2RRUA

Solution structure of the uba omain of p62 and its interaction with ubiquitin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the UBA omain of p62 and its interaction with ubiquitin
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Sequestosome-1
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2rruA00
3K9PA 4F1IA 3FRHA 3LCUA 2DAGA 5JI2E 1F4IA 1GO5A 2LBCA 1OQYA 2JNHA 1ZMWA 2JY5A 1TTEA 2BWBA 1DV0A 3BBZA 1HT2E 1NV8A 1ZMUA 3GLHE 1WHCA 1SG9A 2DAKA 4DBGB 2MR9A 1OTRA 2JY8A 1E94E 2EKFA 2QNJA 1WGLA 2KNVA 1XXHE 1VG5A 4GEWA 2DAEA 1P3QQ 1G4AE 2JUJA 2LVQD 1Y8GA 2EKKA 2L4FA 2DAMA 1JR3E 3E46A 1VDLA 3IECA 1WGNA 2LVOC 2LVNC 4G3OA 2JP7A 4R71A 1IM2A 1OKSA 2MROB 1WJ7A 2CWBA 2L2DA 5DFLA 1ZMVA 2KHHA 2ZTCA 1T6OA 4WP2A 2LVAA 3FRIA 2DAIA 3GLFE 1BVSA 1IFYA 1G41A 2KNAA 3GLIE 1HQYE 3IHPA 1DO2A 1CUKA 2JY7A 3FE3A 4F2LA 2RRUA 2DZLA 1WIVA 3F92A 2H5XA 3LCVB 3MMPA 2DHYA 2OOAA 1G3IA 4HEOA 2LTUA 1PGYA 1VEJA 2MGWA 2JZ0A 2WZJA 3T6PA 1OAIA 2ZTDA 1R4GA 2JZ1A 1MN3A 2HWJA 1Q02A 3GLGE 2CP8A 2DI0A 3K9OA 2JY6B 2L4EA 1QZEA 1DO0A 1VEKA 1VEGA 2KNZA 2B3TA 1YLAA 4Q7JA 1XB2B 1UFZA 2DENA 1C7YA 2HAKA 2O25A 2QSFX 3B89A 1HT1E 2EJSA 1V92A 1WR1B 1VQ1A 1IXSA 2K9DA 2QHOB 2DKLA 1T43A 4UN2B 2OO9A 2K0BX 1KYIA 1NV9A 3H4JA 1TR8A 1AIPC 1A5TA 2MJ5B 1ZV1A 1HJPA 1EFUB 2BWEA 2DNAA 2OOBA 2LVPC 2R0IA 2G3QA 3E21A
chains in the Genus database with same CATH superfamily
3GQ5A 4AW4A 4G4QA 3FTEA 1NY5A 1JQJC 2Y0QA 3UMMA 1KSFX 2DAGA 1SXJD 4IBGA 4OVZA 3TE6A 1QZMA 3L28A 3HZJA 2XSZA 3GQ4A 1OQYA 2X8AA 1IY1A 5KPZA 4M9ZA 2C98A 3KSXA 3TWKA 4BLCA 3R8FA 2G8LA 1NV8A 4OVZB 1ZMUA 3B9PA 3J7AS 2YNMD 2XSZD 3GLHE 3B74A 1WHCA 5BR8M 1SG9A 4IBFA 3FD9A 2GQFA 1N78A 4DBGB 2JA2A 1W5SA 2O01F 3CGWA 5L8RF 2JY8A 1IN5A 3EIEA 4NOOB 3VDPA 1XXHE 4G6ZA 2WSFF 1HNWM 1OFHA 3EIHA 1IN4A 1EE8A 4DR5M 5DYIA 3THGA 4D80A 3KFUG 1Q3BA 2L4FA 2UXDM 1GL7A 1JR3E 2DVWB 4JXJA 3IECA 1DGBA 3AJIB 4CIZA 3TWMA 2K6BA 3C3DA 2LVNC 4LY6A 3QYEA 1NJFA 4M9SA 4QNRA 4XBOA 1OKSA 1PJSA 2MROB 5EP4A 4X62M 3HX3A 2QQ8A 4CHTB 1WJ7A 2L2DA 4PDIA 2KHHA 4FWDA 1T6OA 2N35A 4WP2A 4LF5M 2CV0A 3GLFE 2QPAA 1G41A 2HKJA 2M5ZA 4EIWA 1AUAA 3JR4A 1T3TA 4IJEA 4AKHA 2LNHC 2JY7A 1HQCA 3ZH9B 3J81S 3M0EA 4JI0M 4ITQA 1WIVA 5JI3E 2OOAA 1G8PA 5IZ7D 5ITYA 2R62A 2Q2EB 2MGWA 4Z6YA 3HHYA 5C18A 5E6JA 1R2ZA 4JN6A 3L25A 2L6OA 2C99A 2Z8YM 3VK7A 4L6V6 4FD2A 1G59A 3ILKA 4PCZA 2L7IA 2HWJA 1D0LA 1ZQ9A 2DI0A 1Z5AA 2JY6B 5H37D 3KOZE 2XZUA 3K8ZA 3FUWA 3Q8XA 4LFBM 1S3SA 1YUBA 3LVWA 2XFTA 1VEGA 2KNZA 3L27A 4AQYM 4X66M 1NJGA 1C7YA 1Z5BA 3GO8A 1FNNA 3B89A 4I81A 3I4YA 2D7HA 4DR6M 3HU2A 2J7OA 2P5TA 3KSJA 4IJFA 3MHVC 3TWLA 3PNYA 4NL4H 3AFHA 1HNZM 1IBMM 5IWAM 2VIIA 3GLIB 