2RS11

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus sp.
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1100
3HAGA 1NCRB 1R081 4GB32 4WM8B 4RR3A 3NAPA 1NCQA 1TME2 2R073 1EV12 5K0UC 3VBOB 4YVWB 4NWWA 1FPN3 1RUG1 1RUE1 1AYN2 5C4WC 4CDWA 4RHV3 3TN93 1RUD2 1RUD1 4WM7C 4RQPC 2HWE1 4IV1C 1FOD2 2HWF3 2PLV1 1RVF3 1ND2C 4YVWC 1ND3B 2PLV2 5AC92 1AL23 1VBC1 4CEYB 2RS31 1V9U3 4WM8C 1HX6A 3J8F3 2WFF3 1NCRC 3ZFEC 3ZFFC 2FZ1A 3CJIA 4AEDA 4CDQB 2HWE3 2RS33 4FTBA 3VBUB 5BNOB 3VBHB 5ABJA 4QPIC 3VBFC 4IV1A 1C8M1 4RHV2 4CDWC 1ZBE1 1QJU1 5C8CA 1FPN2 3VBFB 1MQTA 5C4WA 1RUH1 4PDWB 5JZGB 1AYN3 1NY71 5BNOC 3VBUC 1NY72 5DDJ2 2X5IC 2WFF1 1AYM2 2HWE2 1VBA2 3VBUA 1VAKA 1OOPA 1B35A 3NAPC 1AUYA 3VDDA 1F8VA 4QPIA 1PO12 1V9U2 4CDUA 1POV0 1AR81 1ND3C 3VBHA 4SBVA 3S6PA 1ND2B 1MQTB 1VBE3 1HQNA 4IV1B 3VBRB 2RR11 5L7OB 5C8CB 4N53A 1AR92 1RUJ3 3TN92 5C4WB 1R092 1PIV2 5ACA2 1MEC2 1OPOA 2ZZQA 2MEV3 2WZR1 1HRV1 1BEV1 1TME3 2HWB1 1R1A3 4RS5B 4Q4Y2 2RM23 5CFDB 1NG0A 1MEC3 1RHI2 2R062 5K0UA 1AR73 1Z7S2 4GH4C 3JB8A 4N43C 1ZBE2 1QQP3 2RR13 3VBRC 1VBA1 2HWC2 5FMOL 1PGL2 1VBC2 3ZFGB 2HWD2 3IDEA 1F2NA 2HWC1 3J8F2 1VBD2 2FZ2A 3NAPB 2IZWA 1X33A 1VRH1 2QQPA 1RUF2 5ABJC 1HRV2 1ASJ3 2TBVA 1VRH2 5A32B 1NCRA 1RVF2 1FMD3 2X5IB 1VBA3 3ZFFA 1QJX3 4Q4V2 5JZGA 1BBT1 2GH8A 1RUH3 3VBOA 1QJU3 1TMF1 1TMF2 1COV3 5C9AC 3VDDB 1K5MA 1COV1 1SMVA 2RMU3 4Q4W2 5AC91 3FBMA 1PIV1 5ACA1 3JBG1 5BNNB 1RUI1 1B35C 1PVC3 3ZFFB 4GB33 1FOD1 4CDXB 3ZFEB 1AR62 1BBT3 3M8LA 2BFUL 5BNPB 4QPGC 1VBB3 1OOPC 4Q4X2 2WFF2 1A6CA 4Y4YA 1HXS3 3J8F1 1AR61 1RUG2 1RB8G 1AR82 2RMU1 5AC93 1X36A 4WM7B 1RVF1 5C9AA 4RS5A 1H8TC 3VBSA 1RUD3 4CEWA 1K5MB 1NA1C 4YVSC 4FTSA 2WLPA 3VBOC 4GMP0 1POV1 1PO21 4Q4X3 1FPN1 1QJY1 2RS12 1EV11 2R071 5CFCC 4NWVA 4YVSA 2WZR2 4JGYB 1EAH2 3ZFGA 1W39A 5BNPC 1C8M2 1R1A1 1AYM1 1PO22 3JBG3 2RS11 4RQPA 4JGZC 4CDUC 1RUI3 4CEWC 5BNNC 1ND3A 5A32A 4WM7A 3VDDC 1H8TA 3VBSC 4CEYA 5C9AB 1D4M3 1HRI3 1QJU2 1CD3G 2GSYA 4N43A 1ZBA2 1RMU3 3VBRA 5L7OA 1MEC1 1FMD1 1NCQC 4GH4A 1FMD2 1OHFA 4RR3C 1V9U1 1AR91 2XBO2 1CJDA 5D8AB 1BEV3 1TME1 1VRH3 2HWB3 2XBO3 2RS51 4IV3B 2XBO1 3JD71 4RR3B 1NCQB 1BBT2 1ZBA3 4Q4V1 3TN91 5J96B 1QJY3 1QQP2 4AEDC 1RUE3 1VB4A 1HRI2 5CFDA 4CDXA 2XPJA 1WCDJ 1QJY2 4BCUA 2RM21 1RUC2 4CDUB 3JD73 3JBG2 1BMV2 1NA1A 4FTEA 1ZBA1 4Q4V3 2WS93 4GMP1 1QJX2 4JGYC 2RS13 2WS91 4GMP3 5CFCB 1Z7S1 5FOJB 1R093 1RMU2 4YVSB 1PGL1 1AR93 4RFT0 4Q4Y1 3DPRB 3JD72 1PVC1 1E57A 1RUC3 2BUKA 1D4M2 5C8CC 4Z92B 2R042 5A33B 4AEDB 1RUI2 2HWD1 2R063 1RHI3 1EAH3 1VBB2 5BNPA 1M06G 2R041 4PDWA 2MEV1 2WWSA 2RM22 1AR63 4FSJA 4QPGB 4IV3C 1AYM3 1R082 3CJIC 4CDXC 1AYN1 1B35B 5D8AC 2R043 1RMU1 2ZAHA 4N53C 4PDWC 1COV2 3DPRA 1POV3 1PIV3 5ACA3 1D4M1 1RUJ2 1VBE1 4CDWB 4RHV1 1VB2A 5A33A 4QPIB 1RUG3 4N53B 1HXS2 4CEWB 1AR71 3CJIB 1PO13 1AL0G 2WS92 4QPGA 4GB31 4LLFA 1PO23 1R083 1PVC2 1GFF2 1VBB1 2PLV3 4CEYC 2HWF1 5DDJ1 2RMU2 1QJZA 4JGYA 1FOD3 2HWC3 1IHMA 2HWF2 5BNNA 5LK7B 1ZBE3 1NA1B 1TMF3 4Q4W3 4RQPB 1K5MC 4N43B 4JGZA 1H8TB 2BFUS 3DPRC 4Q4Y3 2BPA2 4WM8A 5CFDC 1BMV1 3ZFEA 1HXS1 1EV13 3JB4C 5K0UB 4Q4X1 1RUF3 4YVWA 1BEV2 1C8NA 2HWB2 5GKAC 1OOPB 1HRV3 1AL21 1ND2A 1RHI1 2R061 1VBD3 2HWD3 5J98B 2DF7A 1AL22 1RUJ1 1VBE2 5L7OC 2RR12 2X5IA 1QQP1 1MQTC 1RUE2 4Y5Z0 5BNOA 3LOBA 1RUH2 1C8M3 3ZXAC 1R091 1DDLA 2WZR3 4Q4W1 1ASJ1 1EAH1 4CDQA 1R1A2 5FMOS 2RS52 2RS53 5DDJ3 2BBVA 1RUF1 5ABJB 3VBFA 2R072 2MEV2 1ASJ2 1PGW1 5CFCA 5JZGC 1NOVA 3ZFGC 1RUC1 1PO11 1PGW2 5D8AA 1VBC3 1QJX1 1HRI1 4IV3A 1AR83 4GH4B 3VBSB 2RS32 4EJRA 3VBHC 1VBD1 1AR72 1Z7S3 2Y26A 2ZTNA 4CDQC 4JGZB 2VQ0A 4RS5C
chains in the Genus database with same CATH superfamily
4JQRA 3M70A 4LBMA 3TEYA 1DZRA 1R081 4BYYA 4E4SA 1G7YA 4RR3A 4NOTA 5FP9A 5FZ0A 1JBCA 5T3NA 1TME2 5IVEA 2ILMA 4EWEA 4J6GA 4KBBA 1JOBA 2BDRA 4P9YA 1MZFA 3U78A 3AL6A 5FZFA 4Y22B 4LBLA 4YVWB 4LXLA 1BCXA 1FPN3 2C0ZA 3I3QA 2V72A 5ANQA 4MVTA 1IS3A 1AYN2 5C4WC 4X6RB 4W8JA 5CAZA 3LFMA 3ACLA 3B02A 3J26N 4LITA 4FAHA 4XQ4A 2XJQA 1CAWA 1KS4A 1V70A 2JKXA 3H1YA 1RUD1 4W6XA 2AUYA 5FP4A 4ZXEA 1W9FA 4IV1C 2G1MA 5E88A 1LTEA 2D3RA 2BW8A 1W9YA 2HWF3 3SQOA 4CP9B 4QPWA 4D0QA 1RVF3 5GALA 1QDCA 3GDBA 1AL23 1UU5A 5IK7A 4E8DA 1S0FA 4DZGA 2DVAA 3VLBB 4QD2A 3DYMA 1OA3A 3KV6A 5FP3A 1ZRCA 2WFF3 4MGZE 4QGMA 4O9GA 1DG6A 3ZFEC 5JSPA 1FX5A 5FYUA 3H1WA 1SHWB 2FZ1A 3C7EA 2H6CA 4Q0PA 1QJFA 1WWYA 2YROA 1H2NA 5CKNA 4QM8A 3IBMA 1KITA 3A23A 1F5FA 3N9QA 3H7YA 4QXBA 3VBFC 3ITQA 2P3JA 4M4RA 4NVPA 3BUCA 2HYKA 4D3WA 1DP0A 2DWRA 3V0BB 5C8CA 3OD0A 4KG8A 4HVOA 3ZPOA 3UESA 1TE1B 2W0XA 1S0JA 1JTZX 2GALA 1NY72 1U12A 4H3WA 1DLCA 1H2MA 3CF6E 4YM3A 3QH7A 1UY2A 5F32A 1VBA2 1RL3A 3ILRA 2ZBJA 3MFAA 3K51A 4C0HA 2JDKA 2WWUA 4P08A 3PVNA 2JG9A 4XMIA 1F8VA 3SXWA 3VD3A 4MO3M 4NPMA 2CTVA 1WD4A 4QPIA 3LSEA 4K21A 1POV0 4CDUA 2VC9A 1SQ4A 2QQWA 1AR81 5FZAA 1W90A 5A7PA 4SBVA 1OF3A 2WZ8A 4JDNA 3HBZA 3VBHA 3WDXA 1ZRIA 4YW4A 3V56A 4XABA 1HQNA 2JDHA 3NWKA 3WR0A 2Q1ZB 2QQJA 5C8CB 1JZ6A 2VJXA 2QNKA 2A6ZA 4K3UA 2NP0A 1UN1A 3VKMA 4LQRA 5AVAA 1YWKA 5ACA2 2ARBA 