2RRUA

Solution structure of the uba omain of p62 and its interaction with ubiquitin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the UBA omain of p62 and its interaction with ubiquitin
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Sequestosome-1
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2rruA00
2DAIA 2LBCA 3F92A 1KYIA 2OOBA 1NV8A 2LVOC 1TR8A 2DENA 2QSFX 3GLFE 5JI2E 2MJ5B 3FE3A 1JR3E 1XXHE 4F1IA 2JY6B 1GO5A 1A5TA 2L2DA 1VEGA 1HQYE 3H4JA 2BWBA 1ZMUA 1OAIA 2ZTCA 1Q02A 1QZEA 1YLAA 2OO9A 1F4IA 1BVSA 1DO0A 2JZ1A 2HWJA 2L4EA 1E94E 1HT2E 1ZMVA 1VG5A 1NV9A 1ZMWA 2MROB 2OOAA 4DBGB 1PGYA 1TTEA 1SG9A 2CWBA 2DHYA 2G3QA 3FRHA 4Q7JA 2KNAA 1VQ1A 3B89A 2HAKA 2DAEA 1EFUB 2JY5A 2R0IA 2BWEA 2O25A 2WZJA 1WGLA 3BBZA 1HJPA 2DKLA 4GEWA 1G4AE 2L4FA 1OQYA 2DAGA 1IM2A 1VDLA 2KNZA 3LCUA 1WJ7A 2CP8A 1V92A 5DFLA 1G41A 1Y8GA 2K0BX 1C7YA 2JY8A 1ZV1A 1P3QQ 2B3TA 2JNHA 2MGWA 2LVNC 2MR9A 1T6OA 2DAKA 2QNJA 2KNVA 2DZLA 2LVPC 2LVQD 4WP2A 1WR1B 1IXSA 4HEOA 2JUJA 3K9PA 3E21A 1OKSA 3MMPA 1VEJA 2ZTDA 1WIVA 1HT1E 4UN2B 1CUKA 2EKKA 2EJSA 2H5XA 2K9DA 1AIPC 2EKFA 3E46A 2RRUA 2KHHA 2LVAA 1UFZA 3K9OA 1WHCA 1DO2A 2DNAA 1WGNA 3IHPA 2LTUA 3GLIE 1R4GA 1OTRA 3FRIA 2JY7A 1DV0A 2DI0A 3GLHE 3LCVB 3T6PA 1VEKA 4R71A 2JP7A 4F2LA 2QHOB 2JZ0A 1MN3A 4G3OA 2DAMA 1T43A 1G3IA 1IFYA 3GLGE 3IECA 1XB2B
chains in the Genus database with same CATH superfamily
2DAIA 3SFZA 2OOBA 2FNAA 2DENA 1X37A 1XNQM 4LG2A 2L6OA 4JN6A 4REZA 2HHHM 4KT0F 1E9SA 3J27B 1GO5A 3GPUA 1A5TA 2L2DA 3K2LA 2ZM6M 4P17A 3H4JA 4D80A 3JR5A 3TWMA 4RF0A 4GIPA 1IN8A 3DA1A 1NJGA 3L27A 1QZEA 1RU3A 3U6QA 1BVSA 4LJ7A 3I51A 2F5QA 3FTDA 4LJ4A 4LGMA 4LGYA 3SHFA 1YUBA 2CEAA 4G4NA 3AOGA 2K47A 4JYAM 1ZMVA 3KDSE 4IBFA 3PFIA 1H6UA 3A98B 1D0KA 1L8QA 5E6JA 2LHGA 1NSFA 1QUSA 3J2PB 4LZJA 1TTEA 1SG9A 2G3QA 3M0EA 5FTMA 3HJSA 4AZFA 2C9OA 1PJJA 2ZANA 4NXNM 3HZJA 1R5LA 3B7NA 1PM5A 2FS1A 3GQ3A 3U6DA 3CF6E 1XHBA 4HLQA 3HHYA 1WXQA 2J7OA 1IN6A 3I01M 1QANA 3I04M 3KVWA 3LW5F 2Z4SA 4I5SA 3GLHB 3UZUA 3KOYE 1L2DA 2AHMA 2V1CA 4GC5A 4XK8F 3UK6A 5F3WA 3NBIA 3HWSA 2JXNA 2D7GA 4DV7M 1FNNA 2Z8YM 2KZSA 4IIWA 4QOSA 3UMMA 1PJQA 3D8BA 1QVRA 4DV0M 4DV5M 3BXWA 2CHQA 4HL4A 4CISA 3GRUA 2F4VM 1I94M 5BPVA 1L2CA 1T6OA 2QNJA 3T1HM 2HL7A 4AW4A 4MB7A 5FTJA 3BOSA 2DZLA 1OJLA 2LVQD 4MGZE 2KXEA 2XEPA 1WR1B 4NSOB 5EP4A 5IWAM 3W0FA 1TDHA 1GKIA 2Z7JA 4DV2M 3K9PA 1OKSA 2D7EA 2Y0TA 4DV3M 2GQFA 2RGOA 4DUYM 1MU5A 4S12A 1N77A 2R4JA 3GQ5A 2FFJA 3IG8A 3LQQA 3U6LA 3GRRA 1OIZA 3GLIA 4UN2B 2H5XA 3T1YM 2C99A 4JI4M 4D81A 4AKIA 1IXSB 2R65A 3FUTA 1V34A 2RRUA 2VDBB 2KHHA 3TWKA 4JI8M 4X64M 5ITUA 3K9OA 3QYEA 4M0DA 1WHCA 1PJSA 3LVVA 3AOEA 3FD9A 3QYBA 