2RS11

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1100
2RMU3 4IV3A 1SMVA 1VRH3 4RHV1 3VBFA 4N53C 1AR93 1MQTB 3S6PA 5AC92 5BNOB 4NWVA 5BNNA 2WLPA 4Q4Y3 4RR3C 1NOVA 1TME3 1R093 3VBRB 5AC91 1ND3A 2PLV3 1AL22 5C8CA 1ZBE2 3ZFEA 1BEV2 4CDXA 1HXS3 1AR72 4IV1B 1AYN1 1FMD3 4Q4W2 5A32B 1RMU1 3DPRB 1AL21 3JBG2 1ZBE1 1BEV1 1C8M2 1ND2C 1RUE3 5DDJ2 2XBO2 1EAH2 1AR71 1RVF2 1X36A 1VBD1 2HWD3 1K5MC 4CDUC 1HRV1 3JBG1 3JD71 1C8M1 5DDJ1 1PO12 1RVF1 1ASJ2 1RHI2 4CEWA 3HAGA 1H8TA 4CDWC 1PO11 4N43A 5K0UA 5ACA3 1HQNA 1ASJ1 1RHI1 2ZTNA 1QJU2 4RR3B 2WZR3 1RUD2 2HWE2 1ZBA3 4Q4V2 5FMOL 5JZGC 2RM23 2RS52 2BPA2 1QJU1 1RUF3 1RUD1 4CEYC 2HWE1 4JGYA 4Q4V1 4Q4X2 2HWB1 5C4WC 2RS51 4YVWA 4WM8A 1NCQB 3J8F2 1ND2B 1QQP1 2X5IA 4Q4X1 1Z7S3 1FOD3 4WM7C 1K5MB 5FMOS 4CDUB 2MEV2 3J8F1 4RFT0 4PDWA 1GFF2 5FOJB 1BMV2 4CDWB 1PVC2 3VBFC 1QJX2 3ZFGA 3TN93 4GH4C 1D4M3 2RR13 2FZ1A 5BNNC 3CJIA 1AYN3 1IHMA 1RMU3 2VQ0A 4AEDA 1MEC3 1QJX1 2BBVA 4GB32 3VBOA 1FPN2 1VBD3 4CEYB 5C8CC 2WFF1 1NY72 3ZFEC 4CDXC 1HRV3 1PIV1 3JD73 2HWF3 4FTBA 1FPN1 1RUJ3 1BBT1 1NY71 5BNPA 4CDQC 3ZFFC 2RS11 4WM7B 1POV1 3VDDA 1V9U3 1RUI3 2WS93 1QJY3 4YVSA 1R082 1EV13 1C8NA 1R1A1 1VBE3 4CEWC 5GKAC 1PGL2 1H8TC 1COV2 4QPIA 3VBFB 4RQPA 1R081 4N43C 4RS5A 5K0UC 4GH4B 2R073 3VBSA 1VBB3 3VBHA 1AR63 4GMP3 5BNNB 1AL0G 1PGL1 2HWB3 3NAPA 5CFCC 5C9AA 2R042 1QQP3 2R063 1ND3B 5CFDA 5C8CB 3ZFEB 4CDXB 1RUG2 4SBVA 1HRI2 1PO22 2RS32 1OOPA 4EJRA 1B35A 4CDQB 2X5IC 1AYM2 3ZFFB 1NCQC 1RUG1 1TMF3 1HRI1 1PO21 1VBC3 2RS31 2HWC3 4Q4W1 1AYM1 4PDWC 1QJZA 2XBO1 4CEWB 1EAH1 1QJX3 1H8TB 2TBVA 4N43B 5K0UB 1VBA3 3ZFGC 1NA1A 2WFF3 5A32A 1PIV3 3CJIC 1OPOA 2WWSA 1CD3G 5CFCB 1FPN3 1F2NA 1BBT3 2RS13 1RUC2 1RUH3 4JGZC 1AR82 1R1A3 4WM8B 2X5IB 1RUC1 1F8VA 2RMU2 4N53A 4GMP0 1AR81 1VRH2 4RHV3 4RR3A 1AR92 4QPGA 4YVSC 4PDWB 2RMU1 1WCDJ 4Q4Y2 3IDEA 3VBUA 1VRH1 1TME2 1R092 4IV3C 4QPIC 1AR91 2MEV1 4RS5C 3ZFGB 2PLV2 4Q4Y1 5AC93 3VBHC 3CJIB 1HXS2 1TME1 1R091 1FMD2 3NAPC 5C9AC 1BMV1 2IZWA 1PVC1 2PLV1 1VB4A 1AL23 1ZBE3 1K5MA 1RUE2 5CFDC 1HXS1 1BEV3 1PGW2 1AR73 1ND3C 1FMD1 2HWD2 4Q4W3 4JGZB 5A33A 3JBG3 4GB31 1OOPC 1C8M3 5DDJ3 2XBO3 1EAH3 5ABJA 1B35C 1RVF3 2HWD1 5L7OA 3VDDB 2ZAHA 1PO13 4YVSB 5ACA2 1ASJ3 1RHI3 1NG0A 5JZGA 2WZR2 4IV3B 1ZBA2 4QPIB 2RM22 5ACA1 4RS5B 2DF7A 1RUF2 1NA1C 1QJU3 3VBHB 5C4WA 1RUD3 1ZBA1 2HWE3 3NAPB 4Q4V3 2RM21 5D8AA 1A6CA 5C9AB 1COV1 2RS53 1RUF1 4WM7A 1NCRA 3ZXAC 5CFDB 1Z7S2 1FOD2 4Q4X3 4JGYC 1OOPB 2R041 3J8F3 1B35B 1Z7S1 1FOD1 3JB8A 4WM8C 4YVWC 4BCUA 4GH4A 5LK7B 2MEV3 2QQPA 1W39A 5J96B 2FZ2A 1MQTA 1VAKA 3TN92 4QPGC 2GSYA 5BNOA 2XPJA 1D4M2 2RR12 1AYN2 3VBUC 1OHFA 1RMU2 4Z92B 1CJDA 1MEC2 1PVC3 1X33A 3TN91 3VBRA 1D4M1 2RR11 1NA1B 5J98B 1VBD2 4IV1A 1HRV2 1MEC1 4FSJA 3JD72 2HWF2 3DPRA 4GB33 4CDQA 3ZFFA 4AEDC 1DDLA 1RUJ2 3VBOC 2HWF1 1POV3 1V9U2 1RUI2 4JGYB 2WS92 1QJY2 1RUJ1 1EV12 5ABJC 4YVWB 1VBE2 5L7OC 4N53B 5BNPC 4Y4YA 1V9U1 1RUI1 2WS91 1QJY1 3M8LA 1EV11 1R083 3VDDC 1E57A 4QPGB 2R072 1VBE1 1VBB2 5CFCA 1AR62 3VBUB 2HWB2 1COV3 1AUYA 2R071 1QQP2 1VBB1 1AR61 2R062 4GMP1 2BFUL 2BUKA 4RQPC 3VBSC 5D8AC 2R043 2R061 1VB2A 1NCQA 4AEDB 1ND2A 1NCRC 3VBOB 3JB4C 1TMF2 1RUG3 4CDUA 1M06G 1HRI3 4Y5Z0 1VBC2 1PO23 2RS33 2HWC2 2BFUS 5A33B 1AYM3 1RUE1 5ABJB 1TMF1 1PGW1 2Y26A 5L7OB 5BNPB 4FTEA 1VBC1 2ZZQA 2HWC1 4CDWA 1RB8G 1MQTC 1VBA2 2WFF2 5BNOC 4FTSA 4NWWA 1PIV2 5JZGB 1POV0 1VBA1 3LOBA 1BBT2 3VBRC 3FBMA 4CEYA 4RQPB 2RS12 4JGZA 5C4WB 4IV1C 3VBSB 2WZR1 1RUH2 2GH8A 5D8AB 3DPRC 1R1A2 1NCRB 1RUC3 1RUH1 4LLFA 1HX6A 1AR83 4RHV2
chains in the Genus database with same CATH superfamily
4XQDA 2VZVA 5DABA 5A3WA 1H2MA 4XTMA 4PLMA 3N9NA 2PQSA 2JG9A 5L36A 1BCXA 3ZYRA 1MQTB 2A6XA 2JDHA 1UCXA 3HT2A 3OGGA 5BNNA 2WLPA 3KD4A 3WNNA 2JDZA 4LHKA 2JXAA 1OKQA 1VRBA 3QOPA 1TME3 1VJ2A 4E2QA 4NIIA 1AX2A 1FNYA 3VL9A 2O8QA 1F35A 2V5DA 3HIFA 3T08A 2EAKA 2EICA 5FXXA 4DZGA 1GZCA 1HXS3 1DQ6A 2QZ2A 3R4UA 2OVUA 4FFGA 4K20A 4RYDA 5FYHA 4JHZA 3ZPYA 1F31A 1NE4A 4UWDA 2WFPA 5A32B 2KM2A 3UNPA 4F8AA 5JPNB 2VTFA 4FPJA 4QM8A 5FBZA 4HVQA 1RUE3 1WMFA 2W1QA 1B09A 3UL2A 2XBO2 5DG2A 1UO9A 1X36A 2ZAAA 2QFEA 4MGSA 4YWAA 1QHDA 2QQLA 2VBBA 4LHLA 2DURA 2C24A 5T54A 4KGGA 5JR2A 2RJKA 4PJYA 3HQRA 4QXKA 4A44A 3KT1A 1BLZA 3BTAA 1CR7A 4FPEA 5FY5A 3AJZA 2OX0A 5C33A 3LEGA 3GYDA 4KI5M 5F5AA 5K0UA 1UY1A 3LPGA 1LGNA 3CL1A 4IEXA 2X8KA 1DGLA 4DUXA 1FV3A 1HN1A 4CP9A 1JZ3A 1IQDC 1IKQA 2DCJA 3KCCA 1UXXX 2WDBA 4JCKA 3V0BA 2HWE2 3OGRA 3PU8A 2DUQA 5A80A 2ZGPA 4A41A 4B8EA 4COWA 3S0MA 4EYUA 3LIHA 2NZ9A 1CZTA 2E53A 4COUA 3EYPA 1I1EA 2F4PA 1KEXA 2ZGKA 1VAVA 3NL1A 5CB7A 2HWE1 2XVKA 4FFIA 3WCRA 4AFAA 3THDA 3ZMNA 4EWAA 2HWB1 2RVAA 1YQCA 2RDQA 1F5FA 1XQNA 3J7LA 5HV4A 4HPKA 1N1VA 3LCPA 1XYOA 5BUVA 2WWJA 4YVWA 4QDSA 1RXFA 5A6ZA 1QQP1 5D1IA 5DZFA 2J42A 3RG0A 1STMA 4QXCA 4L9BA 2NPIA 4NMIA 4Y20B 4YW3A 5FMOS 3N3HA 4LORA 4LIVA 4CDUB 2JIGA 4AI8A 4C1XA 1E5SA 2MEV2 3P6BA 1YEWA 4B4PA 5KWRA 3H42B 3DGTA 1GFF2 5FWJA 5FYSA 1XU2A 1OVSA 3ZKYA 4F7ZA 5FOJB 3T1MA 2FMDA 2YBPA 1QNWA 2Y38A 1OA2A 2YB7A 1ST8A 