2RS11

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 42
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1100
5A32A 3NAPB 4SBVA 1ND3B 1PVC1 1RUG1 3JBG2 2RR11 3DPRC 2VQ0A 4JGZC 1RUC2 1OOPB 2DF7A 2RM22 1VBB1 1SMVA 2GH8A 3JB4C 5C9AA 1RUE1 3ZFFB 1QQP3 1RUH3 4CDXA 1F2NA 1R1A1 1BEV2 1PO13 4Q4X2 5FOJB 1C8M1 5BNNB 1QJX1 4CDQA 1NG0A 2HWC2 1FMD1 3VBOB 1VBA2 5C8CB 4FTBA 5C9AC 1QJU3 2R071 4CDXC 1TMF1 1AL21 4WM8A 4GB31 3HAGA 2Y26A 4CDQC 1R083 4FTEA 1FPN3 1RMU1 4QPIB 1HRI1 1AR81 4AEDB 4IV1A 4WM8C 3CJIB 1M06G 5FMOS 4Q4Y3 2WS92 2ZZQA 1F8VA 1AYM3 2GSYA 2WZR3 5BNPA 1RUJ3 1HXS3 1QQP1 4IV1C 4PDWA 2RS33 1RUH1 1AR92 1COV3 1QJY2 2X5IB 1HRV2 4Y4YA 4IV3B 4CDUB 1V9U3 3NAPA 3S6PA 1VBC2 1RUC3 2RM23 5BNPC 1QJU1 3TN93 4PDWC 1BMV2 4WM7B 1OOPA 1R091 5CFCB 1Z7S2 1EV11 3VBHA 5BNOA 3ZFFA 1NOVA 5K0UB 1R081 3NAPC 5JZGB 1AR63 5BNNA 2HWE2 2RMU3 2RS11 3VDDB 2RS52 1VBA3 1OOPC 2FZ2A 2HWF3 3VBHC 3VBOA 4GH4A 5C8CA 4Q4Y1 3ZFFC 2BFUL 1AR72 2HWD1 1AYM1 1HX6A 2XBO2 5BNNC 1ASJ2 3ZFEB 1HXS1 2RS31 1TME3 3VBOC 4GH4C 5C8CC 5CFDB 1COV1 3VBUB 1PGL2 3JD72 4CEYB 4QPGB 2MEV3 4AEDA 4RQPA 4NWWA 3CJIA 1V9U1 1NA1A 1AYN2 2ZTNA 2R063 3TN91 1PIV1 1AR93 1RUF2 4AEDC 1ZBA3 2PLV3 3CJIC 5AC93 1AR61 1NA1C 2RMU1 2X5IA 3VBRB 2WFF2 1BBT3 3VBHB 4IV3A 4CDUA 5BNOB 2HWF1 5DDJ3 5J98B 4RHV1 4WM7A 1ZBE2 2FZ1A 5CFCA 1FOD3 2X5IC 3J8F3 5ACA2 4IV3C 4CDUC 3IDEA 4GH4B 2HWB2 5K0UA 5A33B 2BPA2 5JZGA 1TME1 1VRH1 1PO21 3LOBA 3VDDA 1W39A 4WM7C 2MEV1 5CFCC 1PGW2 2R041 1MEC3 1PVC2 1RUG2 1RVF3 2RR12 5K0UC 1RHI1 2IZWA 2R061 5D8AB 5JZGC 1RUD3 1VBD1 1VBB2 1D4M3 1X36A 3VDDC 4RQPB 1VBE1 1VB4A 3ZFEA 1RUE2 1NA1B 1ZBA1 1NCQA 3FBMA 2PLV1 3VBFB 1R1A2 5AC91 2WLPA 5CFDA 1C8M2 3VBUA 1ND2A 2ZAHA 4CEYA 1RUI3 1BBT1 5LK7B 4QPGA 1B35B 1QJX2 4Q4W3 1EAH3 1FMD2 1K5MB 4Q4V3 3ZFEC 5DDJ1 1X33A 1PO11 1A6CA 2R072 1NCQC 1TMF2 1AL22 1IHMA 5CFDC 2XPJA 3VBUC 1FOD1 1ND2C 3JBG3 4GB32 4CEYC 3J8F1 4QPGC 3VBRA 1RMU2 4RS5B 2BUKA 5GKAC 4CDWA 1HRI2 1AR82 1BEV3 4Q4X3 1WCDJ 1VBE2 1MEC1 1ZBE3 1RVF1 1VB2A 1FPN1 2HWC3 1RUD1 5J96B 3VBRC 1D4M1 4YVSB 4CDWC 5A33A 2WWSA 1OHFA 1QQP2 5BNOC 1RUH2 4NWVA 1RB8G 1RUI1 2WZR1 4FSJA 4Q4W1 2BFUS 2RR13 1RUJ1 1NCQB 4Q4V1 1QJU2 1VBB3 1NY71 5D8AA 1ND2B 1HQNA 1R092 1EV12 2TBVA 2WS93 1H8TB 3JBG1 1RUC1 3VBFA 4N53A 1R082 2RM21 4N43A 3VBSA 1QJX3 2RS12 1FPN2 1B35A 3JB8A 5D8AC 1AL0G 4Q4X1 5ABJB 2QQPA 1K5MA 1QJY3 4RQPC 1TMF3 4Q4Y2 1AL23 1HRV3 4GB33 4GMP0 4CEWA 3VBFC 4N53C 2HWD2 1AYM2 2HWC1 1VBC3 3VBSC 1NCRA 1VBA1 4CDWB 4YVWB 5L7OB 1B35C 1RMU3 1HXS2 1Z7S3 1K5MC 2RS32 1COV2 4RS5A 4RR3B 4CEWC 4GMP3 2BBVA 2HWE3 1NCRC 1V9U2 2RS53 3TN92 4FTSA 1POV3 1PIV2 4RS5C 1AR73 2WS91 4YVSA 2XBO3 4LLFA 1MQTB 1ASJ3 1AR62 4BCUA 2RMU2 1AR91 3ZFGB 1QJY1 2HWF2 3JD73 4YVSC 4N53B 5C4WA 1R093 4N43B 4Y5Z0 1C8NA 1EV13 3VBSB 1HRV1 4RHV2 4JGYB 1VBC1 1H8TA 1AYN3 1BMV1 5FMOL 2RS13 1Z7S1 1TME2 4CEWB 1VRH2 5C4WC 1PO22 1RUF3 1NCRB 3DPRB 4GMP1 2MEV2 5ABJA 1GFF2 4JGZB 2HWE1 1H8TC 2R042 2HWD3 2WFF3 4Z92B 2RS51 1RHI2 2R062 1POV1 5A32B 1CD3G 1VBD2 1AR71 4YVWA 5L7OA 5ABJC 1ZBA2 2XBO1 2PLV2 5AC92 1ASJ1 5ACA3 4RR3A 5C9AB 1BBT2 2HWB3 1ND3A 4CDXB 4RFT0 1PGL1 4YVWC 3JD71 5L7OC 1PIV3 5DDJ2 1PO12 1VAKA 4CDQB 1PVC3 1RUG3 1FOD2 4RR3C 1AYN1 1EAH1 3J8F2 3M8LA 1ND3C 4EJRA 1CJDA 1DDLA 5C4WB 1MQTA 4WM8B 1QJZA 1RUE3 1RUF1 1R1A3 1E57A 3ZFGA 1C8M3 4RHV3 1MEC2 2WFF1 1RVF2 1MQTC 1FMD3 4IV1B 4JGYA 1RUD2 1BEV1 1D4M2 2R073 1VRH3 1PO23 1ZBE1 1AUYA 4QPIA 3ZFGC 3ZXAC 5ACA1 4N43C 1RUI2 2R043 3DPRA 5BNPB 2HWB1 2WZR2 1OPOA 4JGYC 4PDWB 4Q4W2 4JGZA 1EAH2 1RHI3 1RUJ2 1POV0 4Q4V2 1HRI3 1VBD3 1AR83 1NY72 4QPIC 1VBE3 1PGW1