2DZOB 3CTWB 1D2NA 4JI3M 2K0BX 4YY3M 1TR8A 5FTLA 2MJ5B 1HJPA 3HJSA 1C1KA 3RGPA 2RKOA 3SYLA 2C5RA 2OOBA 2DHRA 3FTCA 3FYCA 3LVVA 2G3QA 2LH0A 3B7NA 5EP3A 5FSWA 4G4NA 4AG6A 3K9PA 4F1IA 3FRHA 3LCUA 2ZANA 4DR3M 1F4IA 3OTOM 4B3SM 1XNQM 1R6BX 4QHSA 1ZMWA 3A45A 3J7BA 3TPZA 2BWBA 1QYRA 5ITXE 1J09A 3BOSA 3HU3A 5KQDA 1N33M 4KHPM 3GLGA 3SC3A 4Y28F 4L16A 2VQFM 5DYGA 4KO8A 4DR1M 2RGHA 4LJ4A 2DWNA 4NRWA 2CV1A 1N34M 1IY2A 1D0KA 2FOIC 1OTRA 4LGMA 3VFDA 3KOYE 5IT9S 5FTJA 3E9SA 1SXJE 2DAEA 3U61A 1G4AE 4KT0F 1W5TA 2HL7A 1XC8A 1Y8GA 3GLGB 2DZNB 1PM5A 4I8OA 1WGNA 3VKGA 2LVOC 3SARA 4JI8M 2EUCA 1H6UA 2K47A 4AG5A 3GLIA 4R71A 3FTFA 1XHBA 1IM2A 1TDHA 2BNKA 2CEAA 2CHGA 3AOEC 4IIWA 2LWXA 3PVSA 5EP1A 4D82A 3GPYA 3WHLA 1L1TA 3AL0C 4Z8XA 2ZTCA 2F5OA 4K0KM 3CF2A 4RNAA 4BBAA 4AKGA 2DAIA 4LJ6A 1BVSA 3QYBA 3U6PA 2XLJA 1I4WA 2R65A 3JR5A 1E32A 2DWMA 3U6MA 4M0DA 3AOEA 3IHPA 1DO2A 5EJCA 4F2LA 4CISA 3FKEA 2DZLA 5FLXS 1ZAEA 3F92A 2CE7A 1QDTA 3U6LA 2D7GA 3LCVB 5EQTA 1G3IA 3FUXA 2LTUA 1DGFA 4MGKE 3GPPA 4CJ6A 2X49A 3KP0E 4B3MM 2FE8A 2R46A 4FW9A 3KXEC 4AZFA 5LMUM 1Q02A 3C58A 1IN7A 5GKNA 3K9OA 3KVWA 3D8LA 4LF9M 2KZSA 3HHWA 1K3WA 4LF7M 1GKIA 4P17A 2DWLA 3I04M 3FYDA 4BB9A 2QBYB 4HL4A 2B3TA 1YLAA 2DWZB 4QOSA 3J27B 2F5SA 4HLQA 2KDLA 3HY5A 3U6DA 1XWIA 1HT1E 2EJSA 4CGYB 1NNUC 4LRSA 1ORYB 1MX0A 2WSEF 4I4LA 1NHGC 4PT5A 3U6OA 1DGHA 4LJ5A 4AI6A 4B7GA 1XXHB 2DKLA 3DZDA 4LF4M 4GC5A 4MGYE 3I4VA 3KS4A 4QNMA 4I5SA 4QHTA 2QCUA 4RF1A 4MGHA 2FNAA 1GABA 2V6ZM 3H4JA 4NSOB 4OU7A 4LZJA 1A5TA 3FUTA 1GJSA 4AKIA 4GITA 2QP9X 3GLHB 3MK6A 4NXNM 2HHHM 4NRVA 1YE9A 2JXNA 1L8QA 5FTKA 4DR7M 2J5YA 4G4OA 1IY0A 3R9XB 3LQRA 2V1CA 5KPRA 1IXZA 2R0IA 1Z5CA 4FCVA 1PJTA 1DV0A 3B7QA 3E21A 3M7GA 2F5NA 1IN8A 3WHKA 2O5RA 3GLFB 1Q3CA 3H4MA 4PD2A 2XGNA 4WURA 1I94M 2DXIA 2XZFA 3HHZA 4XGIA 1XMOM 2I7PA 2R45A 4GIPA 3AV0A 4OW0A 2JNHA 3RGSA 1MJGM 1QUSA 3I51A 4LJAA 4JI7M 1LV7A 4IBJA 4X64M 1QDRA 4LRTA 4R3DA 2A5YB 2VQEM 3U6EA 1K3XA 2D7EA 2UUBM 1OIPA 3SFZA 2KEBA 4GRIA 3GLFA 2DAKA 3TQSA 2XFSA 1L2BA 1WXQA 5EXXA 4A3VB 2C96A 3HWSA 3W67A 4DV5M 2EKFA 1IN6A 1GL6A 2QNJA 2KNVA 4FWHA 4PDGA 1IBKM 4JI6M 3TL4X 1VG5A 4GEWA 4IBCA 3U60A 1K82A 1R2YA 3SAUA 2LVQD 4YHHM 3HJ8A 3Q8GA 4GH9A 4KODA 4REZA 3JAMS 5EP2A 4DUZM 2DAMA 3C9PA 2UXCM 3IG8A 2Y0TA 1TH4A 2FS1A 3U5ZA 3W0FA 1PRBA 2W82A 3I01M 4G3OA 5KPTA 3SASA 1QAMA 1DGHB 1N32M 4B08A 1XXHA 3HHXA 2CHVA 1OFIA 1IXSB 3SYKA 4JYAM 1ZMVA 1GLNA 3KP1E 3GRVA 2YQZA 1R5LA 1JR3A 3FRIA 4MB7A 5FTMA 3W68A 1EIJA 5FTNA 2CUZA 2LXEA 3A98B 4LJ9A 1V33A 1YSYA 3W0LB 4DR4M 4IBDA 2KW0A 3GLIE 1Z6TA 1E9SA 2QBYA 1CUKA 3FE3A 3K1JA 2OQ4A 2RRUA 4FCTA 2KRUA 3E4RA 2BJVA 4NC6A 1X37A 3LMMA 3ZQJA 5C1BA 5KO3A 