4IBCA 4LRTA 4BB9A 4YHHM 1GL7A 3GPPA 3HHZA 4B3RM 1EIJA 5EQTA 4LF9M 3FUXA 3VKHA 4GITA 1TH2A 2R4EA 4L78A 4JI1M 2JY7A 5FTLA 3CF0A 4M9XA 5EXXA 2OQ4A 4L8RC 4JI7M 3C58A 1V33A 1OFHA 3RE8A 3TE6A 2JP7A 1J09A 1Z59A 1VDDA 3E4RA 4CGYB 3EIHA 4GKKM 4II7A 1T43A 3FKEA 2UU9M 3THGA 4NL4H 4M9SA 4CHTB 3FYCA 3IECA 1J7KA 4FCTA 3GLGE 2UXCM 2DZOB 2CFOA 1W5SA 3MJ5A 3J7AS 1SXJE 1TGUA 4JI3M 3AOEC 5DYIA 3SARA 2O01F 4LZZA 2QSFX 3GLFE 3KOWE 1QZMA 2MJ5B 4IBJA 3UGJA 5ITRA 1JR3E 1XXHE 2O5RA 1D0LA 1N75A 4AKGA 3J7BA 1W5TA 3L2AA 4AI6A 3L26A 2FE8A 3B74A 1HNWM 3GLIB 4NC6A 2EA0A 1R2YA 2UUBM 4AG6A 2VIIA 1YLAA 2OO9A 4OVZA 3SAWA 2DWLA 3QWLA 4B7FA 1TDZA 2HWJA 2L4EA 1EE8A 3B7ZA 1N32M 4JXJA 1E94E 1HT2E 3VFDA 3PNYA 3U60A 4M9ZA 2J5YA 3HU1A 4NSRA 3UJNA 4B3TM 5EXPA 3KS4A 3A42A 3SMPA 3H4MA 4I8OA 4LF6M 3Q8GA 2FOIC 2XLJA 4LF8M 1OFIA 2WSFF 1N36M 2QCUA 4Q7JA 1VQ1A 3AV0A 2HAKA 3KW6A 2JY5A 1EFUB 2R0IA 1XWIA 2O25A 2XF3A 3RGSA 1GL6A 2WZJA 2YNMD 4LJ9A 1HJPA 4GEWA 4MGKE 3U6MA 2R18A 2YR0A 4NXMM 1G4AE 2L4FA 1OQYA 2BJWA 2QBYB 5FSWA 4LFAM 4PDIA 1IM2A 5JI3E 1VDLA 2KNZA 4LF5M 5EP2A 3SYLA 2YQZA 2CP8A 4LF4M 2APLA 5KQDA 3AFHA 5IT9S 4G4QA 3VLFB 3M6AA 1G41A 4JI2M 4NRVA 1NHGC 1Z5CA 5KPTA 1Z5BA 3SC3A 2CV0A 2KEBA 3J80S 5E26A 2RGHA 4P16A 1L1TA 3AL0C 2JA2A 2VF7A 4DR4M 2R62A 3SATA 4B7HA 4PD2A 1KFVA 2V1UA 4HEOA 2V6ZM 3E21A 3MMPA 4Z8XA 4AKHA 3W67A 3B9PA 4GMQA 4GC9A 4PDGA 1VEJA 2ZTDA 3W0LB 4QOZC 1ZAEA 1HT1E 4DR6M 2EKKA 2MH8A 3GPYA 4DR3M 2K6BA 2EKFA 5BR8M 3E46A 5ITXA 4DR1M 3QAUA 3L25A 2LXEA 4IBEA 3TWLA 3GP1A 3L28A 2R45A 4OX9M 1WGNA 2FH0A 3LMMA 1E32A 3GLIE 1R4GA 3NBXX 3EIEA 4L15A 4PCZA 2Z4RA 3IG5A 3M7GA 2RKOA 4WW0A 5KQ8A 1GJSA 4DV6M 2CHGA 2CE7A 3T6PA 3U6OA 1VEKA 1NJFA 4IJEA 4KLNA 4F2LA 2L7HA 3HGIA 1MN3A 2XH9A 4X66M 5IZ7D 4FVMA 1ORYB 1K3WA 2Y20A 4IBIA 4LRSA 2R6FA 2X49A 4MM3B 4L16A 4TUWA 3F92A 4LJAA 2XZUA 1KYIA 3GLGB 5LMUM 2QQ8A 1NV8A 2DWNA 2LVOC 1GVNA 3FUVA 3TQSA 2C5RA 2C9CA 3HY5A 5GKNA 4YY3M 4KO8A 3E9SA 4F1IA 2JY6B 4BBAA 5KO3A 1I4WA 4FCWA 1N33M 2JWSA 3FTEA 3GLGA 1DGHA 4BLCA 2ERCA 5ITXE 3VDPA 5FTNA 1ZMUA 4R3DA 2ZTCA 5EP1A 1YSYA 3FTCA 4OU7A 1F4IA 3K92A 5KPRA 2QENA 3KP0E 4MGYE 3V76A 5C18A 3GO8A 2OPFA 3VK7A 4K0KM 4RNAA 3SYKA 5EJCA 3NWLA 1HNZM 3LQRA 2I7NA 1L2BA 1NV9A 1TH4A 1GABA 3U61A 1ZMWA 2DZNB 3W68A 4RF1A 5DNYA 2BNKA 1LV7A 1GLNA 2ZAMA 5C1BA 2OOAA 2X4AA 4DBGB 4X65M 1QDTA 2DVWB 1IBLM 4B3SM 1Q3BA 2CWBA 3FRHA 4MGHA 2DAEA 5H37D 2BWEA 1Z6TA 1IFYA 1DGGA 1WGLA 1IY1A 1UM8A 3BBZA 1K82A 2P5TA 3L29A 4ANRA 1JB0F 4FW9A 4XBOA 1NO1A 2KA6B 2L7IA 2DAGA 2XSZA 1Q3CA 2CUZA 4Y28F 2Z3XA 2VF8A 3K8ZA 1QAMA 2CRUA 2XFTA 3LCUA 4GRIA 2UXBM 1R6BX 1IXZA 3SASA 2Y0QA 1QUTA 4FWHA 1Y8GA 3DOAA 5DFLA 2VQFM 3RGPA 