4XW3A 1WCQA 3CEWA 1AF9A 1QU0A 1A3KA 1T6GC 3N9OA 4AFAA 1JZ7A 4NIAA 2ZA9A 2JB8A 5EJ1B 2ZZQA 4JTOA 1A34A 1XE0A 1GZWA 5C3RA 1IPSA 4YW5A 1MZEA 2I07B 3VN4A 4CCNA 5AVPA 4CU9A 1BEV1 1YYNA 1W04A 3MHZA 3DCQA 2RM23 4KWLA 5CFDB 5A3OA 5HV0A 2Q4SA 3WDTA 4CXWA 3KV9A 2J22A 1RHI2 1CONA 2P3YA 2P34A 1FAYA 3AYDA 3ILFA 3KSCA 4LA3A 4BLIA 4I0AA 1AR73 1OH4A 1Z7S2 4GH4C 4N43C 4BPZA 4R9CA 5FZ6A 3MIFA 4MXWB 5A6YA 1G9CA 1QQP3 4CU8A 3VBRC 3O14A 3RZLA 4UI9L 3VL8A 1PM7A 3F2ZA 1UMIA 2IVIB 3BODA 3NNLA 4QGNA 4YZ3A 3RFRA 4CP0A 1LOCA 1TNFA 3ZFGB 4L9BA 2D44A 1DF0A 3USUA 1UOBA 1I9RA 1NZIA 2VOKA 3U07A 4W65A 2Q8DA 4Z2AA 2QQPA 5ABJC 2GNMA 1UY1A 1UCXA 1VRH2 4XTMA 5A32B 1GBGA 3PDQA 3PTYA 2IFWA 2HLEA 3Q8FA 4NJ4A 1CAUA 3ZFFA 4YG6A 4RS5C 1QJX3 4AG4A 4Q4V2 2OS2A 2I2SA 5A6XA 1SFPA 4OCTA 4EE2A 2YB7A 5J1XA 5BYNA 1ZREA 1E5HA 2WKKA 3HQRA 1QJU3 5C70A 3OY8B 2D6LX 1TMF2 1Y4WA 4QXHA 5DAPA 5FP8A 3H0OA 5HXMA 1NXD1 3VV1A 3ACFA 3VDDB 5FOBB 4Q4W2 4QXCA 3FBMA 3IDAA 1GR3A 1QGLA 5BNNB 1K3IA 4COUA 3WSOA 4BHPA 1X9PA 1J3RA 1LKNA 2W46A 5IK5A 4XF9A 4CDXB 1UOGA 3IB3A 1ODNA 4P14A 3KGLA 4GXLA 4WVVA 3W59A 2W08A 3P3NA 4ONUA 5FJKA 5IT6A 4AHXA 3J8F1 4RA0A 1OKQA 2PHFA 5FY4A 1OVSA 3ZO0B 4ZXKA 3SH3A 4HETA 5I0DA 2WQ8A 2VZPA 1AR82 1KJRA 5IAXA 1YFUA 2XVGA 3I2OA 1DFQA 1DGWX 1DIWA 3LD8A 2GNDA 5JOWA 2QQUA 5J36A 1XOYA 4IL7A 4UAPA 4ZU4A 1XYPA 2JG8A 1PNGA 1JHJA 4XFGA 1NA1C 2Y33A 3C7GA 3FLTA 4P00B 4Y22A 4JTNA 1ULEA 3CLPA 4OZXA 1J84A 3POYA 2GP5A 3PU3A 3BU7A 2PELA 2AEZA 3H42B 3MO4A 4AAXA 2CAVA 2YXSA 5CG8A 4NHYA 4MYEA 4QQOA 3QH6A 4JRLA 4YWAA 2W91A 4NWVA 5CFCC 4XIKA 1O3SA 4AFDA 5DAQA 1H1AA 2IXIA 5FYMA 3S0MA 5KWRA 4EN0A 1R1A1 2C24A 4NO4A 4BXSV 3JBG3 2VG9A 4LO8A 5FZKA 1ULGA 3CZUA 2W1WA 4MX3A 4YSFA 5I8SA 3WF4A 5BNNC 1XE8A 3E6BA 3B94A 2GNTA 3MPBA 5C3OA 3VDDC 1H8TA 3VBSC 1U5XA 1OFNA 3H3UA 5DZGA 3KF3A 2K46A 2UY9A 2TNFA 3GM8A 1ZBA2 2OYZA 2W87A 2GC2A 2WUHA 3U10A 1JUIA 1KFXL 4IE7A 3BTYA 1LULA 2ADDA 2JDMA 1WMFA 1OHFA 1V9U1 4XAEA 3HQUA 3HN1A 1TME1 1WCUA 5HI0A 2DBNA 3H7JA 3UNPA 4EZHA 2VMGA 3THTA 1EY2A 4FPOB 2RS51 4HPKB 1E5IA 5KHHA 1XRUA 3QLQA 2Q1MA 4HN1A 4LKDA 3VL9A 3BIWE 3WQ7A 4B7KA 3N7MA 4ZU5A 5FZBA 1KEXA 3TNPB 1BBT2 4OI4A 1XNAA 2WNVC 4YRDA 3R6SA 5KXEA 5DUXA 3GZUC 4N7IA 4D6QA 2WO2A 1W6OA 3LEKA 2VCBA 3TWIA 1RUE3 1HRI2 1LGCA 5CFDA 2PA7A 2BVBA 4CDXA 3AZYA 3OUJA 2XPJA 2VCMA 2ZPXA 3PUHA 3ZR6A 4BCUA 1QXPA 2QQIA 4IUGA 5T54A 4EROA 3H8RA 4S2FA 4F3JA 2BERA 2IXJA 1WD3A 5JIAA 2H0BA 4HXCA 2HBTA 1W28A 3MPPG 4WVMB 4PLMA 4LBQB 4XYXA 2ENRA 3U37A 3AP6A 1H4HA 1DQ2A 5FPXA 4FTEA 1IS4A 1T6BX 3NNGA 1NE4A 2WN3A 2WS93 1W06A 4FBFA 1OH3A 3POFA 1WMXA 2RS13 3N7LA 4O7XA 2WZPP 1JU4A 1SFNA 3M3IA 5FMCA 2DCTA 2AZ5A 4AFBA 3VDAA 3ZYPA 5LY1A 4HG6B 2J1UA 2VMDA 2CSGA 3ON7A 1YRZA 2XWJB 4UW3A 5F9TA 3VD9A 5FV3A 2WO1A 5A1FA 2E26A 2JXAA 1LRHA 2R30A 4IE5A 4WBBA 5T5JA 4YFWA 1WGPA 4JX0A 3KLSA 4RFT0 4UFKA 2ES3A 3A0KA 3UGFA 5SV5A 1MS9A 5FQ0B 5A1LA 4ASMB 2ZEXA 1CAUB 4XMAA 3ABZA 3R4DB 4BM8A 5F6KA 3MLLA 1ZZ9A 3K3NA 4FP3A 4AEDB 3POSA 3WHTA 1RUI2 2E63A 2NYYA 3WVJA 4XCBA 2A6XA 1F4AA 3DN7A 3KVBA 4XXPA 3AKTA 3KF5A 5IWFA 1W8ZA 1EAH3 3AYAA 1M06G 3I4IA 1Q43A 2JE7A 4K7JA 3RYRA 1IG0A 2NMOA 1RIRA 1AYM3 5L9RA 4JHZA 4A41A 3PVEA 1L7QA 4CDXC 1AYN1 4PJYA 3FWEA 1B35B 1KQRA 3R4UA 2A6WA 2AACA 4CU6A 2FCTA 3RVHA 4YM0A 1RMU1 2OVUA 4N53C 3MFCA 4XQWA 5A7OA 3TYJA 4J25A 3OEBA 2VZSA 3QOPA 5F37A 5FQ0A 3U4XA 4CYDA 4DQAA 1PNFA 1D0GA 2EAKA 3VKNA 2VOXA 1WCSA 2VMHA 3VZKA 3T09A 1KGYA 2VZRA 2WRAA 3HOBA 4JCKA 2VNGA 1FI2A 4U2AA 3MIBA 4PI0A 3N7JA 1QNYA 4XEZA 4BQWA 4N53B 3LPFA 4YZ1A 2A71A 3AFGA 4HMZA 4IESA 3NV2A 5DXDA 2ET7A 1AR71 4I30A 1YLLA 2J1EA 3T2TA 5KR7A 2D40A 2LTNA 1PK6B 1PO13 1YHFA 2JJ6A 4QPGA 5FTTC 3ZN4A 4GB31 4WVMA 2XL7A 3MICA 5FPZA 2C26A 2A5ZA 5A6QA 4M3CF 1VALA 4FI9A 2VW1A 5DDJ1 3IDCB 1ACCA 2Q30A 5LK7B 4AZZA 3L2YA 3O1PA 1PHMA 1TMF3 2IVJA 3OBTA 4XJZA 4QU2A 4N43B 3LAGA 1WLDA 1SPPB 3IIAA 1UY3A 3O0VA 1S2BA 5IW0A 5HPOA 2OW4A 3RG0A 3MV11 2BPA2 3MW2A 5A3NA 5CFDC 1YJKA 2C5DA 3S30A 1WBFA 3ZYHA 5F5IA 3AZWA 1NLSA 2Q1FA 2Z79A 1S0EA 4UYBA 2YBPA 1YIPA 5FR3A 3NV3A 2VVDA 2NM1A 3NO8A 3K48A 4ZZ5A 4TWTA 4R52A 2FDFA 3O1UA 2Y38A 3NNJA 2UWBA 5FYTA 3D6EA 4XF3A 3WHUA 2Y0IA 1GLHA 4OI0A 4HKLA 4B4PA 1OLQA 1K12A 2DF7A 3K4AA 4GQ7A 5JXJA 5LBBA 2ZGQA 4QKNA 2R32A 3CL1A 3TEXA 2KR2A 2WT1A 4H7LA 3V64A 1PMHX 1VJ2A 2BWAA 3N35A 4UFHA 4EN6B 1W9SA 2ERFA 3O1SA 1ENRA 1MS5A 1XNDA 2BP6A 1OQ1A 4WZFA 1QQP1 1UIKA 3SH5A 2CYFA 1FATA 5EJZB 1ALYA 3E5XA 4LUKA 3I59B 3SCFA 3DGTA 5E16A 5CISA 2P6CA 2ZEWA 1HB4A 2GC0A 1IG3A 1HB2A 2WZR3 3MF9A 2OQ6A 4P9WA 4CSWA 3I49A 1R1A2 1V6NA 5FMOS 4BDVB 4UBGA 2B45X 4AI0A 1W9WA 4KG0A 4YNIA 3NKTA 3OSDA 3WV6A 4AK3A 5FCCA 2ZGUA 2FCUA 1GOGA 4B3NA 4HVQA 4FQZA 4M4PA 4H55A 2EVXA 2GH2A 1NOVA 1RUC1 3MW4A 1V6LA 4MXWA 4CVUA 1D7PM 4KGGA 4XIOA 2XLAA 4ASLA 3KWVA 3I59A 4R8HA 4A44A 3ZXDA 5IHRA 3OJBA 1OQDA 2FDJA 4IETA 5C6CA 1JZ3A 4A3ZA 1HN0A 3WP5A 2W94A 3P5BA 3N4MA 3ZVXA 4H7MA 5FY5A 2JIJA 3T2QA 5CKMA 1U0AA 1AR72 1Z7S3 3T08A 1X8MA 4CDQC 5GLWA 4CP1A 1YQCA 2Q0AA 2J1TA 2Q5TA 1SLAA 4C1WA 1W6QA 2VQ0A 4KWJA 