2RR13 3R4SA 3LD8A 3RJRA 4DRVA 2OXBA 2Z79A 1W3XA 3NNLA 1IHMA 3AP9A 4OI1A 3ROUA 4ARYA 4OQ8A 2VXRA 3LKJA 3BIEA 5FJKA 4QQPA 1MEC3 3WW1A 2BBVA 3T30A 1G9BA 1OD5A 3VBOA 2GZWA 1G86A 5T52A 3C7HA 2Q5TA 1WKYA 3NMBA 4PLNA 4AQ6A 4CEYB 3PIJA 4BQXA 5IJRA 5IFPA 3RZKA 4AL9A 2P3YA 4IGPA 4QX0A 5E89A 3H8XA 2HWF3 1QXPA 2R0HA 4KWJA 4BH9A 2WQZC 4IGQA 4E9KA 2QDNA 1W9WA 4KWLA 2YY1A 4CDQC 5JSPA 5IK5A 2D3PA 4IEPA 5LY1A 4B1LA 2GP3A 1VR3A 5EJ3A 3P3PA 3I2DA 3VDDA 3ZYGA 3CO2A 1DIWA 4XAEA 3TAYA 4LIUA 1W2NA 4MLOA 3R0RA 2VXJA 5JCTA 2Y60A 5JOYA 1VMJA 1GYKA 5IYYA 4AE2A 5KHKA 4FFFA 4LHNA 2J1RA 3AKSA 1D2QA 2GN3A 5FZ1A 1ZX5A 3RMXA 1PGL2 4KGQA 1Y9QA 4L99A 1UKRA 1N3PA 2BW8A 4OUSA 3VBFB 1RL3A 1DF0A 3ES1A 4XETA 4AEJA 4W6YA 1XNCA 1Q5OA 1SACA 1DQ2A 2VQUA 4DPNA 1XPWA 1PGL1 2HWB3 4I3PA 3B02A 2BWCA 3WY6A 1GQGA 3I2GA 1ENSA 4A6OA 1KJLA 1L7QA 3S7IA 3FL7A 3RNSA 5CZKA 1QQP3 2ZEWA 2R063 1ND3B 2Q0AA 5CFDA 3KS7A 5C8CB 4C0BA 2UWCA 2TNFA 5DAQA 2IWGB 2ZJCA 4LNVA 3WINE 5HXVA 3WG2A 4M0HA 1RGSA 2RS32 2PQQA 4HXCA 3I49A 2ZX2A 1DGRN 3B9CA 3LF7A 1JXNA 3NW4A 1CIYA 1TMF3 1R1ZA 4XFAA 5DAVA 3T2OA 2OZJA 5LA0A 4OHWA 1OMIA 3VKNA 1VBC3 2RS31 4AOCA 5A3MA 5D2AA 2HWC3 2ZGLA 1J3QA 2R49A 5F2SA 3WG3A 4EZ4A 2XQXA 2PHLA 4PDWC 4QB1A 4META 3CJXA 1NYWA 1QJZA 2G1MA 4CEWB 2PHUA 1W6QB 2ZX3A 5IFTA 3NVCA 2E33A 1FATA 4KG0A 3ZXDA 1UZZA 2FCUA 2E31A 2W0XA 3ZFGC 5FZ4A 3MFAA 5EYXA 3WD5A 4DO0A 4W65A 2TEPA 5A32A 3KQRA 1OPOA 2WWSA 1DZQA 1E5HA 1UYYA 1CD3G 2C9AA 4Y1YA 5CFCB 4Y1ZA 1GANA 1F2NA 4XZUG 4C1WA 4Z82A 3D6EA 3OUHA 2XG3A 2ET1A 4MX3A 4NIDA 1VMFA 1RUH3 3DL3A 4NUBA 5LA9A 3OY8A 2BP6A 4JGZC 4PBOA 1AR82 2W47A 4XOGA 5A7OA 2Y64A 3HN1A 2X5IB 1OLQA 3TYJA 4HANA 2GC3A 1EP0A 4IL7A 4ITCA 4N53A 4YNIA 5I0DA 3TNPB 2C0ZA 1AR81 3OGSA 4LITA 1VRH2 5F32A 4NIHA 3ZSEA 1MZFA 3ZSLA 1GZWA 4TXWA 4RGKA 3ZX7A 3GGLA 5APAA 3H9AA 2VTXA 3I3EA 4QU2A 4GJZA 4GKYA 4BQWA 2IFRA 2P17A 1VRH1 4YARA 3UGFA 4I0AA 3WP4A 1CAWA 4EWDA 2BGOA 3ZN6A 3X29B 2ZACA 4Z8BA 2PLV2 5LBCA 5AC93 3LWCA 1EPZA 2VOXA 1UKGA 3CJIB 2VM9A 5I91A 1NAEA 1W6MB 4YG0A 3POSA 3AKRA 5SV5A 1PZ7A 1HJFA 4QGLA 3WDWA 2XB6C 2PLV1 5CYYA 4KMQA 1VB4A 1OH3A 1ENQA 1AL23 2W91A 4QKNA 1ZBE3 2BVBA 2YBSA 3AMMA 2WT2A 3RYRA 5L9BA 5GZGA 1ND3C 2W2IA 3AFKA 3GJBA 2HWD2 4N9HA 3NNMA 3WHTA 5F3CA 1F15A 5FR3A 5A3OA 4XW3A 4CRQA 2VCAA 4PHZA 2WZ8A 3O1PA 2J1VA 1WCSA 3IAPA 1H30A 1OOPC 4LQRA 3V56A 4DUWA 1PK6C 4M01A 1PM7A 3NV4A 5DDJ3 3P3NA 2X10A 2YPJA 4I09A 4CCDA 5ABJA 2HWD1 1S2EA 3THTA 4CPBA 3VZJA 2A1XA 4Y5SA 1MS8A 1C5HA 1SLLA 1H9PA 2ORXA 2V73A 5JSOA 1W8FA 2CYFA 2WN2A 1JYWA 1IPJA 2BNMA 2RHPA 2XJSA 3APBA 2HEYF 1IGOA 1WZXA 4Q0QA 3PUQA 4ZU7A 1RHI3 5JZGA 2JG8A 4YGCA 4LK6A 1IS6A 2WO3A 3E5UA 5H9SA 1W2OA 1GWKA 5LA2A 1IPKA 3T0DA 3HR9A 4RS5B 3PURA 4Y4RA 4FOQA 5BV6A 4EV0A 3T4HB 1OBNA 3VBHB 4UYBA 4AVAA 2RJ2A 3QLQA 4ASKA 1K3IA 4H55A 3TWIA 4M4PA 2WWUA 2QQUA 3ZYHA 2XUMA 4UI9L 3NAPB 4P9IA 3WF2A 2CDOA 1HDKA 3PDQA 2OPKA 4N8MA 4DXSA 2GN7A 2H6BA 1OURA 2EXJA 4MGKE 1WD3A 4AHXA 3H1YA 2QQVA 3PUIA 4YW5A 5FZ3A 4RSUA 1FOD2 3AMNA 4Q4X3 2VMDA 3MIEA 5FY9A 2W1SA 4JGYC 2QQOA 3MW2A 1W6NB 4U2AA 4AEMA 1D4VB 1DG6A 1B35B 1FOD1 5E88A 1V6IA 1QOTA 5IVFA 4QT6A 4CXYA 5FY4A 2DVFA 5DUXA 1UMZA 2ARBA 1S2KA 2XHNA 5FJHA 5LWBA 1W39A 2QQPA 2D3SA 1SFYA 4COVA 2FZ2A 4CUAA 4QPGC 5BNOA 2AZ5A 3PVBB 1D4M2 4BU2A 4Z1VA 1Q8SA 4XIOA 4A7KA 2Z42A 3M3QA 1UIKA 4XC9A 1OD3A 1OHFA 2OZ6A 3AZXA 3VBUC 5EV7A 4KU7A 2ETEA 3KGLA 2O14A 4ZPIA 1D4M1 1Q8OA 1NA1B 4UBHA 5J98B 2VMIA 2EIEA 2HBUA 5LATA 2AREA 1ZRDA 4E27A 4LOSA 2B5HA 4FSJA 4P9WA 1SPPA 3DPRA 5KC5A 1WLTA 1LKNA 2C9KA 3CLPA 4K1ZA 1W6OB 1DDLA 2ZGQA 3ABZA 3CNAA 3ZSKA 2PAKA 3WLUA 1Z78A 3VDBA 2CSGA 2WNEA 2I2SA 3FX3A 5JI9A 1PHMA 1V9U2 3K75B 2W1WA 2ORZA 1RUI2 2YGLA 4QQLA 4XBNA 1UL9A 1W6QA 5A6QA 1ODNA 2Q4SA 3H1MA 1HB3A 1QGLA 5FUPA 1CESA 1VBE2 3VD7A 5L7OC 4CTEA 3I54A 4I0WB 1V9U1 1U12A 4Y4YA 2JKXA 3NJXA 1RUI1 2WNVA 5LK5A 5FP4A 5CEHA 2D98A 3AXEA 3M8LA 4BK4A 3MW4A 4CU9A 4IEOA 1R083 3MBWA 4UW3A 1ULEA 2ZCWA 4U36A 1VBE1 1LOBA 1VBB2 3CQOA 1OA4A 3KV9A 4E8CA 5CFCA 3MV01 1CAXA 1HB2A 1MS0A 5EJZB 4CUCA 4H3WA 4L8QA 4UFJA 4XDPA 1CGPA 1W6PA 2D43A 3O0XA 1XE7A 2JDMA 2OUJA 1VBB1 4PQ9A 4XJAA 2P37A 4FPHA 4GMP1 1SLBA 1ULGA 4QMAA 3SKVA 4BQ4A 1I9RA 4K21A 3ACHA 2PHRA 4HVOA 4XQ4A 5LCWL 5H9QA 2PFWA 4CCNA 5KXDA 1NLRA 2ILMA 3MI8A 4LO4B 1JI6A 1VB2A 1NCQA 3ACFA 3KWVA 4TYSA 4AEDB 2EF6A 4XFCA 3THPA 5LBBA 4K8RB 3BYWA 3JB4C 2C6SA 1O91A 2E32A 4P9GA 4AI1A 4FCAA 2ZMLA 1NE6A 3MLLA 2EXIA 5J09A 2PHWA 1HRI3 4QQOA 1PO23 2PAEA 1PMJX 5F37A 1QJEA 1IS3A 4R9CA 3WVJA 5TSWA 5JUVA 1ZREA 4EQVA 1U5YA 2D93A 4NHKA 1XNBA 4YZ4A 5DPNA 5GLUA 3QH6A 4BIFA 5C70A 2NMOA 4LO6B 3POBA 5T5LA 3N36A 5BNPB 2HJIA 1GLHA 2DUPA 1JU3A 2D6KA 2IXKA 2ZZQA 4K1YA 4YPJA 4FI9A 4EN9B 1JTZX 2XH6A 2XVGA 3K2OA 3FHQA 2CL2A 2ARXA 3ES4A 1VBA2 2XLGA 1J3PA 2WFF2 4FTSA 4XF3A 1GQHA 1TE1B 3K48A 2H0BA 2ET7A 3PJYA 3NKGA 5FLIA 1H1AA 3N9QA 2VZQA 2WRAA 1DQ4A 3BUCA 4AI9A 1LB2A 2ERFA 1BQPA 1XRUA 1VBA1 5EFUA 3SISA 4AI3A 5DUWA 5A7PA 1WLCA 2NM1A 1W2TA 4RQPB 4XMIA 5C4WB 1PX3A 2WNUC 5A3UA 2ZEYA 4IV1C 2A3YA 4CUGA 