3UGJA 1OIZA 1QUTA 3MMPA 3SMSA 2QZ4A 2FFJA 3T1YM 1HR0M 2Y21A 5EXSA 4LFCM 1VEJA 4GKKM 1LTMA 2JZ0A 3FUVA 1TGUA 2WZJA 3D8BA 3T6PA 5A2QS 2R6FA 2WSCF 4DV6M 4LF6M 3KS8A 2JZ1A 4NXMM 3L29A 1QANA 2MH8A 3FUUA 3SHGB 3T38A 2YR0A 1MU5A 3L2AA 4DV7M 3J2PB 2L4EA 1L2DA 4RF0A 3C3EA 4DV0M 1QZEA 2KRKA 1DO0A 1VEKA 4Q7JA 3KOXE 1XB2B 4GMQA 1UFZA 2M60A 4GHAA 1J5EM 2O25A 2QSFX 2LHCA 1NNJA 2UUAM 1V92A 1WR1B 2KXEA 1IQPA 3DOAA 1JR3D 4LFAM 1PJQA 1OJLA 1Q39A 1VQ1A 4IBBA 3PXGA 2VDBB 3PFIA 1QAQA 2Z7JA 3RE8A 2QHOB 1IXRC 1SXJB 2C9OA 1QAOA 1NSFA 4UN2B 2F5QA 3VLFB 3U5ZB 1UM8A 1AIPC 4MM3B 5ITUA 2F5PA 4JI1M 3M6AA 3RFWA 1ZV1A 4MH0E 1EFUB 2Y20A 2BWEA 1J7KA 3QWLA 3GQ3A 5BPVA 2UXBM 3VDUA 2R44A 2CFOA 2LVPC 3HJQA 4L4UA 5E26A 4JI2M 4MGIE 1KFVA 4IBEA 4LF8M 2VF8A 5LMNM 2ERCA 3KDSE 3KW6A 3B7ZA 3GLHA 4DV2M 1VDDA 5JI2E 1GO5A 4GKJM 3GRUA 1R7RA 7CATA 3AKZA 2CRUA 2LBCA 3SAWA 3HU1A 1D0MA 1N75A 2JY5A 1TTEA 4XK8F 1L1ZA 4JI4M 5EXPA 3BBZA 3A42A 3UJNA 1HT2E 4DV1M 3VKHA 2EO2A 3HKPA 3DA1A 2EA0A 4D81A 1QQWA 2JWSA 2R4JA 4DUYM 4IBKA 4LGYA 3U61B 3SATA 3U6QA 2Z4SA 2MR9A 3NBIA 3U6CA 2UUCM 1E94E 1N36M 1WGLA 3MJ5A 3VK8A 2RGOA 2H1RA 4LCBA 2GNOA 4WW0A 1Z59A 4LG2A 2QENA 1P3QQ 2JUJA 1V34A 3NBXX 2EKKA 3NWLA 3HGIA 2ZM6M 1N77A 3DFZA 3E46A 1VDLA 2LHGA 4QOZC 4RKUF 4L8RC 1PJJA 1RU3A 2JP7A 2R4EA 1TDZA 1GVNA 3SAVA 1SXJA 5ITXA 2I7NA 3GRRA 3GRYA 1XMQM 3GPXA 4MGZE 2Z3XA 4GC9A 4DV4M 4P16A 2CWBA 2BJWA 5DFLA 2OPFA 4TUWA 5IREB 1TH2A 3V76A 3ZCBB 1TF0B 2LVAA 4S12A 1IFYA 3UK6A 4OX9M 1NY6A 3T15A 2R18A 3T1HM 1IBLM 5DNYA 5F3WA 2KNAA 4JI5M 1HQYE 1SXJC 4LJ7A 1DGGA 3ZC7B 3BXWA 4LZZA 3SBJA 3KOWE 4X65M 4KLNA 2H5XA 4DV3M 2DHYA 4HEOA 3GPUA 2J7NA 1PGYA 1TH3A 2V1UA 3SHFA 4FCWA 1G71A 2HCBA 4R7GA 2ZBKB 1OAIA 2ZTDA 3CF6E 3QAUA 1R4GA 4DR2M 4B7FA 2C9CA 2UU9M 4ZPXA 3PNVA 1MN3A 3CF0A 3J80S 3GLGE 2CP8A 3L26A 2Z4RA 3K2LA 4L78A 4NSRA 3U6SA 3LW5F 1NO1A 4ANRA 2VF7A 5EXTA 1HNXM 2ZAOA 2AHMA 2KA6B 2ZAMA 5KQ8A 2DENA 2YFQA 1NVMA 2HAKA 3AOGA 4W5WA 1L2CA 3FTDA 2CHQA 1FJGM 4LJ8A 2XF3A 4II7A 2APLA 3LQQA 4JV5M 1IXSA 1NHWC 2K9DA 2F4VM 5ITQA 2FH0A 1QVRA 4M9XA 5ITTA 2NQ8C 1T43A 1JB0F 4B3RM 4B7HA 5ITRA 1PJIA 4FVMA 2OO9A 1KYIA 1NV9A 2KZUA 3A46A 3GP1A 8CATA 2CV2A 2L7HA 4M0WA 1XNRM 2XEPA 4L15A 2DNAA 2G5GX 2X4AA 3SMPA 4G4RA 1OAOC 1E9RA 3U60B 3UZUA 2E5LM 3IG5A 1GJTA 4FWGA 4B3TM 4GHLA 4IBIA 2XH9A 3K92A 2L09A
chains in the Genus database with same CATH topology