4QAWA 1GNHA 4WV8A 1NXMA 5FLHA 1LB2A 2X10A 5E6HA 3NAPA 4F7ZA 4A6OA 1NCQA 2MPFA 3BYWA 4FOWA 1EV12 2PHDA 1YIFA 1OF4A 2RG4A 5K0UC 1ULOA 1AX2A 3VBOB 3S7EA 4LKSA 4Z8BA 3IKWA 2WWJA 2CV6A 3ILNA 4I09A 1XBFA 1D0HA 1SBFA 1UF2C 2GDFA 1OUXA 2IXLA 4IEUA 4RN5A 4YLZA 3TN93 3VZLA 2BTVC 4YW1A 4WM7C 3KZ4C 2WAOA 1FXZA 1I6XA 2GU9A 1SG3A 3IWZA 1FOD2 3B9IA 2HBUA 2YUEA 3WG3A 4YVWC 4TYSA 3SISA 1ND3B 2PLV2 5GLTA 4COYA 1VBC1 4RD7A 3T0BA 4BA6A 4CEYB 2ZZJA 3B3QE 1H6YA 2RS31 4GKYA 2F4LA 2J1RA 3HWJA 1QMJA 1GNZA 1HX6A 3OOXA 2OT7A 3IDBB 3LEIA 5FZMA 4KQ7A 4K40A 4DY5A 4MG2A 1W3VA 3E6CC 2ZHNA 1Y9MA 3EQEA 2VTXJ 4AEDA 4CDQB 5LA1A 2ZGOA 1PVXA 4QPIC 1O59A 1NX9A 5EYXA 4UW6A 2QUOA 4ISQA 4LNVA 4CDWC 4LMFA 4NRMA 3K4ZA 3WNMA 4QDRA 3NV4A 4S2HA 4J1WA 1LHOA 2VZ1A 4BU2A 1MACA 4ZPIA 3JZVA 3LKJA 1FPN2 1V6IA 3ZXJA 2N7GA 4AFCA 4BMBA 3WG2A 2O8OA 5C4WA 1RUH1 4MGIE 2CWSA 5BNOC 3VBUC 2XKPA 4XILA 4AVAA 2AYHA 4G4FA 5DDJ2 1QHDA 1W8FA 3WXPA 1VAKA 1QF3A 4P9XA 4Y5SA 2VQAA 1B35A 4AHYA 3WDWA 3J7HA 2P4EA 4HKOA 4E27A 1Y7BA 1CGPA 4CTEA 3GZAA 1IQDC 2K9ZA 3CZJA 3K75B 3ENRA 1AXZA 2E6VA 3PJYA 2JKBA 1LESA 1GP6A 1MQTB 2GN3A 2JIGA 2XQXA 3C2UA 3FMGA 3SLIA 3M1HA 3HIFA 2G19A 3PUSA 3VBRB 2VW2A 2UY8A 2AGSA 4BWOA 5KBFA 4QXKA 4ORFA 4S2GA 2Q8OA 2IXCA 2ZX3A 3TNQA 3K4DA 2C9AA 1AR92 2V5DA 1RUJ3 2PHLA 1PMIA 1R092 1O3QA 5KXBA 1CAXA 2XB6C 1OA4A 1K45A 1W6MB 5I0TA 5A3TA 2ZX2A 2P5BA 4YFZA 1JXNA 1JYXA 4CE8A 1OPOA 2ZS6B 1C3HA 4HN0A 3EB7A 2VZQA 1VR3A 3K77A 4IGPA 3HBKA 3D8CA 5EWSA 2WZR1 3KT1A 1HRV1 2W1UA 5JWPA 4DEQA 4A7YA 1TME3 5I0SA 5LA9A 4E2GA 3LDBA 3N9PA 5CKQA 2V09A 2VTFA 4RS5B 5DABA 3WQ1A 4Q4Y2 1H30A 5C3PA 2XVLA 2ZMLA 5H9QA 3PUQA 3RZMA 1HLCA 2WIIB 4LK6A 4XAAA 4CCMA 5LEJA 2XXZA 4BK4A 2YC2A 2GC3A 1DZQA 4TLFA 3T2OA 5FP7A 2VMEA 1AJKA 2VXRA 4BH9A 1X9TA 3KCXA 3I3BA 2HWC2 1XNBA 1WA6X 1SLCA 5FMOL 2EAAA 2OIIA 1VBC2 4BQ5A 2ZX1A 2XJTA 1CWPA 5C33A 5IAVA 3AP4A 3DL3A 3IDEA 1W0NA 1JOPA 5JPNB 2VR4A 3IZOA 4UBHA 1BVP1 4AR2A 2K2SA 1NAEA 1VRH1 1URXA 4YGCA 1HRV2 5EHDA 2ZGRA 3ZX7A 1UMZA 3BTZA 4HT1T 2E51A 5ERLA 2R16A 2W1SA 1N1YA 4E8CA 1JOJA 4M3CA 1NCRA 2X5IB 1FMD3 3APBA 4OHYA 2R7EB 5I93A 4JRAA 1BKZA 3C8XA 3GCWA 3IMMA 3S57A 3B00A 1Q5OA 1FNZA 5A3MA 5A7NA 1LOFC 1SCRA 3TEWA 1W8UA 3ETPA 4O65A 2RJKA 3HD8B 1Q8QA 1W2NA 1COV3 4QGLA 4XHXA 4QDQA 1APNA 1AXYA 1COV1 3I54A 1CPNA 4LHLA 4QQLA 5BXXA 3VZJA 1C5HA 1PIV1 1YQ5A 1LHNA 2R6QA 3ELNA 5CIRA 4QM9A 5FPUA 2ZMKA 1B35C 4TSVA 3ALQA 4GB33 2J1SA 1VPHA 4D6RA 1ZYBA 3ZFEB 1CAVA 3WG4A 5BNPB 4QPGC 4DUVA 1Q8PA 4LO4B 1VBB3 1OOPC 2YC4A 3ATGA 4HL0A 4YGBA 4ET7A 4BISA 5BUVA 4CCDA 3ZYIB 1AX1A 1W2AX 4CRQA 1AR61 1BHGA 2YDEA 4QQ2A 1ZX5A 4AOCA 1OMIA 2BVVA 2Z5WA 4GWIA 3WDYA 2BOJA 4Q5OA 1BK0A 5JIUA 3RWNA 1GMMA 2QDNA 5FUIA 5IVJA 3RRDA 5L19A 5C9AA 4RS5A 1H8TC 2ZGTA 4OHZA 3HNYM 3VBSA 3JXSA 1LR5A 2YGLA 2WNUB 2AREA 2B8MA 5FZ7A 3ZPYA 4CEWA 4QKFA 4DNYA 3PIGA 3H3ZA 2XUMA 4I02A 4OUMA 1VMHA 4FTSA 2NQYA 4Y33A 1A8DA 2J1AA 2CDPA 1LOFA 2Y6KA 4Y1VA 1PO21 2YMZA 3S5AA 1QJY1 2YFUA 3PUIA 1EYBA 3P3PA 2P3IA 4BMEA 1EAH2 3ZFGA 4TZDA 1C8M2 4DXRA 3DXTA 2XMLA 4QQPA 5K9YA 2VUAA 4OQ9A 4RQPA 4JGZC 4KMQA 5FWJA 4XDQA 1RUI3 1V6KA 4UXAA 4C90A 1UZVA 1ND3A 4RGKA 3E1F1 5JR7B 3RJ2X 4BE3A 2NZ9A 5DZFA 4E4HA 3EYPA 1KFUL 4HPKA 3WF0A 2XVKA 5C9AB 4QX8A 2FD8A 1JYWA 2JDAA 1UO9A 1CD3G 2X53S 2G4IA 2XHKA 1T2XA 5IVYA 2GSYA 2VNVA 2DU0A 3BPSA 1DGRN 1WW6A 5EIYB 3HPNA 3R05A 2A6VA 1UXZA 5E89A 3VB9A 5FRAA 1NCQC 4YW3A 1S4CA 2GZWA 1FMD2 3IAQA 1QH6A 2PN5A 5B2GB 4ARXA 5FO9B 3ZN6A 1CJDA 1KDKA 5D8AB 2Y0OA 3ST7A 2D7FA 2C4XA 5FY7A 5FYSA 1XU2A 3I3EA 2XBO3 1YQ2A 3IT8A 4FO9A 1C4RA 4IE0A 4B7EA 2XBO1 4NN0A 4Y4RA 2WBKA 3AMNA 3AVSA 3O0WA 3ZYBA 1OA2A 4U36A 1GOFA 1W8OA 5FWEA 5J96B 2FDHA 3AK0A 2W5FA 4N9HA 1I1EA 1QY4A 3MIGA 4COZA 3HNMA 3AL5A 4DPNA 5IVVA 1GP5A 2Y6HA 4QX5A 4GA9A 1JW6A 3WDUA 1WCDJ 5T50A 5C3QA 1QJY2 4TLGA 1UIJA 3DV8A 2AEYA 1BK1A 1KDMA 4IERA 5ISLA 5HCHA 5EZWA 1KRIA 5FZDA 1WBLA 2ARXA 2VTXA 5IATA 5JSOA 2H0VA 4INDA 4L97A 5F2WA 1DQ1A 2UURA 1GNYA 4Q0QA 2UYAA 5JOXA 1QJX2 3AKPA 3I2FA 3SITA 3I3MA 2WS91 1ZNPA 5CFCB 5I91A 3MZHA 1Z7S1 4IEYA 3T0AA 4NAOA 2ZABA 1AVBA 1IZ3A 2AENA 4ES9A 1JHNA 2DTWA 5F5QA 1VMFA 1ULPA 2QVSB 4D8MA 1QIQA 4R4ZA 4Y1XA 1RMU2 4YVSB 3HN3A 1PGL1 1AR93 4Q4Y1 3DPRB 1ONAA 4L92A 4OUSA 2XJRA 3JD72 1HQWA 3GZEA 1E57A 3AB0A 4KGQA 4PLOA 4HZFA 1S0DA 4B4RA 2EIGA 1RUC3 3AKQA 3CHXA 4K6BA 1DCSA 1YJLA 5JXIA 2OPKA 3OGJA 1JUHA 3VKFC 3RZZA 2E32A 2PXJA 2VBDA 4MOAA 4COVA 3AZZA 5A33B 3LF7A 2BEOA 5LBCA 3I7DA 1WMDA 2CY6A 4OHXA 3ZSMA 1JYIA 4XZPA 2A70A 1RHI3 3CBNA 4CUGA 4PDWA 2WWSA 1CX1A 2JDPA 3E6DA 4FFIA 3O1VA 2JD9A 1AR63 4IV3C 4EQVA 1CESA 2VMCA 4K1ZA 4LLOA 4E4DX 1JZ2A 3LDRA 4CA9A 2VQTA 1JYNA 2VPVA 2WABA 3M3QA 2ZHKA 5D8AC 2WSUA 5E8AA 3ZDVA 3F95A 2K0GA 3FZ3A 2Q8CA 1HQLA 3BGAA 2P37A 4PDWC 3PL0A 2AR6A 2VULA 1WW5A 5ACA3 3C7FA 4AWDA 5C7GA 1KXGA 5IVFA 4GULA 1RUJ2 1TNRA 4ZHNA 4RHV1 2Y6FA 1ZRFA 2XLFA 4IGQA 3CU7A 5A33A 2OKXA 1ZA4A 2YU1A 2B46X 2GP3A 3TB0A 2QZ2A 4UFIA 3OBRA 2EXJA 2ZEYA 3GBGA 1HXS2 4CEWB 4HBNA 3HT1A 1V6JA 4X6QB 4FXGB 4TTGA 5GM0A 5BV6A 3CJIB 1XQNA 1ZZBA 1ENSA 