4LJ5A 2Y21A 4RKUF 2JY8A 4R7GA 1C7YA 1ZV1A 1P3QQ 3U6EA 2B3TA 1XXHB 3Q8XA 1SXJB 5FTKA 4Z6YA 3C9PA 2MR9A 1PRBA 2DAKA 3U6CA 4JI6M 3GLFB 3HU2A 2KNVA 5EP3A 3KP1E 3U5ZA 1QAQA 3SMSA 4WP2A 4JI5M 2L09A 2J7NA 1IXSA 3LVWA 8CATA 5KPZA 1NY5A 4LFCM 5ITYA 1XXHA 3PNVA 1LTMA 1DGFA 2D7HA 3A46A 1TH3A 4FD2A 2G5GX 4CIZA 4ITQA 1CUKA 1PJTA 2EJSA 2UXDM 2M5ZA 3CTWB 1AIPC 1SXJC 4AG5A 4D82A 2Q2EB 2LVAA 2EUCA 2KRUA 1NVMA 3GQ4A 3SAVA 3ZH9B 2F5PA 2XGNA 4GH9A 2G8LA 2DNAA 1S3SA 3IHPA 2LTUA 1AUAA 7CATA 1R2ZA 1OTRA 2LWXA 3FRIA 1DV0A 3LCVB 5EXSA 3RFWA 3FTFA 1N78A 1ZQ9A 4DR5M 2CV2A 3KOXE 1FJGM 4R71A 3U60B 3KXEC 4JV5M 1IY2A 1IBMM 2NQ8C 4L6V6 4GHAA 1JR3D 1G3IA 2H1RA 4OVZB 1KSFX 4MGIE 3U61B 1Q39A 3DZDA 4FWGA 4B7GA 2LBCA 4G4OA 1SXJD 1HQCA 1OIPA 2KDLA 1TR8A 4IBDA 2XFSA 5JI2E 2LNHC 3KOZE 3MK6A 4QNMA 3C3DA 1G59A 3FE3A 4FCVA 1HR0M 1DGBA 3K1JA 1Z5AA 1DGHB 2YFQA 1VEGA 4IBBA 1HQYE 5L8RF 3GLHA 2BWBA 1G8PA 3A45A 4X62M 4GHLA 1OAIA 1Q02A 1NY6A 1R7RA 2XZFA 1QAOA 3KS8A 3C3EA 4WURA 5DYGA 3GRYA 2VQEM 2KRKA 1DO0A 1OAOC 3FUWA 4QNRA 2JZ1A 5ITTA 2F5SA 1XNRM 1GJTA 4XGIA 4G4RA 1XMQM 4I4LA 2HKJA 4B3MM 4L4UA 3PXGA 4QHTA 1VG5A 1IXRC 3U5ZB 1L1ZA 2UUCM 3D8LA 4CJ6A 3R8FA 2DXIA 5IREB 2DHRA 3T38A 4LJ8A 3FYDA 5LMNM 2F5OA 2QZ4A 2MROB 2W82A 2LHCA 1PGYA 2DHYA 3HJQA 2M60A 1K3XA 2F5NA 2KNAA 3B89A 4DV4M 3T15A 1YE9A 4IJFA 4JI0M 5EXTA 2HCBA 2KZUA 2QPAA 2DKLA 4KODA 2BJVA 3HHWA 4MH0E 3SHGB 3GLFA 3ZC7B 4AQYM 5ITQA 1NNJA 3R9XB 2WSEF 2R46A 3TL4X 1SXJA 2DWZB 2XSZD 1C1KA 2QP9X 4FWDA 1WJ7A 1QYRA 1NHWC 1JR3A 1QDRA 3WHKA 1N34M 1V92A 2K0BX 4IBKA 2C98A 1T3TA 1PJIA 3HX3A 4GKJM 4LY6A 2CV1A 3ILKA 1IY0A 4DV1M 2JNHA 1QQWA 3JR4A 3KSXA 3SBJA 4I81A 1E9RA 2LVNC 2MGWA 2R44A 5FLXS 1TF0B 4NOOB 4ZPXA 3OTOM 3U6PA 4DR7M 2C96A 3TPZA 1J5EM 2LVPC 1XC8A 1D2NA 3ZCBB 2ZAOA 2N35A 3HJ8A 4M0WA 2JUJA 2A5YB 4EIWA 2KW0A 4OW0A 3KSJA 1IN4A 1MJGM 4A3VB 2I7PA 2WSCF 4QHSA 3SAUA 1JQJC 3PVSA 1IN7A 1WIVA 4W5WA 3VK8A 3AJIB 2DWMA 2K9DA 3U6SA 1MX0A 3CF2A 1IQPA 2EO2A 3JAMS 4KHPM 1HNXM 3CGWA 4B08A 1NNUC 3KFUG 1UFZA 2GNOA 1DO2A 3MHVC 3J81S 2X8AA 3HHXA 2QBYA 4NRWA 4LFBM 1D0MA 2UUAM 3FUUA 4DR2M 1IN5A 4PT5A 4G6ZA 3VDUA 4DUZM 2LH0A 1IBKM 2E5LM 3DFZA 2DI0A 3GLHE 3VKGA 3I4YA 4LF7M 2ZBKB 3GRVA 4LJ6A 3AKZA 3B7QA 5A2QS 3WHLA 3ZQJA 2QHOB 3GPXA 2JZ0A 3HKPA 4G3OA 1G71A 2DAMA 4LCBA 1XMOM 4IBGA 2CHVA 3HU3A 3I4VA 1XB2B
chains in the Genus database with same CATH topology
