2RRUA

Solution structure of the uba omain of p62 and its interaction with ubiquitin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
b'GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
molecule tags Protein binding
source organism Mus musculus
publication title Crystal structure of the UBA omain of p62 and its interaction with ubiquitin
rcsb
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2rruA00
1G3IA 2DZLA 1ZMVA 2L4FA 3T6PA 2MGWA 3H4JA 2CWBA 1OTRA 2LTUA 2LVOC 2O25A 3MMPA 1IFYA 1DO2A 3GLIE 3FRIA 1WR1B 1KYIA 2LBCA 3GLFE 2EKKA 2ZTDA 2EKFA 4F2LA 1YLAA 1XXHE 1WGNA 3GLHE 2QHOB 3F92A 2KNVA 3LCVB 2H5XA 2LVQD 1OAIA 1UFZA 2QNJA 1VQ1A 2MJ5B 3FRHA 1WIVA 2HWJA 1ZMUA 4G3OA 3BBZA 3E46A 1HT2E 1F4IA 1E94E 1MN3A 1VEGA 1ZMWA 2KHHA 2DAEA 1C7YA 2OOAA 2LVAA 2OOBA 1P3QQ 2QSFX 4GEWA 1Y8GA 1T43A 1Q02A 2ZTCA 1HT1E 1VG5A 5JI2E 1NV9A 1WJ7A 4DBGB 1TTEA 3GLGE 2DENA 2KNAA 1DO0A 3B89A 1ZV1A 1HQYE 2BWEA 1OKSA 1T6OA 1PGYA 2DAMA 2OO9A 4Q7JA 1JR3E 1IXSA 1A5TA 1CUKA 2DKLA 3LCUA 2DHYA 2DI0A 1AIPC 4UN2B 2JY8A 2MR9A 1SG9A 2R0IA 2L4EA 2JUJA 4WP2A 2B3TA 1VEJA 1IM2A 3IHPA 1DV0A 2JY7A 1EFUB 1WHCA 1V92A 2RRUA 1NV8A 1OQYA 2DAKA 3K9PA 2DAGA 1R4GA 2JZ0A 2K9DA 1GO5A 2JP7A 3FE3A 5DFLA 1G4AE 1QZEA 1TR8A 2G3QA 2HAKA 3E21A 2MROB 1G41A 2EJSA 3K9OA 2DNAA 1VEKA 4F1IA 2WZJA 2JZ1A 2K0BX 2JY5A 1WGLA 2JY6B 2BWBA 2L2DA 4R71A 1XB2B 2LVPC 1HJPA 3IECA 4HEOA 2LVNC 1BVSA 2CP8A 2KNZA 1VDLA 2JNHA 2DAIA
chains in the Genus database with same CATH superfamily
4LJ7A 2XH9A 4Y28F 3HKPA 2DZLA 4DV4M 1NJGA 5ITUA 4KT0F 1NVMA 2CWBA 3SYLA 3ILKA 1D0LA 2LTUA 5ITQA 4RNAA 3HJQA 3RFWA 1WR1B 1YUBA 3KP0E 3LVVA 2H1RA 2EKFA 1R2ZA 3GQ5A 1XXHE 4M9SA 5FTKA 1V34A 2WSCF 1WGNA 3L27A 1I4WA 4I5SA 2ZBKB 1IBLM 2L7IA 5KPTA 4DR6M 2LVQD 4ITQA 4LRSA 1UFZA 2EUCA 1VQ1A 3QYBA 4S12A 2MJ5B 3FRHA 2C96A 1N77A 1TH2A 1ZMUA 2GNOA 4KLNA 4NSRA 3A46A 3KS4A 3E46A 4IBEA 1HT2E 3U6QA 4AQYM 4HL4A 5EXPA 1N34M 2QCUA 3L25A 3ZC7B 4MGYE 2KHHA 1XHBA 4M9ZA 1NHWC 4LJ9A 4LFBM 1IQPA 1P3QQ 4LG2A 4GEWA 4JI3M 3H4MA 3CTWB 5FTLA 2ZTCA 2O5RA 2R45A 2Y21A 2UUAM 1WJ7A 2KZSA 1TTEA 1C1KA 1IY0A 2DENA 2LXEA 3U61A 2JA2A 1XMOM 1J09A 1ZV1A 1HQYE 4GC5A 3U5ZB 1OKSA 5KQ8A 2VIIA 3GQ3A 3U6DA 2UXDM 2V1CA 2CHQA 1YSYA 5FTMA 4JYAM 1IXSA 4IBBA 4IBJA 1PJSA 3HHYA 1A5TA 1R7RA 5IT9S 3SYKA 2DI0A 2OQ4A 1AIPC 2C98A 1X37A 4MGZE 2C9CA 2JY8A 4DV5M 3I4VA 1OAOC 1J7KA 3HGIA 3AOEA 3NWLA 3AOEC 4B7HA 4WP2A 2C5RA 2B3TA 3DOAA 2DWNA 3HHWA 4Z8XA 3UMMA 2X8AA 3GPUA 3GO8A 3GLIA 4JI6M 4HLQA 3VLFB 3KW6A 4IJEA 1G59A 4IBKA 2XFSA 3DA1A 1Z6TA 1WHCA 1NJFA 5H37D 5FSWA 1JQJC 3C58A 1TH3A 3VDUA 2DAKA 5FLXS 3SHGB 4NRWA 4NC6A 2L7HA 3K2LA 4LFAM 2BJWA 5ITRA 4YY3M 4QNRA 2Z3XA 3A98B 