2ZAM A;  4GHA A;  4L78 A;  2DWM A;  3V76 A;  3B89 A;  1DGB A;  2DAE A;  2JY6 B;  3K2L A;  5A2Q S;  4LRS A;  4AZF A;  4OW0 A;  3TWL A;  5C18 A;  4WP2 A;  1OTR A;  2NQ8 C;  5IZ7 D;  3E21 A;  4I4L A;  2GQF A;  2GNO A;  2L2D A;  4BBA A;  4FWD A;  4OX9 M;  1IN4 A;  4REZ A;  2JA2 A;  3GLH B;  3U6Q A;  4OVZ A;  5KPT A;  4B3M M;  2O5R A;  2CP8 A;  1R2Z A;  3E9S A;  2CHV A;  3T6P A;  5BPV A;  1PJI A;  2LHC A;  3SHF A;  1Z5A A;  3U5Z B;  2MGW A;  4WW0 A;  2L4F A;  3GQ4 A;  3B7Z A;  2APL A;  2J5Y A;  4LF7 M;  3J7A S;  1JR3 A;  1G41 A;  3HHY A;  1OJL A;  4NXM M;  4BB9 A;  3GLI A;  2EKF A;  1TR8 A;  2DEN A;  3L28 A;  2MH8 A;  3A98 B;  1PM5 A;  4G4Q A;  3FYC A;  2Z3X A;  2Q2E B;  3SAS A;  2ERC A;  4MGZ E;  2XZU A;  3KOX E;  2LVO C;  1ORY B;  1KYI A;  1PJJ A;  2DAM A;  1WJ7 A;  3HY5 A;  4YY3 M;  1QQW A;  1JR3 E;  2KA6 B;  4LJ9 A;  1ZMV A; 
#chains in the Genus database with same CATH homology
 1F4I A;  4HEO A;  2MJ5 B;  1TTE A;  1VDL A;  1YLA A;  1VEK A;  1WIV A;  3GLI E;  2DKL A;  2ZTD A;  1OAI A;  4F2L A;  1OQY A;  3H4J A;  1IFY A;  2JY7 A;  3GLG E;  2H5X A;  1DO0 A;  2KNV A;  2JNH A;  1GO5 A;  1VG5 A;  3IEC A;  2KNZ A;  1ZMW A;  3K9O A;  1WR1 B;  1AIP C;  2DNA A;  2K9D A;  1HJP A;  1ZMU A;  1IXS A;  3F92 A;  2DZL A;  4F1I A;  1NV8 A;  2JP7 A;  1WHC A;  1P3Q Q;  1XB2 B;  2MRO B;  3MMP A;  2L4E A;  2LVP C;  1R4G A;  3FE3 A;  2LVA A;  2KHH A;  2BWB A;  2HAK A;  2K0B X;  2WZJ A;  1OKS A;  2LVQ D;  4UN2 B;  1HT1 E;  2JY5 A;  2QHO B;  3GLH E;  1EFU B;  1G3I A;  1T43 A;  1E94 E;  1DO2 A;  2QNJ A;  4DBG B;  1MN3 A;  1T6O A;  2DAI A;  1C7Y A;  2EJS A;  2OOA A;  2B3T A;  2OOB A;  3LCU A;  1DV0 A;  1Y8G A;  3LCV B;  1WGN A;  2OO9 A;  2CWB A;  1VQ1 A;  2JUJ A;  3IHP A;  1HT2 E;  1V92 A;  4GEW A;  2DHY A;  3B89 A;  1HQY E;  2DAE A;  2JY6 B;  1G4A E;  1NV9 A;  2MR9 A;  1VEJ A;  1IM2 A;  3E46 A;  2LTU A;  4WP2 A;  1OTR A;  2BWE A;  2R0I A;  1CUK A;  1UFZ A;  3E21 A;  2G3Q A;  1A5T A;  2DAG A;  2L2D A;  3GLF E;  1ZV1 A;  4G3O A;  2JZ1 A;  2JY8 A;  4R71 A;  2RRU A;  1WGL A;  2QSF X;  2CP8 A;  2DI0 A;  1VEG A;  4Q7J A;  3T6P A;  5DFL A;  3K9P A;  1PGY A;  2MGW A;  2EKK A;  2ZTC A;  2HWJ A;  2L4F A;  2JZ0 A;  1BVS A;  1G41 A;  2KNA A;  1Q02 A;  5JI2 E;  3FRH A;  3BBZ A;  2EKF A;  1SG9 A;  1TR8 A;  1XXH E;  2DEN A;  2DAK A;  2LVO C;  1KYI A;  2LBC A;  2O25 A;  2DAM A;  1WJ7 A;  2LVN C;  1JR3 E;  1QZE A;  3FRI A;  1ZMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...