2DAIA 2LBCA 3F92A 1KYIA 2OOBA 1NV8A 2LVOC 1TR8A 2DENA 2QSFX 3GLFE 5JI2E 2MJ5B 3FE3A 1JR3E 1XXHE 4F1IA 2JY6B 1GO5A 1A5TA 2L2DA 1VEGA 1HQYE 3H4JA 2BWBA 1ZMUA 1OAIA 2ZTCA 1Q02A 1QZEA 1YLAA 2OO9A 1F4IA 1BVSA 1DO0A 2JZ1A 2HWJA 2L4EA 1E94E 1HT2E 1ZMVA 1VG5A 1NV9A 1ZMWA 2MROB 2OOAA 4DBGB 1PGYA 1TTEA 1SG9A 2CWBA 2DHYA 2G3QA 3FRHA 4Q7JA 2KNAA 1VQ1A 3B89A 2HAKA 2DAEA 1EFUB 2JY5A 2R0IA 2BWEA 2O25A 2WZJA 1WGLA 3BBZA 1HJPA 2DKLA 4GEWA 1G4AE 2L4FA 1OQYA 2DAGA 1IM2A 1VDLA 2KNZA 3LCUA 1WJ7A 2CP8A 1V92A 5DFLA 1G41A 1Y8GA 2K0BX 1C7YA 2JY8A 1ZV1A 1P3QQ 2B3TA 2JNHA 2MGWA 2LVNC 2MR9A 1T6OA 2DAKA 2QNJA 2KNVA 2DZLA 2LVPC 2LVQD 4WP2A 1WR1B 1IXSA 4HEOA 2JUJA 3K9PA 3E21A 1OKSA 3MMPA 1VEJA 2ZTDA 1WIVA 1HT1E 4UN2B 1CUKA 2EKKA 2EJSA 2H5XA 2K9DA 1AIPC 2EKFA 3E46A 2RRUA 2KHHA 2LVAA 1UFZA 3K9OA 1WHCA 1DO2A 2DNAA 1WGNA 3IHPA 2LTUA 3GLIE 1R4GA 1OTRA 3FRIA 2JY7A 1DV0A 2DI0A 3GLHE 3LCVB 3T6PA 1VEKA 4R71A 2JP7A 4F2LA 2QHOB 2JZ0A 1MN3A 4G3OA 2DAMA 1T43A 1G3IA 1IFYA 3GLGE 3IECA 1XB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAI A;  2LBC A;  3F92 A;  1KYI A;  2OOB A;  1NV8 A;  2LVO C;  1TR8 A;  2DEN A;  2QSF X;  3GLF E;  5JI2 E;  2MJ5 B;  3FE3 A;  1JR3 E;  1XXH E;  4F1I A;  2JY6 B;  1GO5 A;  1A5T A;  2L2D A;  1VEG A;  1HQY E;  3H4J A;  2BWB A;  1ZMU A;  1OAI A;  2ZTC A;  1Q02 A;  1QZE A;  1YLA A;  2OO9 A;  1F4I A;  1BVS A;  1DO0 A;  2JZ1 A;  2HWJ A;  2L4E A;  1E94 E;  1HT2 E;  1ZMV A;  1VG5 A;  1NV9 A;  1ZMW A;  2MRO B;  2OOA A;  4DBG B;  1PGY A;  1TTE A;  1SG9 A;  2CWB A;  2DHY A;  2G3Q A;  3FRH A;  4Q7J A;  2KNA A;  1VQ1 A;  3B89 A;  2HAK A;  2DAE A;  1EFU B;  2JY5 A;  2R0I A;  2BWE A;  2O25 A;  2WZJ A;  1WGL A;  3BBZ A;  1HJP A;  2DKL A;  4GEW A;  1G4A E;  2L4F A;  1OQY A;  2DAG A;  1IM2 A;  1VDL A;  2KNZ A;  3LCU A;  1WJ7 A;  2CP8 A;  1V92 A;  5DFL A;  1G41 A;  1Y8G A;  2K0B X;  1C7Y A;  2JY8 A;  1ZV1 A;  1P3Q Q;  2B3T A;  2JNH A;  2MGW A;  2LVN C;  2MR9 A;  1T6O A;  2DAK A;  2QNJ A;  2KNV A;  2DZL A;  2LVP C;  2LVQ D;  4WP2 A;  1WR1 B;  1IXS A;  4HEO A;  2JUJ A;  3K9P A;  3E21 A;  1OKS A;  3MMP A;  1VEJ A;  2ZTD A;  1WIV A;  1HT1 E;  4UN2 B;  1CUK A;  2EKK A;  2EJS A;  2H5X A;  2K9D A;  1AIP C;  2EKF A;  3E46 A;  2RRU A;  2KHH A;  2LVA A;  1UFZ A;  3K9O A;  1WHC A;  1DO2 A;  2DNA A;  1WGN A;  3IHP A;  2LTU A;  3GLI E;  1R4G A;  1OTR A;  3FRI A;  2JY7 A;  1DV0 A;  2DI0 A;  3GLH E;  3LCV B;  3T6P A;  1VEK A;  4R71 A;  2JP7 A;  4F2L A;  2QHO B;  2JZ0 A;  1MN3 A;  4G3O A;  2DAM A;  1T43 A;  1G3I A;  1IFY A;  3GLG E;  3IEC A;  1XB2 B; 
#chains in the Genus database with same CATH topology