3AJIB 1GABA 4X62M 3FE3A 4D81A 2G3QA 3QWLA 2I7NA 1G41A 1Z5AA 3K1JA 2F5OA 4GRIA 1SXJC 4B3MM 3PNVA 3TPZA 4NL4H 4LF7M 1VDDA 5A2QS 2M5ZA 4B7FA 1QUTA 2D7GA 3LMMA 1SXJE 2K0BX 1D0MA 1Q3BA 4PDIA 3I51A 3I4YA 2Z8YM 1XXHB 4QOSA 4DR3M 3KFUG 3KSJA 2VQFM 2XLJA 3GLGA 4TUWA 4M9XA 4X66M 4FCTA 3JR4A 1HNWM 4W5WA 2LVPC 3CGWA 1NO1A 3K8ZA 2C9OA 3U6EA 3EIEA 3W0FA 1VDLA 2JNHA 2UUBM 3GPPA 3GLGB 1G3IA 1XNRM 5ITYA 4DR1M 2DXIA 4L8RC 1OIPA 3C3DA 3GRVA 3TL4X 3SBJA 2L4FA 3T6PA 1N75A 5LMUM 1TF0B 3MMPA 2FOIC 3FKEA 4L15A 1RU3A 4JN6A 4OVZA 3L29A 2KXEA 3THGA 3D8BA 1YLAA 4IJFA 4LF4M 4MM3B 4LF6M 4L16A 4IBGA 2HCBA 4LCBA 3BOSA 5BPVA 1L2BA 4GHAA 2KNVA 4DV1M 2CFOA 2H5XA 4R3DA 1WIVA 3HWSA 3IG5A 2R6FA 2DZOB 1ZQ9A 4G3OA 2E5LM 4XK8F 4MGKE 5EP4A 5ITTA 1IXRC 5EXTA 1D0KA 1E94E 1MN3A 3Q8GA 4AZFA 3HHZA 1MJGM 1EIJA 1Z59A 1G71A 2WSFF 1C7YA 2LVAA 3GLIB 1K3WA 2P5TA 4NSOB 3JAMS 2DZNB 2J5YA 4IBCA 1VG5A 4JI0M 4ANRA 1OIZA 2VDBB 3GLGE 1QVRA 2KDLA 3GRRA 3KS8A 2CV1A 1TDHA 1EE8A 1PGYA 2VF8A 4KO8A 1NSFA 4LGYA 1IXSB 2MH8A 2KRUA 2X4AA 4LGMA 2R44A 4XGIA 1HNXM 2M60A 2V1UA 1CUKA 3LCUA 1MU5A 3MHVC 3QAUA 1PM5A 2KEBA 1W5TA 1OFHA 4G4QA 3U61B 1DGHB 3T1YM 4FWHA 3PFIA 2A5YB 4PT5A 3FYDA 2L4EA 5DYIA 2NQ8C 1NY5A 2Y0TA 4NXMM 4DUZM 4L78A 4LJ6A 3JR5A 1QAMA 4LJAA 5ITXE 1QQWA 3AOGA 1DV0A 2XSZD 3B74A 2F5QA 3U6CA 4AKGA 3J81S 1V92A 2K6BA 3C3EA 3OTOM 3SAVA 4KHPM 3J80S 4AG5A 1TGUA 2RRUA 2X49A 3HU2A 4XBOA 3HJ8A 4X64M 2VQEM 1XMQM 2DAGA 2ERCA 4DV7M 1IN8A 3LW5F 2QZ4A 1YE9A 2VF7A 1Z5BA 2JZ0A 2UUCM 1L1TA 3HJSA 1QZMA 1NHGC 2FNAA 2JP7A 3VKGA 1QDTA 1TR8A 2HAKA 3E21A 4ZPXA 2MROB 2BNKA 2EJSA 4PD2A 4II7A 4GH9A 3M0EA 4OW0A 3L26A 3VK7A 2HKJA 2JWSA 2DNAA 1VEKA 4F1IA 4JI1M 2WZJA 3SASA 3B7NA 5IREB 3SAWA 4B3TM 1HQCA 4MB7A 3FUVA 1WGLA 1T3TA 2JY6B 2J7OA 2R62A 3BXWA 3E9SA 2DWLA 1N33M 2CHGA 4L4UA 4G6ZA 2CV0A 4FWDA 3T1HM 1XB2B 1DGHA 3SAUA 4QNMA 4AG6A 2CV2A 1L8QA 3L28A 2YFQA 3FUUA 3J7BA 3RE8A 1BVSA 5ITXA 3IG8A 3HU1A 4GIPA 5BR8M 4R7GA 4LZZA 1R2YA 3ZH9B 3U60B 1LV7A 3VFDA 3ZCBB 1I94M 2FFJA 5L8RF 3KDSE 4DV6M 3SARA 2OPFA 4KODA 4LJ4A 1OTRA 2LVOC 3B9PA 1IFYA 1DO2A 3GLIE 1E9SA 3C9PA 4GKJM 3U6OA 1KYIA 3FTDA 5EP3A 3B7QA 1WXQA 2R4JA 2DHRA 2ZTDA 3K92A 2XZFA 1ORYB 1XC8A 4JI2M 3WHLA 2C99A 4AW4A 4YHHM 5E26A 3AV0A 2EA0A 3GLHE 3NBIA 1HR0M 4G4OA 2YNMD 5KPZA 3LCVB 1OAIA 1JR3A 3KP1E 3HHXA 4REZA 4CIZA 2HWJA 1GKIA 4DV0M 4IIWA 1IN6A 4NRVA 1GJTA 1LTMA 3J27B 1TH4A 4QHSA 2DAEA 2QSFX 2W82A 2OOBA 3ZQJA 1W5SA 2G5GX 2RGOA 1GLNA 1GJSA 4Z6YA 1Y8GA 1T43A 2BJVA 3Q8XA 3SC3A 1KFVA 1HT1E 3GQ4A 5JI2E 1NV9A 2FS1A 4JXJA 4OVZB 4BBAA 1Q3CA 4DBGB 5C18A 1IXZA 4RF0A 3UJNA 4JI7M 4GHLA 2KNAA 3PNYA 4P16A 3B89A 4FCVA 3CF0A 4A3VB 2QBYA 2XGNA 2V6ZM 2BWEA 5DNYA 3VK8A 3J7AS 