3K9PA 4F1IA 3FRHA 3LCUA 2DAGA 5JI2E 1F4IA 1GO5A 2LBCA 1OQYA 2JNHA 1ZMWA 2JY5A 1TTEA 2BWBA 1DV0A 3BBZA 1HT2E 1NV8A 1ZMUA 3GLHE 1WHCA 1SG9A 2DAKA 4DBGB 2MR9A 1OTRA 2JY8A 1E94E 2EKFA 2QNJA 1WGLA 2KNVA 1XXHE 1VG5A 4GEWA 2DAEA 1P3QQ 1G4AE 2JUJA 2LVQD 1Y8GA 2EKKA 2L4FA 2DAMA 1JR3E 3E46A 1VDLA 3IECA 1WGNA 2LVOC 2LVNC 4G3OA 2JP7A 4R71A 1IM2A 1OKSA 2MROB 1WJ7A 2CWBA 2L2DA 5DFLA 1ZMVA 2KHHA 2ZTCA 1T6OA 4WP2A 2LVAA 3FRIA 2DAIA 3GLFE 1BVSA 1IFYA 1G41A 2KNAA 3GLIE 1HQYE 3IHPA 1DO2A 1CUKA 2JY7A 3FE3A 4F2LA 2RRUA 2DZLA 1WIVA 3F92A 2H5XA 3LCVB 3MMPA 2DHYA 2OOAA 1G3IA 4HEOA 2LTUA 1PGYA 1VEJA 2MGWA 2JZ0A 2WZJA 3T6PA 1OAIA 2ZTDA 1R4GA 2JZ1A 1MN3A 2HWJA 1Q02A 3GLGE 2CP8A 2DI0A 3K9OA 2JY6B 2L4EA 1QZEA 1DO0A 1VEKA 1VEGA 2KNZA 2B3TA 1YLAA 4Q7JA 1XB2B 1UFZA 2DENA 1C7YA 2HAKA 2O25A 2QSFX 3B89A 1HT1E 2EJSA 1V92A 1WR1B 1VQ1A 1IXSA 2K9DA 2QHOB 2DKLA 1T43A 4UN2B 2OO9A 2K0BX 1KYIA 1NV9A 3H4JA 1TR8A 1AIPC 1A5TA 2MJ5B 1ZV1A 1HJPA 1EFUB 2BWEA 2DNAA 2OOBA 2LVPC 2R0IA 2G3QA 3E21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9P A;  4F1I A;  3FRH A;  3LCU A;  2DAG A;  5JI2 E;  1F4I A;  1GO5 A;  2LBC A;  1OQY A;  2JNH A;  1ZMW A;  2JY5 A;  1TTE A;  2BWB A;  1DV0 A;  3BBZ A;  1HT2 E;  1NV8 A;  1ZMU A;  3GLH E;  1WHC A;  1SG9 A;  2DAK A;  4DBG B;  2MR9 A;  1OTR A;  2JY8 A;  1E94 E;  2EKF A;  2QNJ A;  1WGL A;  2KNV A;  1XXH E;  1VG5 A;  4GEW A;  2DAE A;  1P3Q Q;  1G4A E;  2JUJ A;  2LVQ D;  1Y8G A;  2EKK A;  2L4F A;  2DAM A;  1JR3 E;  3E46 A;  1VDL A;  3IEC A;  1WGN A;  2LVO C;  2LVN C;  4G3O A;  2JP7 A;  4R71 A;  1IM2 A;  1OKS A;  2MRO B;  1WJ7 A;  2CWB A;  2L2D A;  5DFL A;  1ZMV A;  2KHH A;  2ZTC A;  1T6O A;  4WP2 A;  2LVA A;  3FRI A;  2DAI A;  3GLF E;  1BVS A;  1IFY A;  1G41 A;  2KNA A;  3GLI E;  1HQY E;  3IHP A;  1DO2 A;  1CUK A;  2JY7 A;  3FE3 A;  4F2L A;  2RRU A;  2DZL A;  1WIV A;  3F92 A;  2H5X A;  3LCV B;  3MMP A;  2DHY A;  2OOA A;  1G3I A;  4HEO A;  2LTU A;  1PGY A;  1VEJ A;  2MGW A;  2JZ0 A;  2WZJ A;  3T6P A;  1OAI A;  2ZTD A;  1R4G A;  2JZ1 A;  1MN3 A;  2HWJ A;  1Q02 A;  3GLG E;  2CP8 A;  2DI0 A;  3K9O A;  2JY6 B;  2L4E A;  1QZE A;  1DO0 A;  1VEK A;  1VEG A;  2KNZ A;  2B3T A;  1YLA A;  4Q7J A;  1XB2 B;  1UFZ A;  2DEN A;  1C7Y A;  2HAK A;  2O25 A;  2QSF X;  3B89 A;  1HT1 E;  2EJS A;  1V92 A;  1WR1 B;  1VQ1 A;  1IXS A;  2K9D A;  2QHO B;  2DKL A;  1T43 A;  4UN2 B;  2OO9 A;  2K0B X;  1KYI A;  1NV9 A;  3H4J A;  1TR8 A;  1AIP C;  1A5T A;  2MJ5 B;  1ZV1 A;  1HJP A;  1EFU B;  2BWE A;  2DNA A;  2OOB A;  2LVP C;  2R0I A;  2G3Q A;  3E21 A; 
#chains in the Genus database with same CATH topology