 2DAI A;  3SFZ A;  2OOB A;  2FNA A;  2DEN A;  1X37 A;  1XNQ M;  4LG2 A;  2L6O A;  4JN6 A;  4REZ A;  2HHH M;  4KT0 F;  1E9S A;  3J27 B;  1GO5 A;  3GPU A;  1A5T A;  2L2D A;  3K2L A;  2ZM6 M;  4P17 A;  3H4J A;  4D80 A;  3JR5 A;  3TWM A;  4RF0 A;  4GIP A;  1IN8 A;  3DA1 A;  1NJG A;  3L27 A;  1QZE A;  1RU3 A;  3U6Q A;  1BVS A;  4LJ7 A;  3I51 A;  2F5Q A;  3FTD A;  4LJ4 A;  4LGM A;  4LGY A;  3SHF A;  1YUB A;  2CEA A;  4G4N A;  3AOG A;  2K47 A;  4JYA M;  1ZMV A;  3KDS E;  4IBF A;  3PFI A;  1H6U A;  3A98 B;  1D0K A;  1L8Q A;  5E6J A;  2LHG A;  1NSF A;  1QUS A;  3J2P B;  4LZJ A;  1TTE A;  1SG9 A;  2G3Q A;  3M0E A;  5FTM A;  3HJS A;  4AZF A;  2C9O A;  1PJJ A;  2ZAN A;  4NXN M;  3HZJ A;  1R5L A;  3B7N A;  1PM5 A;  2FS1 A;  3GQ3 A;  3U6D A;  3CF6 E;  1XHB A;  4HLQ A;  3HHY A;  1WXQ A;  2J7O A;  1IN6 A;  3I01 M;  1QAN A;  3I04 M;  3KVW A;  3LW5 F;  2Z4S A;  4I5S A;  3GLH B;  3UZU A;  3KOY E;  1L2D A;  2AHM A;  2V1C A;  4GC5 A;  4XK8 F;  3UK6 A;  5F3W A;  3NBI A;  3HWS A;  2JXN A;  2D7G A;  4DV7 M;  1FNN A;  2Z8Y M;  2KZS A;  4IIW A;  4QOS A;  3UMM A;  1PJQ A;  3D8B A;  1QVR A;  4DV0 M;  4DV5 M;  3BXW A;  2CHQ A;  4HL4 A;  4CIS A;  3GRU A;  2F4V M;  1I94 M;  5BPV A;  1L2C A;  1T6O A;  2QNJ A;  3T1H M;  2HL7 A;  4AW4 A;  4MB7 A;  5FTJ A;  3BOS A;  2DZL A;  1OJL A;  2LVQ D;  4MGZ E;  2KXE A;  2XEP A;  1WR1 B;  4NSO B;  5EP4 A;  5IWA M;  3W0F A;  1TDH A;  1GKI A;  2Z7J A;  4DV2 M;  3K9P A;  1OKS A;  2D7E A;  2Y0T A;  4DV3 M;  2GQF A;  2RGO A;  4DUY M;  1MU5 A;  4S12 A;  1N77 A;  2R4J A;  3GQ5 A;  2FFJ A;  3IG8 A;  3LQQ A;  3U6L A;  3GRR A;  1OIZ A;  3GLI A;  4UN2 B;  2H5X A;  3T1Y M;  2C99 A;  4JI4 M;  4D81 A;  4AKI A;  1IXS B;  2R65 A;  3FUT A;  1V34 A;  2RRU A;  2VDB B;  2KHH A;  3TWK A;  4JI8 M;  4X64 M;  5ITU A;  3K9O A;  3QYE A;  4M0D A;  1WHC A;  1PJS A;  3LVV A;  3AOE A;  3FD9 A;  3QYB A;  4IBC A;  4LRT A;  4BB9 A;  4YHH M;  1GL7 A;  3GPP A;  3HHZ A;  4B3R M;  1EIJ A;  5EQT A;  4LF9 M;  3FUX A;  3VKH A;  4GIT A;  1TH2 A;  2R4E A;  4L78 A;  4JI1 M;  2JY7 A;  5FTL A;  3CF0 A;  4M9X A;  5EXX A;  2OQ4 A;  4L8R C;  4JI7 M;  3C58 A;  1V33 A;  1OFH A;  3RE8 A;  3TE6 A;  2JP7 A;  1J09 A;  1Z59 A;  1VDD A;  3E4R A;  4CGY B;  3EIH A;  4GKK M;  4II7 A;  1T43 A;  3FKE A;  2UU9 M;  3THG A;  4NL4 H;  4M9S A;  4CHT B;  3FYC A;  3IEC A;  1J7K A;  4FCT A;  3GLG E;  2UXC M;  2DZO B;  2CFO A;  1W5S A;  3MJ5 A;  3J7A S;  1SXJ E;  1TGU A;  4JI3 M;  3AOE C;  5DYI A;  3SAR A;  2O01 F;  4LZZ A;  2QSF X;  3GLF E;  3KOW E;  1QZM A;  2MJ5 B;  4IBJ A;  3UGJ A;  5ITR A;  1JR3 E;  1XXH E;  2O5R A;  1D0L A;  1N75 A;  4AKG A;  3J7B A;  1W5T A;  3L2A A;  4AI6 A;  3L26 A;  2FE8 A;  3B74 A;  1HNW M;  3GLI B;  4NC6 A;  2EA0 A;  1R2Y A;  2UUB M;  4AG6 A;  2VII A;  1YLA A;  2OO9 A;  4OVZ A;  3SAW A;  2DWL A;  3QWL A;  4B7F A;  1TDZ A;  2HWJ A;  2L4E A;  1EE8 A;  3B7Z A;  1N32 M;  4JXJ A;  1E94 E;  1HT2 E;  3VFD A;  3PNY A;  3U60 A;  4M9Z A;  2J5Y A;  3HU1 