2WS92 2ORZA 2ZGPA 4C1XA 3U0ZA 2W2IA 1Q3EA 1R083 5B4XA 4LBQA 4ASKA 1OKOA 3DKWA 5FUPA 4KH9A 3AMMA 1UKGA 2VZOA 4XFAA 5FZ1A 1VBB1 3V65A 1LEDA 3O1TA 2JX9A 2IXHA 4Y1YA 3LIGA 1QJZA 4IE6A 1LECA 3KHBA 3OGSA 1KS5A 1IHMA 2RDQA 5CEHA 5FPVA 1ZBE3 4QHBA 5AFEA 4LTAA 4RQPB 2XG3A 3WT3A 3K2OA 1J3QA 5GJ6A 4Q27A 1DQ6A 3FE5A 4MSVA 1S2EA 2EIDA 5J37A 4LUMA 2VVFA 1LENA 4UWDA 4XTPA 2VZ3A 3KHCA 2PQSA 1AX0A 4UT5A 2QQNA 3A4UA 4WM8A 3SCHA 4NAMA 3ZFEA 4DRRA 1QXJA 2RDSA 3MIHA 3ZSJA 1MS0A 5KHIA 2DCJA 3ACHA 4Z1VA 4F8AA 2DVDA 3SCGA 4YVWA 3PJQA 1C8NA 2DFBA 2XDVA 3OG2A 3SMHA 4DO0A 2PTMA 4CP9A 3LEGA 1HRV3 1AL21 1TG7A 1LNSA 2DTYA 5I0UA 4LIUA 3OYWA 1CN1A 1YXWA 2ZCWA 2R061 5FK8A 3VDCA 3WNLA 1VBD3 4XUPA 3IN9A 3CMGA 1GSLA 2ZGMA 1WLTA 2RVAA 3DYOA 4BQXA 2D5FA 1OBNA 3DKQA 4D7TA 3B7MA 2CL2A 3NJYA 1VBE2 1OD3A 2QZ3A 2RR12 1F5JA 2D97A 1H9WA 2RE9A 3H8UA 3OD4A 3LEMA 3WP3A 3GXUA 1RUE2 5KC5A 1GV9A 2J42A 2YFZA 1J1LA 1QEXA 2WA3A 2V73A 5LRRA 1RUH2 4UFJA 4AGVA 4AI8A 1K5JA 1F35A 1OSGA 1C8M3 3T1LA 1LAJA 4AVVA 1QOSA 5FMBA 3MV01 4Q4W1 2BOIA 2W68A 1ASJ1 4FPLA 1EAH1 5FPBA 1PMJX 4E9KA 4CDQA 1Z0HA 4PCRA 2GAUA 2Y60A 3AKSA 3UJQA 4UF0A 2BBVA 1RUF1 1MVQA 5DZEA 3AP9A 3W58A 2MEV2 2YBKA 1Q8VA 3MUY1 2TUNA 2DDUA 4DXZA 3WZ1A 3WOGA 4FAGA 1U5YA 3OPTA 2W47A 1PO11 1JN2P 2OX0A 5DQ0A 3WW1A 2WAAA 1W6PA 4BIFA 1GZ9A 2O8QA 4OI2A 2RHPA 5DAXA 4XZUG 5DPNA 5BNQA 1OPMA 4CCOA 2JG9B 2VE1A 5GZGA 1QJX1 3L9JT 1HRI1 1YO8A 1AR83 2DV9A 3GBWA 3IM0A 3LA2A 3VBHC 2WNUA 1O91A 1GUIA 2D3SA 4DB5A 5F5AA 4CCKA 3ROUA 5CYYA 5FZ8A 1F4HA 4Y26A 4MGTA 3OF1A 4IQPA 3MF6A 3EXUA 1XB9A 1PZ9A 1RGSA 4GB32 2XH6A 3PU8A 1JYVA 3N9LA 4AVCA 1AZDA 2JDZA 2QE3A 3NV1A 5FXVA 2WQ4A 4LBQD 3VHRA 5FBJA 1YC61 1M4WA 3MI8A 3RI9A 1G8WA 2BU9A 4Z82A 2CDOA 4Q8KA 2VBPA 4JDMA 1RUE1 1WW4A 4AEMA 3AZVA 5EV7A 4QX1A 3VHNA 4DMIA 4MGKE 4RHV3 2ID4A 1F31A 1OURA 3PVOA 4O61A 5LASA 4ZKTB 3VD4A 2QFEA 4NROA 4XDPA 1RXGA 2B5HA 3ACGA 5FYIA 1ULDA 2FQPA 4XOGA 2WR9A 4FFHA 4XUTA 1GKBA 5CZKA 2JE9A 3KS7A 3ES1A 3W21A 1UY0A 1ND2C 4A7ZA 2FHRA 3WF3A 4AQSA 4LT5A 3A0NA 4DUXA 4C91A 3WW3A 1CIYA 1ZZ6A 1V9U3 5FJHA 1G9BA 4LBNA 5A7WB 4L11A 4QX3A 4CCJA 4W6YA 1YNAA 3Q9OA 3D82A 1NCRC 1IPKA 1H6XA 1CVNA 5F5CA 3D5OA 1KD7A 3JUUA 3ZFFC 4AHWA 3FLPA 1C57A 4XACA 2WO3A 4FTBA 2RS33 4Q26A 3VBUB 3WCRA 5BNOB 1WKYA 4OULA 3RI8A 3BPZA 5ABJA 3WUCA 3M7AA 4FFFA 2VCCA 4LE4A 4NIGA 4EN7B 1ZBE1 1OLMA 1YCIA 2IC1A 2XGXA 2VM9A 2YPJA 3GJAA 1SBEA 4NUBA 1W2UA 3O1MA 1ZZ8A 5JZGB 4LO6B 4PDWB 4BQ3A 2P6HA 1NY71 1A8MA 5C5UA 1DQ0A 5GZCA 3RGBA 1X50A 2WFF1 3OTFA 1X7NA 2HWE2 4N8MA 1OOPA 1GQGA 3WP6A 3X29B 1W6NA 3RS6A 3H8OA 2YPDA 5BY5A 4CUBA 1XYNA 2UYBA 3NAPC 4Q1PA 3MLJA 5DN2A 3VDDA 4EWAA 5JCTA 1QNWA 1LOAA 3PNAA 3Q8AA 4XFFA 2BZDA 5JSRA 4FXKB 3T1MA 1SZBA 1PO12 3PLQA 3OY8A 5IYYA 1N1SA 2JEMA 2V4AA 2WL1A 3MIDA 3UKTA 2QDRA 1IS6A 1ND2B 1VAVA 5GLVA 3UT0A 3M3EA 1JI6A 1VBE3 3PHMA 1PZ8A 2VOWA 3Q8BA 1LJ7A 1LHWA 3AM2A 5L7OB 5CU1A 1UX6A 1JU3A 5JI9A 1NQJA 2J1VA 1BJQA 4IE4A 3WW2A 3BVCA 3VD7A 4P5YA 3B69A 1PIV2 2VO5A 3GZTB 1VAMA 3WD5A 4QDSA 2A3YA 1EP0A 5HBAA 4GJYA 2I45A 1JZ8A 3KVAA 2JG8C 2MEV3 2JG8B 1VRBA 2ZX0A 1DQ5A 4GJZA 5JMCA 3B5LB 3EJKA 3RZGA 2D6NA 1R1A3 1UYXA 5A3LA 2LRPA 2QQOA 2R062 1SACA 2VVEA 2WZEA 1K42A 3WINE 4V1PA 4LK7A 2WA4A 3LZZA 5K0UA 3T4HB 4A2UA 1DGRA 4XQDA 1OT5A 1H9PA 3B9CA 4XPVA 1HKDA 2D3PA 1NZCA 1VBA1 2MNGA 2RR13 3GCXA 4JQTA 4LPLA 3CDZB 4YW2A 5FZOB 1ENQA 3FL7A 3OGGA 4UOJA 4ZS2A 1PGL2 1LU1A 4EV0A 3ZXKA 4B29A 1S0CA 4PQ9A 1RJ7A 3S7IA 3UGHA 3HNBM 4KU7A 4FFGA 3O5SA 2F6BA 3ZIWA 2HWC1 2EXKA 1VBD2 3C7OA 2FZ2A 3NAPB 1HJGA 2IZWA 1X33A 5G05L 1RUOA 1RUF2 5LA2A 1ASJ3 4HFSA 1SDWA 2WO7A 1NE6A 4OI1A 4AHZA 1DGLA 1O4TA 3AYCA 2ADEA 2R49A 1RVF2 1J83A 1Y43B 4HK9A 1VBA3 1TQ5A 3C3VA 2FDGA 1GOHA 4OMDA 4P5HA 3VUOA 5FXWA 1UOJA 4AI9A 3I3DA 1BBT1 4YW7A 4QT6A 2ZKNA 4XBLA 2PAEA 3VHOA 2G9GA 4N9IA 4P9LA 4QX2A 1RUH3 1U5ZA 1H1MA 2ZHMA 5CVRA 1RYYA 5FZ9A 4BB3A 1REEA 2A3WA 3RZHA 2O1QA 4QQHA 5C9AC 4GZ9A 1REDA 1SMVA 3T2PA 3Q8CA 4FT8A 5LBEA 1IKQA 1UNBA 5FBZA 5DUWA 1RUI1 1WLCA 1W0OA 3DUIA 4DEVA 1FOD1 3ZR5A 1SCSA 4A3XA 1L7RA 2B39A 4PQQA 4KWUA 1BBT3 3A7QA 4PLNA 3VD5A 3GHMA 4K20A 5LY2A 2WFF2 4D7YA 1A6CA 2XKOA 4Q2FA 1STMA 1ZA7A 4Y4YA 1LCLA 4CCLA 1GWMA 4AEJA 1RB8G 2J7MA 1W03A 4HANA 4NIIA 3BTXA 1DYOA 2FDKA 2RMU1 4K1YA 5AC93 4L8QA 4XFBA 1SBDA 3SH4A 3UYJA 2E7AA 4CU7A 3NNFA 5M0TA 3RSJA 1R64A 2P1BA 4GAZA 5FYCA 5CBLA 1NLRA 3MLKA 4KI5M 3EMRA 1MS8A 5FK7A 3U14A 4B8EA 3FC0A 4DXTA 1Y9GA 2WLPA 5FZEA 3ZMNA 5JLVA 3N9MA 1POV1 4YPJA 4ARYA 4P02B 3BU0A 2R071 2Z4FA 3C7HA 3KB5A 4YGDA 2Y8KA 2ET1A 1LGNA 2WZR2 3NQHA 4JGYB 1BLZA 3NNMA 4Q0UA 3LFIA 4OHVA 3T4VA 5JVVA 2QQLA 3U11A 1AYM1 4N90A 1PO22 4D69A 4ZS3A 2DCZA 2RS11 1MPXA 3M3CA 2XWBB 4K9SA 5TSWA 4CDUC 1RC6A 1Q8OA 4CEWC 5K8SA 2JICA 4OFGA 2ZJCA 3LOIA 4WM7A 3FN9A 1QJEA 1D4M3 1UQXA 2XHNA 5JAXA 1QJU2 2FMYA 5FAXA 5F1RA 1XU1A 3KQRA 4XJAA 1CZSA 1W05A 5FXZA 1BXHA 4LHNA 3GNEA 3VBRA 3ASIA 3I2IA 5JI7A 5I8TA 5L7OA 1MEC1 3INAA 1FMD1 5DUVA 3ZSLA 1FYUA 3RQ0A 1EPWA 1H4GA 4GH4A 4RR3C 4UW5A 5HCBA 2C9KA 2HWB3 1VRH3 3CIHA 3RWKX 3WDVA 1C28A 