 3GQ5 A;  4AW4 A;  4G4Q A;  3FTE A;  1NY5 A;  1JQJ C;  2Y0Q A;  3UMM A;  1KSF X;  2DAG A;  1SXJ D;  4IBG A;  4OVZ A;  3TE6 A;  1QZM A;  3L28 A;  3HZJ A;  2XSZ A;  3GQ4 A;  1OQY A;  2X8A A;  1IY1 A;  5KPZ A;  4M9Z A;  2C98 A;  3KSX A;  3TWK A;  4BLC A;  3R8F A;  2G8L A;  1NV8 A;  4OVZ B;  1ZMU A;  3B9P A;  3J7A S;  2YNM D;  2XSZ D;  3GLH E;  3B74 A;  1WHC A;  5BR8 M;  1SG9 A;  4IBF A;  3FD9 A;  2GQF A;  1N78 A;  4DBG B;  2JA2 A;  1W5S A;  2O01 F;  3CGW A;  5L8R F;  2JY8 A;  1IN5 A;  3EIE A;  4NOO B;  3VDP A;  1XXH E;  4G6Z A;  2WSF F;  1HNW M;  1OFH A;  3EIH A;  1IN4 A;  1EE8 A;  4DR5 M;  5DYI A;  3THG A;  4D80 A;  3KFU G;  1Q3B A;  2L4F A;  2UXD M;  1GL7 A;  1JR3 E;  2DVW B;  4JXJ A;  3IEC A;  1DGB A;  3AJI B;  4CIZ A;  3TWM A;  2K6B A;  3C3D A;  2LVN C;  4LY6 A;  3QYE A;  1NJF A;  4M9S A;  4QNR A;  4XBO A;  1OKS A;  1PJS A;  2MRO B;  5EP4 A;  4X62 M;  3HX3 A;  2QQ8 A;  4CHT B;  1WJ7 A;  2L2D A;  4PDI A;  2KHH A;  4FWD A;  1T6O A;  2N35 A;  4WP2 A;  4LF5 M;  2CV0 A;  3GLF E;  2QPA A;  1G41 A;  2HKJ A;  2M5Z A;  4EIW A;  1AUA A;  3JR4 A;  1T3T A;  4IJE A;  4AKH A;  2LNH C;  2JY7 A;  1HQC A;  3ZH9 B;  3J81 S;  3M0E A;  4JI0 M;  4ITQ A;  1WIV A;  5JI3 E;  2OOA A;  1G8P A;  5IZ7 D;  5ITY A;  2R62 A;  2Q2E B;  2MGW A;  4Z6Y A;  3HHY A;  5C18 A;  5E6J A;  1R2Z A;  4JN6 A;  3L25 A;  2L6O A;  2C99 A;  2Z8Y M;  3VK7 A;  4L6V 6;  4FD2 A;  1G59 A;  3ILK A;  4PCZ A;  2L7I A;  2HWJ A;  1D0L A;  1ZQ9 A;  2DI0 A;  1Z5A A;  2JY6 B;  5H37 D;  3KOZ E;  2XZU A;  3K8Z A;  3FUW A;  3Q8X A;  4LFB M;  1S3S A;  1YUB A;  3LVW A;  2XFT A;  1VEG A;  2KNZ A;  3L27 A;  4AQY M;  4X66 M;  1NJG A;  1C7Y A;  1Z5B A;  3GO8 A;  1FNN A;  3B89 A;  4I81 A;  3I4Y A;  2D7H A;  4DR6 M;  3HU2 A;  2J7O A;  2P5T A;  3KSJ A;  4IJF A;  3MHV C;  3TWL A;  3PNY A;  4NL4 H;  3AFH A;  1HNZ M;  1IBM M;  5IWA M;  2VII A;  3GLI B;  2DZO B;  3CTW B;  1D2N A;  4JI3 M;  2K0B X;  4YY3 M;  1TR8 A;  5FTL A;  2MJ5 B;  1HJP A;  3HJS A;  1C1K A;  3RGP A;  2RKO A;  3SYL A;  2C5R A;  2OOB A;  2DHR A;  3FTC A;  3FYC A;  3LVV A;  2G3Q A;  2LH0 A;  3B7N A;  5EP3 A;  5FSW A;  4G4N A;  4AG6 A;  3K9P A;  4F1I A;  3FRH A;  3LCU A;  2ZAN A;  4DR3 M;  1F4I A;  3OTO M;  4B3S M;  1XNQ M;  1R6B X;  4QHS A;  1ZMW A;  3A45 A;  3J7B A;  3TPZ A;  2BWB A;  1QYR A;  5ITX E;  1J09 A;  3BOS A;  3HU3 A;  5KQD A;  1N33 M;  4KHP M;  3GLG A;  3SC3 A;  4Y28 F;  4L16 A;  2VQF M;  5DYG A;  4KO8 A;  4DR1 M;  2RGH A;  4LJ4 A;  2DWN A;  4NRW A;  2CV1 A;  1N34 M;  1IY2 A;  1D0K A;  2FOI C;  1OTR A;  4LGM A;  3VFD A;  3KOY E;  5IT9 S;  5FTJ A;  3E9S A;  1SXJ E;  2DAE A;  3U61 A;  1G4A E;  4KT0 F;  1W5T A;  2HL7 A;  1XC8 A;  1Y8G A;  3GLG B;  2DZN B;  1PM5 A;  4I8O A;  1WGN A;  3VKG A;  2LVO C;  3SAR A;  4JI8 M;  2EUC A;  1H6U A;  2K47 A;  4AG5 A;  3GLI A;  4R71 A;  3FTF A;  1XHB A;  1IM2 A;  1TDH A;  2BNK A;  2CEA A;  2CHG A;  3AOE C;  4IIW A;  2LWX A;  3PVS A;  5EP1 A;  4D82 A;  3GPY A;  3WHL A;  1L1T