2WZR1 1GUIA 3U11A 5D8AB 3M1HA 4JX0A 4IEZA 1R1A2 2W87A 5A7WA 3PUHA 1BXHA 1CAUA 2P1BA 1RUC3 2G4IA 2QQWA 3M7AA 4WV8A 3NSTA 1O4YA 2ID4A 4NROA 3AVSA 3MICA 1SCSA 1HX6A 3I8TA 1GNHA 3O5SA 2WZPP 2YGMA 4CP1A 4DFSA 5CISA 2XONA 4RHV2 2OA2A 3T0BA 2FD8A 4OHXA 5EP9A 5JMCA 4D6RA 5F5QA 2JWPA 2R32A 2GDFA 1LTEA 2YMZA 4JDOA 4QDQA 4UW5A 4Z07A 5HV0A 3Q8FA 4QX2A 4RHV1 1F4AA 1UYZA 1OPMA 5DQ0A 3VHNA 4AVCA 2K46A 1RIRA 2WT0A 5AVAA 3WW4A 1AR93 1RTVA 3TOJA 5KXEA 4DEQA 5FUNA 2BV4A 3GALA 4NWVA 4O7XA 4RR3C 1W0OA 5G04L 3I3QA 2NMNA 5J48A 3WOGA 1KFXL 4Q0PA 3ACIA 3SCGA 5A3TA 3VBRB 3OGJA 1NLQA 5FZGA 1S1AA 1X8MA 5JSRA 3LSEA 5FZOA 1BEV2 3ZFEA 4CDXA 2DTYA 4FQZA 3U0ZA 5JI7A 1SHWB 4Q4W2 5I0RA 5FYZA 3M3EA 5FY0A 3JBG2 1GMMA 2QNKA 1ACCA 1BEV1 1ND2C 1IZ3A 1EAH2 4NN0A 1VBD1 5CNAA 1IS5A 1K5MC 2YYOA 3ZKUA 3FZ3A 1LOAA 2ZX0A 3JBG1 3AYAA 1RINA 3JD71 4CPBD 1GOHA 1WA4A 1LRHA 1PZ9A 1SLIA 5DN2A 1QH7A 3ZSJA 1UPSA 4QAWA 1CONA 4XVHA 4JRLA 2YPDA 2JD4A 2R6QA 3OPZA 1H8TA 2JDAA 4CDWC 4N43A 2Y6GA 1XYPA 5ACA3 1A3KA 1S4CA 2ZTNA 3J7NA 5KHJA 4HN0A 1QJU2 2Z69A 3EB7A 1LOFA 3MV11 1V00A 1XNKA 3VDAA 2WZR3 1LAJA 1UY2A 4G4FA 3OOXA 1ZYBA 3OBTA 2YC2A 1Z0HA 1ZBA3 1XNDA 4Q4V2 2XJRA 3C2UA 2RM23 4FP2A 2RS52 1JBCA 4CZSA 1SDWA 1QJU1 2EALA 3OUJA 1JHJA 1AX0A 3KM5A 4K40A 5C3PA 4FOWA 3T1LA 5FXWA 2CWSA 2FDJA 3FLPA 3M4FA 4Q4V1 1WBLA 5F7UA 5C4WC 4J25A 2RS51 4BZ4A 1MACA 3GCWA 5EPAA 4MXWA 3RI9A 3J8F2 1LHOA 1O5LA 1OKOA 1W2AX 3OSDA 1Y4WA 4IW3A 3SMHA 1W8HA 4GWMA 1MZEA 4L92A 3SCFA 3R05A 4ZU5A 4WM7C 3KQ4B 3N9LA 2Y6LA 4XF1A 5JXJA 3M3CA 1O4ZA 1O3SA 4R9AA 1MVQA 2XMLA 3J8F1 1I6XA 2EIDA 2A3XA 3MW3A 3RVHA 1RUNA 4XUTA 3CEWA 3NV3A 5FPXA 4XJWA 2VMGA 1SBDA 1HW5A 5EIYB 3CHXA 4ARXA 1C1LA 1PVC2 3GZTB 4HN1A 4RGAA 3VUOA 5IK7A 4YG6A 3TN93 4QKBA 1GNYA 5BNNC 4IDZA 3WNMA 5I0SA 3HQUA 3M3OA 2A73B 1NZCA 1LENA 2WAAA 4AEDA 1CN1A 1JMUB 3VZNA 4GB32 1FPN2 2ZGOA 4JDMA 3FC0A 4KU8A 4RFRB 1HIXA 1VBD3 1VALA 3AP5A 2DBIA 1NY72 4JHTA 4FAGA 2VZPA 4A3ZA 1Y9GA 4S2FA 4Q8KA 1H1IA 3JD73 4M3CE 2CGOA 2WUHA 3PVEA 4QB2A 1FPN1 5FQ0B 5EYYA 1SDDB 3ZO0B 4DIQA 4FTBA 4ES9A 4G3YC 1NY71 2ZPXA 2XL9A 2WIIB 1EUTA 3K51A 4FPCA 5BNPA 5FUIA 4BQ2A 2RS11 4GXLA 1QOSA 4TLGA 1D0GA 3I3BA 1GU3A 3EBRA 3S30A 3PIGA 2R1DA 1SFPA 2A6ZA 3C7GA 2WS93 2DBNA 4YVSA 1EV13 1C8NA 5A6YA 3WW3A 1MPXA 4UFKA 4HKLA 2VC9A 1LHUA 3PU3A 4DB5A 1GP4A 3UK9A 3ZXKA 4QPIA 3F95A 4RQPA 2UU8A 1V6LA 3FLRA 3UKNA 3Q8AA 2IXLA 5K0UC 1V6JA 1XE0A 3RFRA 2G9ZA 1AR63 5JOXA 4E4ZA 1REEA 2JB4A 3AZZA 3RSJA 2JDPA 2CWMA 3S5AA 3IMMA 4AHYA 3H0OA 3KLSA 1FXZA 3ETQA 2PELA 4YGDA 5C9AA 1LHNA 1DYPA 2R042 4A7ZA 1VE0A 5K8SA 4BQ3A 1F5JA 4QWNA 4WZFA 3ZMOA 4KWUA 3GBWA 1YQ2A 3A23A 3MHZA 4J6GA 3ZYIB 1W8UA 1RUG2 2IVJA 2YDEA 3WNOA 3T2PA 2IC1A 4D7YA 3RPQA 5GZFA 2WA3A 4XJ8A 5FLJA 2VNRA 4EJRA 2LS6A 4CDQB 5IVYA 2ZGRA 3IIIA 1AYM2 1TEIA 5FZLA 5IVVA 3MPPG 5FPZA 1RUG1 5F9TA 1QH6A 5HCFA 3WQ1A 4FAHA 3VZLA 1U5XA 1W9SA 3LEMA 1UD1A 4S2DA 2A6VA 3BPZA 5T5PA 5DAWA 4AK3A 2JE9A 4AQ2A 5F39A 4LKEA 1K42A 1LGBA 1AYM1 2VGDA 4BM8A 4Y22B 2K9ZA 2XBO1 1H2KA 1WW6A 5F8PA 1C5IA 1V6KA 4LULA 4CU6A 2PHXA 1YFYA 4HK9A 1XU1A 3ZVXA 4B29A 3GJAA 3QH7A 4D6SA 4QQ2A 1N47A 3IDBB 1JZ6A 2ZHLA 5L19A 4L11A 3V65A 1FPN3 1WD4A 2DVDA 3BKZA 2I45A 5DAXA 1ZZBA 4V2WA 3B9IA 4ORFA 4XFIA 4NHYA 1A8MA 2XJVA 4CCKA 4DY5A 2RS13 4OMCA 4HVRA 1NQJA 5KR7A 3TEYA 3B94A 3ZYFA 3MIGA 1S55A 3M70A 4Q5OA 4N9IA 4BLIA 4WM8B 3ALQA 3M3IA 4AAXA 1H2LA 3O14A 2VR4A 3LIGA 2RMU2 3SNMA 2R0FA 4GMP0 2HH9A 1VLNA 3CU7A 2QQMA 1CWPA 4D69A 1ZRFA 4AI0A 3KZ4C 4UW4A 4YM0A 4CCLA 2TUNA 3FJSA 2UURA 4A3XA 4F83A 4PDWB 2RDSA 2RMU1 3IKWA 1UQXA 4RL7A 1GOFA 4XDQA 3PMSA 2D97A 4P14A 4Q4Y2 4TSVA 5FPUA 4GALA 1UYXA 2LROA 1V6OA 2LTNA 1K12A 2JKBA 5F3GA 5IVJA 1QDCA 2UY8A 3INAA 4IEYA 4A6SA 1R092 3JQXA 4IV3C 1GSLA 2FDFA 2JJ6A 4IEWA 3Q8EA 2MEV1 3POYA 4MHRA 1DBNA 3K3NA 4NO4A 3ZFGB 4Q4Y1 2E9QA 3H3UA 2W95A 4OI4A 4UF0B 2XKOA 2WINB 1R091 5DZGA 3C3VA 1FMD2 2DDUA 3NRUA 4HKWA 3VDCA 1RUOA 4AZZA 2B45X 1BVVA 5CFDC 1TZOA 3O1RA 1NX9A 2WO2A 4EN7B 3CZJA 1FMD1 1US3A 1XOYA 2QJVA 2WO1A 3HN3A 2NYYA 4JGZB 2GC0A 1W03A 1DQ5A 1LESA 5FBJA 1WMXA 5A33A 1W05A 1K5JA 4Y1VA 3FMGA 2XBO3 3F2ZA 1WCKA 2VUCA 4OZOA 5F5CA 3WG4A 3HQXA 2WQ4A 2GMPA 4YW7A 1FI2A 1UZ0A 3AKPA 2B8MA 3KV6A 2D3RA 2Y8KA 4MUVA 3ZXJA 5BYNA 3RYKA 3WW2A 2VW1A 4YZ2A 5IVCA 1A8DA 3NQHA 5FP7A 5LB6A 3VD4A 4XFHA 4N7UA 2XL7A 4ES8A 4HZFA 5FTTC 2JIJA 3ACGA 4HMZA 2VUAA 1Q8PA 3C7EA 2ADEA 2OPWA 2RE9A 3M2MA 3HNYM 5CA6A 2R1BA 3T09A 1RUF2 2ZA9A 2Y0OA 2VMFA 2XLFA 3EQEA 3I59B 4M0NA 1UX6A 2HWE3 4PBPA 4LXLA 3P1IA 5FZ7A 2OYZA 1RUF1 1X9TA 2OT7A 4YGEA 4MVTA 2AGSA 1W9FA 3IDCB 2A7AA 1NCRA 2PYTA 1J59A 2JICA 1G9FA 1S0IA 3IT8A 1Z7S2 1VPHA 4QGMA 1W8NA 3BTYA 1GP5A 5A6XA 3AYCA 1MZ6A 3LGRA 1OOPB 3MZHA 1LULA 1PK6B 4Y24A 2AENA 2FCTA 1URXA 3OYWB 5M0TA 1W3VA 1Z7S1 4WM8C 2Z4FA 5GM0A 3PVOA 5LK7B 4XCAA 1GICA 2MEV3 2VH9A 3ELNA 1LU1A 3QBQA 4P9YA 3WQBA 4BQYA 5ANNA 1MQTA 1VAKA 5CG9A 4LBQB 2GH2A 4MGYE 3W9AA 1XE8A 4QM9A 5T5OA 3RWNA 4AFBA 1AYN2 4OVEA 4Q8LA 3WP6A 1MS5A 1DZTA 3ZYBA 1PNFA 1RMU2 1X8EA 3AK0A 3L2YA 1YUDA 4Z92B 3O1SA 