chains in the Genus database with same CATH superfamily
2VMIA 3D4KA 4BK4A 2P34A 1CAXA 1NLRA 1DYKA 4BMEA 5KXEA 4LHNA 2RR11 1XPWA 4HKLA 5F7UA 4YM3A 3MFAA 1W6OA 4R9CA 1ZYBA 2X53S 4QB1A 1XBFA 4P00B 2VUAA 4BQ2A 4YRDA 5C9AA 2WO3A 4L2NA 4TXWA 4DRVA 4X8PA 2WZ8A 1DLCA 4UF0A 1F2NA 1R1A1 1S0IA 1PO13 4XBLA 3AMMA 4NAMA 3QCWA 2P3KA 1APNA 1O4TA 4W6YA 4Q0SA 5FY5A 4P9WA 2RE9A 4XCBA 1NAEA 4Q8LA 3KB5A 4OMCA 4FTBA 3BIWE 4GXLA 1ULGA 1ZA4A 5FZ4A 4DOUA 3I2DA 2AYHA 4QDRA 1JYNA 5AVAA 2JIGA 5EWSA 3OTFA 3U11A 4GB31 5DG1A 4XAAA 3BB6A 3UK9A 3EMRA 3WCSA 3MW3A 5BUVA 5LRRA 3RG0A 4YGBA 5FZKA 2W5FA 2Y0OA 3NMBA 2ZEWA 4JCKA 5A80A 4EZHA 1FPN3 1ULEA 2ENRA 1F31A 3NNFA 3IMNA 1S1AA 3AZZA 2PHTA 4R4ZA 1ZA7A 2VQUA 3MYXA 3LCPA 4QQOA 1AR81 3N36A 1F4HA 2VOTA 3NJYA 4HONA 5CYYA 5K8SA 1O8SA 3JQWA 5FWJA 1M06G 4Q4Y3 3R4UA 4LO6B 1W9TA 3M3EA 1A3KA 4KU8A 1IG0A 3LF7A 1F8VA 4LO4B 3T2TA 4XEZA 1QOOA 3WQ1A 4WVVA 2GSYA 4AAPA 1LKNA 2A6XA 2P3YA 2Y6GA 3EB7A 1H1AA 4AAXA 4B8EA 5BNPA 3AM2A 4UI9L 3MUZ1 4IV1C 4XCAA 5FUPA 1LCLA 4UAPA 4PLNA 3EO6A 4XBNA 1QJY2 1QXRA 2PMWB 3RZHA 4P5HA 3M3OA 5FZLA 1HV0A 2B39A 1XNBA 2WDBA 5TSWA 2BGCA 1GSLA 1V9U3 2Y64A 3NAPA 4KG0A 4QKFA 1VBC2 2JICA 4UBHA 5HXVA 3LA3A 1WCKA 4BXFA 4QX7A 5J36A 4AI0A 1O3RA 3MIHA 3ILNA 4PDWC 1GWKA 2WUHA 5T5PA 1OOPA 3C7GA 4FCAA 1V6LA 3MIBA 3VBHA 3UKTA 4KWKA 5A3MA 4LA2A 2XB6C 2ZX0A 4L0PA 4MXWA 1ULOA 3FN9A 2W39A 3QH7A 4X6RB 3IPVA 4E4HA 4MG2A 5JZGB 1AR63 3VDCA 2HWE2 2VZUA 5BNNA 2RMU3 3BTXA 2YGLA 1WMFA 3SMHA 3AX4A 4LUMA 3CO2A 3K3NA 2BERA 3KV6A 4P08A 5FO8B 1H9PA 2FZ2A 2WC2A 5FY1A 5C3SA 2Y6LA 3DECA 2V5YA 4LT5A 2D6OX 2XJVA 1AYM1 1ENQA 3CZJA 1XNDA 2YDEA 2D5FA 3MEPA 3VGIA 5IVCA 4WVMB 2FCUA 2FMYA 4GZ9A 2PTMA 1WW5A 2VECA 4LR4A 3WINE 2OS2A 4QB6A 3NSTA 4H55A 2GC0A 4UW5A 2OT7A 2WBKA 3NKGA 2RS31 4URTA 3AMNA 3L2YA 5FXVA 5E6HA 4YZ3A 5CFDB 3JD72 2AC1A 4I3GA 4BH9A 1W0OA 2MEV3 1S0GA 2UWCA 3AMQA 3APBA 3RMXA 2VZ1A 2TNFA 5JI9A 3V0BB 3AMHA 1KDMA 2UYBA 2ZKLA 5FP8A 5GLUA 2E7QA 1X9TA 4NUBA 1DZQA 1W9YA 4XC9A 4XW3A 2ZTNA 4XABA 4FAGA 3UV9A 2R063 2VOWA 2WYFA 3LFIA 2A6ZA 3MF6A 4YG6A 1FX5A 2DYCA 1K12A 1SFPA 1DGWA 2R32A 4OI0A 2OW4A 1IPSA 3POIA 3RZZA 3MV01 3OSDA 2HH9A 4LBQD 2ZHLA 2OUHA 4CUCA 2KD7A 2W1SA 1OBNA 4W6XA 1GBGA 1NA1C 3NV2A 4XAEA 1W8TA 3GZEA 4BIFA 5A6QA 3VBRB 4BQXA 1W06A 4XF3A 3D3AA 1NZCA 1MPXA 1G8WA 1KS5A 4P02B 5JIUA 3KS7A 5BNOB 1BXHA 1CIYA 1GUIA 4YW3A 5KHKA 2W68A 1GLHA 1EPWA 1U5IA 1W0PA 3INAA 4LOTA 3DV8A 2X29A 2CAVA 4RHV1 4WM7A 4YYOA 1EUUA 2A7AA 2JKBA 1QF3A 1SFNA 1YYNA 3AFGA 4GA9A 3W9AA 3POBA 3FLTA 1OH3A 3A0KA 3SLIA 3IDEA 4Y1VA 3RZLA 2A5ZA 1CONA 3ALQA 1LTEA 1TME1 5CG8A 1YFXA 1UAIA 4BLJA 1PO21 2O0OA 5LA0A 3LOBA 1V6NA 5A7QA 1CAUB 4DQAA 4GWNA 3HT1A 1KJLA 3K48A 2FDKA 2ORXA 2RJLA 2RDRA 4LITA 2YZ4A 4DUVA 3LDBA 1PVC2 1RUG2 1RVF3 1JHJA 1W8OA 4AVSA 3USUB 5FYHA 1YXWA 4B4PA 2IZWA 3O1RA 3H3UA 5JZGC 4MOAA 3BOPA 4FPFA 4XIOA 1VBB2 4IETA 4UFMA 4YW7A 3H8OA 3ZFEA 5C71A 2VUCA 3GF6A 2NMOA 2YBKA 3FBMA 1NXD1 3NRUA 3KV4A 2JG9C 2WQ4A 3OBAA 5DUWA 4ZY9A 2WLPA 5CB7A 4NIAA 1C8M2 4QQ2A 1U5XA 5CZKA 4DMIA 3QOPA 1RUI3 2Y60A 1BBT1 1PMIA 1W2AX 1S0FA 1B35B 5F32A 3J7NA 4LO7A 4GULA 3HIFA 4QX3A 1JZ4A 1S2KA 1H9WA 4NR1A 3UKVA 2ZMNA 5DDJ1 3RGBA 3A21A 5T52A 1XB9A 2ZBJA 3WVJA 1AVBA 2J1UA 1AL22 4ZPIA 5FLJA 4I01A 5JI7A 5CFDC 2QCSB 