A;  3AL0 C;  4Z8X A;  2ZTC A;  2F5O A;  4K0K M;  3CF2 A;  4RNA A;  4BBA A;  4AKG A;  2DAI A;  4LJ6 A;  1BVS A;  3QYB A;  3U6P A;  2XLJ A;  1I4W A;  2R65 A;  3JR5 A;  1E32 A;  2DWM A;  3U6M A;  4M0D A;  3AOE A;  3IHP A;  1DO2 A;  5EJC A;  4F2L A;  4CIS A;  3FKE A;  2DZL A;  5FLX S;  1ZAE A;  3F92 A;  2CE7 A;  1QDT A;  3U6L A;  2D7G A;  3LCV B;  5EQT A;  1G3I A;  3FUX A;  2LTU A;  1DGF A;  4MGK E;  3GPP A;  4CJ6 A;  2X49 A;  3KP0 E;  4B3M M;  2FE8 A;  2R46 A;  4FW9 A;  3KXE C;  4AZF A;  5LMU M;  1Q02 A;  3C58 A;  1IN7 A;  5GKN A;  3K9O A;  3KVW A;  3D8L A;  4LF9 M;  2KZS A;  3HHW A;  1K3W A;  4LF7 M;  1GKI A;  4P17 A;  2DWL A;  3I04 M;  3FYD A;  4BB9 A;  2QBY B;  4HL4 A;  2B3T A;  1YLA A;  2DWZ B;  4QOS A;  3J27 B;  2F5S A;  4HLQ A;  2KDL A;  3HY5 A;  3U6D A;  1XWI A;  1HT1 E;  2EJS A;  4CGY B;  1NNU C;  4LRS A;  1ORY B;  1MX0 A;  2WSE F;  4I4L A;  1NHG C;  4PT5 A;  3U6O A;  1DGH A;  4LJ5 A;  4AI6 A;  4B7G A;  1XXH B;  2DKL A;  3DZD A;  4LF4 M;  4GC5 A;  4MGY E;  3I4V A;  3KS4 A;  4QNM A;  4I5S A;  4QHT A;  2QCU A;  4RF1 A;  4MGH A;  2FNA A;  1GAB A;  2V6Z M;  3H4J A;  4NSO B;  4OU7 A;  4LZJ A;  1A5T A;  3FUT A;  1GJS A;  4AKI A;  4GIT A;  2QP9 X;  3GLH B;  3MK6 A;  4NXN M;  2HHH M;  4NRV A;  1YE9 A;  2JXN A;  1L8Q A;  5FTK A;  4DR7 M;  2J5Y A;  4G4O A;  1IY0 A;  3R9X B;  3LQR A;  2V1C A;  5KPR A;  1IXZ A;  2R0I A;  1Z5C A;  4FCV A;  1PJT A;  1DV0 A;  3B7Q A;  3E21 A;  3M7G A;  2F5N A;  1IN8 A;  3WHK A;  2O5R A;  3GLF B;  1Q3C A;  3H4M A;  4PD2 A;  2XGN A;  4WUR A;  1I94 M;  2DXI A;  2XZF A;  3HHZ A;  4XGI A;  1XMO M;  2I7P A;  2R45 A;  4GIP A;  3AV0 A;  4OW0 A;  2JNH A;  3RGS A;  1MJG M;  1QUS A;  3I51 A;  4LJA A;  4JI7 M;  1LV7 A;  4IBJ A;  4X64 M;  1QDR A;  4LRT A;  4R3D A;  2A5Y B;  2VQE M;  3U6E A;  1K3X A;  2D7E A;  2UUB M;  1OIP A;  3SFZ A;  2KEB A;  4GRI A;  3GLF A;  2DAK A;  3TQS A;  2XFS A;  1L2B A;  1WXQ A;  5EXX A;  4A3V B;  2C96 A;  3HWS A;  3W67 A;  4DV5 M;  2EKF A;  1IN6 A;  1GL6 A;  2QNJ A;  2KNV A;  4FWH A;  4PDG A;  1IBK M;  4JI6 M;  3TL4 X;  1VG5 A;  4GEW A;  4IBC A;  3U60 A;  1K82 A;  1R2Y A;  3SAU A;  2LVQ D;  4YHH M;  3HJ8 A;  3Q8G A;  4GH9 A;  4KOD A;  4REZ A;  3JAM S;  5EP2 A;  4DUZ M;  2DAM A;  3C9P A;  2UXC M;  3IG8 A;  2Y0T A;  1TH4 A;  2FS1 A;  3U5Z A;  3W0F A;  1PRB A;  2W82 A;  3I01 M;  4G3O A;  5KPT A;  3SAS A;  1QAM A;  1DGH B;  1N32 M;  4B08 A;  1XXH A;  3HHX A;  2CHV A;  1OFI A;  1IXS B;  3SYK A;  4JYA M;  1ZMV A;  1GLN A;  3KP1 E;  3GRV A;  2YQZ A;  1R5L A;  1JR3 A;  3FRI A;  4MB7 A;  5FTM A;  3W68 A;  1EIJ A;  5FTN A;  2CUZ A;  2LXE A;  3A98 B;  4LJ9 A;  1V33 A;  