2WLQA 4JKLA 3ZMOA 1UD1A 5F7UA 2D93A 3E5QA 1VE0A 4BIOA 4IV3B 2C6SA 2XUEA 2WSVA 3DYPA 1HB3A 3UKVA 4DS0A 2IXKA 5KXCA 3ZKUA 1V00A 2WN2A 1QWRA 3AFKA 4G9SB 4Q4V1 1IS5A 3NW4A 1LGBA 4I0WB 1H0BA 4WVWA 2VNOA 1S2KA 2PFWA 3ACIA 4Y3OA 4QU1A 3BKZA 3H50A 4Z07A 2G9FA 1P8JA 3IAPA 4HK8A 4JV4A 1OC1A 4G3YC 1GANA 2CAUA 5KHJA 1O6UA 5H9RA 1N3QA 2XR4A 4YG0A 4PIZA 2UWAA 5KHGA 1WLWA 4E2SA 5LRSA 4CDUB 3JD73 1BMV2 1X8EA 2WDBA 3N36A 4XJUA 1LOEA 3AZXA 3PVBB 3PIJA 3OPZA 4GMP1 1XNCA 3ORJA 4Q4V3 4RFRB 3FFQA 4QX7A 5T52A 5JR2A 5FIXA 2ORXA 4JKMA 4A42A 3A22A 3AMPA 3RMYA 4OMCA 5CG9A 2WYSA 4AI3A 2OZJA 3I2DA 2LUWA 5C71A 1G9FA 1W8TA 3LWCA 2QQMA 4RSUA 5FOJB 1R093 3POEA 1DYPA 2BJSA 4ES8A 1FT9A 1W9TA 2A75A 5FZIA 5F39A 4LBOA 2BGOA 4IW3A 3EBRA 1S1AA 3RNSA 2DVBA 3J9SA 4BOWA 3JCIA 2R042 2W39A 3OGRA 2GN7A 4XURA 1MVEA 3WUDA 5I0RA 3T30A 3LQCA 2PYTA 4O9EA 5KC6A 3JQWA 4Y1ZA 1SLTA 1QKQA 3HQXA 3PTRB 1UYPA 2PAKA 2VBBA 2WNVB 4FPYA 5FZHA 5H9SA 3NVCA 1VBB2 2EIEA 1C1FA 4NRQA 4URAA 5BNPA 2YC0A 2RM22 1XNTA 4AXOA 3VKLA 4FSJA 1HV1A 2X29A 2ZKLA 5CNAA 3WQBA 3AKRA 3FLRA 2Y64A 2NLRA 4AGGA 2VGDA 2VCAA 1RITA 1ULFA 4AVTA 2VUDA 1F9KA 5T5LA 2ZAHA 3LA3A 1PGSA 3DPRA 3RDIA 3TAYA 1PX3A 5F8PA 1POV3 4MGQA 1WZXA 1YI7A 4QPYA 5G04L 1NQDA 3WF2A 3DF0A 1VB2A 1QDOA 1SPPA 2XL9A 3FJSA 1B09A 4NHKA 4XJWA 4QPIB 2ZMNA 5A70A 1O8PA 2BNOA 4IXLA 3N7KA 1RUG3 2MHFA 1FV3A 1UW8A 1GQPA 1OLME 1W6PB 1JH5A 5FYBA 5FY8A 2P3KA 3MGUA 4M0HA 5JXHA 3WX5A 4BQ2A 2JDNA 3K3OA 4LLFA 1PO23 4NHXA 1CPMA 2YBSA 1H8VA 3G6JB 1PVC2 1GFF2 5CA6A 3VGIA 4DFSA 1GZWB 2PLV3 5EQUA 2GMEA 3SKJE 4BK5A 3OB8A 2BRTA 4DINB 2RMU2 1YQ6A 1FOD3 1SDDB 2HWC3 4MXVA 4PF5A 4XJ9A 5LBFA 5BNNA 2I74A 4JZRA 1O3RA 1NA1B 4Q4W3 4LHKA 4QX0A 4LBKA 1XE7A 4E4ZA 4JGZA 1CZVA 4AQ6A 1W3XA 1W6QB 5FZ4A 1H8TB 4M0NA 5DG2A 2BFUS 3DPRC 3ZXFA 2PAMA 4AEKA 3FUQA 4DUWA 5EXOA 5GLUA 1HXS1 1QOTA 1UOFA 4FPCA 3J4UH 3O12A 3AP7A 4LEJA 3ZSKA 4CXYA 2E31A 1W2TA 3QACA 1EV13 2BBAA 5FO8B 1FV2A 3CJXA 5K0UB 4Q4X1 2WINB 3RZJA 1UZZA 3OBZA 2DUOA 1BEV2 4FPJA 1JMUB 4YM2A 4AVSA 1RINA 1OOPB 1G9AA 5FLJA 2E33A 3CQOA 2DCYA 2B9UA 5LEKA 2Z2SB 3AMQA 3V0AA 1ZZ7A 2JB4A 4P9GA 5J98B 3MUZ1 4M00A 1AXKA 5JDBA 1DHKB 1AL22 4PIXA 1ODMA 3NRUA 1MS1A 3D3AA 4AI2A 4CCEA 2VXJA 5L7OC 3FX3A 3UL2A 4XCAA 1JODA 4OZOA 2X5IA 2R1DA 4FVVA 4MLOA 1LHUA 4Y5Z0 4ATFA 2D5HA 1LOGA 1VLNA 5BNOA 4Q1RA 5E1RA 2P17A 1O4YA 5CB7A 3ZXAC 1R091 1V6OA 5FMDA 3W5MA 1RXFA 3VKOA 2VW0A 4MGYE 3IPVB 1DDLA 5FY0A 2VH9A 1JYCA 4HONA 2QBXA 4NHMA 2W95A 4PF1A 2RS53 4XETA 3ZN5A 5JUVA 2SBAA 5BPXA 5A80A 5FLIA 5F3CA 5K4LA 5HCAA 1O4ZA 3WNXA 3VZOA 2R072 2XOMA 3LA7A 1DBNA 2DYCA 1ASJ2 2HYXA 1PGW1 1PM4A 2HEVF 4PBPA 5APAA 5A6ZA 1LODA 4XUOA 1ZVFA 5LCWL 5CFCA 5IVCA 3ZFGC 2FDIA 2E53A 1ZRRA 4LE3A 2JDYA 1US2A 5A1AA 3SEEA 5FDBA 1YQ8A 2ZACA 5D8AA 1BQPA 3PURA 4IEVA 3E5UA 2Z42A 3AXDA 2DU1A 2D98A 4Z2WA 1YI9A 1HV0A 2G9ZA 5HV4A 4IV3A 2NPIA 5IVBA 1ENXA 4GH4B 2RS32 4FPHA 1UPSA 2BQPA 1JS9A 2DUQA 4FOVA 4S2DA 3WG1A 2F4PA 2Y26A 2ZTNA 2A6YA 4ZU7A 4FPKA 5LWBA 3VZMA 1WUVA 2ARCA 2JECA 2TEPA 3HR9A 2B42B 2LS6A 3AP5A 3GF6A 1NCRB 3HAGA 3BB6A 3IIIA 4HVRA 4IEZA 2Y6GA 4LA2A 4RYDA 4AL9A 4WM8B 4IDZA 4FPGA 3HMYA 4K8FA 1GZTA 2R073 4AYUA 1LOBA 5B4NA 4CPBD 1XPWA 3P6BA 4NR1A 3VHPA 2BWCA 1OI6A 3J7NA 4NWWA 3KM5A 5F2SA 1RUG1 1DQ4A 2PHXA 3B93A 5A3UA 2BNMA 3NJXA 5A7WA 1HJFA 2Q8EA 3WNPA 2O0OA 4R9DA 4BJ0A 4CDWA 3CNAA 2E7QA 4FOYA 4PIYA 1RUD2 3V0AB 3O1RA 4XE9A 3V0BA 5FY1A 4QKBA 4WVZA 4RQPC 5FYZA 2HWE1 3CO2A 1PZ7A 5F3GA 3VDBA 1NUKA 2PLV1 4I0BA 5D2AA 5DG1A 2GNBA 4SLIA 4XFHA 1UU4A 5AC92 4BQYA 1POQA 3DEMA 1YFWA 2YYOA 3ECQA 2EA7A 3I2KA 4XUNA 1O5UA 3KV5A 1D2QA 1CQ9A 1NKGA 4KBZA 4WM8C 3J8F3 5C3SA 2D6PA 2B9VA 2X8KA 2WFPA 1E5RA 1H1IA 2RV9A 2V5YA 5D21A 4CZSA 3CJIA 4W50A 4FPFA 1DU3D 3D0SA 5A3PA 5EJ3A 2HWE3 2VZUA 5FYVA 3MIEA 1QXRA 4PBOA 3VBHB 2RJLA 4KNCA 4YZ4A 1IOAA 1XNKA 2WNEA 4KWKA 2PHTA 3M2MA 4HSLA 3HT2A 5H9PA 3OUHA 4ZY9A 4JKKA 2W1QA 2JG9C 1C8M1 4IV1A 4RHV2 4XFCA 1QJU1 1X82A 2WNOA 1I3HA 4R9BA 2KD7A 4M01A 5JMOA 2ETEA 3VBFB 1GP4A 1GYKA 4I3PA 1MQTA 4I3GA 3AC0A 4LORA 5AFBA 1QOOA 3H3LA 1AYN3 5CADA 4NIHA 4EYUA 1N3PA 2CNAA 3HEIA 2QQVA 3AJYA 2FCVA 3ETQA 4M3CB 2X5IC 3WNKA 2VMFA 1AYM2 3D4KA 1DYKA 4A45A 4C8DA 3VBUA 3LB9A 4XC9A 1S0GA 4YGEA 1J59A 1UKRA 3URFA 1AUYA 4KU8A 4BXFA 4NIDA 1CX4A 1N3OA 4LULA 2EXHA 1Y3TA 4LIVA 4I01A 4MUVA 4QB2A 5F6LB 1V9U2 3KT4A 4FPEA 1ND3C 4UFMA 1C5IA 3S6PA 5LB6A 4J1XA 1YFXA 3GBFA 3HJRA 3ZYRA 4QKDA 1VP6A 2KXLA 2EXIA 2UWCA 1SLIA 4IV1B 4GKXA 2RR11 3J7LA 4P9JA 3OBAA 1W0PA 2CGPA 4Y20B 2VNRA 3FUOA 1HDKA 4EN9B 4N53A 4CXXA 2BGPA 4PI2A 4QHZA 5EPAA 4HSJA 2SLIA 2VL4A 3TN92 5C4WB 1TZOA 1Z78A 2W9XA 3KCCA 4NMIA 3IPVA 4GWNA 3AYEA 5IK8A 3K46A 4NRPA 4B4QA 1MEC2 1V6MA 3KGZA 2HEWF 1OXCA 3ZN6B 4HLTA 4R4XA 3AMHA 3NL1A 2QJVA 1RTVA 1S0IA 3KV4A 4JAAA 1CJPA 3DECA 1FNYA 5DAWA 5EYYA 2HWB1 1CAWB 1EPZA 1MZ6A 4JC1A 3QD6A 3N3HA 5GLZA 4B1LA 1BVVA 3GHNA 3PMSA 4CPBA 1NG0A 2ZX4A 1MEC3 3GALA 3ME2A 3LGRA 5FPAA 1TVGA 4L99A 4W6WA 5JOZA 2OZ6A 2GC1A 2R0HA 3BI3A 4MZUA 3JB8A 2FMDA 3POIA 1ZBE2 4GWJA 1SLBA 5C8WA 3KQ4B 4CCCA 2WT0A 