4YW6A 2PHXA 4AI9A 4NPMA 3LIHA 1ZZ7A 4A41A 5F9TA 1UZVA 4A3ZA 1DLLA 4HZFA 3I8TA 3PHMA 1C1LA 4FPCA 3I3MA 3GBFA 2OQ7A 2WWUA 3F95A 3NNJA 1W2NA 3VKMA 3ZN5A 5FOBB 2YU1A 5IVFA 1DQ1A 3I4IA 4FBFA 1X8MA 2XVGA 4XFBA 4CDWA 1HRI2 2Q30A 3CHXA 2V4AA 2D93A 5DZEA 1C4RA 1MEC1 1OXCA 1DGLA 3JU9A 5FYBA 3BKZA 1WLCA 1VB2A 1YC61 3KCYA 2NYYA 1ENRA 1XYOA 1QU0A 5KHIA 3WP4A 1MZEA 3VBRC 2XXZA 2ZHNA 4XTPA 1D4M1 5FUIA 5IK4A 4YVSB 1SCSA 4LKSA 4GKYA 4XF4A 3TEYA 5AVPA 3MIDA 1OHFA 5BNOC 1RUH2 1YIFA 4FPOB 4HFSA 5DAVA 4QXBA 4NE9A 3VD4A 3ST7A 1DP0A 4EWAA 3D0JA 3W59A 4B4RA 3ZKYA 3ZYHA 4PLMA 3IAPA 4AWDA 2QTWB 1CAVB 3FHIB 4HVQA 4OUEA 2BU9A 5FPZA 5I8YA 1NCQB 4Q4V1 2XONA 2ZABA 5G05L 4Z2WA 1QJU2 1VBB3 4Y22B 2DDUA 1ND2B 3GHNA 1FT9A 1R092 1JTZX 1WKYA 4O65A 2FCTA 3I54A 3VD7A 1KDKA 1UZWA 3JBG1 2D5HA 2WNOA 3TBDA 4OHVA 5I8SA 4AGVA 4DIQA 3VZMA 2GAUA 4N53A 1NT0A 2RM21 4JDNA 1EP0A 4NHXA 2XVLA 1UCXA 3ZN6B 5FWEA 1CAWA 3SISA 4Q4X1 3KD4A 1QWRA 3GGLA 3U0ZA 2VMFA 4DUWA 4KL1A 1DQ2A 1AL23 5BYNA 1QHDA 4CUBA 2Z5WA 3WDXA 2QDNA 3VBSC 1I3HA 2F17A 2BTVC 4XJ8A 3IMMA 3U78A 3DUIA 1B35C 2XQRA 5LEKA 1CX4A 1G86A 1UIKA 5DN2A 1AX2A 4YW2A 4RS5A 4BQWA 2ZGLA 3MF9A 1W6QA 3ACHA 3OF1A 4ASKA 4UOJA 2WLQA 4MGSA 3F2ZA 5C3QA 1UMZA 2JDYA 4FXGB 4AGRA 2VBDA 3KLSA 2XUEA 1NE6A 3CJXA 3TN92 2ETEA 5A1LA 4UFLA 4ET7A 3BU7A 1O8PA 2RG4A 3PDQA 5JIAA 5KR7A 2BJSA 2AEZA 3VDBA 2X09A 2WS91 2C26A 2CWSA 4IESA 1CR7A 2E26A 3EHKA 2QQMA 4G3YC 4LLFA 4DZGA 3C8XA 1MQTB 1SEFA 2JDZA 2IFWA 2PQSA 3QACA 1GU3A 3BTZA 3POJA 2VL4A 4XFAA 4BA6A 1YO8A 1WBLA 3AC0A 2AEYA 4XZPA 2ZEXA 2ZS6B 3U10A 3DYOA 3U4SA 4ATEA 3ZFGB 5KXBA 2HWF2 3RJ2X 4YVSC 1YI9A 1R093 1UPIA 2ATFA 2H6BA 4HPKB 4N43B 4Y5Z0 4FXKB 1WMEA 3TEZA 4LUKA 5FZOB 2HYXA 1H8TA 2WN2A 1LU2A 3O14A 1XSQA 4DO0A 1SDDB 2ZGPA 1W3XA 5T54A 4CCJA 3RZMA 4R9DA 2XJPA 4Y1UA 1QGLA 1Z7S1 2A6YA 3ZYBA 1ZRRA 5FQ0A 1YQ8A 2NQYA 3K4ZA 4Y20B 5A1AA 1W9FA 3V64A 1RUF3 4LBMA 5C4WC 5BPXA 1NCRB 4XBQA 3NO8A 1V70A 3AXEA 4OVEA 1GFF2 2BVVA 3K4DA 2XJSA 2DV9A 3GZTB 2JDAA 3OOXA 3IT8A 2J42A 2WFF3 3W5MA 1QJEA 4Z92B 1KRIA 5FYZA 4IGQA 2JG8A 4IEYA 2GC2A 4YPJA 5JOWA 3KVAA 4AK3A 1POV1 4KMQA 3SNMA 4AVBA 3K75B 4DXZA 1AR71 4XXPA 2VH9A 2ZKNA 4R9BA 4XQWA 4CCDA 1ZBA2 5DZGA 2YHJA 2PLV2 3PUSA 1N3QA 5AC92 1TNRA 2H6CA 4AQ2A 2XKPA 4AVVA 4HK9A 2DU0A 2D3PA 4J25A 2YUEA 4RR3A 3RJRA 1IQDC 3PIGA 3CIHA 5CKMA 3P1IA 4UFKA 3Q8CA 1VAMA 4CE8A 3FBYA 3QD6A 4MZUA 4PIZA 3BIEA 1JU4A 1W8WA 3U14A 3PUQA 2AGSA 4M3CA 4N7UA 4UW4A 4CDQB 5CNAA 1SLAA 2MPFA 2YC0A 1OA3A 1BVVA 1O59A 1NLQA 1OLME 1AYN1 1EAH1 1RTVA 2QJVA 3J8F2 1SDWA 3N9LA 4BJ0A 4BQ5A 3MUY1 3I3QA 1CJDA 1DDLA 3ZSLA 3A7QA 3T08A 3GDBA 1H0BA 3TEXA 4DS0A 2DFCA 1RUE3 4ARYA 2DUPA 1PZ8A 4AFBA 5JLVA 1Q3EA 5FZBA 2XG3A 4CXWA 2JE9A 4FQ4A 2F4PA 5FBJA 3FC0A 5ANNA 1KD7A 3VZJA 1H1MA 3WX5A 2D44A 3NJVA 4K9SA 3OEBA 4FT8A 2P3JA 4LNVA 5A6XA 2FBEA 3VD5A 4RFRB 1MQTC 3CBNA 3SCGA 4JGYA 4AHYA 1STMA 1RUD2 1N3OA 1G7YA 1IG3A 2R16A 1XNCA 1BEV1 4K1YA 5GJ6A 2PFWA 3UL2A 4Q5OA 1KXGA 2ARAA 2PAEA 4BXSV 5F37A 1H6YA 2B5HA 4KU7A 3RDIA 3WOGA 2WQ8A 3ZFGC 4ZXEA 2CL2A 1WMXA 4N43C 4QU2A 1SG3A 4Y1XA 3WW3A 2WZR2 3HBKA 4UW3A 4Q4W2 1EAH2 2QBXA 5JXJA 2WT2A 1HKDA 3VDAA 2JB8A 2VW0A 3Q9OA 3QLQA 4GIQA 4CUGA 5C7GA 4RD7A 2ZGNA 4QPWA 2QUOA 1PK6A 4DXSA 4QPIC 4E27A 1VBE3 2VZOA 5A32A 5KC6A 2I2SA 4SBVA 1ND3B 1UYZA 1TE1B 4COUA 2R49A 1WWYA 3CNAA 4JGZC 4XJWA 1RUC2 3ZYIB 2DF7A 3IWZA 4O7XA 1RUNA 1VIWB 2ADEA 3BPZA 2EAKA 5A7NA 4JRLA 1V6KA 3ZYJB 5F5QA 1QQP3 