1YSY A;  3W0L B;  4DR4 M;  4IBD A;  2KW0 A;  3GLI E;  1Z6T A;  1E9S A;  2QBY A;  1CUK A;  3FE3 A;  3K1J A;  2OQ4 A;  2RRU A;  4FCT A;  2KRU A;  3E4R A;  2BJV A;  4NC6 A;  1X37 A;  3LMM A;  3ZQJ A;  5C1B A;  5KO3 A;  3UGJ A;  1OIZ A;  1QUT A;  3MMP A;  3SMS A;  2QZ4 A;  2FFJ A;  3T1Y M;  1HR0 M;  2Y21 A;  5EXS A;  4LFC M;  1VEJ A;  4GKK M;  1LTM A;  2JZ0 A;  3FUV A;  1TGU A;  2WZJ A;  3D8B A;  3T6P A;  5A2Q S;  2R6F A;  2WSC F;  4DV6 M;  4LF6 M;  3KS8 A;  2JZ1 A;  4NXM M;  3L29 A;  1QAN A;  2MH8 A;  3FUU A;  3SHG B;  3T38 A;  2YR0 A;  1MU5 A;  3L2A A;  4DV7 M;  3J2P B;  2L4E A;  1L2D A;  4RF0 A;  3C3E A;  4DV0 M;  1QZE A;  2KRK A;  1DO0 A;  1VEK A;  4Q7J A;  3KOX E;  1XB2 B;  4GMQ A;  1UFZ A;  2M60 A;  4GHA A;  1J5E M;  2O25 A;  2QSF X;  2LHC A;  1NNJ A;  2UUA M;  1V92 A;  1WR1 B;  2KXE A;  1IQP A;  3DOA A;  1JR3 D;  4LFA M;  1PJQ A;  1OJL A;  1Q39 A;  1VQ1 A;  4IBB A;  3PXG A;  2VDB B;  3PFI A;  1QAQ A;  2Z7J A;  3RE8 A;  2QHO B;  1IXR C;  1SXJ B;  2C9O A;  1QAO A;  1NSF A;  4UN2 B;  2F5Q A;  3VLF B;  3U5Z B;  1UM8 A;  1AIP C;  4MM3 B;  5ITU A;  2F5P A;  4JI1 M;  3M6A A;  3RFW A;  1ZV1 A;  4MH0 E;  1EFU B;  2Y20 A;  2BWE A;  1J7K A;  3QWL A;  3GQ3 A;  5BPV A;  2UXB M;  3VDU A;  2R44 A;  2CFO A;  2LVP C;  3HJQ A;  4L4U A;  5E26 A;  4JI2 M;  4MGI E;  1KFV A;  4IBE A;  4LF8 M;  2VF8 A;  5LMN M;  2ERC A;  3KDS E;  3KW6 A;  3B7Z A;  3GLH A;  4DV2 M;  1VDD A;  5JI2 E;  1GO5 A;  4GKJ M;  3GRU A;  1R7R A;  7CAT A;  3AKZ A;  2CRU A;  2LBC A;  3SAW A;  3HU1 A;  1D0M A;  1N75 A;  2JY5 A;  1TTE A;  4XK8 F;  1L1Z A;  4JI4 M;  5EXP A;  3BBZ A;  3A42 A;  3UJN A;  1HT2 E;  4DV1 M;  3VKH A;  2EO2 A;  3HKP A;  3DA1 A;  2EA0 A;  4D81 A;  1QQW A;  2JWS A;  2R4J A;  4DUY M;  4IBK A;  4LGY A;  3U61 B;  3SAT A;  3U6Q A;  2Z4S A;  2MR9 A;  3NBI A;  3U6C A;  2UUC M;  1E94 E;  1N36 M;  1WGL A;  3MJ5 A;  3VK8 A;  2RGO A;  2H1R A;  4LCB A;  2GNO A;  4WW0 A;  1Z59 A;  4LG2 A;  2QEN A;  1P3Q Q;  2JUJ A;  1V34 A;  3NBX X;  2EKK A;  3NWL A;  3HGI A;  2ZM6 M;  1N77 A;  3DFZ A;  3E46 A;  1VDL A;  2LHG A;  4QOZ C;  4RKU F;  4L8R C;  1PJJ A;  1RU3 A;  2JP7 A;  2R4E A;  1TDZ A;  1GVN A;  3SAV A;  1SXJ A;  5ITX A;  2I7N A;  3GRR A;  3GRY A;  1XMQ M;  3GPX A;  4MGZ E;  2Z3X A;  4GC9 A;  4DV4 M;  4P16 A;  2CWB A;  2BJW A;  5DFL A;  2OPF A;  4TUW A;  5IRE B;  1TH2 A;  3V76 A;  3ZCB B;  1TF0 B;  2LVA A;  4S12 A;  1IFY A;  3UK6 A;  4OX9 M;  1NY6 A;  3T15 A;  2R18 A;  3T1H M;  1IBL M;  5DNY A;  5F3W A;  2KNA A;  4JI5 M;  1HQY E;  1SXJ C;  4LJ7 A;  1DGG A;  3ZC7 B;  3BXW A;  4LZZ A;  3SBJ A;  3KOW E;  4X65 M;  4KLN A;  2H5X A;  4DV3 M;  2DHY