3AKZA 3B7ZA 2OO9A 4Q7JA 1KSFX 1JR3E 1L1ZA 1V33A 4M0WA 2R65A 1SXJB 4JI8M 2J7NA 3AFHA 5KQDA 2DHYA 1N78A 3GLHA 3L2AA 3SFZA 3DFZA 4B3RM 2Y0QA 4UN2B 5KPRA 2MR9A 2R46A 2CE7A 2QQ8A 1IN5A 1SG9A 2ZAOA 3A42A 4B3SM 4FWGA 2D7EA 3W0LB 5C1BA 4M0DA 1XXHA 2O01F 2JUJA 3EIHA 1IBMM 2XEPA 4NOOB 2ZANA 4B7GA 1IY1A 1AUAA 3GRYA 2F4VM 3HY5A 2CUZA 2RGHA 1VEJA 1IM2A 1E32A 3J2PB 2L09A 2JY7A 3LQQA 1EFUB 4NXNM 3FUTA 2YR0A 4LF9M 3SMSA 2CHVA 5F3WA 1TDZA 1L2CA 1IN4A 3K9PA 1MX0A 4QHTA 3SMPA 4QOZC 4AKHA 4RF1A 5EXSA 2UXCM 2K9DA 2R4EA 2KZUA 3TE6A 5DFLA 4BB9A 1QZEA 5EP1A 2DWZB 2LNHC 7CATA 1L2DA 5JI3E 2HHHM 2CRUA 1HNZM 2DWMA 3GRUA 3K9OA 3TWKA 1G8PA 2Z4SA 2UXBM 2I7PA 2L6OA 3TQSA 4I81A 3UK6A 2DVWB 4LF8M 3PVSA 2JZ1A 4X65M 4CJ6A 2JY5A 4JI5M 4MH0E 1E9RA 4CGYB 2XZUA 2BWBA 2LHGA 1J5EM 2L2DA 4DR2M 1PJTA 2Q2EB 4I8OA 4OU7A 2QPAA 1GL6A 4FD2A 4WURA 3FTFA 4GKKM 1UM8A 4WW0A 3WHKA 1PRBA 2CP8A 3W67A 4P17A 1DGGA 2Y20A 3FUXA 2DAIA 3MK6A 3RGSA 3GPXA 1DGBA 3T38A 1ZMVA 2UU9M 5E6JA 2MGWA 3U5ZA 3H4JA 2LWXA 3KOWE 4GMQA 2O25A 1R5LA 2WSEF 4MGHA 3LVWA 1GL7A 1Q39A 3FRIA 2YQZA 2G8LA 4IBFA 2ZAMA 2LBCA 4GC9A 2EKKA 3GLFE 4F2LA 2KA6B 3KOZE 4L6V6 4AI6A 3HX3A 1PJJA 3FTEA 3T15A 1NNJA 4D80A 2QHOB 3F92A 1QDRA 3KXEC 3V76A 2QNJA 3MJ5A 4AKIA 4LF5M 4DUYM 1S3SA 3SHFA 1FJGM 4MGIE 1D2NA 3BBZA 1NNUC 1GVNA 3FUWA 5EQTA 1F4IA 2FE8A 1VEGA 1K82A 3U6LA 1ZMWA 3FYCA 3R8FA 3TWLA 2KW0A 4FW9A 2OOAA 2ZM6M 4DV2M 4G4NA 3TWMA 1Q02A 3KVWA 4PDGA 1FNNA 2N35A 3LQRA 4FVMA 4LJ8A 3KOYE 5EXXA 1JR3D 5IZ7D 3A45A 1QAQA 1DO0A 2RKOA 4IBDA 3GLHB 5FTJA 4EIWA 2APLA 4DR7M 3CF2A 1SXJA 4DR4M 1T6OA 4G4RA 2DAMA 2Z7JA 2R18A 4CHTB 8CATA 5EJCA 2DKLA 3AL0C 2QBYB 3HU3A 3I04M 1PJQA 1N32M 3U6PA 1Z5CA 1K3XA 2R0IA 3VDPA 3UZUA 1QANA 4JV5M 3KSXA 1IY2A 3M7GA 3E4RA 1QAOA 3PXGA 3GLFA 3VKHA 2Z4RA 1SXJD 4LZJA 2HL7A 4FCWA 2CEAA 5FTNA 3IHPA 5LMNM 1OJLA 3I01M 2LH0A 3DZDA 3FTCA 3W68A 2FH0A 4RKUF 2EO2A 1IBKM 4PCZA 2F5SA 1QYRA 1NV8A 1OQYA 3D8LA 3SATA 4JI4M 4DR5M 3RGPA 1R4GA 3NBXX 1QUSA 1PJIA 4LRTA 4B08A 3U6MA 2GQFA 1N36M 3R9XB 1R6BX 1XWIA 3UGJA 3U6SA 4DV3M 1GO5A 1G4AE 2KRKA 2F5PA 1XNQM 4GITA 5KO3A 1DGFA 4LY6A 5IWAM 3GP1A 3CF6E 4LJ5A 5EP2A 1H6UA 4BLCA 3GLFB 3FD9A 4I4LA 3GPYA 2F5NA 5GKNA 3M6AA 4CISA 3HZJA 3U60A 4LFCM 4IBIA 2D7HA 3KOXE 4R71A 1NY6A 2AHMA 2QP9X 4K0KM 1OFIA 4OX9M 1HJPA 2K47A 1JB0F 1ZAEA 2LHCA 3IECA 4HEOA 2XSZA 5DYGA 2LVNC 4D82A 1IN7A 2KNZA 3QYEA 2JXNA 2XF3A 2XFTA 2QENA
chains in the Genus database with same CATH topology