4H7MA 4EN0A 3WNKA 2ZABA 4CP2A 1W28A 4TN7A 2B9VA 4O9EA 4YW6A 2CHHA 3LE0A 3D8CA 3HBZA 5A3NA 3EO6A 2B42B 1HRV2 4ZXEA 4P5HA 2VJXA 1BHGA 4XDOA 4CDQA 1S0EA 2LRPA 3NNFA 3MUY1 3HWJA 3S5QA 1OFNA 3WUDA 1QXJA 1RUJ2 2W3JA 3DXTA 4DMIA 5HPOA 2BEOA 4QPYA 3WX5A 2XJUA 4JTNA 2IUWA 1U5IA 2E26A 1D7PM 2VCMA 4ZZ5A 1GNZA 2IVIB 2QQKA 5F1RA 2VBPA 4JGYB 1QJY2 1CZSA 1RUJ1 4CSWA 3I2HA 3D0SA 1UF2C 2EIBA 5ABJC 1XNAA 2B39A 3WDUA 4K7JA 4R9DA 2Q1MA 1N1SA 2P6HA 4UFIA 2YBKA 3EHKA 3D82A 3U37A 1KFUL 1QJY1 4BXSV 4CE8A 3A7QA 4QPGB 4QDRA 2D6NA 2R072 1I3HA 4FO9A 2VL4A 4YLZA 4HBNA 4D6QA 5J37A 3VBUB 2JG8C 2PXJA 4ZZ8A 1AUYA 4M3CF 3AZYA 5F6LB 1G9DA 5JR7B 1XC6A 1RITA 2R071 3CDZB 3WF1A 4XAAA 2BFUL 2BUKA 5FOBB 2XGXA 3SH5A 2DUOA 3VBSC 5F2WA 3NWKA 4B3NA 1SZBA 2W1UA 1FAYA 4D7TA 1W8OA 5FRAA 5HCAA 3WNPA 3VL8A 1O5UA 4Y20A 3AKQA 4CDUA 1RJ7A 3ECQA 3SKJE 2DU1A 1HV1A 3IZOA 4I0BA 3I2OA 2RS33 2W46A 1S0BA 1JZ7A 4LEJA 5IAXA 2EXHA 2Q1ZB 2VPVA 2VOTA 2XWBB 5L7OB 3KVAA 2GNTA 5FIXA 4FTEA 5C5TA 1J58A 1ENRA 3KCYA 1OLMA 4UF0A 2QE3A 2QZ3A 2ZHMA 5FYTA 5BNOC 3AP6A 3OG2A 3ENRA 1NUKA 3POFA 1PIV2 2N7GA 1HQLA 4BK5A 1S0DA 1UYPA 1E5RA 3DUIA 3OEAA 4JKMA 3ZN5A 1O8PA 5I8SA 1BBT2 4AR2A 5FK8A 2FDIA 4CEYA 1QF3A 4X6RB 3E5XA 4JGZA 4AEKA 4XQWA 2HYXA 1JN2P 2Z2SB 2CAVA 2PHFA 4Q26A 2KD7A 2GH8A 4NJ4A 2VMEA 4H2AA 3S57A 2JE8A 1LJ7A 1MR5A 3JZVA 4OULA 3DPRC 4KQ7A 1SBEA 1KS5A 3URFA 1BKZA 4KBZA 4UXAA 2PHDA 4Y33A 4UOJA 3P5BA 5JOZA 5J1XA 4HLTA 3IM0A 4JQRA 2G9FA 4CCEA 1OQDA 2JD9A 4S2HA 3USUB 1X50A 1YJLA 2DVGA 1AR83 2DCKA 2ZGUA 5H9RA 3VZKA 4ASMB 5FZKA 1XSRA 3DV8A 4LJHA 2UYBA 2CTVA 4LBKA 3FHAA 3C7FA 3VD3A 4ZS3A 1JYCA 1SMVA 1W8ZA 3VGIA 2O1QA 3ZLIA 4NRQA 5C3OA 2DCTA 4INDA 4LMFA 1OSGA 1H8VA 1VRH3 2WNVC 1WMEA 1ZRIA 3IB3A 3VBFA 5E1RA 1OUXA 1X82A 2OS2A 1ENXA 1FNZA 1BZWA 1GWLA 4OI0A 1AXYA 1NT0A 2X05A 4H7LA 3UGHA 2FQPA 3PJQA 1UOJA 4HETA 5C5UA 1ZZ7A 5HXMA 3POIA 3H7JA 2QTWB 1JOBA 2NLRA 1ND3A 2PLV3 3NNJA 4LKSA 1JZ5A 3DKQA 5C8CA 4PIXA 2DYCA 1REDA 1T6GC 3KF5A 2WNUB 3U4XA 1AR72 1WCQA 4IV1B 4YFWA 2ZGNA 1Q56A 3O0VA 1LCLA 4PLOA 4WBBA 3OYWA 2A6YA 2DV9A 2JB8A 1C8M2 1W8TA 4C0HA 2BNNA 2BQPA 5A1FA 5K4LA 1AR71 1Y43B 2DFCA 1RVF2 3HVDA 5CKMA 4O9GA 2D6OX 2HWD3 5LZ6A 4XBQA 1ULPA 2VZOA 2YV8A 1L3JA 3VHPA 1C8M1 1W2UA 1PO12 5FMCA 3VHOA 3WDXA 3ZM8A 5KHIA 5JVVA 4DUVA 1RVF1 1SG3A 2NQYA 1A78A 1ASJ2 5FZ9A 4CEWA 4OMDA 4AWDA 3ILFA 3WV6A 3ZN4A 1BK0A 1CPNA 1MVEA 5L9RA 3OF1A 3SXWA 5I8YA 1C3HA 1PO11 4BA6A 5C6CA 5KHGA 1WLWA 3QD6A 1ASJ1 1HQNA 3EJKA 2J22A 5LEJA 2J1SA 4RR3B 4IE5A 1XSQA 4DNYA 1RUD2 1ZVFA 2VVFA 4Y1XA 4GWNA 5FPBA 2Z5WA 1C28A 1ZZCA 2JEMA 1IS4A 2VAUA 5FMOL 2K2SA 1ULFA 5CU1A 1F9KA 1ULOA 3I7DA 4X8NA 5GALA 1RUD1 2OQ6A 2Q30A 5EXOA 3LEIA 3OPWA 4JGYA 5B4XA 4NVPA 3BN6A 4E8DA 3N4MA 2VZTA 1QKQA 3PTYA 4GA9A 4K6BA 2UWBA 4C91A 5C8WA 1UZVA 3E6CC 5BXXA 1CX1A 3NNGA 1ND2B 2X5IA 4P02B 2ZEXA 5FO7B 1FOD3 1K5MB 2W9XA 3POWA 4XJ9A 4FFHA 3WG1A 5ISLA 2OW4A 4QHBA 2XHKA 4OHVA 4RFT0 1DFQA 4QB6A 2WZEA 4P9LA 1JUIA 4FT8A 3OBZA 4O61A 3SH4A 5JWPA 2OKXA 1ULCA 5GLVA 4FXGB 2X09A 1CAVB 1BMV2 2XJQA 4XABA 1O3TA 4CDWB 4TLFA 3FHIB 4OFGA 5I8TA 2D6MA 4GH4C 4IXLA 1D4M3 4JKKA 3HOBA 3NJYA 1ZZ9A 3CJIA 3OD0A 4NE9A 4AYUA 1VIWB 1W6MA 2FMYA 2LM3A 3DCQA 3Q8CA 4MSVA 3ILRA 4HOOA 2VQ0A 3WP3A 2JE7A 3PL0A 4V1PA 1MZ5A 4XBLA 4CCCA 5CVRA 3WDYA 4HKOA 2ZKLA 4AHWA 4W8JA 2E7QA 1IPSA 2FDGA 2BGCA 2WFF1 3ZFEC 1J83A 4JC1A 4CDXC 4HSJA 4XILA 4XJZA 3SHRA 3OTFA 1TNRA 3T2QA 1DQ0A 4Q2FA 2ZX4A 2B4KA 4PI0A 1JOPA 2VZ3A 3ZFFC 3MDPA 5FLHA 3ITQA 2WJSA 4YM3A 4WM7B 4CVUA 1POV1 1CQ9A 4E4HA 4YZ3A 3KT7A 3A22A 1V9U3 2HEWF 3H3ZA 5KC6A 1RUI3 3GHNA 4WVMB 2ZGSA 3HEIA 1I5PA 4GD4A 3CMGA 2WL1A 1IQAA 1R1A1 2X53S 5FYIA 3IPVB 4LBJA 1VBE3 4QHOA 3BODA 5GKAC 3BIWE 1H8TC 1COV2 4Y3OA 2IXIA 2CAUA 3Q9OA 4IE7A 4N43C 4RS5A 4AF9A 1GZTA 1LR5A 3H8RA 4P5YA 3UKVA 1VBB3 3AMHA 3MIFA 3VBHA 4AFCA 4GMP3 5BNNB 4QX7A 5GLTA 2VCBA 1LOFC 3C7OA 3DKWA 4BDVB 5JXHA 3E6BA 3NAPA 2BVVA 3OBAA 4ZU4A 1DZRA 1PX4A 3TB0A 4MGIE 5LW9A 2H0VA 1EUUA 2XDVA 5CG8A 1KJRA 4LPLA 4QKDA 4Z2AA 1JYIA 2I74A 3HJRA 4YM1A 1CJPA 4LBNA 3I97A 3KVBA 4K8FA 3AB0A 2QQIA 4NPRA 4NOTA 1CIWA 2C4XA 1W6NA 4LUMA 4LKDA 1KITA 2L9LA 3K4AA 4RGGA 4URAA 4Q0VA 1AF9A 1B35A 1JZ4A 1YI7A 3J26N 5LY2A 1XNTA 3DYPA 2EA7A 3VZMA 4YW2A 3POEA 3U1XA 1OXCA 2R16A 4Q4W1 1Q3EA 2Q8OA 1NQDA 5F3IA 1PMHX 3WF3A 2P5BA 3KV5A 5GLZA 2P4EA 2GC2A 1YYNA 3MLJA 4DXZA 1JUHA 3BOPA 3NV1A 4R52A 4JRAA 1EAH1 3FUOA 4CU8A 1CPMA 3NV2A 2C26A 2IXJA 3H3LA 2TBVA 4GAZA 4LUKA 2VOKA 3U4SA 5K0UB 2GAUA 1VBA3 1JODA 2WNUA 1BYHA 1NA1A 1MS4A 2WFF3 4AFMA 4CP9B 5DXDA 3HNBM 2YC0A 4AAPA 5LBEA 4D3WA 1X7NA 3H7YA 3V0BB 3IBMA 1LHVA 2IXHA 3GDBA 3ZDSA 1PZ8A 3ZDVA 1W6OA 4AXOA 4UW6A 1S0GA 1QDOA 3BTXA 1W9TA 1QNYA 1FX5A 2B46X 2ZXQA 5FYYA 4ZS2A 2WKKA 3GM8A 4URTA 4HPKB 5JPMB 2QUOA 3GZUC 1R1A3 3FFZA 1PVXA 1W04A 2JDNA 5J7MA 2SBAA 1DQ1A 2OIIA 4FOYA 2XKPA 4H14A 3I2IA 5L73A 3ETPA 4RN5A 4OQ9A 3EMRA 3BU7A 4Z2WA 1SQ4A 3CZUA 3BGAA 4LBLA 3GNEA 4NAMA 4RHV3 1UMHA 4RR3A 4SLIA 5C3RA 4YVSC 5IHRA 3UETA 1UOGA 5K9YA 1BVP1 1ZA7A 1OQ1A 4WVWA 3O1UA 1WCDJ 3D3AA 1C4RA 