1C5IA 4CDXA 3BUCA 5E1RA 1BEV2 3OD0A 3ZYGA 4ISQA 2WNUA 2QQLA 1I9RA 4CZSA 3H8RA 1JZ2A 2VMHA 1C1FA 2DUOA 2O8OA 5E16A 1QJX1 5F2WA 5GZCA 3TWIA 1NG0A 1UKGA 3GZUC 1S55A 2D43A 1UMIA 1FMD1 2HWC2 4NJ4A 3D8CA 3RWNA 4K1ZA 2NLRA 2YU2A 2R071 3ILFA 1YQ5A 1W0NA 2Q8CA 1VMFA 4WM8A 2CU5A 4LBLA 3T09A 5H9RA 1JN2P 3NNMA 1KJRA 2WO1A 3HAGA 3POGA 3AKRA 4CDQC 1CZTA 1R083 2O8QA 1Q8OA 3LOIA 2B9VA 1OA4A 3VLBB 1YUDA 1GQHA 1SLLA 2QDRA 3T4HB 3E6DA 2CAUA 2W46A 4XDOA 3C7OA 2QQJA 3DXUA 3I2GA 4FFFA 1NKGA 4JKLA 5FMOS 4JKKA 5CA6A 1YNAA 4CU8A 1J3PA 2FDFA 5C70A 3CU7A 5M0TA 4NIIA 5AFEA 1XQNA 3VKOA 4EYUA 4YFZA 3RNSA 3R05A 2E63A 2WZR3 3HN1A 2VZVA 4NRPA 3MPBA 2XLAA 5FLHA 1HXS3 1S0JA 1MZ6A 5F8PA 1Y9GA 1UF2C 3K77A 4E4DX 1AR92 3V0AA 1COV3 1JHNA 2YB7A 3AK0A 5JCTA 2WYSA 5IFTA 1WLDA 1HRV2 1T2XA 4Y4YA 4IV3B 3WF2A 4K6BA 4MVTA 2E6VA 2Y6KA 1UQXA 1T6BX 5EQUA 5I0TA 1RUC3 3ORJA 2E7AA 3HPNA 3IIAA 4JGZB 4WVZA 5CFCB 3SITA 3LB9A 4NHMA 2RVAA 3E97A 4L99A 1O7FA 3ZFFA 1VMHA 5BNOA 2UU8A 5JSOA 4Q26A 1LESA 4A2UA 1Y43B 2CDOA 3H1YA 4AXOA 4Z8BA 1RUOA 2ERFA 3HNBM 5IVYA 1WCSA 2JB4A 2W94A 3DN7A 4GWMA 2RS52 1W04A 3HJRA 3B02A 3WG2A 2J22A 5GM0A 3E5QA 4Y24A 4C1WA 3VBOA 3NVCA 5C8CA 4Q4Y1 2JDKA 4LJHA 3OJBA 4NIDA 4MGTA 1HN0A 1SFYA 4S2DA 3B9CA 4Y33A 1JYTA 2XBO2 3W5NA 2WNEA 2KXLA 5T5OA 1RYYA 2QQUA 1ASJ2 2WO7A 3SEPA 4D6RA 1YFWA 1DQ0A 4ZXKA 4DRRA 1LB2A 1HW5A 2OUJA 4IDZA 5IJRA 4AF9A 4I0BA 2VUDA 1IS3A 1CPMA 4AE2A 3SHRA 5IUQA 4FPLA 4GH4C 4IUGA 3N9OA 4MGIE 5EZWA 3VBUB 1HB1A 1W6NA 1SLCA 1LNSA 5A7PA 4CEYB 5A3LA 5K7PA 4QHZA 4QPGB 4AEDA 2VU9A 1KGYA 4ZHNA 4D6SA 1F5FA 1W6MB 3CJIA 3DYMA 1V9U1 2K0GA 5FMBA 4AQTA 4A3XA 1GZWB 2ID4A 1DGRN 2K46A 2WT0A 3HR9A 4HSJA 3SKVA 2G9FA 4INDA 4NIGA 3LA7A 4RGAA 2VMEA 1H6XA 3O0VA 4COYA 4YW1A 1AR93 1XNAA 3FJSA 5FZ8A 3KF3A 5DAWA 2FDIA 2XHKA 1AR61 3VB9A 2RMU1 2X5IA 2DBNA 4AYUA 3TYJA 5FY9A 3UESA 4ZZ5A 4CDUA 4N9IA 3NWKA 5JMOA 1HB4A 4UW6A 5ISLA 5T5JA 4IE6A 4FOWA 5JAXA 2LUWA 3LEIA 3S5AA 4X8NA 3S30A 5FYCA 1NUKA 3THTA 1DQ6A 1OFNA 1FOD3 3KCCA 3WDUA 4OZXA 5ACA2 2MHFA 2Z4FA 2ZGSA 3FMGA 2CV6A 3WG4A 3ZXGA 2WSUA 4PQ9A 4IV3C 5K0UA 4RL7A 2HWB2 3H3ZA 3LQCA 3I59B 5A33B 2YYOA 2VOKA 5FK7A 1XNTA 1ZRIA 4O61A 4Q29A 4IW3A 5T5LA 3TRSB 3AKTA 4YW4A 3U1XA 3VDDA 1O5LA 2C9AA 2Y8KA 2MEV1 4ISRA 1W05A 1W6PA 2HJIA 4QXCA 1JS9A 4J1WA 1V0AA 5CFCC 1MZ5A 2E31A 1YIPA 2R041 4IE4A 2VZPA 2VCAA 1OQEA 4HVRA 5FP4A 3J7LA 2RR12 3NNGA 1OH4A 2IXIA 4H7LA 1RHI1 4QX0A 2R061 2B46X 4LE4A 5A3OA 3ACIA 4HKOA 5D8AB 3W21A 3P3PA 4N7IA 5FZ1A 2V09A 1CAVA 1RJ7A 4NHYA 3BTAA 5BXXA 1NA1B 4ZKTB 4XFIA 2GNBA 1NCQA 2LM3A 1R1A2 2Q1ZB 4H3WA 3UJQA 2A1XA 3PURA 1ND2A 1D0HA 2ZAHA 4CYDA 3OG2A 4LBJA 5FPLA 5HCBA 1N1VA 4L8QA 4ZS3A 2X05A 2GN7A 4BQYA 4P9LA 3JUUA 1GQGA 3IDBB 4IGPA 1K5MB 4FPYA 4QX2A 4YGEA 1W2OA 3N7KA 2HLEA 1X33A 3EJKA 1A6CA 1U0AA 2ILMA 5EYXA 5HCHA 1L7QA 1BKZA 4CP9B 1F35A 3HNMA 1IHMA 3B01A 2XPJA 1CX1A 4HOOA 1XOYA 4GB32 3VBUC 4CEYC 3O1PA 4QPGC 5FYVA 1BLZA 3H3LA 5A6ZA 2G19A 2VM9A 5ANQA 2V72A 1L7LA 4KGGA 3ZOIA 4EROA 5CISA 2E53A 2BUKA 1AXZA 1I6XA 4C0HA 1AR82 1WD4A 2NM1A 3DKQA 4IEOA 4XFGA 3WDVA 4DFSA 1W3VA 3AP9A 3U07A 1RVF1 3IZOA 3O0WA 3TEWA 1H4HA 2BW8A 2WIIB 3RZJA 2JDPA 2W92A 3POYA 3U4XA 1AJOA 2ZX1A 2JEMA 4EN7B 1YQ2A 4F3JA 2JG9B 3MGUA 1JYXA 5FPAA 4XF0A 1ULCA 1RUI1 2WKKA 3AVSA 1UPSA 3VD3A 2BFUS 4EWDA 2RR13 3ZVXA 2EXIA 1FNZA 1YQCA 1HQWA 1RUJ1 4GWJA 4P9YA 4PT6A 1X82A 4HN0A 4ASLA 4FPGA 3C7EA 5FZ0A 3THCA 3BYWA 4A6SA 1LOCA 4QWNA 1DZTA 2IXHA 1SBFA 4ZU7A 2A3WA 1XU2A 3VZLA 3ITQA 3OYWA 2AACA 1LGCA 3EXUA 1OFSA 2N7GA 4XE9A 3M4FA 3JCIA 3A22A 4UFHA 1LU1A 5IHRA 4QDSA 2YC2A 1GV9A 3VBFA 1YFYA 4V1PA 3EYPA 4N43A 5IVVA 5E8AA 3ZXKA 1JXNA 2H0BA 3P6BA 4ZZ8A 1UYXA 1VLNA 3KV9A 4DY5A 4XHBA 3JB8A 5D8AC 5LB6A 1AL0G 3THDA 1K5JA 1QMJA 2QQPA 3ES4A 1QJY3 2D6NA 4W50A 3T2PA 3EBRA 3A23A 3SEEA 2EA7A 1X9PA 2ZJCA 5CG9A 4GB33 5A7WA 4LBQA 3RPQA 1AYM2 3KSCA 1VBC3 1NCRA 4ASMB 1VBA1 4NN0A 4Y5SA 4GD4A 5KHJA 2F6BA 1OF3A 5L7OB 2ZPXA 3THPA 1H8VA 1ZZ8A 2GMEA 3ENRA 4PIXA 3WUCA 4AI8A 1K5MC 2RS32 3LPFA 4HN1A 4YZ2A 1NE4A 5HV0A 2TUNA 2BNOA 1UMHA 4GALA 4B4QA 4CEWC 2QQIA 4GMP3 4IEQA 3VKFC 2QNKA 3WHUA 1A8MA 3V56A 2R0HA 3H8XA 2BBVA 5FP7A 2HWE3 1O3QA 1JZ3A 4AFCA 4ZU4A 3SC7X 1MACA 2GALA 3FFZA 4NAOA 4RA0A 5T55A 3UGFA 2DUQA 5HXMA 1E5RA 4FTSA 1O6UA 4FFHA 1LOFC 2G9ZA 5C3RA 3RMYA 1D7PM 2D3SA 4UT5A 1BQPA 2VW2A 3RSJA 4FFGA 3H50A 4CPBD 2FMDA 3H1WA 3KQRA 3CMGA 4AI3A 1DBNA 3NKTA 4K40A 4IEUA 4QQPA 3S57A 5FZIA 5I0UA 1O91A 2VC9A 5F3IA 2W1QA 3DXTA 2VPVA 1RXFA 2WZEA 5A3WA 3ZSKA 4K7JA 1W8HA 2GU9A 2VMCA 3JD73 3UGGA 4HG6B 2ZACA 2QVSB 1C8NA 3VBSB 3OY8B 2CGOA 4RHV2 4K20A 1SPPB 1KS4A 3K3OA 1CWPA 2DCYA 4XETA 1J83A 1Q56A 1O5UA 4GJZA 3LKJA 4MV2A 1BMV1 1UU5A 2R1BA 3BALA 2DCTA 2Y0IA 1TME2 1J84A 5B4XA 1REEA 4BISA 1N1YA 1PO22 1PM7A 1WA4A 1MS0A 4I30A 1UWWA 4U2AA 1QEXA 3DPRB 5FKBA 2EIDA 2W52A 2ZHKA 5ABJA 2A3YA 3ZMOA 4KBBA 3T3YA 3DKWA 4EWEA 3GHMA 2ES3A 4FP3A 1X50A 4Q1RA 2JE7A 4U36A 1MS1A 4XJUA 3M70A 3QH6A 5I8TA 2CY6A 4K8FA 2ZCWA 4OHZA 4CUAA 1LHUA 2VVEA 1CAXB 1W8FA 2UY9A 5LEJA 4YVWA 1XYPA 2QKDA 3OGVA 4JV4A 2PA7A 1DG6A 4QXHA 1DF0A 1TNFA 1W6OB 3I7DA 1W8ZA 3WLUA 2W95A 1CZSA 1JOBA 5CIRA 5GLZA 1UXZA 2BGPA 5C9AB 1BBT2 1REDA 1W2UA 4JHZA 4XHXA 4YGCA 5IATA 1F5JA 1ND3A 1ODMA 2QQNA 3OPTA 4TN7A 4UF0B 2BOJA 4V2WA 5APAA 1DGRA 3IDAA 4QQLA 3OUHA 2WT1A 1Q8VA 3I97A 1UL9A 1DFQA 3UNPA 5L7OC 4JX0A 5DDJ2 2BGOA 4CCMA 5IAVA 3KCXA 4MSVA 1PVC3 1RUG3 3SXWA 2KR2A 2VR4A 3M8LA 3PVNA 1EY2A 5FJKA 4XF1A 5C4WB 4FOQA 4P9IA 4HXCA 4XQ4A 2PAMA 2P6HA 4IEPA 2XJTA 1OT5A 1WUVA 1U5ZA 1YHFA 1LEMA 1RUF1 2O14A 4C1XA 5J48A 1UD1A 5JPNB 4YM2A 5HCFA 2VZ3A 3ZIXA 1C8M3 4E2GA 3RZGA 1GANA 5FZAA 5FZ6A 4RHV3 1J59A 4I2OA 1SBDA 1MEC2 2WFF1 3GJBA 1BYHA 3WF3A 2WR9A 3ZYPA 5IVEA 5FZFA 4YZ1A 4YFWA 3LFMA 1TQ5A 3B94A 3WY6A 4QGMA 1RJ8A 3NJXA 4BOWA 2B7YA 3HBZA 5IW0A 1MS5A 3O1UA 1UOFA 2C0ZA 1D4M2 2ARXA 4LPLA 4KQ7A 5DUVA 4OI2A 1PO23 1ZBE1 1F9KA 2XKOA 5J1XA 2UWAA 3ZX7A 1IS4A 2PHFA 4Y3OA 2OX0A 3GBWA 3ABZA 5T50A 1V6JA 3N9NA 5BNPB 4HL0A 4LK6A 4JKMA 5FO9B 1UYPA 5IFPA 5EP9A 1U12A 4Y1ZA 3RYPA 4Q4V2 2DCKA 2WABA 4LBNA 2Q0AA 5FR3A 4AI2A 1DHKB 1HRI3 1LHNA 2RDQA 3AFKA 2VCCA 1GNHA 1PGW1 3NAPB 2HEYF 4IXLA 2D40A 3JBG2 5FO7B 2VNGA 3DPRC 4IEZA 3LAGA 3ZLIA 1PX4A 2W47A 3OUJA 1OOPB 1ZZ9A 2RHPA 2RM22 2A73B 3KF5A 4TLGA 2E9QA 1ENXA 1SMVA 2GH8A 4M3CF 1RUE1 3GM8A 2A71A 3PVOA 2B45X 4MXWB 4XJ9A 4DY3A 1RUH3 5JUVA 4KNCA 3O1MA 3IPVB 4Q4X2 1HJGA 5FOJB 5BNNB 5LBEA 3WNNA 4Q0PA 1PNGA 4PQQA 1WA6X 2AZ5A 2NMNA 1W8UA 5DUUA 3PMEA 4CP1A 4QXKA 2ZOEB 3NV1A 2XL7A 4MO3M 4RGGA 5F5IA 1QJU3 2JENA 3AZWA 5A7SA 4A4AA 5C9AC 3B69A 4I09A 2V73A 1TMF1 5DAPA 3PVBB 5FZ9A 4GKXA 2OVUA 1LRHA 1OLRA 4I02A 3T0AA 4XACA 2ZGRA 3AP6A 2DVFA 3WW1A 1MS8A 2VY0A 2HKXA 2PXJA 1C57A 2Y26A 5CVRA 1C28A 4LULA 3AVRA 4FPHA 1HB3A 3I3BA 4LKDA 3JZVA 1IOAA 2J1EA 1FATA 1UU4A 5AFBA 1RMU1 5FZGA 4QPIB 1QY4A 2WJSA 4BLIA 1GOGA 4X6QB 4A42A 1OKQA 2ZGQA 3LIGA 3MLJA 4IV1A 