1G3IA 2DZLA 1ZMVA 2L4FA 3T6PA 2MGWA 3H4JA 2CWBA 1OTRA 2LTUA 2LVOC 2O25A 3MMPA 1IFYA 1DO2A 3GLIE 3FRIA 1WR1B 1KYIA 2LBCA 3GLFE 2EKKA 2ZTDA 2EKFA 4F2LA 1YLAA 1XXHE 1WGNA 3GLHE 2QHOB 3F92A 2KNVA 3LCVB 2H5XA 2LVQD 1OAIA 1UFZA 2QNJA 1VQ1A 2MJ5B 3FRHA 1WIVA 2HWJA 1ZMUA 4G3OA 3BBZA 3E46A 1HT2E 1F4IA 1E94E 1MN3A 1VEGA 1ZMWA 2KHHA 2DAEA 1C7YA 2OOAA 2LVAA 2OOBA 1P3QQ 2QSFX 4GEWA 1Y8GA 1T43A 1Q02A 2ZTCA 1HT1E 1VG5A 5JI2E 1NV9A 1WJ7A 4DBGB 1TTEA 3GLGE 2DENA 2KNAA 1DO0A 3B89A 1ZV1A 1HQYE 2BWEA 1OKSA 1T6OA 1PGYA 2DAMA 2OO9A 4Q7JA 1JR3E 1IXSA 1A5TA 1CUKA 2DKLA 3LCUA 2DHYA 2DI0A 1AIPC 4UN2B 2JY8A 2MR9A 1SG9A 2R0IA 2L4EA 2JUJA 4WP2A 2B3TA 1VEJA 1IM2A 3IHPA 1DV0A 2JY7A 1EFUB 1WHCA 1V92A 2RRUA 1NV8A 1OQYA 2DAKA 3K9PA 2DAGA 1R4GA 2JZ0A 2K9DA 1GO5A 2JP7A 3FE3A 5DFLA 1G4AE 1QZEA 1TR8A 2G3QA 2HAKA 3E21A 2MROB 1G41A 2EJSA 3K9OA 2DNAA 1VEKA 4F1IA 2WZJA 2JZ1A 2K0BX 2JY5A 1WGLA 2JY6B 2BWBA 2L2DA 4R71A 1XB2B 2LVPC 1HJPA 3IECA 4HEOA 2LVNC 1BVSA 2CP8A 2KNZA 1VDLA 2JNHA 2DAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3I A;  2DZL A;  1ZMV A;  2L4F A;  3T6P A;  2MGW A;  3H4J A;  2CWB A;  1OTR A;  2LTU A;  2LVO C;  2O25 A;  3MMP A;  1IFY A;  1DO2 A;  3GLI E;  3FRI A;  1WR1 B;  1KYI A;  2LBC A;  3GLF E;  2EKK A;  2ZTD A;  2EKF A;  4F2L A;  1YLA A;  1XXH E;  1WGN A;  3GLH E;  2QHO B;  3F92 A;  2KNV A;  3LCV B;  2H5X A;  2LVQ D;  1OAI A;  1UFZ A;  2QNJ A;  1VQ1 A;  2MJ5 B;  3FRH A;  1WIV A;  2HWJ A;  1ZMU A;  4G3O A;  3BBZ A;  3E46 A;  1HT2 E;  1F4I A;  1E94 E;  1MN3 A;  1VEG A;  1ZMW A;  2KHH A;  2DAE A;  1C7Y A;  2OOA A;  2LVA A;  2OOB A;  1P3Q Q;  2QSF X;  4GEW A;  1Y8G A;  1T43 A;  1Q02 A;  2ZTC A;  1HT1 E;  1VG5 A;  5JI2 E;  1NV9 A;  1WJ7 A;  4DBG B;  1TTE A;  3GLG E;  2DEN A;  2KNA A;  1DO0 A;  3B89 A;  1ZV1 A;  1HQY E;  2BWE A;  1OKS A;  1T6O A;  1PGY A;  2DAM A;  2OO9 A;  4Q7J A;  1JR3 E;  1IXS A;  1A5T A;  1CUK A;  2DKL A;  3LCU A;  2DHY A;  2DI0 A;  1AIP C;  4UN2 B;  2JY8 A;  2MR9 A;  1SG9 A;  2R0I A;  2L4E A;  2JUJ A;  4WP2 A;  2B3T A;  1VEJ A;  1IM2 A;  3IHP A;  1DV0 A;  2JY7 A;  1EFU B;  1WHC A;  1V92 A;  2RRU A;  1NV8 A;  1OQY A;  2DAK A;  3K9P A;  2DAG A;  1R4G A;  2JZ0 A;  2K9D A;  1GO5 A;  2JP7 A;  3FE3 A;  5DFL A;  1G4A E;  1QZE A;  1TR8 A;  2G3Q A;  2HAK A;  3E21 A;  2MRO B;  1G41 A;  2EJS A;  3K9O A;  2DNA A;  1VEK A;  4F1I A;  2WZJ A;  2JZ1 A;  2K0B X;  2JY5 A;  1WGL A;  2JY6 B;  2BWB A;  2L2D A;  4R71 A;  1XB2 B;  2LVP C;  1HJP A;  3IEC A;  4HEO A;  2LVN C;  1BVS A;  2CP8 A;  2KNZ A;  1VDL A;  2JNH A;  2DAI A; 
#chains in the Genus database with same CATH topology