3A0NA 3MPBA 1TME2 3VV1A 3AYDA 4BQ5A 3TRSB 1HN0A 4NHMA 4QPIC 4LTAA 1O4TA 2W94A 2RDNA 5FP9A 4YSFA 3W5NA 4XZPA 3AL6A 3G7DA 1ODMA 2JG9C 2WLQA 2XQRA 3RGBA 1S0JA 1HXS2 1NZIA 1TME1 5DAPA 4KWKA 5FPLA 5IWFA 3NO8A 4NIAA 5GZCA 4AVSA 1QU0A 2A75A 2VNVA 2HBTA 2GP5A 4YRDA 2CU5A 1AJOA 5FZDA 5C9AC 1PVC1 3D0JA 3PNAA 3ON7A 1OLME 1K5MA 1RUE2 1HXS1 1BEV3 1PGW2 4YM2A 5F5IA 3W21A 4A7YA 4D94A 2RV9A 3MF9A 3AL5A 3VB9A 4Q4W3 5FYCA 5FP8A 2WA4A 2WABA 3JBG3 3RZGA 3GXUA 2W5FA 4FPYA 4GB31 3L9JT 3BPSA 2BRTA 4Q0SA 3WCSA 1EAH3 3B00A 3J7MA 4J1WA 2BTVC 2DCZA 2QQJA 2ZKNA 1IKPA 2BGPA 1DU3D 1AJKA 4LR4A 1ZRCA 4MGTA 3VDDB 5LRRA 4BQ1A 4FP3A 2JECA 2YXSA 3WHUA 4QQHA 1NG0A 3QCWA 1G9AA 1QJFA 4BMBA 1RXGA 4C90A 4IV3B 5LRSA 1P8JA 3FLTA 3O12A 4ZKTB 2QBXA 1SLTA 2GMEA 3AP7A 5LASA 2ES3A 2ZHNA 2P3JA 3D5OA 1QJU3 5T50A 4EE2A 5BNQA 5C4WA 3LFIA 1DP0A 1ALYA 3OCPA 3R4DB 1QMJA 1R64A 4FOVA 4AQTA 4QX8A 4Q4V3 5D8AA 2JDKA 2VMHA 2RS53 3B93A 3S7EA 2QDRA 2VO5A 4WM7A 3LDBA 1NLSA 2A6WA 3ZSMA 5CFDB 1DGWX 1JYNA 4R4XA 3MO4A 4OLLA 3OGVA 3WNLA 1YNAA 1UXZA 3QACA 4MADA 1OLRA 3IIAA 3RDIA 2W52A 3DECA 2I07B 4IE6A 2R041 5FY1A 3J8F3 4EROA 5BY5A 3VKLA 2A3WA 4CXWA 3POJA 3JB8A 1XB9A 2FBEA 4YVWC 1OUSA 5IK4A 2LALA 1JZ8A 4BCUA 3GCXA 3I3MA 1PM4A 4XUNA 5J96B 4BIOA 5FDBA 3RZLA 2RR12 4CU7A 1W99A 4BXFA 3I2JA 4QU1A 2XXZA 1HV0A 4MG2A 5FYBA 4DINB 5FZIA 4PF5A 1MEC2 1PVC3 1XJAA 1SEFA 4GWJA 3WNXA 4DS0A 3VBRA 1UAIA 4BPZA 2RR11 3ZYJB 4BB3A 2VVDA 3IWZA 2G19A 4N7IA 2SLIA 5AFBA 3HT1A 1MEC1 2ZHKA 2VUJA 2GMMA 4RA0A 1XXNA 3AMQA 3KHCA 2HWF2 3GHMA 4GB33 3ST7A 2C5DA 3K77A 5FZFA 3OBRA 4S2GA 1GZ9A 4D7SA 1O3QA 4D8MA 4OHYA 1MS9A 2WSUA 2ZS6B 4NHLA 3VBOC 4ZHNA 4ZONA 4FPOB 1LHWA 1RJ8A 1UWWA 4EN6B 2RG4A 4K9SA 2HWF1 2AUYA 4E4DX 3OY8B 1T6BX 5LBFA 1YI9A 3WXPA 3CBNA 2F4LA 2YG0A 4YYOA 2D7FA 3WEZA 1Y7BA 5GJ6A 4OI2A 4ET7A 4W4ZA 4QHZA 3B3QE 3U07A 2GC1A 4N53B 4QPWA 4TZDA 2UYAA 1N3OA 2HEVF 2OUHA 1HLCA 1ZA4A 3PVNA 5E16A 4XUOA 4DXRA 5IAVA 1GZWB 4HFSA 4RD7A 3VDDC 3JQWA 1E57A 4JZRA 4IUGA 2HLEA 2WR9A 2HKXA 4Y5TA 4CCJA 4X6QB 2O8OA 3JUUA 4XE9A 3HPNA 4Q1RA 2D40A 2HWB2 3C8XA 4IETA 2ZMNA 1CAWB 1T2XA 4MGQA 3MYXA 3ZN6B 5FZAA 3LB9A 1L7LA 1QQP2 2R062 4NAOA 4XCBA 1HB1A 1UZYA 1KDKA 3ME2A 3HD8B 2VD7A 5AFEA 3T4VA 3WT3A 2R043 1JHNA 4R4ZA 2J1AA 2R061 5DUVA 2Q8DA 4AG4A 1HKDA 2XUEA 1PNGA 1ZZ6A 3ILNA 5D21A 1NCRC 5IVBA 5FWEA 4QXHA 5FCCA 3I2KA 2XOMA 2YUEA 1TMF2 3U14A 1RUG3 2VMCA 1M06G 3ZXLA 5CKNA 1VBC2 3I2FA 4W50A 2HWC2 4NHXA 4CYDA 2GU9A 3AZVA 3HMYA 3PTRB 4QD2A 1G8WA 4WVZA 4AVVA 1HQWA 3H8UA 1AYM3 5FKBA 5ABJB 1TMF1 1LOEA 4L2NA 3TBDA 4AFDA 3DN7A 1VBC1 1WWYA 2HWC1 4IEVA 3ZXGA 3GF6A 5JLVA 1GP6A 3LSDA 4FPFA 3N9PA 1RB8G 2VNOA 1MQTC 1Y3TA 4P00B 4DQAA 5FXVA 4E2GA 1OC1A 1D2SA 4NWWA 4LHSA 3WUCA 2VTXJ 5JZGB 2VZUA 3B5LB 3OPTA 1YJKA 2JG8B 4M3CB 4ZXKA 4E2SA 4WZCA 3BOWA 4XTPA 1POV0 4KNCA 3FBMA 5I0UA 3A21A 5FPVA 1AX1A 2BERA 1X9PA 3I4IA 5FZ8A 1OF4A 4Q27A 1U0AA 4AI2A 3LA7A 3VBSB 2G9GA 5J36A 2YZ4A 1RUH2 2VU9A 2VW0A 4LBOA 5FQ0A 2EXKA 3AP4A 3E6DA 4UAPA 5GZEA 1YXWA 5CIRA 5F6KA 1UMIA 2WYFA 4FPGA 3W58A 5A1LA 5LA1A 4ASLA 4W6XA 1RUH1 3OB8A 2CDPA 4IERA 1YFWA 2YU2A 2V72A 5JOWA 3KF3A 4HT1T 4YW4A 4CCMA 1KDMA 2UWAA 1UX7A 3EXUA 4Q29A 4UBGA 3RYPA 1KQRA 2C1FA 1N3QA 3VLBB 4BE3A 4MXVA 3SCHA 5C71A 2RMU3 2VQAA 4DY3A 4IV3A 4P9XA 1SBFA 3SQOA 5JIUA 4LOTA 1WBFA 1UY4A 4HSLA 4MOAA 4N53C 3S6PA 1MS3A 2BOIA 3RRDA 5AC92 1W0NA 5BNOB 3E1F1 4Q4Y3 1UNBA 1UY3A 4JAAA 3RJ2X 2V4AA 1NOVA 1FV2A 1R093 4I01A 1LGCA 2ZZJA 2EVXA 2GNDA 2GNBA 4UFMA 5AC91 1W0PA 2VOWA 5EHDA 1AL22 1U5ZA 1GKBA 1ZBE2 4B7KA 3KB5A 5JXIA 1J84A 1F4HA 2P34A 5ERLA 1J1LA 1AYN1 4XF0A 3U75A 3UGGA 3V64A 1FMD3 3CKHA 1RMU1 1SPPB 3MIBA 3MLKA 3DPRB 2XJTA 5FZ0A 4B4RA 4D0QA 1AL21 1TNFA 1ZBE1 3HBKA 5DDJ2 1JH5A 5FZ6A 4YFZA 1A34A 3VZOA 3ZXEA 3E5QA 4W6WA 2KR2A 5FMDA 5DZEA 1YQ6A 2LUWA 5IVEA 4CDUC 1HRV1 1YQ5A 4A45A 1LU2A 3MF6A 1DCSA 1UY0A 3PLQA 5DDJ1 4IE0A 2WAOA 3J9SA 2QKDA 2ZBJA 3K4DA 2VW2A 4Y22A 4LO7A 1RHI2 3TEWA 3ZR6A 1HJGA 3RI8A 2ATFA 1UIJA 1WCUA 5HI0A 2VBDA 1VP6A 3HAGA 4CCOA 3WDVA 1DGWA 2WNVB 3VN4A 2E6VA 1SLAA 4BLJA 1S0CA 1D0HA 1RHI1 3AJYA 5EZWA 5FY8A 1WW4A 2AR6A 2QCSB 4X8PA 3LA3A 2KA3A 1CAXB 5CAZA 2P3KA 5FO9B 5IW0A 3SEPA 5JZGC 2BPA2 1W6PB 3J7HA 1TVGA 3KSCA 3WQ0A 4XXPA 1RUF3 2ADDA 2FDKA 2YROA 4CEYC 3G6JB 1WW5A 4IESA 1JZ2A 1G7YA 4JVAA 4Q4X2 5FYMA 5BPXA 2D5HA 2J7MA 1KGYA 5H9PA 1KXGA 2VULA 4AGRA 3ZOIA 4WM8A 2BNOA 2IXCA 1NCQB 3AX4A 3N7MA 5IUQA 4MGZE 3VKFC 2YU1A 1AHSA 2AEZA 4Q4X1 4NPLA 1Z7S3 2F6BA 4I2OA 3AVRA 5FO8B 2Y6FA 1YIPA 2GALA 5IK8A 3O1TA 3NKTA 4PDWA 4BISA 5A3LA 3N35A 3U10A 1WW7A 2ZGTA 3MGUA 3VD9A 4JV4A 4B7EA 4XMAA 3LZZA 4OYUA 3JXSA 3N9OA 3THCA 4OZXA 2O0OA 2PTMA 1UN1A 3SH3A 3T3YA 3VBFC 1QJX2 2BBAA 4P08A 3ZFGA 2YC4A 4KH9A 3UJOA 2KXLA 2FZ1A 1OH4A 1NXMA 3ASIA 4IQPA 1AYN3 1WUVA 3LAGA 1WMDA 2VG9A 4K3UA 1RMU3 2ENRA 1QJX1 2NP0A 5FKCA 1S2BA 1FT9A 1OQEA 4MHUA 3UESA 2PN5A 1GR3A 2VZSA 5CADA 4OUEA 3OJBA 3AKTA 5C8CC 1W9YA 4XACA 4B4QA 4UT5A 4OHZA 1HRV3 1PIV1 3E97A 1RYYA 3WZ1A 2VOVA 1QY4A 4F3JA 3ZIXA 4GJYA 1AXZA 1RUJ3 1BBT1 3AXDA 1H9WA 4IEUA 