4F8AA 3UYJA 1FI2A 2D97A 4PI0A 4Z2AA 1BK0A 1AHSA 4AW7A 1H2MA 4AHXA 2WS92 1HDKA 5JOXA 4QAWA 1LOAA 3VZOA 4C90A 1QXJA 3LE0A 2GDFA 2D6MA 3AYCA 4XDQA 2W3JA 2VOVA 4FO9A 1W99A 1W6MA 3E5UA 2CYFA 5L19A 5CKNA 1DZRA 1QQP1 1UY0A 4PDWA 3U75A 4BE3A 1GZWA 4KH9A 5KC5A 3CLPA 5KXCA 3BI3A 1AXKA 1XC6A 2Q5TA 4BQ3A 1JZ5A 1IGOA 2YBPA 3NW4A 4R52A 3POSA 3PJQA 1VRBA 3AKSA 2PHRA 4NHKA 1O3TA 2DTYA 1J1LA 2RM23 5BNPC 4QU1A 3TN93 3KZ4C 3FFQA 1J3RA 4WM7B 2OA2A 1Z7S2 1EV11 1P8JA 2ZEYA 5IT6A 2LW8A 3OB8A 1UZYA 3I49A 4META 4AGGA 1NOVA 4W8JA 5FMCA 5LY1A 1R081 4LO8A 3NAPC 3HQRA 4Q2FA 3VHRA 4OCTA 3GCXA 3LA2A 4P9JA 1IPJA 2RS11 4MX3A 4A7KA 5FXZA 2IFRA 2YC4A 4J1XA 2WL1A 2OKXA 5DQ0A 3T0BA 3O1SA 3N9MA 1OOPC 1NXMA 3I2KA 4FOVA 1WCQA 3M2MA 3K4AA 2HWF3 3VBHC 4J6GA 2XH6A 4XPVA 3P5BA 5BV6A 1GP4A 4N90A 1AR72 3BPSA 5FYUA 2HWD1 3T2QA 1MZFA 1D4VB 1JYCA 5FTTC 5BNNC 4A7YA 1N47A 2J7MA 4EN6B 2XL9A 3ZFEB 2IWGB 3OPZA 2BVBA 1OUSA 4BMBA 2OQ6A 5C3OA 5KBFA 1HXS1 3R0RA 1T6GC 4OMDA 4XTMA 3L2HA 2WO2A 5FP9A 1OQ1A 4L11A 3ETPA 1AF9A 1COV1 1HQLA 1PVXA 4JQTA 3ACLA 1S2EA 1K3IA 1UX6A 3WZ1A 2BZDA 4Z07A 5DMYA 1OI6A 4G9SB 4NWWA 2XLGA 2QQOA 4ORFA 1SHWB 2LROA 3FLPA 5H9QA 1WW4A 1NA1A 1UNBA 4AOCA 3HMYA 3R6SA 1GKBA 2VTXA 3I2JA 1AYN2 1CESA 5GALA 4XZUG 4XIKA 3RS6A 4Y26A 1LOBA 3WXPA 3E1F1 1OSGA 1PIV1 2BNMA 4B7KA 5A70A 2VCMA 3GZAA 3VL8A 5IK8A 3PLQA 2VULA 4NVPA 3VKLA 2J1AA 2YV8A 1ZBA3 3UT0A 4HT1T 5EV7A 2PLV3 2GZWA 3DEMA 3MFCA 2R6QA 3NL1A 4QD2A 1D2QA 5FCCA 4MGZE 5SV8A 5AC93 1D0GA 4FPJA 2WNVB 1FYUA 5BY5A 5F3CA 3NV3A 3ECQA 3WHTA 3WNPA 5I91A 5IAXA 1V00A 2QE3A 2QZ3A 2W0XA 4LO5B 4PIYA 4OFGA 4M0NA 1YCIA 3MHZA 4WVWA 4JRAA 3WG1A 1G9BA 4FPKA 4QKNA 5CBLA 3M7AA 3POWA 1Q8SA 4M4RA 3J8F3 2XOMA 2YMZA 3G6JB 4MH0E 3O1TA 3MIFA 3MLKA 4XUOA 2BPA2 4GH4B 1XJAA 1ULDA 1ZNPA 3ZR5A 2D98A 3FHAA 5JZGA 3NNLA 1ODNA 4PBPA 1VRH1 3N7LA 3T4VA 1G9DA 2YXSA 1SLIA 4KBZA 5FZEA 5IVJA 4D94A 4B1LA 4CRQA 2EICA 1W39A 2D7FA 2XHNA 3KHBA 1JOPA 2PN5A 4HETA 4WM7C 3N9QA 3RI9A 3ZXLA 3JXSA 3I2IA 4HLTA 5I93A 2GNMA 4AG4A 2JG9A 2PHDA 1LHVA 4OLLA 5FJHA 4AHWA 1G9AA 1UY2A 5C3PA 3K51A 3OPWA 3W58A 1GZ9A 1OLMA 4QM9A 3RQ0A 5G04L 3CF6E 1RUD3 4WVMA 1SZBA 1VBD1 2P5BA 1L7RA 3VKNA 2VZSA 1QXPA 1PX3A 4RQPB 1VB4A 2VBPA 1ZRDA 1PGSA 1ST8A 2X10A 4UFJA 4E2SA 1UXXX 3QBQA 5DPNA 5CFDA 3WR0A 2H0VA 3H9AA 4S2GA 2HEWF 3OGRA 3HD8B 1QJX2 2JDHA 4Q4W3 1EAH3 3V0BA 1CAWB 3ON7A 1FMD2 2XJUA 3PUIA 5GZDA 3ZFEC 1NX9A 4EE2A 1PO11 5FXXA 3HT2A 1YI7A 2R072 3U37A 5KXDA 3MI8A 3MIEA 5BNQA 4C91A 2W2IA 2IVJA 3JQXA 4D7YA 3AZVA 5I0SA 1FOD1 1OD5A 3VD9A 3WQBA 2HYKA 4EN0A 4OI1A 5A3PA 1UOBA 3HOBA 2Q8DA 5FYYA 5JR2A 3WUDA 1VAVA 2QQVA 2VNVA 5GLTA 4CCKA 4IEWA 5EJ3A 4LTAA 4Q27A 3VBRA 3J7MA 5FZ3A 5GLVA 3RYKA 1KFUL 4RS5B 5HV4A 2XWBB 5GKAC 3LZZA 1RXGA 3T30A 1BEV3 1W6QB 3IAQA 3AMPA 5J3UA 2RJKA 4PCRA 1H1IA 4P9GA 3NV4A 2VZTA 2ORZA 2A70A 1FPN1 4XQDA 4FOYA 2HWC3 5FKCA 1LOGA 2WNVC 4HKWA 3NQHA 1LHWA 4COZA 1OUXA 4XJAA 1E5HA 4QPYA 4DB5A 3OD4A 3WP6A 4Q8KA 1POQA 2JIJA 3PL0A 5FK8A 4CDWC 4D3WA 1ZRCA 2E33A 5D1IA 5F5CA 5FY7A 4AEMA 3BOWA 4CCEA 2NN8A 4QX1A 2QZ2A 1XYNA 1IPKA 1BHGA 2Y6JA 1HN1A 5FPVA 4CTEA 1CAUA 4ES9A 4K8RB 5HCAA 4FSJA 2RJ2A 2UURA 2VNRA 3CDZB 2BP6A 3VN4A 4ATFA 3M3QA 1ZREA 3LPGA 3USUA 4PHZA 1NY71 5LK5A 3LEKA 1EPZA 1G6NA 3D0SA 3MBWA 1SLBA 5A3TA 4FPEA 1W9SA 1H8TB 2WA4A 4LHLA 3E6BA 2BWCA 2VTFA 1UY4A 4EZ4A 3HWJA 5FZMA 2D6PA 4AVCA 3HVDA 2ZX4A 2WA3A 3R4SA 4YG3A 3M3CA 1QJX3 3VBSA 1MS4A 5FQ0B 3HQUA 1FPN2 2BRTA 