4Y24A 4LR4A 1A78A 4AFMA 4A6SA 2RDRA 1OVPA 2LALA 2W52A 3JQXA 4XBQA 3VZNA 3ZOIA 3ZM8A 2HWD2 1GZCA 1O3TA 5IFTA 2BV4A 1F2NA 1UL9A 3J8F2 5L73A 3THCA 4AW7A 3ZSEA 3H1MA 3FHQA 1W8WA 3TBDA 1G9DA 4GIQA 3KMHA 1OD5A 2TBVA 1Y9QA 4YYOA 4GWMA 3WP4A 3Q8EA 4MADA 4D94A 3O1OA 3TOJA 2IUWA 1GU3A 1XJAA 1CAVB 5FUNA 4BLJA 2ZGKA 1OLRA 3NMBA 2VAUA 4NPRA 5JZGA 4XF4A 2EF6A 2GH8A 4AAPA 1YFYA 3R0RA 4IEOA 3VBOA 4Q0VA 1CIWA 2VECA 1TMF1 2VQUA 1OFSA 2F17A 4C0BA 4CP2A 2WNVA 5KXDA 1K5MA 3AJZA 2RMU3 1SEFA 5AC91 2LROA 2WC2A 2VOVA 5ACA1 3QBQA 2D43A 3JBG1 1HW5A 3POBA 4L2NA 4R9AA 5C5TA 1PVC3 2AC1A 1QH7A 1PX4A 3ZFFB 3NSTA 1UXXX 4DRVA 4E2QA 1AR62 1Q56A 2V4VA 2FBEA 2P2KA 2BFUL 2CHHA 3M8LA 4LKFA 1O7FA 3POGA 1EUTA 1O5LA 2A1XA 4Q4X2 4PHZA 3WEZA 4OQ8A 1N1TA 1HXS3 3WY6A 3ZXLA 3THDA 3P1IA 1RUG2 3ZDSA 4BQ4A 2DURA 2JDUA 4A4AA 4AVBA 1UZWA 3MDPA 3USSA 3ZLIA 2RDNA 1X36A 4NPLA 4RGAA 1XYOA 1US3A 1RVF1 1WW7A 4WM7B 5FZCA 2HH9A 4YM1A 2OUJA 4YZ5A 2WNUC 4A7KA 4MGSA 5A7QA 1R1ZA 1RUD3 2VUJA 1K5MB 5GZDA 4YVSC 2ZOEB 4RGGA 3WF1A 3T3YA 2XLGA 3AX4A 2X05A 5L36A 3FHAA 2ZXQA 4GMP0 4HKWA 1UWWA 2NN8A 4WZCA 5DAVA 1AJOA 3VBOC 2PHRA 1D4VB 5IJRA 5JXGA 2W92A 4Q4X3 5J3UA 1FPN1 4XBNA 2RS12 1EV11 3CKHA 4M3CE 1IGOA 4YVSA 4H14A 2ZHLA 3BN6A 1BYHA 1IKPA 2EIBA 1W39A 3LE0A 3LCPA 4OUEA 5FYHA 5BNPC 3BCWA 1I5PA 5A3WA 5FY9A 4L0PA 4XF0A 4GALA 2QQKA 4K8RB 3W20A 4Q29A 4DOUA 2VZTA 3U75A 4NHLA 5A32A 4XHBA 5GZFA 1XSQA 2JD4A 4JHTA 2NMNA 4CEYA 4AI1A 5FZ3A 1HRI3 5HXVA 4LKEA 1GICA 2EICA 3AVRA 4FOQA 4N43A 4Y5TA 4LJHA 2PHUA 2IFRA 1RMU3 1UPIA 2ATFA 2XONA 4YG3A 3ZYJB 4IEXA 2XJSA 5LATA 3IMNA 2H6BA 3OCPA 3L2HA 3BOPA 1W8NA 3QCWA 1AR91 1CZTA 1L3JA 2XBO2 2LW8A 2VU9A 3DXUA 3H8XA 2A3XA 1BEV3 4X8NA 3UGGA 2YG0A 3OYWB 3UJOA 2VY0A 4LOSA 3I2HA 2YZ4A 3MW3A 2EALA 3JD71 2VZVA 2YGMA 5IUQA 4RR3B 5FREA 3MYXA 4D7SA 1MS4A 1UYZA 4RL7A 1NCQB 1UMHA 2DCKA 4YW6A 1UZYA 1HIXA 1ZBA3 4ZZ8A 2VMIA 4Q8LA 3A21A 3ES4A 3TN91 4AQTA 1ZRDA 1QJY3 2QTWB 4YZ2A 2GMMA 1QQP2 2QCSB 2ZGSA 4MV2A 4AEDC 4AGRA 1VB4A 3T0DA 1RUNA 3SNMA 4IEQA 1WA4A 3ZYGA 4CUAA 1WCKA 2UU8A 2W3JA 2DUPA 4AE2A 4XDOA 2RM21 1RUC2 2XJPA 3O0XA 5FFOC 4COWA 1S55A 3LDKA 3JBG2 4XUQA 5A7SA 1J3PA 1NA1A 2PHWA 3B01A 5I8YA 1WMEA 2Y34A 3ZYFA 3WLUA 1ZBA1 5T5OA 4JGYC 2Y6LA 1N1VA 1C1LA 1H2KA 4GMP3 2WQZC 1LEMA 1HN1A 4QMAA 3USUB 3I8TA 2RJ2A 2BGCA 5FKCA 4IEPA 2O14A 3PUAA 2YY1A 2OUHA 2ARAA 4NE9A 1ZM1A 2HEYF 2QKDA 2XQRA 1W2OA 4XFIA 4TXWA 2Z69A 5ANNA 1VMJA 4FCAA 1YEWA 3UETA 4V2VA 1PVC1 5JPMB 3W9AA 2ZGNA 4XVHA 5LZ6A 4MHUA 4PT6A 2BUKA 1D4M2 3THPA 3U4SA 3EO6A 5C8CC 4Z92B 2IWGB 2CWMA 1DLLA 2WT2A 5HCFA 2B7YA 1OUSA 3U1XA 4BZ4A 1TEIA 4OYUA 1UY4A 1GWLA 3LPGA 3OEAA 1F15A 1SFYA 2HWD1 3M4FA 5IK4A 4QB1A 2VD7A 2OXBA 1D2SA 2R063 2DVFA 3WNNA 4JVAA 1CR7A 2R041 2MEV1 3WNOA 1MS3A 1BZWA 4QPGB 5JOYA 5GZEA 4QWNA 1PK6C 1R082 1UU6A 3CJIC 1LHVA 3NJVA 2OQ7A 4UW4A 4F83A 2DFCA 3ZKYA 4CUCA 3UKNA 3I2GA 3WQ0A 5FZGA 2E9QA 2XJVA 3D0JA 2R043 5FYYA 4ITCA 1COV2 2D6KA 2DBIA 3UV9A 2E7TA 3N9NA 3W5NA 1PIV3 3OGVA 2HJIA 2R1BA 5LK5A 1D4M1 3ZIXA 1XXNA 1VBE1 4XXAA 4CDWB 3EHKA 3GJBA 3SHRA 1NT0A 4OLLA 3ZXGA 1J1TA 3NJZA 4LBJA 1UZ0A 2ZEZA 1W8HA 1S0BA 3GYDA 4UFLA 1W99A 3WW4A 1CAXB 1UAIA 3OUIA 4Y1UA 4DIQA 3FFZA 1JYTA 1G6NA 1AL0G 2A73B 3J7MA 4ISRA 4OVEA 2CU5A 3E97A 4URTA 5LA0A 1SLLA 2D6OX 4B1MA 4YARA 5IFPA 4W4ZA 1JZ5A 3KCYA 4CEYC 2KA3A 1Q8SA 2HWF1 1W6MA 1KJLA 4V2WA 4JGYA 4FQ4A 2HWF2 4XF1A 2X09A 5T55A 5DMYA 3MEPA 4LO7A 3SEPA 5J7MA 1K5MC 2PQQA 3RJRA 3G7DA 1H2LA 1O8SA 4FP2A 3O7OA 5D1IA 1J58A 5FKBA 1G86A 1MR5A 2WJSA 2OPWA 5F3IA 4D6SA 5J48A 3RMXA 2VOTA 3GGLA 2BNNA 3BTAA 4Q4Y3 5FZLA 3FBYA 4EN8B 5LW9A 1BMV1 5FZOA 3BIEA 3I97A 4HOOA 4IGOA 4GD4A 1AHSA 4DY3A 3JB4C 1E5SA 3RYPA 1PK6A 1N47A 1RUF3 3KD4A 4MHRA 2HKXA 2HWB2 5FXXA 3S5QA 2OA2A 4AF9A 5J09A 5GKAC 5F3EA 4DXSA 3BOWA 1ND2A 5FPLA 3M3OA 3WCSA 2ZGLA 3MBWA 2LM3A 3OPWA 5EFUA 4OHWA 1RJ8A 1GWKA 1DZTA 1IQAA 1NLQA 1RHI1 2DVGA 3BALA 4ZONA 4Y20A 4LO5B 2HWD3 1OQEA 3NKGA 4AQ2A 4BQ1A 2D6MA 2WYFA 1L7LA 3I2JA 5SV8A 1RUJ1 4EWDA 4JDOA 1ST8A 3SKVA 5KHKA 5L9VA 3KT7A 2AH2A 2Y6JA 4XJ8A 4ATEA 1MQTC 4LOTA 1UYYA 4QB6A 2YHJA 3FHIB 3HVDA 4X8PA 3AXEA 4EZ4A 4P9IA 1LU2A 3RZKA 3LOBA 3LSDA 4H2AA 1VIWB 2B4KA 3SC7X 1NYWA 1DGWA 5T5PA 1XC6A 3LIHA 2JE8A 3POWA 1ULCA 2ZAAA 4META 2YU2A 3ZXEA 5FO7B 3POJA 2RS52 3TRSB 2JWPA 2KM2A 4MH0E 5DDJ3 5ABJB 1YUDA 3VBFA 2CGNA 3H9AA 2L9LA 1ZZCA 3JU9A 4N7UA 1EUUA 1V0AA 2R0FA 5JZGC 1HB1A 2VUCA 3RYKA 2CGOA 2XJUA 1W6NB 1PGW2 4QHOA 2GMPA 4I2OA 5K7PA 1VBC3 1XSRA 2PMWB 2JENA 3RPQA 1REFA 4KL1A 1I5ZA 4IEWA 2A7AA 1MZ5A 3VBSB 1UX7A 2C1FA 5DUUA 4EJRA 1VBD1 3UK9A 4UF0B 3TEZA 3R4SA 1IPJA 1U5IA 4JGZB 3PMEA 4TN7A 4Q0SA 5EP9A 2YV8A 1JZ4A 1GQHA 2BYVE 4LHSA 1W6OB 5L9BA
chains in the Genus database with same CATH topology