5EQUA 5AVPA 5A7WB 5L9VA 3N7LA 2ZEZA 4ATFA 2J1TA 1CAUB 5A3PA 2EAAA 1REFA 4BWOA 2ZX1A 4JKLA 4EN8B 1DYOA 1QJY3 4GQ7A 1R082 1LOGA 3B7MA 3R6SA 4M3CA 3WR0A 4CEWC 2VVEA 4COYA 4LE3A 1SCRA 5FZMA 5LEKA 1R081 1JOJA 4NR1A 3T0AA 4GH4B 4R9BA 2P2KA 2R073 3VBSA 1OFSA 1AL0G 2Q1FA 4OUMA 4XF4A 1H4GA 3I59A 3N7JA 1LNSA 2LW8A 4QX1A 3KV4A 3FBYA 2P6CA 1EYBA 4GIQA 5CFCC 1UW8A 2R7EB 5K7PA 3I3DA 3KHBA 4Y1UA 2MNGA 4YW1A 4I02A 5I0TA 4TTGA 3CIHA 3O7OA 1CX4A 4XPVA 5FZOB 3ZFEB 3KGZA 4CDXB 2BDRA 4KBBA 4QX3A 3USSA 4SBVA 1HRI2 2WT1A 4HONA 5IATA 1PO22 3RMYA 4N90A 1OOPA 5KXCA 1ULDA 1PK6A 1OA3A 1LEDA 2X5IC 2W08A 3AMPA 3K3OA 2BZDA 3LDKA 5FPAA 3MIHA 1NCQC 3LEKA 3ZFFB 1AXKA 2P3IA 2PMWB 1HRI1 4NRPA 5SV8A 4DXTA 3VKOA 1PO21 3LPFA 1Q8QA 3O0WA 5FK7A 4LBQA 4AHZA 4IE4A 3CF6E 4LO8A 5T5JA 3V0AB 1JW6A 1QJX3 3UKTA 1VMHA 1H8TB 1UU5A 4N43B 4EZHA 5A7QA 1ZM1A 1IG0A 4QGNA 4IGOA 3N9MA 3NJVA 4LA2A 4XEZA 1KRIA 1IOAA 1PIV3 3CJIC 3MEPA 4ISQA 4IEQA 5B4NA 3B69A 4QXBA 4BOWA 1VAMA 2WYSA 1BBT3 2MHFA 3PUAA 5KXBA 1PGSA 1UPIA 1W90A 1YLLA 1N1YA 4KG8A 2PA7A 2E7TA 3TEXA 1RUC2 2A70A 2DU0A 3UV9A 1H6XA 5FV3A 2D6PA 2E63A 4A2UA 3ZPOA 4FVVA 2D6LX 3DEMA 2JX9A 3JU9A 4MXWB 3WSOA 3LFMA 1JU4A 4P9JA 4LO5B 1RUC1 2B9UA 4AQSA 4CUBA 2R30A 1F8VA 4YZ5A 5HBAA 3VKMA 3ZXFA 1DHKB 1V6MA 3OD4A 4XUPA 3U78A 2OQ7A 1GBGA 1GWMA 2RDRA 4PQQA 4TWTA 1PMIA 1Y9MA 1O7FA 1AR92 1YQ8A 3MUZ1 4QPGA 3RZZA 1US2A 2JENA 4XURA 2ZGMA 2V09A 4XFBA 3IDEA 1YCIA 5JXGA 3VBUA 3TEZA 1DLLA 2V5YA 2CV6A 3LOIA 4E4SA 4CP0A 5A1AA 4OCTA 3BI3A 1AR91 5KHHA 4R8HA 1Q8VA 1UOFA 4RS5C 1OVPA 4YG3A 1S0FA 3MFCA 5J3UA 1FYUA 1RC6A 4XFGA 4HL0A 2GNMA 3VBHC 5EJ1B 5CBLA 1QEXA 4MO3M 4L97A 4LK7A 4B1MA 1CVNA 2W39A 2A71A 2YFZA 3H1WA 3NAPC 4FPKA 1BMV1 2QVSB 1YWKA 1OT5A 3IAQA 2DVAA 2IZWA 4YZ1A 4GKXA 4O65A 1EPWA 1H2NA 3WP5A 1G6NA 1AR73 3LA2A 4Y26A 3RZHA 4AGGA 4AW7A 4AGVA 1BJQA 4BJ0A 3SC7X 2JDUA 2CGNA 2E7AA 4GZ9A 4WVVA 1WGPA 4JDNA 1C8M3 1H6YA 2XVLA 5A70A 4V2VA 1B35C 1O8SA 1RVF3 2ARCA 4J1XA 5L7OA 1QIQA 1APNA 1WLDA 3DYMA 3HNMA 5FAXA 4A42A 3KT4A 3O1MA 2VCCA 3POGA 4JTOA 4NRMA 2ZAHA 1AZDA 1PO13 1WA6X 4YVSB 5T55A 5ACA2 5JAXA 5E8AA 1V6NA 1ASJ3 1N1TA 2AACA 3WQ7A 3AC0A 1V0AA 2WZR2 2D5FA 4NIGA 1O59A 2AYHA 1HB4A 1ZBA2 4PIYA 4QPIB 4XYXA 3GBGA 2RM22 5ACA1 4PCRA 1TQ5A 3JCIA 2DF7A 2AC1A 2MPFA 5C3QA 3H50A 1NA1C 2JG9B 3BALA 3L2HA 4NPMA 1RUD3 5KBFA 2AH2A 4M00A 1YRZA 1ZBA1 2RM21 5C9AB 1A6CA 1J1TA 5FZHA 1COV1 1YO8A 1KS4A 4M4RA 4MV2A 3IN9A 1EY2A 2JDYA 2WBKA 3ZXAC 1O6UA 2Y34A 2ZOEB 3ATGA 3FUQA 4L0PA 3O1VA 3FFQA 3USUA 4LKFA 4G9SB 4FBFA 3OEBA 1QXRA 3NJZA 1CZVA 2HYKA 4HG6B 1ZZ8A 3FE5A 2Q8EA 2BU9A 4MZUA 5CKQA 4BHPA 3GBFA 4GH4A 4FQ4A 1UU6A 4A4AA 5GLWA 1BK1A 2W68A 3D4KA 5I93A 4GULA 3TN92 4DRRA 2GSYA 3GZEA 2XPJA 1LEMA 2CNAA 4BYYA 2Y0IA 1GV9A 4EWEA 4BMEA 1AVBA 1CJDA 1X33A 4C8DA 3TN91 2K0GA 2XWJB 2YHJA 4QX5A 1W06A 2VUDA 3DYOA 3K46A 3BU0A 2VY0A 1VBD2 4GWIA 4XJUA 5FYUA 4XXAA 4IV1A 5C7GA 5E6HA 2Y6KA 1ZNPA 1MS1A 3JD72 1JYVA 5JDBA 2FDHA 3UT0A 1POQA 4JQTA 2XLAA 1JYXA 3ZFFA 2CY6A 4LLOA 4XF9A 4COZA 4XHBA 4AEDC 5A7SA 2V4VA 5C3SA 1DGRA 4Q0UA 2Y33A 3W5MA 5FY7A 4PI2A 4AVBA 4I3GA 1NKGA 1J3RA 1TG7A 3K4ZA 3LQCA 5EWSA 1POV3 5JIAA 2J1EA 3J4UH 2FHRA 3BCWA 2WS92 3V0AA 5A7NA 1EV12 1YFXA 3BVCA 2VECA 2WC2A 2BWAA 1H0BA 4YVWB 3RWKX 1QOOA 2Y6HA 2J1UA 5BNPC 2XR4A 3BB6A 3WF4A 1K45A 1ONAA 3A4UA 5FREA 1H4HA 2WS91 4ONUA 4MYEA 5T3NA 2FCVA 4KL1A 3W59A 3H8OA 1C57A 1EV11 1QWRA 5G05L 1C1FA 3SLIA 3RZJA 5HCHA 1AR62 4FXKB 2RJLA 2W92A 3RQ0A 2E51A 1UU4A 2ZMKA 4ZY9A 1COV3 2ARAA 3IMNA 5FFOC 1IG3A 4LT5A 3TNQA 1GOGA 1XYNA 3ORJA 2PHTA 3FN9A 1AR61 1SFNA 4RQPC 3GZAA 1UOBA 4CXXA 2WNOA 1E5IA 1JYTA 2WQ8A 4PF1A 4ISRA 5DG1A 4XUQA 1V70A 3A0KA 1G9CA 3IDAA 5D8AC 3SITA 1YIFA 3WDTA 3ZYPA 2DTWA 2WSVA 3PHMA 3KMHA 1KD7A 4LA3A 1ND2A 5B2GB 5FMBA 4Q1PA 5DUUA 1NXD1 3VBOB 1M4WA 3ZIWA 5ANQA 1LOCA 3MIDA 2DCYA 4QKFA 3KCXA 3B01A 4LE4A 1W8WA 2BOJA 4Y5Z0 1YFUA 3AFGA 1I5ZA 1SLCA 3AYEA 2DFBA 2DWRA 3PUSA 3UJQA 2BFUS 5A33B 3O1OA 5F3EA 4XHXA 3BTZA 2WO7A 1RUE1 4LBMA 1PGW1 2BYVE 2VZ1A 1LECA 2Y26A 4HK8A 1CAVA 2AEYA 1YHFA 4LBQD 4XIKA 2EIGA 2VNGA 4CDWA 5FYVA 4XFFA 5FZBA 1OI6A 2Q8CA 4UFLA 1YC61 2B7YA 3T2TA 2F17A 4PT6A 2VQTA 3FWEA 5DMYA 3PMEA 4YGBA 3ZR5A 3UYJA 4AVTA 3DXUA 2WN3A 5FZCA 2A5ZA 3LOBA 5FZEA 2YFUA 3ACLA 1LODA 1OF3A 2D44A 2BJSA 1H1MA 2QQNA 2VZRA 1ZRRA 3DF0A 4I30A 3VBRC 2RS12 2Y6JA 3VD5A 3AZWA 1L7RA 5JMOA 1UZWA 1Q43A 5HCBA 3RS6A 5GZDA 3LDRA 5FXZA 4ATEA 4DEVA 2PAMA 2XJPA 3AM2A 4DOUA 5IT6A 2X29A 2DVBA 1NCRB 3SEEA 2H6CA 3WF0A 2VE1A 4CA9A 4FPLA 4MH0E 4UFHA 3Q8BA 4LLFA 3W20A 3N7KA 3VHRA 1JS9A 2UY9A 1O3RA 3RZMA 4PIZA 4WVMA 5FP3A 1DYKA 2IFWA 2CGPA 1DLCA 2NN8A 1GQPA 3OUIA 1XBFA 3IPVA
chains in the Genus database with same CATH topology