A;  4NSR A;  3UJN A;  4B3T M;  5EXP A;  3KS4 A;  3A42 A;  3SMP A;  3H4M A;  4I8O A;  4LF6 M;  3Q8G A;  2FOI C;  2XLJ A;  4LF8 M;  1OFI A;  2WSF F;  1N36 M;  2QCU A;  4Q7J A;  1VQ1 A;  3AV0 A;  2HAK A;  3KW6 A;  2JY5 A;  1EFU B;  2R0I A;  1XWI A;  2O25 A;  2XF3 A;  3RGS A;  1GL6 A;  2WZJ A;  2YNM D;  4LJ9 A;  1HJP A;  4GEW A;  4MGK E;  3U6M A;  2R18 A;  2YR0 A;  4NXM M;  1G4A E;  2L4F A;  1OQY A;  2BJW A;  2QBY B;  5FSW A;  4LFA M;  4PDI A;  1IM2 A;  5JI3 E;  1VDL A;  2KNZ A;  4LF5 M;  5EP2 A;  3SYL A;  2YQZ A;  2CP8 A;  4LF4 M;  2APL A;  5KQD A;  3AFH A;  5IT9 S;  4G4Q A;  3VLF B;  3M6A A;  1G41 A;  4JI2 M;  4NRV A;  1NHG C;  1Z5C A;  5KPT A;  1Z5B A;  3SC3 A;  2CV0 A;  2KEB A;  3J80 S;  5E26 A;  2RGH A;  4P16 A;  1L1T A;  3AL0 C;  2JA2 A;  2VF7 A;  4DR4 M;  2R62 A;  3SAT A;  4B7H A;  4PD2 A;  1KFV A;  2V1U A;  4HEO A;  2V6Z M;  3E21 A;  3MMP A;  4Z8X A;  4AKH A;  3W67 A;  3B9P A;  4GMQ A;  4GC9 A;  4PDG A;  1VEJ A;  2ZTD A;  3W0L B;  4QOZ C;  1ZAE A;  1HT1 E;  4DR6 M;  2EKK A;  2MH8 A;  3GPY A;  4DR3 M;  2K6B A;  2EKF A;  5BR8 M;  3E46 A;  5ITX A;  4DR1 M;  3QAU A;  3L25 A;  2LXE A;  4IBE A;  3TWL A;  3GP1 A;  3L28 A;  2R45 A;  4OX9 M;  1WGN A;  2FH0 A;  3LMM A;  1E32 A;  3GLI E;  1R4G A;  3NBX X;  3EIE A;  4L15 A;  4PCZ A;  2Z4R A;  3IG5 A;  3M7G A;  2RKO A;  4WW0 A;  5KQ8 A;  1GJS A;  4DV6 M;  2CHG A;  2CE7 A;  3T6P A;  3U6O A;  1VEK A;  1NJF A;  4IJE A;  4KLN A;  4F2L A;  2L7H A;  3HGI A;  1MN3 A;  2XH9 A;  4X66 M;  5IZ7 D;  4FVM A;  1ORY B;  1K3W A;  2Y20 A;  4IBI A;  4LRS A;  2R6F A;  2X49 A;  4MM3 B;  4L16 A;  4TUW A;  3F92 A;  4LJA A;  2XZU A;  1KYI A;  3GLG B;  5LMU M;  2QQ8 A;  1NV8 A;  2DWN A;  2LVO C;  1GVN A;  3FUV A;  3TQS A;  2C5R A;  2C9C A;  3HY5 A;  5GKN A;  4YY3 M;  4KO8 A;  3E9S A;  4F1I A;  2JY6 B;  4BBA A;  5KO3 A;  1I4W A;  4FCW A;  1N33 M;  2JWS A;  3FTE A;  3GLG A;  1DGH A;  4BLC A;  2ERC A;  5ITX E;  3VDP A;  5FTN A;  1ZMU A;  4R3D A;  2ZTC A;  5EP1 A;  1YSY A;  3FTC A;  4OU7 A;  1F4I A;  3K92 A;  5KPR A;  2QEN A;  3KP0 E;  4MGY E;  3V76 A;  5C18 A;  3GO8 A;  2OPF A;  3VK7 A;  4K0K M;  4RNA A;  3SYK A;  5EJC A;  3NWL A;  1HNZ M;  3LQR A;  2I7N A;  1L2B A;  1NV9 A;  1TH4 A;  1GAB A;  3U61 A;  1ZMW A;  2DZN B;  3W68 A;  4RF1 A;  5DNY A;  2BNK A;  1LV7 A;  1GLN A;  2ZAM A;  5C1B A;  2OOA A;  2X4A A;  4DBG B;  4X65 M;  1QDT A;  2DVW B;  1IBL M;  4B3S M;  1Q3B A;  2CWB A;  3FRH A;  4MGH A;  2DAE A;  5H37 D;  2BWE A;  1Z6T A;  1IFY A;  1DGG A;  1WGL A;  1IY1 A;  1UM8 A;  3BBZ A;  1K82 A;  2P5T A;  3L29 A;  4ANR A;  1JB0 F;  4FW9 A;  4XBO A;  1NO1 A;  2KA6 B;  2L7I A;  2DAG A;  