4JQRA 3M70A 4LBMA 1DZRA 1R081 4BYYA 4E4SA 1G7YA 4RR3A 4NOTA 5T3NA 1JBCA 1TME2 2ILMA 4EWEA 4J6GA 4KBBA 4P9YA 1MZFA 4Y22B 4LBLA 4YVWB 1BCXA 1FPN3 2C0ZA 4MVTA 1IS3A 1AYN2 5C4WC 4X6RB 5CAZA 3ACLA 3B02A 3J26N 4FAHA 4XQ4A 2XJQA 1CAWA 1KS4A 1V70A 3H1YA 1RUD1 4W6XA 2AUYA 5E88A 4IV1C 1LTEA 2D3RA 2BW8A 2HWF3 1RVF3 5GALA 1QDCA 1AL23 1UU5A 5IK7A 1S0FA 4DZGA 2DVAA 3VLBB 4QD2A 1OA3A 1ZRCA 2WFF3 4MGZE 4QGMA 4O9GA 1DG6A 3ZFEC 5JSPA 1FX5A 3H1WA 2FZ1A 2H6CA 4Q0PA 2YROA 1H2NA 4QM8A 3IBMA 1KITA 1F5FA 3H7YA 3VBFC 2P3JA 4NVPA 2HYKA 4D3WA 2DWRA 3V0BB 5C8CA 3OD0A 4KG8A 4HVOA 1TE1B 2W0XA 1S0JA 1JTZX 2GALA 1NY72 1U12A 4H3WA 1H2MA 3CF6E 4YM3A 3QH7A 1VBA2 1RL3A 3ILRA 2ZBJA 3MFAA 3K51A 4C0HA 3PVNA 2JG9A 4XMIA 1F8VA 3SXWA 2CTVA 1WD4A 4QPIA 3LSEA 4K21A 1POV0 4CDUA 1SQ4A 1AR81 3VBHA 3WDXA 4SBVA 4JDNA 3HBZA 4YW4A 3V56A 1HQNA 3NWKA 3WR0A 2Q1ZB 5C8CB 2QNKA 2A6ZA 4K3UA 2NP0A 1UN1A 3VKMA 5AVAA 1YWKA 5ACA2 2ARBA 4XW3A 3CEWA 1AF9A 1QU0A 1A3KA 1T6GC 4AFAA 2ZA9A 2ZZQA 4JTOA 1GZWA 4YW5A 3VN4A 1MZEA 2I07B 5AVPA 1BEV1 1YYNA 2RM23 4KWLA 5CFDB 2Q4SA 3WDTA 1RHI2 1CONA 3AYDA 2P34A 1FAYA 3ILFA 3KSCA 4LA3A 4BLIA 4I0AA 1AR73 1Z7S2 4GH4C 4N43C 4BPZA 4R9CA 3MIFA 4MXWB 1G9CA 1QQP3 3VBRC 3O14A 3VL8A 1PM7A 3BODA 4YZ3A 4QGNA 4CP0A 1LOCA 1TNFA 3ZFGB 4L9BA 2D44A 1DF0A 3USUA 1I9RA 2VOKA 3U07A 4W65A 2QQPA 5ABJC 2GNMA 1UCXA 1VRH2 4XTMA 5A32B 1GBGA 3PTYA 2IFWA 1CAUA 3ZFFA 4YG6A 4AG4A 1QJX3 4Q4V2 2I2SA 5BYNA 1ZREA 2WKKA 1QJU3 3OY8B 2D6LX 1TMF2 3H0OA 1NXD1 3VV1A 3VDDB 5FOBB 4Q4W2 3FBMA 1GR3A 1QGLA 5BNNB 4COUA 4BHPA 1J3RA 1LKNA 5IK5A 4XF9A 4CDXB 4P14A 3KGLA 4GXLA 4WVVA 3W59A 2W08A 3P3NA 4ONUA 5IT6A 4AHXA 3J8F1 4RA0A 1OKQA 2PHFA 3ZO0B 4ZXKA 3SH3A 4HETA 1AR82 1KJRA 1YFUA 2XVGA 1DFQA 1DGWX 1DIWA 2GNDA 5JOWA 5J36A 4IL7A 4ZU4A 1XYPA 2JG8A 1PNGA 4XFGA 1NA1C 3FLTA 4Y22A 4JTNA 1ULEA 3CLPA 4OZXA 3POYA 3BU7A 2PELA 5CG8A 2CAVA 2YXSA 4MYEA 4QQOA 3QH6A 4JRLA 5CFCC 1O3SA 4NWVA 4XIKA 4AFDA 1H1AA 2IXIA 3S0MA 5KWRA 4EN0A 1R1A1 4NO4A 3JBG3 2VG9A 4LO8A 1ULGA 4MX3A 4YSFA 5I8SA 5BNNC 1XE8A 3E6BA 3B94A 2GNTA 3MPBA 3VDDC 1H8TA 3VBSC 1U5XA 1OFNA 3H3UA 5DZGA 2UY9A 2TNFA 1ZBA2 2OYZA 2GC2A 3U10A 1JUIA 1KFXL 1LULA 1WMFA 1OHFA 1V9U1 3HN1A 1TME1 5HI0A 3H7JA 2VMGA 3THTA 1EY2A 4FPOB 2RS51 4HPKB 5KHHA 1XRUA 3QLQA 2Q1MA 4HN1A 3VL9A 3WQ7A 3BIWE 4B7KA 3N7MA 4ZU5A 3TNPB 1BBT2 4OI4A 4YRDA 2WNVC 5KXEA 5DUXA 3GZUC 4N7IA 1W6OA 3TWIA 1RUE3 1HRI2 1LGCA 5CFDA 2PA7A 2BVBA 4CDXA 3AZYA 2XPJA 2ZPXA 4BCUA 1QXPA 4EROA 5T54A 4S2FA 4F3JA 2IXJA 1WD3A 5JIAA 2H0BA 3MPPG 4WVMB 4PLMA 4LBQB 4XYXA 2ENRA 3AP6A 1H4HA 1DQ2A 5FPXA 4FTEA 1IS4A 1NE4A 2WS93 4FBFA 2WZPP 2RS13 3N7LA 3M3IA 1SFNA 2DCTA 2AZ5A 4AFBA 3ZYPA 1YRZA 2XWJB 4UW3A 5F9TA 2JXAA 1LRHA 2R30A 4WBBA 5T5JA 4YFWA 1WGPA 4RFT0 3KLSA 2ES3A 3A0KA 5SV5A 1MS9A 5FQ0B 4ASMB 4XMAA 1CAUB 3R4DB 4BM8A 5F6KA 3MLLA 1ZZ9A 4FP3A 4AEDB 3POSA 3WHTA 1RUI2 2E63A 2NYYA 3WVJA 2A6XA 3DN7A 4XXPA 3AKTA 1EAH3 3AYAA 1M06G 3I4IA 1Q43A 2JE7A 4K7JA 3RYRA 2NMOA 1RIRA 1AYM3 4CDXC 3PVEA 1AYN1 4PJYA 3FWEA 1B35B 1KQRA 3R4UA 2A6WA 4YM0A 1RMU1 2OVUA 4N53C 3MFCA 4XQWA 3TYJA 5FQ0A 3QOPA 3U4XA 4CYDA 4DQAA 1PNFA 1D0GA 2EAKA 3VKNA 2VOXA 1WCSA 2VMHA 3VZKA 4JCKA 2VNGA 1FI2A 4U2AA 3MIBA 3N7JA 1QNYA 4XEZA 4N53B 4YZ1A 2A71A 3AFGA 4HMZA 4IESA 3NV2A 5DXDA 2ET7A 1AR71 4I30A 1YLLA 3T2TA 2D40A 2LTNA 1PK6B 1PO13 1YHFA 2JJ6A 4QPGA 5FTTC 3ZN4A 4GB31 4WVMA 2XL7A 3MICA 5FPZA 2A5ZA 4M3CF 1VALA 2VW1A 5DDJ1 3IDCB 2Q30A 5LK7B 3L2YA 1PHMA 1TMF3 3OBTA 4XJZA 4QU2A 4N43B 3LAGA 1WLDA 3IIAA 3O0VA 1S2BA 2OW4A 3RG0A 2BPA2 3MW2A 5CFDC 1YJKA 2C5DA 3S30A 1WBFA 3AZWA 1NLSA 2Z79A 1S0EA 1YIPA 3NV3A 2VVDA 2NM1A 3NO8A 3K48A 4TWTA 4R52A 2Y38A 2UWBA 3D6EA 4XF3A 3WHUA 2Y0IA 1GLHA 4OI0A 4HKLA 4B4PA 1OLQA 2DF7A 4GQ7A 2ZGQA 2R32A 3CL1A 2WT1A 4H7LA 3V64A 2BWAA 1VJ2A 3N35A 4EN6B 2ERFA 1ENRA 1MS5A 1XNDA 4WZFA 1OQ1A 1QQP1 1UIKA 3SH5A 2CYFA 1FATA 1ALYA 3E5XA 4LUKA 3I59B 3SCFA 3DGTA 5E16A 2GC0A 4P9WA 3MF9A 2WZR3 1R1A2 1V6NA 5FMOS 4UBGA 2B45X 4AI0A 4KG0A 4YNIA 3NKTA 3WV6A 4AK3A 5FCCA 2ZGUA 4B3NA 4HVQA 4FQZA 4H55A 2EVXA 2GH2A 1NOVA 1RUC1 3MW4A 1V6LA 4MXWA 4KGGA 4XIOA 2XLAA 4ASLA 3I59A 4R8HA 3OJBA 1OQDA 4IETA 5C6CA 3WP5A 3N4MA 3ZVXA 4H7MA 1U0AA 1AR72 1Z7S3 1X8MA 4CDQC 5GLWA 4CP1A 2Q0AA 2Q5TA 1SLAA 4C1WA 1W6QA 2VQ0A 4KWJA 4WV8A 1GNHA 1NXMA 5FLHA 1LB2A 3NAPA 4F7ZA 1NCQA 2MPFA 4FOWA 1EV12 2PHDA 1YIFA 5K0UC 1AX2A 3VBOB 3S7EA 4Z8BA 3IKWA 2CV6A 3ILNA 4I09A 1D0HA 1SBFA 1UF2C 2GDFA 2IXLA 4IEUA 4YLZA 3TN93 3VZLA 2BTVC 4YW1A 4WM7C 3KZ4C 1FXZA 1I6XA 2GU9A 3IWZA 1FOD2 3B9IA 2YUEA 3WG3A 4YVWC 4TYSA 3SISA 1ND3B 2PLV2 5GLTA 4COYA 1VBC1 4RD7A 4BA6A 4CEYB 2ZZJA 3B3QE 2RS31 4GKYA 3HWJA 1QMJA 1GNZA 1HX6A 3IDBB 4KQ7A 4K40A 4DY5A 3E6CC 2ZHNA 3EQEA 4AEDA 4CDQB 2ZGOA 1PVXA 4QPIC 5EYXA 4UW6A 2QUOA 4ISQA 4LNVA 4CDWC 3NV4A 4S2HA 4J1WA 1LHOA 1MACA 3JZVA 3LKJA 1FPN2 1V6IA 3ZXJA 2N7GA 4AFCA 4BMBA 3WG2A 2O8OA 5C4WA 1RUH1 4MGIE 2CWSA 5BNOC 3VBUC 2XKPA 4XILA 4AVAA 2AYHA 4G4FA 5DDJ2 1QHDA 3WXPA 1VAKA 1QF3A 4P9XA 2VQAA 1B35A 4AHYA 3WDWA 4HKOA 4E27A 1Y7BA 1CGPA 4CTEA 3GZAA 2K9ZA 3ENRA 1AXZA 2E6VA 3PJYA 1LESA 2GN3A 1MQTB 2JKBA 3C2UA 3FMGA 3SLIA 3M1HA 3HIFA 3VBRB 2VW2A 2UY8A 2AGSA 4BWOA 5KBFA 4QXKA 4ORFA 4S2GA 2Q8OA 2IXCA 2ZX3A 3TNQA 2C9AA 1AR92 1RUJ3 2PHLA 1PMIA 1R092 1O3QA 5KXBA 1CAXA 2XB6C 1OA4A 1W6MB 5I0TA 2ZX2A 4YFZA 1JXNA 1OPOA 2ZS6B 1C3HA 4HN0A 1VR3A 3D8CA 5EWSA 