1UZZA 1YLLA 2DCZA 4KWLA 5DAQA 1B35A 4CCCA 5JWPA 4QHBA 3OBZA 4ITCA 3WP3A 1H4GA 1W2TA 4RQPC 4UBGA 1YWKA 4Q4Y2 4D69A 4BM8A 1BK1A 1HRV3 2RV9A 2JG8B 3PUAA 4E2QA 2DFBA 4N53C 4E8DA 4Q0QA 4ES8A 3POEA 2VGDA 2KM2A 4PLOA 5L36A 4JDMA 4A45A 1JUIA 1QNYA 5EFUA 2EAAA 2OPKA 3AXDA 1RIRA 1XXNA 1JYVA 2BV4A 2C9KA 5JVVA 1UKRA 1PGL2 1I5PA 1OA2A 3WW2A 1JMUB 1V6IA 3ZIWA 4RR3B 1OMIA 1CVNA 3FZ3A 2ZA9A 2FQPA 2XJQA 1CZVA 1UY1A 5GZEA 1V9U2 1ULFA 1LHOA 3LEMA 1EYBA 3AB0A 3BODA 2BWAA 3GNEA 2RS53 2GN3A 1HLCA 4MXVA 2ZGOA 2J1VA 5F6LB 1QH6A 2BYVE 2LTNA 2Q4SA 4M3CB 5CEHA 5GZGA 1FAYA 4WV8A 4CVUA 4YLZA 1BZWA 1LENA 2BOIA 2YPDA 2ZZJA 4RS5C 4YVSA 3ZN4A 2JE8A 2R7EB 3PIJA 2XBO3 2VQAA 3VZKA 4MGQA 1S0DA 4I0AA 1OKOA 4Q1PA 1ASJ3 2G1MA 2ZX2A 2VQTA 3G7DA 3VZNA 1AR62 5JOZA 2RMU2 3GJAA 2JX9A 1MR5A 4LBOA 4BK5A 4KWUA 2GNDA 5L9BA 1OPMA 4TTGA 4DXTA 1QJY1 4IE0A 1IZ3A 5C4WA 3RI8A 4Y22A 2EXHA 2XGXA 3OGJA 2R1DA 5FPUA 1GNYA 1LULA 4I0WB 3SQOA 5C33A 1NQJA 3O12A 4JGYB 3O1OA 1VBC1 2VBBA 1V6OA 3H8UA 4PF5A 4E8CA 2UWBA 2XMLA 2YY1A 1W03A 3PNAA 4XVHA 2QQKA 2XR4A 5FMOL 4E4ZA 2WAOA 1AX1A 3PTRB 4LMFA 4B29A 5JSRA 5C5UA 4CEWB 4E9KA 4N8MA 5EJ1B 4A6OA 2VO5A 4D0QA 3ZN6A 4GMP1 2MEV2 1H2NA 3FHQA 2HWE1 1TEIA 1H8TC 2R042 2CHHA 2GP5A 3CEWA 2GH2A 2JD9A 3A0NA 4KGQA 3MPPG 3D6EA 1RHI2 1YJKA 1PK6B 2R062 5EXOA 5FPBA 3VHOA 2WQZC 1WCUA 5A32B 1CD3G 2BQPA 5GZFA 3H7YA 3LWCA 3VV1A 1GZTA 4IEVA 3MDPA 5EPAA 3B9IA 1Q8QA 5L73A 4AFDA 2RDSA 3ZXJA 1OVSA 5ACA3 2GNTA 1LECA 4QX5A 2EALA 1JUHA 2CWMA 2JG8C 3TNPB 2HWB3 4XILA 4NO4A 3WG3A 1RINA 2VJXA 2Z42A 2ZMKA 3ZDVA 4CDXB 4RFT0 1ZZ6A 2SBAA 4XF9A 5FY4A 3VUOA 2WNUB 3AYEA 2A6WA 3JD71 1WW6A 2W08A 2XVKA 4FFIA 3BU0A 3PU3A 1TVGA 3PTYA 3TNQA 3D82A 1GMMA 3FWEA 5FP3A 4RR3C 3KT7A 2SLIA 1Q5OA 4UYBA 4EV0A 3KGLA 4JQRA 5LA1A 2E32A 2OZJA 1MQTA 4M01A 5EJZB 4WM8B 3WNLA 5LWBA 4MADA 4AL9A 1L3JA 1QJZA 3C3VA 4FVVA 3W20A 1GR3A 1XE7A 3BCWA 4F7ZA 2NP0A 1JOJA 2IXKA 4B1MA 1AX0A 1R1A3 4E4SA 2WAAA 3E5XA 3ZFGA 3CKHA 1KEXA 3DF0A 2VXRA 3LEGA 3NJZA 2AUYA 4S2HA 5FYTA 4HPKA 1RVF2 2JDNA 3DL3A 4Q0VA 4YM1A 4YW5A 3MW4A 1GOHA 5FZOA 5B4NA 3MZHA 1VR3A 2C5DA 4GWIA 4AHZA 5ERLA 1ZZCA 4XMIA 5DABA 4M0HA 4KG8A 5FLIA 5FY0A 5JR7B 4CP2A 2WSVA 5F3GA 2IVIB 1JODA 2XQXA 3LDKA 4XOGA 3WDYA 4BZ4A 3E6CC 4QPIA 2I07B 3FE5A 1JYWA 2P37A 2OYZA 4IEXA 4Y20A 3ZPOA 4OQ8A 3ZMNA 1DU3D 1OD3A 1RUI2 1N1TA 1H2LA 2P4EA 2R043 2V5DA 2VUJA 4IE7A 1OPOA 3ACFA 4JGYC 5EYYA 1ZX5A 4JGZA 3HEIA 1B09A 4NIHA 4I3PA 1Z0HA 2D6LX 1RHI3 1K45A 1RUJ2 3J7HA 3V0AB 1SACA 1POV0 1UY3A 5GLWA 4ARXA 3N3HA 3T1LA 1AR83 5FZCA 4AFMA 4IGOA 3MW2A 4QMAA 1PVC1 1RUG1 1W8NA 4AVAA 3AKQA 2OIIA 3ZM8A 3ZR6A 3S0MA 1QOSA 2VQ0A 4AR2A 1SQ4A 2DVDA 4BWOA 2XDVA 3KQ4B 5EIYB 3ZXFA 1VBB1 3HN3A 3POFA 3IB3A 1ZVFA 1Y9QA 3HQXA 1C3HA 3EQEA 3JB4C 5FBZA 3RYRA 3ZFFB 1PK6C 1JI6A 3IKWA 2R30A 1REFA 1C8M1 1S4CA 3LD8A 4XXAA 1QNWA 3ZKUA 2I45A 2HBTA 2JDMA 1PMHX 2Y33A 4M4PA 2ZEZA 3Q8BA 4CDQA 3B00A 1E5SA 4CPBA 1H2KA 1LEDA 4LK7A 1XRUA 2VMDA 1VBA2 3VBOB 4YGDA 5C8CB 5LASA 4XJZA 1JH5A 4CDXC 1YRZA 2YFZA 3MICA 1IKPA 2Q8OA 3WEZA 1AL21 3S7EA 3ZO0B 2WNUC 5I0DA 2J1SA 4MYEA 5IK7A 1H30A 2NPIA 3TB0A 3AZXA 2JECA 1XSRA 1W28A 4FTEA 1A78A 4K21A 1AJKA 1VPHA 4JVAA 4PI2A 1QDOA 4PJYA 2PELA 2WWJA 5F1RA 1W6NB 4RN5A 4ZONA 3B93A 2QFEA 1HRI1 1JW6A 4AEDB 2FDJA 4WM8C 5IWFA 4JTOA 3CJIB 5LBFA 1UZ0A 4YG0A 5IVBA 3KWVA 2J1RA 2R0FA 2VAUA 1PNFA 3Q8EA 5FZ7A 2ZZQA 2IUWA 1CJPA 4NOTA 2B9UA 5E88A 1AYM3 2DU1A 2DURA 5JPMB 5LA2A 1J1TA 4QGLA 