2XSZ A;  1Q3C A;  2CUZ A;  4Y28 F;  2Z3X A;  2VF8 A;  3K8Z A;  1QAM A;  2CRU A;  2XFT A;  3LCU A;  4GRI A;  2UXB M;  1R6B X;  1IXZ A;  3SAS A;  2Y0Q A;  1QUT A;  4FWH A;  1Y8G A;  3DOA A;  5DFL A;  2VQF M;  3RGP A;  4LJ5 A;  2Y21 A;  4RKU F;  2JY8 A;  4R7G A;  1C7Y A;  1ZV1 A;  1P3Q Q;  3U6E A;  2B3T A;  1XXH B;  3Q8X A;  1SXJ B;  5FTK A;  4Z6Y A;  3C9P A;  2MR9 A;  1PRB A;  2DAK A;  3U6C A;  4JI6 M;  3GLF B;  3HU2 A;  2KNV A;  5EP3 A;  3KP1 E;  3U5Z A;  1QAQ A;  3SMS A;  4WP2 A;  4JI5 M;  2L09 A;  2J7N A;  1IXS A;  3LVW A;  8CAT A;  5KPZ A;  1NY5 A;  4LFC M;  5ITY A;  1XXH A;  3PNV A;  1LTM A;  1DGF A;  2D7H A;  3A46 A;  1TH3 A;  4FD2 A;  2G5G X;  4CIZ A;  4ITQ A;  1CUK A;  1PJT A;  2EJS A;  2UXD M;  2M5Z A;  3CTW B;  1AIP C;  1SXJ C;  4AG5 A;  4D82 A;  2Q2E B;  2LVA A;  2EUC A;  2KRU A;  1NVM A;  3GQ4 A;  3SAV A;  3ZH9 B;  2F5P A;  2XGN A;  4GH9 A;  2G8L A;  2DNA A;  1S3S A;  3IHP A;  2LTU A;  1AUA A;  7CAT A;  1R2Z A;  1OTR A;  2LWX A;  3FRI A;  1DV0 A;  3LCV B;  5EXS A;  3RFW A;  3FTF A;  1N78 A;  1ZQ9 A;  4DR5 M;  2CV2 A;  3KOX E;  1FJG M;  4R71 A;  3U60 B;  3KXE C;  4JV5 M;  1IY2 A;  1IBM M;  2NQ8 C;  4L6V 6;  4GHA A;  1JR3 D;  1G3I A;  2H1R A;  4OVZ B;  1KSF X;  4MGI E;  3U61 B;  1Q39 A;  3DZD A;  4FWG A;  4B7G A;  2LBC A;  4G4O A;  1SXJ D;  1HQC A;  1OIP A;  2KDL A;  1TR8 A;  4IBD A;  2XFS A;  5JI2 E;  2LNH C;  3KOZ E;  3MK6 A;  4QNM A;  3C3D A;  1G59 A;  3FE3 A;  4FCV A;  1HR0 M;  1DGB A;  3K1J A;  1Z5A A;  1DGH B;  2YFQ A;  1VEG A;  4IBB A;  1HQY E;  5L8R F;  3GLH A;  2BWB A;  1G8P A;  3A45 A;  4X62 M;  4GHL A;  1OAI A;  1Q02 A;  1NY6 A;  1R7R A;  2XZF A;  1QAO A;  3KS8 A;  3C3E A;  4WUR A;  5DYG A;  3GRY A;  2VQE M;  2KRK A;  1DO0 A;  1OAO C;  3FUW A;  4QNR A;  2JZ1 A;  5ITT A;  2F5S A;  1XNR M;  1GJT A;  4XGI A;  4G4R A;  1XMQ M;  4I4L A;  2HKJ A;  4B3M M;  4L4U A;  3PXG A;  4QHT A;  1VG5 A;  1IXR C;  3U5Z B;  1L1Z A;  2UUC M;  3D8L A;  4CJ6 A;  3R8F A;  2DXI A;  5IRE B;  2DHR A;  3T38 A;  4LJ8 A;  3FYD A;  5LMN M;  2F5O A;  2QZ4 A;  2MRO B;  2W82 A;  2LHC A;  1PGY A;  2DHY A;  3HJQ A;  2M60 A;  1K3X A;  2F5N A;  2KNA A;  3B89 A;  4DV4 M;  3T15 A;  1YE9 A;  4IJF A;  4JI0 M;  5EXT A;  2HCB A;  2KZU A;  2QPA A;  2DKL A;  4KOD A;  2BJV A;  3HHW A;  4MH0 E;  3SHG B;  3GLF A;  3ZC7 B;  4AQY M;  5ITQ A;  1NNJ A;  3R9X B;  2WSE F;  2R46 A;  3TL4 X;  1SXJ A;  2DWZ B;  2XSZ D;  1C1K A;  2QP9 X;  4FWD A;  1WJ7 A;  1QYR A;  1NHW C;  1JR3 A;  1QDR A;  3WHK A;  1N34 M;  1V92 A;  2K0B X;  4IBK A;  2C98 A;  1T3T A;  1PJI A;  3HX3 A;  4GKJ M;  4LY6 A;  2CV1 A;  3ILK A;  1IY0 A;  4DV1 M;  2JNH A;  