4XQDA 1H2MA 4XTMA 4PLMA 2JG9A 5L36A 1BCXA 3ZYRA 1MQTB 2A6XA 3HT2A 1UCXA 3OGGA 5BNNA 2WLPA 3KD4A 2JDZA 4LHKA 2JXAA 1OKQA 3QOPA 1TME3 1VJ2A 4E2QA 1AX2A 1FNYA 3VL9A 2O8QA 3HIFA 2EAKA 4DZGA 1GZCA 1HXS3 1DQ6A 2QZ2A 3R4UA 2OVUA 4K20A 3ZPYA 1F31A 1NE4A 5A32B 2WFPA 2KM2A 4F8AA 5JPNB 4FPJA 4QM8A 5FBZA 4HVQA 1RUE3 1WMFA 3UL2A 1B09A 2XBO2 5DG2A 1X36A 2ZAAA 2QFEA 1QHDA 4LHLA 2DURA 5T54A 4KGGA 2RJKA 4PJYA 4QXKA 3KT1A 3BTAA 1CR7A 4FPEA 3AJZA 5C33A 3GYDA 5K0UA 1LGNA 3CL1A 4IEXA 2X8KA 1DGLA 1FV3A 2DCJA 1IKQA 3KCCA 4JCKA 3V0BA 2HWE2 2DUQA 2ZGPA 4B8EA 4COWA 3S0MA 2NZ9A 2E53A 4COUA 1I1EA 2F4PA 2ZGKA 1VAVA 3NL1A 5CB7A 2HWE1 2XVKA 4AFAA 3WCRA 3ZMNA 4EWAA 2HWB1 1F5FA 1XQNA 4HPKA 1N1VA 3LCPA 1XYOA 5BUVA 4YVWA 1QQP1 5D1IA 5DZFA 3RG0A 4L9BA 2NPIA 4Y20B 4YW3A 5FMOS 3N3HA 4CDUB 4AI8A 4C1XA 2MEV2 4B4PA 5KWRA 3DGTA 1GFF2 1XU2A 5FOJB 4F7ZA 3T1MA 2FMDA 1QNWA 2Y38A 1OA2A 2RR13 3R4SA 3RJRA 4DRVA 2Z79A 4OI1A 1IHMA 3AP9A 3ROUA 2VXRA 3LKJA 4QQPA 1MEC3 3WW1A 2BBVA 1G9BA 1OD5A 3VBOA 2GZWA 1G86A 5T52A 2Q5TA 4PLNA 4AQ6A 4CEYB 5E89A 2HWF3 1QXPA 2R0HA 4KWJA 4BH9A 2WQZC 4E9KA 2QDNA 4KWLA 2YY1A 4CDQC 5JSPA 5IK5A 2D3PA 4IEPA 1VR3A 5EJ3A 3P3PA 3I2DA 3VDDA 3ZYGA 3CO2A 1DIWA 3TAYA 4MLOA 3R0RA 5JCTA 1GYKA 4AE2A 5KHKA 4LHNA 3AKSA 1D2QA 2GN3A 3RMXA 1ZX5A 1PGL2 4KGQA 1Y9QA 4L99A 1UKRA 1N3PA 2BW8A 4OUSA 3VBFB 1RL3A 1DF0A 3ES1A 4XETA 4AEJA 4W6YA 1XNCA 1Q5OA 1SACA 1DQ2A 4DPNA 1PGL1 2HWB3 4I3PA 3B02A 2BWCA 3WY6A 1GQGA 1ENSA 1KJLA 3S7IA 3RNSA 1QQP3 2R063 1ND3B 2Q0AA 5CFDA 3KS7A 5C8CB 4C0BA 2UWCA 2TNFA 2IWGB 2ZJCA 4LNVA 3WINE 5HXVA 3WG2A 4M0HA 1RGSA 2RS32 2PQQA 2ZX2A 1DGRN 3B9CA 1JXNA 3NW4A 1TMF3 1R1ZA 4XFAA 2OZJA 4OHWA 1OMIA 3VKNA 1VBC3 2RS31 5A3MA 2HWC3 2ZGLA 1J3QA 2R49A 3WG3A 2PHLA 4PDWC 4META 3CJXA 1NYWA 1QJZA 4CEWB 2PHUA 1W6QB 2ZX3A 3NVCA 1FATA 4KG0A 3ZXDA 1UZZA 2W0XA 3ZFGC 3MFAA 5EYXA 3WD5A 4W65A 2TEPA 5A32A 3KQRA 1OPOA 2WWSA 1DZQA 4Y1YA 1CD3G 2C9AA 5CFCB 4Y1ZA 1GANA 1F2NA 4C1WA 4Z82A 3D6EA 2XG3A 2ET1A 4MX3A 1RUH3 3DL3A 3OY8A 4JGZC 4PBOA 1AR82 4XOGA 3HN1A 2X5IB 1OLQA 3TYJA 4HANA 2GC3A 1EP0A 4IL7A 4ITCA 4N53A 4YNIA 3TNPB 2C0ZA 1AR81 1VRH2 3ZSEA 1MZFA 3ZSLA 1GZWA 3ZX7A 3H9AA 4QU2A 4GKYA 2IFRA 2P17A 1VRH1 4YARA 4I0AA 3WP4A 1CAWA 4EWDA 3ZN6A 3X29B 2ZACA 4Z8BA 2PLV2 5AC93 3LWCA 1EPZA 2VOXA 1UKGA 3CJIB 5I91A 1W6MB 4YG0A 3POSA 3AKRA 5SV5A 1PZ7A 4QGLA 3WDWA 2XB6C 2PLV1 1VB4A 1ENQA 1AL23 1ZBE3 2BVBA 3AMMA 2WT2A 3RYRA 5GZGA 1ND3C 3AFKA 4N9HA 3WHTA 2HWD2 4XW3A 4CRQA 1WCSA 1H30A 1OOPC 3V56A 1PK6C 4M01A 1PM7A 3NV4A 5DDJ3 3P3NA 4I09A 2YPJA 5ABJA 2HWD1 3THTA 3VZJA 1MS8A 1C5HA 1SLLA 1H9PA 2V73A 5JSOA 2CYFA 1IPJA 2BNMA 2RHPA 2XJSA 3APBA 2HEYF 1IGOA 4Q0QA 4ZU7A 1RHI3 5JZGA 2JG8A 4YGCA 1IS6A 3E5UA 5H9SA 1IPKA 3HR9A 4RS5B 5BV6A 4FOQA 4EV0A 3VBHB 4AVAA 3QLQA 4H55A 3TWIA 2XUMA 3NAPB 4P9IA 1HDKA 2OPKA 2GN7A 2H6BA 2EXJA 4MGKE 1WD3A 4AHXA 3H1YA 4YW5A 4RSUA 1FOD2 3AMNA 4Q4X3 3MIEA 4JGYC 3MW2A 1W6NB 4U2AA 4AEMA 1D4VB 1DG6A 1B35B 1FOD1 5E88A 1V6IA 1QOTA 4QT6A 2DVFA 5DUXA 1UMZA 2ARBA 1S2KA 2QQPA 1W39A 2D3SA 1SFYA 4COVA 2FZ2A 4QPGC 5BNOA 2AZ5A 3PVBB 1D4M2 4Z1VA 1Q8SA 4XIOA 4A7KA 2Z42A 3M3QA 1UIKA 3AZXA 1OHFA 2OZ6A 3VBUC 5EV7A 4KU7A 2ETEA 3KGLA 1D4M1 1Q8OA 1NA1B 4UBHA 5J98B 2VMIA 2AREA 1ZRDA 4E27A 2B5HA 4FSJA 4P9WA 3DPRA 5KC5A 1WLTA 1LKNA 3CLPA 4K1ZA 1W6OB 1DDLA 2ZGQA 3CNAA 3ZSKA 2PAKA 3WLUA 1Z78A 2WNEA 2I2SA 3FX3A 5JI9A 1PHMA 1V9U2 1RUI2 2YGLA 4QQLA 4XBNA 1UL9A 1W6QA 2Q4SA 3H1MA 1QGLA 1CESA 1VBE2 5L7OC 4CTEA 3I54A 4I0WB 1V9U1 1U12A 4Y4YA 1RUI1 2WNVA 5LK5A 5JOYA 2D98A 3AXEA 3M8LA 3MW4A 4IEOA 1R083 4UW3A 1ULEA 2ZCWA 4U36A 1VBE1 1LOBA 1VBB2 5CFCA 1OA4A 1CAXA 1MS0A 1CGPA 4H3WA 4L8QA 1W6PA 2D43A 3O0XA 1XE7A 2OUJA 1VBB1 4PQ9A 4XJAA 2P37A 4FPHA 4GMP1 1SLBA 1ULGA 4QMAA 1I9RA 4K21A 2PHRA 4HVOA 4XQ4A 5H9QA 2PFWA 5KXDA 1NLRA 2ILMA 3MI8A 4LO4B 1VB2A 1NCQA 4TYSA 4AEDB 2EF6A 4XFCA 3THPA 4AI1A 3JB4C 4P9GA 1O91A 4FCAA 2ZMLA 1NE6A 3MLLA 2EXIA 5J09A 2PHWA 1HRI3 4QQOA 1PO23 2PAEA 1IS3A 4R9CA 3WVJA 5TSWA 1ZREA 1U5YA 2D93A 4NHKA 1XNBA 4YZ4A 5GLUA 4BIFA 3QH6A 2NMOA 4LO6B 5T5LA 3N36A 5BNPB 2DUPA 1GLHA 2HJIA 2D6KA 2IXKA 2ZZQA 4K1YA 4EN9B 1JTZX 2XH6A 2XVGA 2CL2A 2ARXA 3ES4A 1VBA2 2XLGA 1J3PA 2WFF2 4FTSA 4XF3A 1GQHA 1TE1B 3K48A 2H0BA 2ET7A 3PJYA 3NKGA 5FLIA 1H1AA 1DQ4A 1LB2A 2ERFA 1BQPA 1XRUA 1VBA1 5EFUA 3SISA 4AI3A 5DUWA 1WLCA 2NM1A 4RQPB 4XMIA 5C4WB 2WNUC 4IV1C 2A3YA 2WZR1 3U11A 5D8AB 3M1HA 4IEZA 1R1A2 1BXHA 1CAUA 3M7AA 1RUC3 2G4IA 4WV8A 3NSTA 1O4YA 3MICA 1SCSA 1HX6A 3I8TA 1GNHA 3O5SA 2WZPP 2YGMA 4CP1A 4DFSA 4RHV2 2OA2A 4OHXA 5JMCA 5F5QA 2R32A 2GDFA 1LTEA 2YMZA 4JDOA 4UW5A 4Z07A 4RHV1 1OPMA 3VHNA 4AVCA 2WT0A 1RIRA 5AVAA 3WW4A 1AR93 1RTVA 3TOJA 5KXEA 3GALA 4NWVA 4RR3C 1W0OA 2NMNA 5J48A 3WOGA 1KFXL 4Q0PA 3SCGA 3VBRB 3OGJA 5JSRA 1S1AA 1X8MA 3LSEA 3ZFEA 1BEV2 4CDXA 2DTYA 4FQZA 3U0ZA 5JI7A 4Q4W2 5I0RA 3M3EA 3JBG2 2QNKA 1BEV1 1ND2C 1IZ3A 1EAH2 4NN0A 1VBD1 5CNAA 1IS5A 1K5MC 2YYOA 3FZ3A 1LOAA 2ZX0A 3JBG1 3AYAA 1RINA 3JD71 1WA4A 1LRHA 1PZ9A 1SLIA 1QH7A 3ZSJA 1UPSA 1CONA 4JRLA 2JD4A 2R6QA 3OPZA 1H8TA 4CDWC 4N43A 1XYPA 5ACA3 1A3KA 2ZTNA 5KHJA 4HN0A 1QJU2 2Z69A 1LOFA 1V00A 1XNKA 2WZR3 4G4FA 1ZYBA 3OBTA 1Z0HA 1ZBA3 1XNDA 4Q4V2 2XJRA 3C2UA 2RM23 4FP2A 2RS52 1JBCA 4CZSA 1SDWA 1QJU1 2EALA 1AX0A 3KM5A 4K40A 4FOWA 3T1LA 2CWSA 3FLPA 3M4FA 4Q4V1 1WBLA 5C4WC 2RS51 4BZ4A 1MACA 4MXWA 3RI9A 3J8F2 1LHOA 1O5LA 