 4LJ7 A;  2XH9 A;  4Y28 F;  3HKP A;  2DZL A;  4DV4 M;  1NJG A;  5ITU A;  4KT0 F;  1NVM A;  2CWB A;  3SYL A;  3ILK A;  1D0L A;  2LTU A;  5ITQ A;  4RNA A;  3HJQ A;  3RFW A;  1WR1 B;  1YUB A;  3KP0 E;  3LVV A;  2H1R A;  2EKF A;  1R2Z A;  3GQ5 A;  1XXH E;  4M9S A;  5FTK A;  1V34 A;  2WSC F;  1WGN A;  3L27 A;  1I4W A;  4I5S A;  2ZBK B;  1IBL M;  2L7I A;  5KPT A;  4DR6 M;  2LVQ D;  4ITQ A;  4LRS A;  1UFZ A;  2EUC A;  1VQ1 A;  3QYB A;  4S12 A;  2MJ5 B;  3FRH A;  2C96 A;  1N77 A;  1TH2 A;  1ZMU A;  2GNO A;  4KLN A;  4NSR A;  3A46 A;  3KS4 A;  3E46 A;  4IBE A;  1HT2 E;  3U6Q A;  4AQY M;  4HL4 A;  5EXP A;  1N34 M;  2QCU A;  3L25 A;  3ZC7 B;  4MGY E;  2KHH A;  1XHB A;  4M9Z A;  1NHW C;  4LJ9 A;  4LFB M;  1IQP A;  1P3Q Q;  4LG2 A;  4GEW A;  4JI3 M;  3H4M A;  3CTW B;  5FTL A;  2ZTC A;  2O5R A;  2R45 A;  2Y21 A;  2UUA M;  1WJ7 A;  2KZS A;  1TTE A;  1C1K A;  1IY0 A;  2DEN A;  2LXE A;  3U61 A;  2JA2 A;  1XMO M;  1J09 A;  1ZV1 A;  1HQY E;  4GC5 A;  3U5Z B;  1OKS A;  5KQ8 A;  2VII A;  3GQ3 A;  3U6D A;  2UXD M;  2V1C A;  2CHQ A;  1YSY A;  5FTM A;  4JYA M;  1IXS A;  4IBB A;  4IBJ A;  1PJS A;  3HHY A;  1A5T A;  1R7R A;  5IT9 S;  3SYK A;  2DI0 A;  2OQ4 A;  1AIP C;  2C98 A;  1X37 A;  4MGZ E;  2C9C A;  2JY8 A;  4DV5 M;  3I4V A;  1OAO C;  1J7K A;  3HGI A;  3AOE A;  3NWL A;  3AOE C;  4B7H A;  4WP2 A;  2C5R A;  2B3T A;  3DOA A;  2DWN A;  3HHW A;  4Z8X A;  3UMM A;  2X8A A;  3GPU A;  3GO8 A;  3GLI A;  4JI6 M;  4HLQ A;  3VLF B;  3KW6 A;  4IJE A;  1G59 A;  4IBK A;  2XFS A;  3DA1 A;  1Z6T A;  1WHC A;  1NJF A;  5H37 D;  5FSW A;  1JQJ C;  3C58 A;  1TH3 A;  3VDU A;  2DAK A;  5FLX S;  3SHG B;  4NRW A;  4NC6 A;  2L7H A;  3K2L A;  4LFA M;  2BJW A;  5ITR A;  4YY3 M;  4QNR A;  2Z3X A;  3A98 B;  3AJI B;  1GAB A;  4X62 M;  3FE3 A;  4D81 A;  2G3Q A;  3QWL A;  2I7N A;  1G41 A;  1Z5A A;  3K1J A;  2F5O A;  4GRI A;  1SXJ C;  4B3M M;  3PNV A;  3TPZ A;  4NL4 H;  4LF7 M;  1VDD A;  5A2Q S;  2M5Z A;  4B7F A;  1QUT A;  2D7G A;  3LMM A;  1SXJ E;  2K0B X;  1D0M A;  1Q3B A;  4PDI A;  3I51 A;  3I4Y A;  2Z8Y M;  1XXH B;  4QOS A;  4DR3 M;  3KFU G;  3KSJ A;  2VQF M;  2XLJ A;  3GLG A;  4TUW A;  4M9X A;  4X66 M;  4FCT A;  3JR4 A;  1HNW M;  4W5W A;  2LVP C;  3CGW A;  1NO1 A;  3K8Z A;  2C9O A;  3U6E A;  3EIE A;  3W0F A;  1VDL A;  2JNH A;  2UUB M;  3GPP A;  3GLG B;  1G3I A;  1XNR M;  5ITY A;  4DR1 M;  2DXI A;  4L8R C;  1OIP A;  3C3D A;  3GRV A;  3TL4 X;  3SBJ A;  2L4F A;  3T6P A;  1N75 A;  5LMU M;  1TF0 B;  3MMP A;  2FOI C;  3FKE A;  4L15 A;  1RU3 A;  4JN6 A;  4OVZ A;  3L29 A;  2KXE A;  3THG A;  3D8B A;  1YLA A;  4IJF A;  4LF4 M;  4MM3 B;  4LF6 M;  4L16 A;  4IBG A;  2HCB A;  4LCB A;  3BOS A;  5BPV A;  1L2B A;  4GHA A;  2KNV A;  4DV1 M;  2CFO A;  2H5X A;  4R3D A;  1WIV A;  3HWS A;  3IG5 A;  2R6F A;  2DZO B;  1ZQ9 A;  4G3O A;  2E5L M;  4XK8 F;  4MGK E;  5EP4 A;  5ITT A;  1IXR C;  5EXT A;  1D0K A;  1E94 E;  1MN3 A;  3Q8G A;  4AZF A;  3HHZ A;  1MJG M;  1EIJ A;  1Z59 A;  1G71 A;  2WSF F;  1C7Y A;  2LVA A;  3GLI B;  1K3W A;  2P5T A;  4NSO B;  3JAM S;  2DZN B;  2J5Y A;  4IBC A;  1VG5 A;  4JI0 M;  4ANR A;  1OIZ A;  2VDB B;  3GLG E;  1QVR A;  2KDL A;  3GRR A;  3KS8 A;  2CV1 A;  1TDH A;  1EE8 A;  1PGY A;  2VF8 A;  4KO8 A;  1NSF A;  4LGY A;  1IXS B;  2MH8 A;  2KRU A;  2X4A A;  4LGM A;  2R44 A;  4XGI A;  1HNX M;  2M60 A;  2V1U A;  1CUK A;  3LCU A;  1MU5 A;  3MHV C;  3QAU A;  1PM5 A;  2KEB A;  1W5T A;  1OFH A;  4G4Q A;  3U61 B;  1DGH B;  3T1Y M;  4FWH A;  3PFI A;  2A5Y B;  4PT5 A;  3FYD A;  2L4E A;  5DYI A;  2NQ8 C;  1NY5 A;  2Y0T A;  4NXM M;  4DUZ M;  4L78 A;  4LJ6 A;  3JR5 A;  1QAM A;  4LJA A;  5ITX E;  1QQW A;  3AOG A;  1DV0 A;  2XSZ D;  3B74 A;  2F5Q A;  3U6C A;  4AKG A;  3J81 S;  1V92 A;  2K6B A;  3C3E A;  3OTO M;  3SAV A;  4KHP M;  3J80 S;  4AG5 A;  1TGU A;  2RRU A;  2X49 A;  3HU2 A;  4XBO A;  3HJ8 A;  4X64 M;  2VQE M;  1XMQ M;  2DAG A;  2ERC A;  4DV7 M;  1IN8 A;  3LW5 F;  2QZ4 A;  1YE9 A;  2VF7 A;  1Z5B A;  2JZ0 A;  2UUC M;  1L1T A;  3HJS A;  1QZM A;  1NHG C;  2FNA A;  2JP7 A;  3VKG A;  1QDT A;  1TR8 A;  2HAK A;  3E21 A;  4ZPX A;  2MRO B;  2BNK A;  2EJS A;  4PD2 A;  4II7 A;  4GH9 A;  3M0E A;  4OW0 A;  3L26 A;  3VK7 A;  2HKJ A;  2JWS A;  2DNA A;  1VEK A;  4F1I A;  4JI1 M;  2WZJ A;  3SAS A;  3B7N A;  5IRE B;  3SAW A;  4B3T M;  1HQC A;  4MB7 A;  3FUV A;  1WGL A;  1T3T A;  2JY6 B;  2J7O A;  2R62 A;  3BXW A;  3E9S A;  2DWL A;  1N33 M;  2CHG A;  4L4U A;  4G6Z A;  2CV0 A;  4FWD A;  3T1H M;  1XB2 B;  1DGH A;  3SAU A;  4QNM A;  4AG6 A;  2CV2 A;  1L8Q A;  3L28 A;  2YFQ A;  3FUU A;  3J7B A;  3RE8 A;  1BVS A;  5ITX A;  3IG8 A;  3HU1 A;  4GIP A;  5BR8 M;  4R7G A;  4LZZ A;  1R2Y A;  3ZH9 B;  3U60 B;  1LV7 A;  3VFD A;  3ZCB B;  1I94 M;  2FFJ A;  5L8R F;  3KDS E;  4DV6 M;  3SAR A;  2OPF A;  4KOD A;  4LJ4 A;  1OTR A;  2LVO C;  3B9P A;  1IFY A;  1DO2 A;  3GLI E;  1E9S A;  3C9P A;  4GKJ M;  3U6O A;  1KYI A;  3FTD A;  5EP3 A;  3B7Q A;  1WXQ A;  2R4J A;  2DHR A;  2ZTD A;  3K92 A;  2XZF A;  1ORY B;  1XC8 A;  4JI2 M;  3WHL A;  2C99 A;  4AW4 A;  4YHH M;  5E26 A;  3AV0 A;  2EA0 A;  3GLH E;  3NBI A;  1HR0 M;  4G4O A;  2YNM D;  5KPZ A;  3LCV B;  1OAI A;  1JR3 A;  3KP1 E;  3HHX A;  4REZ A;  4CIZ A;  2HWJ A;  1GKI A;  4DV0 M;  4IIW A;  1IN6 A;  4NRV A;  1GJT A;  1LTM A;  3J27 B;  1TH4 A;  4QHS A;  2DAE A;  2QSF X;  2W82 A;  2OOB A;  3ZQJ A;  1W5S A;  2G5G X;  2RGO A;  1GLN A;  1GJS A;  4Z6Y A;  1Y8G A;  1T43 A;  2BJV A;  3Q8X A;  3SC3 A;  1KFV A;  1HT1 E;  3GQ4 A;  5JI2 E;  1NV9 A;  2FS1 A;  4JXJ A;  4OVZ B;  4BBA A;  1Q3C A;  4DBG B;  5C18 A;  1IXZ A;  4RF0 A;  3UJN A;  