A;  4HEO A;  3GPU A;  2J7N A;  1PGY A;  1TH3 A;  2V1U A;  3SHF A;  4FCW A;  1G71 A;  2HCB A;  4R7G A;  2ZBK B;  1OAI A;  2ZTD A;  3CF6 E;  3QAU A;  1R4G A;  4DR2 M;  4B7F A;  2C9C A;  2UU9 M;  4ZPX A;  3PNV A;  1MN3 A;  3CF0 A;  3J80 S;  3GLG E;  2CP8 A;  3L26 A;  2Z4R A;  3K2L A;  4L78 A;  4NSR A;  3U6S A;  3LW5 F;  1NO1 A;  4ANR A;  2VF7 A;  5EXT A;  1HNX M;  2ZAO A;  2AHM A;  2KA6 B;  2ZAM A;  5KQ8 A;  2DEN A;  2YFQ A;  1NVM A;  2HAK A;  3AOG A;  4W5W A;  1L2C A;  3FTD A;  2CHQ A;  1FJG M;  4LJ8 A;  2XF3 A;  4II7 A;  2APL A;  3LQQ A;  4JV5 M;  1IXS A;  1NHW C;  2K9D A;  2F4V M;  5ITQ A;  2FH0 A;  1QVR A;  4M9X A;  5ITT A;  2NQ8 C;  1T43 A;  1JB0 F;  4B3R M;  4B7H A;  5ITR A;  1PJI A;  4FVM A;  2OO9 A;  1KYI A;  1NV9 A;  2KZU A;  3A46 A;  3GP1 A;  8CAT A;  2CV2 A;  2L7H A;  4M0W A;  1XNR M;  2XEP A;  4L15 A;  2DNA A;  2G5G X;  2X4A A;  3SMP A;  4G4R A;  1OAO C;  1E9R A;  3U60 B;  3UZU A;  2E5L M;  3IG5 A;  1GJT A;  4FWG A;  4B3T M;  4GHL A;  4IBI A;  2XH9 A;  3K92 A;  2L09 A; 
#chains in the Genus database with same CATH homology
 3K9P A;  4F1I A;  3FRH A;  3LCU A;  2DAG A;  5JI2 E;  1F4I A;  1GO5 A;  2LBC A;  1OQY A;  2JNH A;  1ZMW A;  2JY5 A;  1TTE A;  2BWB A;  1DV0 A;  3BBZ A;  1HT2 E;  1NV8 A;  1ZMU A;  3GLH E;  1WHC A;  1SG9 A;  2DAK A;  4DBG B;  2MR9 A;  1OTR A;  2JY8 A;  1E94 E;  2EKF A;  2QNJ A;  1WGL A;  2KNV A;  1XXH E;  1VG5 A;  4GEW A;  2DAE A;  1P3Q Q;  1G4A E;  2JUJ A;  2LVQ D;  1Y8G A;  2EKK A;  2L4F A;  2DAM A;  1JR3 E;  3E46 A;  1VDL A;  3IEC A;  1WGN A;  2LVO C;  2LVN C;  4G3O A;  2JP7 A;  4R71 A;  1IM2 A;  1OKS A;  2MRO B;  1WJ7 A;  2CWB A;  2L2D A;  5DFL A;  1ZMV A;  2KHH A;  2ZTC A;  1T6O A;  4WP2 A;  2LVA A;  3FRI A;  2DAI A;  3GLF E;  1BVS A;  1IFY A;  1G41 A;  2KNA A;  3GLI E;  1HQY E;  3IHP A;  1DO2 A;  1CUK A;  2JY7 A;  3FE3 A;  4F2L A;  2RRU A;  2DZL A;  1WIV A;  3F92 A;  2H5X A;  3LCV B;  3MMP A;  2DHY A;  2OOA A;  1G3I A;  4HEO A;  2LTU A;  1PGY A;  1VEJ A;  2MGW A;  2JZ0 A;  2WZJ A;  3T6P A;  1OAI A;  2ZTD A;  1R4G A;  2JZ1 A;  1MN3 A;  2HWJ A;  1Q02 A;  3GLG E;  2CP8 A;  2DI0 A;  3K9O A;  2JY6 B;  2L4E A;  1QZE A;  1DO0 A;  1VEK A;  1VEG A;  2KNZ A;  2B3T A;  1YLA A;  4Q7J A;  1XB2 B;  1UFZ A;  2DEN A;  1C7Y A;  2HAK A;  2O25 A;  2QSF X;  3B89 A;  1HT1 E;  2EJS A;  1V92 A;  1WR1 B;  1VQ1 A;  1IXS A;  2K9D A;  2QHO B;  2DKL A;  1T43 A;  4UN2 B;  2OO9 A;  2K0B X;  1KYI A;  1NV9 A;  3H4J A;  1TR8 A;  1AIP C;  1A5T A;  2MJ5 B;  1ZV1 A;  1HJP A;  1EFU B;  2BWE A;  2DNA A;  2OOB A;  2LVP C;  2R0I A;  2G3Q A;  3E21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...