3SMHA 4GWMA 1MZEA 4L92A 3SCFA 3R05A 4ZU5A 4WM7C 4XF1A 3M3CA 1O4ZA 1O3SA 4R9AA 1MVQA 3J8F1 1I6XA 2A3XA 3MW3A 1RUNA 3CEWA 3NV3A 5FPXA 4XJWA 2VMGA 1SBDA 1HW5A 1C1LA 1PVC2 3GZTB 4HN1A 4RGAA 3VUOA 4YG6A 3TN93 5BNNC 5I0SA 3M3OA 2A73B 1NZCA 1LENA 4AEDA 1CN1A 3VZNA 4GB32 1FPN2 2ZGOA 4JDMA 3FC0A 4KU8A 1HIXA 1VBD3 1VALA 3AP5A 1NY72 4FAGA 4S2FA 4Q8KA 1H1IA 3JD73 4M3CE 2CGOA 3PVEA 5FQ0B 4FTBA 1FPN1 3ZO0B 5EYYA 4ES9A 4G3YC 1NY71 2ZPXA 2XL9A 2WIIB 3K51A 4FPCA 5BNPA 2RS11 4GXLA 1QOSA 1D0GA 3EBRA 3S30A 2R1DA 2A6ZA 2WS93 4YVSA 1EV13 1C8NA 3WW3A 4HKLA 1LHUA 4DB5A 3UK9A 3ZXKA 4QPIA 4RQPA 2UU8A 1V6LA 3FLRA 3UKNA 5K0UC 2IXLA 1V6JA 1AR63 5JOXA 4E4ZA 1REEA 3RSJA 3AZZA 2CWMA 4AHYA 3H0OA 3KLSA 1FXZA 3ETQA 2PELA 4YGDA 5C9AA 1LHNA 1DYPA 2R042 4A7ZA 5K8SA 1F5JA 3ZMOA 4WZFA 3GBWA 4J6GA 3ZYIB 1RUG2 2YDEA 2IC1A 4D7YA 3RPQA 5GZFA 2WA3A 4XJ8A 5FLJA 2VNRA 4EJRA 4CDQB 2ZGRA 1AYM2 1TEIA 3MPPG 5FPZA 1RUG1 5F9TA 1QH6A 5HCFA 3WQ1A 4FAHA 3VZLA 1U5XA 4S2DA 5T5PA 1UD1A 4AK3A 2A6VA 3BPZA 4AQ2A 2JE9A 1LGBA 1AYM1 2VGDA 4BM8A 4Y22B 2K9ZA 2XBO1 1H2KA 1WW6A 1C5IA 1V6KA 4LULA 2PHXA 1YFYA 4HK9A 1XU1A 3ZVXA 4B29A 3QH7A 4QQ2A 1N47A 3IDBB 2ZHLA 5L19A 4L11A 3V65A 1FPN3 1WD4A 2DVDA 2I45A 1ZZBA 4XFIA 3B9IA 4ORFA 1A8MA 2XJVA 4DY5A 2RS13 4HVRA 1NQJA 3B94A 3MIGA 1S55A 3M70A 4N9IA 4BLIA 4WM8B 3ALQA 3M3IA 1H2LA 3O14A 2RMU2 3SNMA 2R0FA 4GMP0 1VLNA 3CU7A 4D69A 1ZRFA 4AI0A 3KZ4C 4UW4A 4YM0A 2TUNA 3FJSA 2UURA 4A3XA 4F83A 4PDWB 3IKWA 2RMU1 4RL7A 4XDQA 3PMSA 2D97A 4P14A 4Q4Y2 4TSVA 4GALA 2LTNA 1V6OA 2JKBA 1QDCA 2UY8A 3INAA 4IEYA 1R092 3JQXA 4IV3C 1GSLA 2JJ6A 4IEWA 2MEV1 3POYA 3ZFGB 1DBNA 4NO4A 4Q4Y1 2E9QA 3H3UA 4OI4A 2XKOA 2WINB 1R091 5DZGA 3C3VA 1FMD2 4HKWA 1RUOA 2B45X 1BVVA 5CFDC 4EN7B 1FMD1 2QJVA 2NYYA 4JGZB 2GC0A 1DQ5A 1LESA 5A33A 4Y1VA 3FMGA 2XBO3 1WCKA 3WG4A 3HQXA 2WQ4A 2GMPA 1FI2A 3AKPA 2B8MA 2D3RA 4MUVA 3ZXJA 5BYNA 3RYKA 3WW2A 2VW1A 4YZ2A 1A8DA 4XFHA 4N7UA 2XL7A 4ES8A 4HZFA 5FTTC 4HMZA 2VUAA 1Q8PA 2RE9A 3M2MA 5CA6A 2R1BA 1RUF2 2ZA9A 2Y0OA 2XLFA 3EQEA 4M0NA 3I59B 1UX6A 2HWE3 4PBPA 2OYZA 1RUF1 4YGEA 4MVTA 2AGSA 3IDCB 2A7AA 1NCRA 2PYTA 1J59A 2JICA 1G9FA 1S0IA 3IT8A 1Z7S2 4QGMA 3AYCA 1MZ6A 3LGRA 1OOPB 3MZHA 1LULA 1PK6B 4Y24A 2AENA 1URXA 3OYWB 1Z7S1 4WM8C 5GM0A 3PVOA 5LK7B 1GICA 2MEV3 2VH9A 3ELNA 1LU1A 3QBQA 1MQTA 1VAKA 5CG9A 4LBQB 2GH2A 4MGYE 3W9AA 1XE8A 4QM9A 5T5OA 3RWNA 4AFBA 1AYN2 4OVEA 4Q8LA 3WP6A 1MS5A 1DZTA 1PNFA 1RMU2 1X8EA 3AK0A 3L2YA 1YUDA 4Z92B 4H7MA 4EN0A 2ZABA 4CP2A 4O9EA 3D8CA 3HBZA 3EO6A 2B42B 1HRV2 4P5HA 4CDQA 1S0EA 3HWJA 1OFNA 3WUDA 1QXJA 1RUJ2 4DMIA 2BEOA 4QPYA 3WX5A 2XJUA 4JTNA 1U5IA 1GNZA 5F1RA 4JGYB 1QJY2 1RUJ1 3D0SA 1UF2C 5ABJC 2B39A 3WDUA 4K7JA 4R9DA 2Q1MA 1N1SA 3EHKA 3D82A 1KFUL 1QJY1 4QPGB 2D6NA 2R072 1I3HA 4FO9A 4YLZA 5J37A 4HBNA 3VBUB 2JG8C 1AUYA 4M3CF 3AZYA 5F6LB 1G9DA 5JR7B 1RITA 2R071 2BFUL 2BUKA 5FOBB 2XGXA 3SH5A 2DUOA 3VBSC 3NWKA 4B3NA 1FAYA 4D7TA 5FRAA 5HCAA 3VL8A 1O5UA 4Y20A 3AKQA 4CDUA 1RJ7A 3ECQA 1HV1A 2DU1A 4I0BA 2RS33 1S0BA 4LEJA 2EXHA 2Q1ZB 2VPVA 2XWBB 5L7OB 2GNTA 4FTEA 1J58A 1ENRA 3KCYA 2QE3A 2QZ3A 2ZHMA 5BNOC 3AP6A 3ENRA 1PIV2 2N7GA 1HQLA 1S0DA 3DUIA 3ZN5A 5I8SA 1BBT2 4CEYA 1QF3A 4X6RB 3E5XA 4JGZA 4AEKA 4XQWA 2Z2SB 1JN2P 2CAVA 2PHFA 4Q26A 2GH8A 3JZVA 1LJ7A 1MR5A 4OULA 3DPRC 4KQ7A 1SBEA 1KS5A 3URFA 1BKZA 4UXAA 2PHDA 5JOZA 4HLTA 3IM0A 4JQRA 2G9FA 1OQDA 4S2HA 3USUB 1X50A 1YJLA 2DVGA 1AR83 2DCKA 2ZGUA 5H9RA 3VZKA 4ASMB 3DV8A 2UYBA 2CTVA 4LBKA 1JYCA 1SMVA 3VGIA 2O1QA 5JPMB 5IK7A 2DCTA 4INDA 1OSGA 1H8VA 1VRH3 2WNVC 1WMEA 3VBFA 5E1RA 1X82A 1ENXA 1FNZA 1BZWA 4OI0A 1AXYA 4H7LA 2FQPA 3PJQA 4HETA 1ZZ7A 3H7JA 2NLRA 1ND3A 2PLV3 5C8CA 4PIXA 2DYCA 1REDA 1T6GC 2WNUB 3U4XA 1AR72 4IV1B 4YFWA 2ZGNA 1Q56A 3O0VA 1LCLA 4PLOA 4WBBA 3OYWA 2A6YA 2DV9A 4C0HA 1C8M2 2BNNA 2BQPA 1AR71 1Y43B 2DFCA 1RVF2 4O9GA 2D6OX 2HWD3 4XBQA 2YV8A 1L3JA 3VHPA 1C8M1 1W2UA 1PO12 3VHOA 3WDXA 5KHIA 5JVVA 1RVF1 2NQYA 1A78A 1ASJ2 4CEWA 4AWDA 3ILFA 3WV6A 3ZN4A 1CPNA 1MVEA 3OF1A 3SXWA 5I8YA 1C3HA 1PO11 4BA6A 5C6CA 5KHGA 1WLWA 3QD6A 1ASJ1 1HQNA 3EJKA 5LEJA 4RR3B 4DNYA 1RUD2 1ZVFA 2VVFA 4Y1XA 4GWNA 2Z5WA 1C28A 1ZZCA 2JEMA 1IS4A 5FMOL 2K2SA 1ULFA 5CU1A 1F9KA 3I7DA 4X8NA 5GALA 1RUD1 2Q30A 5EXOA 4JGYA 4NVPA 3N4MA 1QKQA 3PTYA 4GA9A 4K6BA 2UWBA 4C91A 5C8WA 3E6CC 5BXXA 1ND2B 2X5IA 5FO7B 1FOD3 1K5MB 3POWA 4XJ9A 3WG1A 2OW4A 4QHBA 2XHKA 4OHVA 4RFT0 1DFQA 4P9LA 1JUIA 4FT8A 3SH4A 5JWPA 1ULCA 5GLVA 4FXGB 1BMV2 1CAVB 2XJQA 1O3TA 4CDWB 4TLFA 3FHIB 4OFGA 5I8TA 2D6MA 4GH4C 4IXLA 1D4M3 4AYUA 1ZZ9A 3CJIA 3OD0A 1VIWB 1W6MA 2FMYA 2LM3A 4MSVA 3ILRA 2VQ0A 3WP3A 2JE7A 4V1PA 1MZ5A 4XBLA 5CVRA 3WDYA 4HKOA 2ZKLA 4AHWA 2E7QA 2BGCA 2WFF1 3ZFEC 4JC1A 4CDXC 4HSJA 4XILA 4XJZA 3SHRA 3OTFA 1TNRA 1DQ0A 4Q2FA 2ZX4A 3ZFFC 3MDPA 5FLHA 2WJSA 4YM3A 4WM7B 1POV1 1CQ9A 4YZ3A 3KT7A 1V9U3 2HEWF 3H3ZA 5KC6A 1RUI3 3GHNA 4WVMB 2ZGSA 2WL1A 1IQAA 1R1A1 2X53S 3IPVB 4LBJA 1VBE3 3BODA 5GKAC 3BIWE 1H8TC 1COV2 2IXIA 2CAUA 3Q9OA 4N43C 4RS5A 4AF9A 1LR5A 3UKVA 1VBB3 3AMHA 3MIFA 3VBHA 4AFCA 4GMP3 5BNNB 5GLTA