2WZR1 3KT1A 1HRV1 5JWPA 4A7YA 1TME3 5I0SA 4E2GA 2V09A 4RS5B 3WQ1A 4Q4Y2 1H30A 2XVLA 2ZMLA 5H9QA 1HLCA 2WIIB 5LEJA 2GC3A 1DZQA 4TLFA 1AJKA 2VXRA 4BH9A 3KCXA 2HWC2 1XNBA 1SLCA 5FMOL 2EAAA 2OIIA 1VBC2 2ZX1A 2XJTA 5C33A 3AP4A 3DL3A 3IDEA 5JPNB 4UBHA 1BVP1 2K2SA 1VRH1 4YGCA 1URXA 1HRV2 2ZGRA 3ZX7A 1UMZA 4HT1T 2E51A 2R16A 1N1YA 1JOJA 4M3CA 1NCRA 2X5IB 1FMD3 3APBA 4OHYA 5I93A 4JRAA 1BKZA 3B00A 1Q5OA 1FNZA 5A3MA 1LOFC 1SCRA 2RJKA 3HD8B 1Q8QA 1COV3 4QGLA 4XHXA 1APNA 1AXYA 1COV1 3I54A 1CPNA 4LHLA 4QQLA 5BXXA 3VZJA 1C5HA 1PIV1 1LHNA 2R6QA 3ELNA 5CIRA 4QM9A 2ZMKA 1B35C 4TSVA 3ALQA 4GB33 1ZYBA 3ZFEB 1CAVA 3WG4A 5BNPB 4QPGC 1Q8PA 4LO4B 1VBB3 1OOPC 3ATGA 4YGBA 4HL0A 5BUVA 3ZYIB 1AX1A 4CRQA 1AR61 2YDEA 4QQ2A 1ZX5A 1OMIA 2BVVA 2Z5WA 3WDYA 5JIUA 3RWNA 2QDNA 3RRDA 5L19A 5C9AA 4RS5A 1H8TC 2ZGTA 4OHZA 3VBSA 1LR5A 2YGLA 2WNUB 2AREA 2B8MA 3ZPYA 4CEWA 4DNYA 3H3ZA 2XUMA 4I02A 4OUMA 4FTSA 2NQYA 1A8DA 1LOFA 4Y1VA 1PO21 2YMZA 1QJY1 1EYBA 3P3PA 2P3IA 4BMEA 1EAH2 3ZFGA 4TZDA 1C8M2 4QQPA 5K9YA 2VUAA 4RQPA 4JGZC 4XDQA 1RUI3 1V6KA 4UXAA 4C90A 1ND3A 5JR7B 3RJ2X 4BE3A 2NZ9A 5DZFA 4HPKA 1KFUL 2XVKA 5C9AB 1CD3G 2X53S 2G4IA 2XHKA 2GSYA 2DU0A 1DGRN 1WW6A 3R05A 2A6VA 5E89A 5FRAA 1NCQC 4YW3A 2GZWA 5B2GB 1FMD2 5FO9B 1QH6A 2PN5A 3ZN6A 1CJDA 1KDKA 5D8AB 2Y0OA 3ST7A 2D7FA 1XU2A 2XBO3 3IT8A 4FO9A 1C4RA 4B7EA 2XBO1 4NN0A 3AMNA 3O0WA 1OA2A 4U36A 5J96B 3AK0A 4N9HA 1I1EA 1QY4A 3MIGA 4COZA 4DPNA 4QX5A 4GA9A 1JW6A 3WDUA 1WCDJ 5T50A 1QJY2 1UIJA 3DV8A 1BK1A 1KDMA 4IERA 5EZWA 1KRIA 1WBLA 2ARXA 5JSOA 2H0VA 4INDA 4L97A 1DQ1A 2UURA 4Q0QA 2UYAA 5JOXA 1QJX2 3AKPA 3SITA 2WS91 1ZNPA 5CFCB 5I91A 3MZHA 1Z7S1 4IEYA 2ZABA 1AVBA 1IZ3A 2AENA 4ES9A 1JHNA 2DTWA 5F5QA 2QVSB 4R4ZA 4Y1XA 1RMU2 4YVSB 1PGL1 1AR93 4Q4Y1 3DPRB 1ONAA 4L92A 4OUSA 2XJRA 3JD72 1HQWA 4KGQA 1E57A 3AB0A 4PLOA 4B4RA 4HZFA 1S0DA 2EIGA 1RUC3 3AKQA 4K6BA 1YJLA 2OPKA 3OGJA 1JUHA 3VKFC 3RZZA 4COVA 3AZZA 5A33B 2BEOA 3I7DA 1WMDA 2CY6A 4OHXA 3ZSMA 1JYIA 4XZPA 2A70A 1RHI3 4PDWA 2WWSA 3E6DA 1AR63 4IV3C 1CESA 4K1ZA 4LLOA 4E4DX 2VPVA 3M3QA 2ZHKA 5D8AC 2WSUA 5E8AA 2K0GA 3FZ3A 1HQLA 2P37A 4PDWC 2AR6A 2VULA 1WW5A 5ACA3 4AWDA 1KXGA 4GULA 1RUJ2 1TNRA 4RHV1 1ZRFA 2XLFA 3CU7A 5A33A 1ZA4A 3TB0A 2B46X 2QZ2A 3OBRA 2EXJA 3GBGA 1HXS2 4CEWB 4HBNA 3HT1A 1V6JA 4X6QB 4FXGB 5GM0A 5BV6A 3CJIB 1XQNA 1ZZBA 1ENSA 2WS92 2ZGPA 4C1XA 3U0ZA 1Q3EA 1R083 4LBQA 3DKWA 4KH9A 3AMMA 1UKGA 4XFAA 1VBB1 3V65A 1LEDA 2JX9A 2IXHA 4Y1YA 1QJZA 1LECA 1KS5A 1IHMA 1ZBE3 4QHBA 5AFEA 4LTAA 4RQPB 2XG3A 3WT3A 1J3QA 5GJ6A 4Q27A 1DQ6A 3FE5A 4MSVA 5J37A 4LUMA 2VVFA 1LENA 4XTPA 1AX0A 3A4UA 3SCHA 4WM8A 3ZFEA 4DRRA 1QXJA 3MIHA 3ZSJA 1MS0A 5KHIA 2DCJA 4Z1VA 4F8AA 2DVDA 3SCGA 4YVWA 3PJQA 1C8NA 2DFBA 3SMHA 2PTMA 1HRV3 1AL21 2DTYA 5I0UA 3OYWA 1CN1A 1YXWA 2ZCWA 2R061 1VBD3 3IN9A 1GSLA 2ZGMA 1WLTA 2D5FA 4D7TA 3B7MA 2CL2A 1VBE2 2QZ3A 2RR12 1F5JA 2D97A 1H9WA 2RE9A 3H8UA 3OD4A 3WP3A 1RUE2 5KC5A 1GV9A 5LRRA 1J1LA 4AI8A 2WA3A 2V73A 4AGVA 1RUH2 3T1LA 1OSGA 1C8M3 4AVVA 1QOSA 4Q4W1 2W68A 1ASJ1 4FPLA 1EAH1 4E9KA 4CDQA 1Z0HA 4PCRA 2GAUA 3AKSA 3UJQA 2BBVA 1RUF1 1MVQA 5DZEA 3AP9A 3W58A 2MEV2 1Q8VA 2TUNA 4DXZA 3WZ1A 3WOGA 4FAGA 1U5YA 1PO11 1JN2P 4BIFA 3WW1A 1W6PA 1GZ9A 2O8QA 4OI2A 2RHPA 5BNQA 1OPMA 2JG9B 5GZGA 1QJX1 3L9JT 1HRI1 1YO8A 1AR83 2DV9A 3GBWA 3IM0A 3LA2A 3VBHC 2WNUA 1O91A 2D3SA 4DB5A 3ROUA 4Y26A 3OF1A 4IQPA 3MF6A 3EXUA 4GB32 1PZ9A 1RGSA 2XH6A 4AVCA 1AZDA 2JDZA 2QE3A 3NV1A 3VHRA 2WQ4A 4LBQD 1M4WA 3MI8A 3RI9A 1G8WA 4Z82A 4Q8KA 4JDMA 1RUE1 1WW4A 4AEMA 3AZVA 5EV7A 3VHNA 4DMIA 4MGKE 4RHV3 3PVOA 1F31A 4ZKTB 2QFEA 2B5HA 1ULDA 2FQPA 4XOGA 1GKBA 2JE9A 3KS7A 3ES1A 4A7ZA 1ND2C 2FHRA 4AQSA 4LT5A 3A0NA 4C91A 3WW3A 1ZZ6A 1G9BA 1V9U3 4LBNA 4L11A 4W6YA 1YNAA 3Q9OA 3D82A 1NCRC 1IPKA 1CVNA 3D5OA 1KD7A 3JUUA 3ZFFC 4AHWA 3FLPA 1C57A 4FTBA 2RS33 4Q26A 3VBUB 3WCRA 5BNOB 4OULA 3RI8A 3BPZA 5ABJA 3WUCA 3M7AA 4LE4A 4EN7B 1ZBE1 1YCIA 2IC1A 2XGXA 2YPJA 1SBEA 1W2UA 1ZZ8A 5JZGB 4LO6B 4PDWB 1NY71 1A8MA 1DQ0A 5GZCA 1X50A 2WFF1 3OTFA 1X7NA 2HWE2 1OOPA 1GQGA 3WP6A 3X29B 1W6NA 3RS6A 5BY5A 1XYNA 2UYBA 3NAPC 4Q1PA 3MLJA 3VDDA 4EWAA 5JCTA 1QNWA 1LOAA 3PNAA 4XFFA 5JSRA 4FXKB 3T1MA 1PO12 3PLQA 3OY8A 1N1SA 2JEMA 2WL1A 3MIDA 3UKTA 2QDRA 1IS6A 1ND2B 1VAVA 5GLVA 3M3EA 1VBE3 3PHMA 1PZ8A 2VOWA 1LJ7A 1LHWA 3AM2A 5L7OB 5CU1A 1UX6A 5JI9A 1NQJA 1BJQA 3WW2A 3B69A 1PIV2 3GZTB 1VAMA 3WD5A 2A3YA 1EP0A 5HBAA 2I45A 2JG8C 2MEV3 2JG8B 2ZX0A 1DQ5A 5JMCA 3B5LB 3EJKA 2D6NA 1R1A3 5A3LA 2R062 1SACA 2VVEA 3WINE 4V1PA 2WA4A 3LZZA 5K0UA 4A2UA 1DGRA 4XQDA 1H9PA 3B9CA 4XPVA 1HKDA 2D3PA 1NZCA 1VBA1 2MNGA 2RR13 4YW2A 1ENQA 1PGL2 3OGGA 1LU1A 4EV0A 3ZXKA 4B29A 1S0CA 4PQ9A 1RJ7A 3S7IA 4KU7A 3O5SA 2F6BA 3ZIWA 2HWC1 2EXKA 1VBD2 2FZ2A 3NAPB 2IZWA 1X33A 1RUOA 1RUF2 1ASJ3 4HFSA 1SDWA 1NE6A 4OI1A 4AHZA 1DGLA 1O4TA 3AYCA 2R49A 1RVF2 1Y43B 4HK9A 1VBA3 1TQ5A 3C3VA 4P5HA 3VUOA 1BBT1 4QT6A 2ZKNA 3VHOA 2PAEA 2G9GA 4N9IA 4P9LA 1RUH3 1U5ZA 1H1MA 2ZHMA 5CVRA 1REEA 2A3WA 2O1QA 4QQHA 5C9AC 1REDA 1SMVA 4FT8A 1IKQA 5FBZA 5DUWA 1RUI1 1WLCA 1W0OA