1QQW A;  3JR4 A;  3KSX A;  3SBJ A;  4I81 A;  1E9R A;  2LVN C;  2MGW A;  2R44 A;  5FLX S;  1TF0 B;  4NOO B;  4ZPX A;  3OTO M;  3U6P A;  4DR7 M;  2C96 A;  3TPZ A;  1J5E M;  2LVP C;  1XC8 A;  1D2N A;  3ZCB B;  2ZAO A;  2N35 A;  3HJ8 A;  4M0W A;  2JUJ A;  2A5Y B;  4EIW A;  2KW0 A;  4OW0 A;  3KSJ A;  1IN4 A;  1MJG M;  4A3V B;  2I7P A;  2WSC F;  4QHS A;  3SAU A;  1JQJ C;  3PVS A;  1IN7 A;  1WIV A;  4W5W A;  3VK8 A;  3AJI B;  2DWM A;  2K9D A;  3U6S A;  1MX0 A;  3CF2 A;  1IQP A;  2EO2 A;  3JAM S;  4KHP M;  1HNX M;  3CGW A;  4B08 A;  1NNU C;  3KFU G;  1UFZ A;  2GNO A;  1DO2 A;  3MHV C;  3J81 S;  2X8A A;  3HHX A;  2QBY A;  4NRW A;  4LFB M;  1D0M A;  2UUA M;  3FUU A;  4DR2 M;  1IN5 A;  4PT5 A;  4G6Z A;  3VDU A;  4DUZ M;  2LH0 A;  1IBK M;  2E5L M;  3DFZ A;  2DI0 A;  3GLH E;  3VKG A;  3I4Y A;  4LF7 M;  2ZBK B;  3GRV A;  4LJ6 A;  3AKZ A;  3B7Q A;  5A2Q S;  3WHL A;  3ZQJ A;  2QHO B;  3GPX A;  2JZ0 A;  3HKP A;  4G3O A;  1G71 A;  2DAM A;  4LCB A;  1XMO M;  4IBG A;  2CHV A;  3HU3 A;  3I4V A;  1XB2 B; 
#chains in the Genus database with same CATH homology
 2DAI A;  2LBC A;  3F92 A;  1KYI A;  2OOB A;  1NV8 A;  2LVO C;  1TR8 A;  2DEN A;  2QSF X;  3GLF E;  5JI2 E;  2MJ5 B;  3FE3 A;  1JR3 E;  1XXH E;  4F1I A;  2JY6 B;  1GO5 A;  1A5T A;  2L2D A;  1VEG A;  1HQY E;  3H4J A;  2BWB A;  1ZMU A;  1OAI A;  2ZTC A;  1Q02 A;  1QZE A;  1YLA A;  2OO9 A;  1F4I A;  1BVS A;  1DO0 A;  2JZ1 A;  2HWJ A;  2L4E A;  1E94 E;  1HT2 E;  1ZMV A;  1VG5 A;  1NV9 A;  1ZMW A;  2MRO B;  2OOA A;  4DBG B;  1PGY A;  1TTE A;  1SG9 A;  2CWB A;  2DHY A;  2G3Q A;  3FRH A;  4Q7J A;  2KNA A;  1VQ1 A;  3B89 A;  2HAK A;  2DAE A;  1EFU B;  2JY5 A;  2R0I A;  2BWE A;  2O25 A;  2WZJ A;  1WGL A;  3BBZ A;  1HJP A;  2DKL A;  4GEW A;  1G4A E;  2L4F A;  1OQY A;  2DAG A;  1IM2 A;  1VDL A;  2KNZ A;  3LCU A;  1WJ7 A;  2CP8 A;  1V92 A;  5DFL A;  1G41 A;  1Y8G A;  2K0B X;  1C7Y A;  2JY8 A;  1ZV1 A;  1P3Q Q;  2B3T A;  2JNH A;  2MGW A;  2LVN C;  2MR9 A;  1T6O A;  2DAK A;  2QNJ A;  2KNV A;  2DZL A;  2LVP C;  2LVQ D;  4WP2 A;  1WR1 B;  1IXS A;  4HEO A;  2JUJ A;  3K9P A;  3E21 A;  1OKS A;  3MMP A;  1VEJ A;  2ZTD A;  1WIV A;  1HT1 E;  4UN2 B;  1CUK A;  2EKK A;  2EJS A;  2H5X A;  2K9D A;  1AIP C;  2EKF A;  3E46 A;  2RRU A;  2KHH A;  2LVA A;  1UFZ A;  3K9O A;  1WHC A;  1DO2 A;  2DNA A;  1WGN A;  3IHP A;  2LTU A;  3GLI E;  1R4G A;  1OTR A;  3FRI A;  2JY7 A;  1DV0 A;  2DI0 A;  3GLH E;  3LCV B;  3T6P A;  1VEK A;  4R71 A;  2JP7 A;  4F2L A;  2QHO B;  2JZ0 A;  1MN3 A;  4G3O A;  2DAM A;  1T43 A;  1G3I A;  1IFY A;  3GLG E;  3IEC A;  1XB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...