4JI7 M;  4GHL A;  2KNA A;  3PNY A;  4P16 A;  3B89 A;  4FCV A;  3CF0 A;  4A3V B;  2QBY A;  2XGN A;  2V6Z M;  2BWE A;  5DNY A;  3VK8 A;  3J7A S;  3AKZ A;  3B7Z A;  2OO9 A;  4Q7J A;  1KSF X;  1JR3 E;  1L1Z A;  1V33 A;  4M0W A;  2R65 A;  1SXJ B;  4JI8 M;  2J7N A;  3AFH A;  5KQD A;  2DHY A;  1N78 A;  3GLH A;  3L2A A;  3SFZ A;  3DFZ A;  4B3R M;  2Y0Q A;  4UN2 B;  5KPR A;  2MR9 A;  2R46 A;  2CE7 A;  2QQ8 A;  1IN5 A;  1SG9 A;  2ZAO A;  3A42 A;  4B3S M;  4FWG A;  2D7E A;  3W0L B;  5C1B A;  4M0D A;  1XXH A;  2O01 F;  2JUJ A;  3EIH A;  1IBM M;  2XEP A;  4NOO B;  2ZAN A;  4B7G A;  1IY1 A;  1AUA A;  3GRY A;  2F4V M;  3HY5 A;  2CUZ A;  2RGH A;  1VEJ A;  1IM2 A;  1E32 A;  3J2P B;  2L09 A;  2JY7 A;  3LQQ A;  1EFU B;  4NXN M;  3FUT A;  2YR0 A;  4LF9 M;  3SMS A;  2CHV A;  5F3W A;  1TDZ A;  1L2C A;  1IN4 A;  3K9P A;  1MX0 A;  4QHT A;  3SMP A;  4QOZ C;  4AKH A;  4RF1 A;  5EXS A;  2UXC M;  2K9D A;  2R4E A;  2KZU A;  3TE6 A;  5DFL A;  4BB9 A;  1QZE A;  5EP1 A;  2DWZ B;  2LNH C;  7CAT A;  1L2D A;  5JI3 E;  2HHH M;  2CRU A;  1HNZ M;  2DWM A;  3GRU A;  3K9O A;  3TWK A;  1G8P A;  2Z4S A;  2UXB M;  2I7P A;  2L6O A;  3TQS A;  4I81 A;  3UK6 A;  2DVW B;  4LF8 M;  3PVS A;  2JZ1 A;  4X65 M;  4CJ6 A;  2JY5 A;  4JI5 M;  4MH0 E;  1E9R A;  4CGY B;  2XZU A;  2BWB A;  2LHG A;  1J5E M;  2L2D A;  4DR2 M;  1PJT A;  2Q2E B;  4I8O A;  4OU7 A;  2QPA A;  1GL6 A;  4FD2 A;  4WUR A;  3FTF A;  4GKK M;  1UM8 A;  4WW0 A;  3WHK A;  1PRB A;  2CP8 A;  3W67 A;  4P17 A;  1DGG A;  2Y20 A;  3FUX A;  2DAI A;  3MK6 A;  3RGS A;  3GPX A;  1DGB A;  3T38 A;  1ZMV A;  2UU9 M;  5E6J A;  2MGW A;  3U5Z A;  3H4J A;  2LWX A;  3KOW E;  4GMQ A;  2O25 A;  1R5L A;  2WSE F;  4MGH A;  3LVW A;  1GL7 A;  1Q39 A;  3FRI A;  2YQZ A;  2G8L A;  4IBF A;  2ZAM A;  2LBC A;  4GC9 A;  2EKK A;  3GLF E;  4F2L A;  2KA6 B;  3KOZ E;  4L6V 6;  4AI6 A;  3HX3 A;  1PJJ A;  3FTE A;  3T15 A;  1NNJ A;  4D80 A;  2QHO B;  3F92 A;  1QDR A;  3KXE C;  3V76 A;  2QNJ A;  3MJ5 A;  4AKI A;  4LF5 M;  4DUY M;  1S3S A;  3SHF A;  1FJG M;  4MGI E;  1D2N A;  3BBZ A;  1NNU C;  1GVN A;  3FUW A;  5EQT A;  1F4I A;  2FE8 A;  1VEG A;  1K82 A;  3U6L A;  1ZMW A;  3FYC A;  3R8F A;  3TWL A;  2KW0 A;  4FW9 A;  2OOA A;  2ZM6 M;  4DV2 M;  4G4N A;  3TWM A;  1Q02 A;  3KVW A;  4PDG A;  1FNN A;  2N35 A;  3LQR A;  4FVM A;  4LJ8 A;  3KOY E;  5EXX A;  1JR3 D;  5IZ7 D;  3A45 A;  1QAQ A;  1DO0 A;  2RKO A;  4IBD A;  3GLH B;  5FTJ A;  4EIW A;  2APL A;  4DR7 M;  3CF2 A;  1SXJ A;  4DR4 M;  1T6O A;  4G4R A;  2DAM A;  2Z7J A;  2R18 A;  4CHT B;  8CAT A;  5EJC A;  2DKL A;  3AL0 C;  2QBY B;  3HU3 A;  3I04 M;  1PJQ A;  1N32 M;  3U6P A;  1Z5C A;  1K3X A;  2R0I A;  3VDP A;  3UZU A;  1QAN A;  4JV5 M;  3KSX A;  1IY2 A;  3M7G A;  3E4R A;  1QAO A;  3PXG A;  3GLF A;  3VKH A;  2Z4R A;  1SXJ D;  4LZJ A;  2HL7 A;  4FCW A;  2CEA A;  5FTN A;  3IHP A;  5LMN M;  1OJL A;  3I01 M;  2LH0 A;  3DZD A;  3FTC A;  3W68 A;  2FH0 A;  4RKU F;  2EO2 A;  1IBK M;  4PCZ A;  2F5S A;  1QYR A;  1NV8 A;  1OQY A;  3D8L A;  3SAT A;  4JI4 M;  4DR5 M;  3RGP A;  1R4G A;  3NBX X;  1QUS A;  1PJI A;  4LRT A;  4B08 A;  3U6M A;  2GQF A;  1N36 M;  3R9X B;  1R6B X;  1XWI A;  3UGJ A;  3U6S A;  4DV3 M;  1GO5 A;  1G4A E;  2KRK A;  2F5P A;  1XNQ M;  4GIT A;  5KO3 A;  1DGF A;  4LY6 A;  5IWA M;  3GP1 A;  3CF6 E;  4LJ5 A;  5EP2 A;  1H6U A;  4BLC A;  3GLF B;  3FD9 A;  4I4L A;  3GPY A;  2F5N A;  5GKN A;  3M6A A;  4CIS A;  3HZJ A;  3U60 A;  4LFC M;  4IBI A;  2D7H A;  3KOX E;  4R71 A;  1NY6 A;  2AHM A;  2QP9 X;  4K0K M;  1OFI A;  4OX9 M;  1HJP A;  2K47 A;  1JB0 F;  1ZAE A;  2LHC A;  3IEC A;  4HEO A;  2XSZ A;  5DYG A;  2LVN C;  4D82 A;  1IN7 A;  2KNZ A;  3QYE A;  2JXN A;  2XF3 A;  2XFT A;  2QEN A; 
#chains in the Genus database with same CATH homology
 1G3I A;  2DZL A;  1ZMV A;  2L4F A;  3T6P A;  2MGW A;  3H4J A;  2CWB A;  1OTR A;  2LTU A;  2LVO C;  2O25 A;  3MMP A;  1IFY A;  1DO2 A;  3GLI E;  3FRI A;  1WR1 B;  1KYI A;  2LBC A;  3GLF E;  2EKK A;  2ZTD A;  2EKF A;  4F2L A;  1YLA A;  1XXH E;  1WGN A;  3GLH E;  2QHO B;  3F92 A;  2KNV A;  3LCV B;  2H5X A;  2LVQ D;  1OAI A;  1UFZ A;  2QNJ A;  1VQ1 A;  2MJ5 B;  3FRH A;  1WIV A;  2HWJ A;  1ZMU A;  4G3O A;  3BBZ A;  3E46 A;  1HT2 E;  1F4I A;  1E94 E;  1MN3 A;  1VEG A;  1ZMW A;  2KHH A;  2DAE A;  1C7Y A;  2OOA A;  2LVA A;  2OOB A;  1P3Q Q;  2QSF X;  4GEW A;  1Y8G A;  1T43 A;  1Q02 A;  2ZTC A;  1HT1 E;  1VG5 A;  5JI2 E;  1NV9 A;  1WJ7 A;  4DBG B;  1TTE A;  3GLG E;  2DEN A;  2KNA A;  1DO0 A;  3B89 A;  1ZV1 A;  1HQY E;  2BWE A;  1OKS A;  1T6O A;  1PGY A;  2DAM A;  2OO9 A;  4Q7J A;  1JR3 E;  1IXS A;  1A5T A;  1CUK A;  2DKL A;  3LCU A;  2DHY A;  2DI0 A;  1AIP C;  4UN2 B;  2JY8 A;  2MR9 A;  1SG9 A;  2R0I A;  2L4E A;  2JUJ A;  4WP2 A;  2B3T A;  1VEJ A;  1IM2 A;  3IHP A;  1DV0 A;  2JY7 A;  1EFU B;  1WHC A;  1V92 A;  2RRU A;  1NV8 A;  1OQY A;  2DAK A;  3K9P A;  2DAG A;  1R4G A;  2JZ0 A;  2K9D A;  1GO5 A;  2JP7 A;  3FE3 A;  5DFL A;  1G4A E;  1QZE A;  1TR8 A;  2G3Q A;  2HAK A;  3E21 A;  2MRO B;  1G41 A;  2EJS A;  3K9O A;  2DNA A;  1VEK A;  4F1I A;  2WZJ A;  2JZ1 A;  2K0B X;  2JY5 A;  1WGL A;  2JY6 B;  2BWB A;  2L2D A;  4R71 A;  1XB2 B;  2LVP C;  1HJP A;  3IEC A;  4HEO A;  2LVN C;  1BVS A;  2CP8 A;  2KNZ A;  1VDL A;  2JNH A;  2DAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...