4HVOA 2K9ZA 2W1WA 4XUTA 3I2HA 1GWLA 4OI4A 4YZ4A 1J3QA 3WCRA 1QOTA 1RUJ3 4WZCA 4XMAA 1HIXA 2DVBA 1RUH1 1BJQA 2RDNA 2C1FA 2ET1A 2RS33 4JDOA 5A6YA 4CA9A 5CAZA 1K42A 1RITA 1WBFA 5F3EA 2V4VA 2X5IB 4JAAA 1WZXA 4W65A 1YFUA 1LGNA 1UIJA 5JMCA 5JXHA 3AL6A 4RGKA 3WV6A 3VL9A 4B7EA 4CDUB 1OF4A 1DQ5A 3IDCB 3S6PA 3N4MA 1ALYA 4UXAA 2WINB 4LKEA 2PHUA 1WLWA 1QJU1 1MVEA 4BYYA 2WNVA 1DCSA 4EQVA 3UETA 1BMV2 3ME2A 5J7MA 1R091 3H7JA 2Q8EA 4Z82A 3A4UA 2PYTA 3ZPYA 1CN1A 1I1EA 3I3EA 4G4FA 1GWMA 1RC6A 4BU2A 5F2SA 1DGWX 5K0UB 2DVAA 3FX3A 2B42B 1Z78A 4GQ7A 4AI1A 1JZ6A 2LRPA 3HNYM 5C6CA 4LORA 1S0BA 4Q0UA 3ZSJA 3VDDB 4QKBA 1VBA3 5FZHA 5F5AA 1GNZA 1W6PB 3ZSEA 5A1FA 4O9GA 3GYDA 4TYSA 4GH4A 4ZU5A 1PHMA 2B8MA 2VTXJ 1MVQA 3ZFFC 2BFUL 4EN9B 4MUVA 1Y9MA 2VOXA 5IYYA 1HX6A 1RGSA 2K2SA 2VE1A 1KITA 2WZPP 4LXLA 4AQSA 4XUQA 1WLTA 4BIOA 3PU8A 4AQ6A 4LQRA 4IE5A 4PBOA 1XNKA 3OBRA 4JHTA 4XDPA 5FMDA 4Z1VA 4AEKA 1TME3 3WQ7A 3URFA 4LIVA 3VBOC 2CDPA 3R4DB 3MIGA 5C8CC 3B5LB 4K3UA 4CCOA 1CQ9A 4JTNA 4TZDA 2VMGA 4LHSA 3L9JT 4JC1A 4RQPA 4NPRA 3TOJA 2G9GA 5LW9A 4BPZA 1GZCA 1F15A 4H7MA 2IC1A 3H42B 1NQDA 1CIWA 4TWTA 2ZGTA 5DAXA 5HBAA 2Y6HA 4CU9A 2Z2SB 2G4IA 3TN91 1FV2A 2JWPA 3FUOA 1DYOA 3WNKA 2ZX3A 4SLIA 1PZ7A 2CGNA 4XUNA 1Y3TA 3SH3A 1HV1A 1RUF2 4AEDC 2GC3A 2JDUA 3CJIC 1LOEA 1HB2A 3KHCA 2FDHA 2XLFA 1GQPA 1LODA 4COWA 2WFF2 1BBT3 4LEJA 4BQ1A 2CNAA 2W1UA 1GYKA 3J4UH 4EN8B 3VBHB 3IM0A 4C8DA 4IV3A 1XU1A 2ZGUA 1O4ZA 2YBSA 2HWF1 4XFHA 2VXJA 1LJ7A 2AREA 4JZRA 4M3CE 5DUXA 4ONUA 5DDJ3 5J98B 1BCXA 2Q1MA 3ILRA 1TG7A 1S0CA 4DEVA 5E89A 3WT3A 1ZBE2 4LHKA 1X7NA 2FZ1A 5CFCA 1O3SA 2E7TA 3CQOA 3IBMA 2NZ9A 4OYUA 2X5IC 3BVCA 3LGRA 4OQ9A 2WRAA 4IERA 3UKNA 4CDUC 3CL1A 5LY2A 1I5ZA 4XURA 5FPXA 2HEVF 1VALA 4CU6A 3SCFA 1UN1A 3O7OA 5C8WA 2EIGA 4OZOA 1CGPA 2PQQA 1FNYA 3CZUA 1PGW2 2EXKA 2FCVA 1MEC3 1VP6A 2Q1FA 5JDBA 2C4XA 3OGSA 4OHWA 4YM0A 4QHOA 3WDTA 5K0UC 1ZRFA 3N7JA 1GP5A 4TLFA 2Y6FA 3OYWB 4HK8A 1D4M3 1X36A 2DBIA 3VDDC 1QIQA 1VBE1 3GCWA 3WNXA 1UYYA 3BGAA 2Y38A 4MGKE 1IS5A 1GP6A 1RUE2 2ADDA 4HSLA 4AFAA 3C7FA 1ZBA1 5A3NA 3GALA 2PLV1 3VBFB 5AC91 1LGBA 4WBBA 3VBUA 4CEYA 2B4KA 5LK7B 2P2KA 4QPGA 3GBGA 2VCBA 2VW1A 5FREA 1BVP1 3AP7A 1KQRA 3ES1A 3N7MA 1ONAA 4Q4V3 4LIUA 3AJZA 3P3NA 3ATGA 3KT1A 1A34A 1G9CA 2ARBA 1NCQC 5A7WB 1TMF2 3KV5A 4URAA 4LBQB 2C6SA 3AP5A 3N9PA 1WW7A 2OZ6A 1ND2C 3JBG3 3J8F1 2O1QA 3FLRA 4A7ZA 5JOYA 1OVPA 3B7MA 4H14A 3X29B 3LDRA 2EIBA 1IKQA 4QM8A 1MS9A 3RZKA 4DEQA 1RMU2 2MNGA 1PZ9A 5DXDA 1N3PA 3O1VA 4AEJA 4Q4X3 1UOJA 2P1BA 1WCDJ 2KA3A 3PVEA 5EHDA 4B3NA 1VBE2 2EF6A 4NPLA 5FIXA 5L9RA 1ZBE3 1IQAA 5A3UA 1FXZA 5SV5A 1CPNA 4DINB 4LKFA 1VJ2A 2YG0A 4BHPA 4PF1A 4NRQA 3ZSMA 1Y4WA 1RUD1 5DG2A 5J96B 1DYPA 3WW4A 5J09A 2GC1A 3OEAA 2YPJA 4FI9A 4HANA 5F6KA 3VHNA 2IXLA 5HI0A 1JBCA 3AP4A 2WWSA 2JKXA 1QQP2 3I59A 5A33A 4QQHA 1QH7A 4NWVA 2EVXA 5JXGA 3FL7A 1RB8G 2CSGA 2WZR1 1SLTA 1HJFA 1ULPA 4L97A 4O9EA 4Q4W1 4YNIA 1UX7A 4D7SA 4YARA 1ZM1A 4KI5M 3WF4A 5CKQA 3RWKX 4R8HA 1ENSA 3OGGA 1MS3A 5D8AA 2BDRA 1FV3A 1HQNA 3MV11 3C7HA 4V2VA 5L9VA 1EV12 2TBVA 2WS93 2BBAA 3KM5A 4XFCA 2GMMA 3ACGA 5I0RA 2AR6A 2DVGA 2DTWA 2A6VA 1RUC1 2PHWA 1OLQA 1R082 1OURA 3BN6A 4IQPA 4LLOA 1SBEA 3T2OA 5K9YA 5KWRA 5JXIA 5D2AA 2RS12 3ZXDA 4NRMA 2FD8A 4OUSA 5LCWL 3PJYA 3WF0A 3M1HA 5F39A 5ABJB 3WNMA 2BNNA 1UOGA 4IL7A 2I74A 4FQZA 1K5MA 1WMDA 3DGTA 1TMF3 4UWDA 4FAHA 3FUQA 5J37A 4CEWA 1URXA 2UYAA 3J9SA 4GMP0 2HWD2 3VBFC 4DUXA 3OCPA 2HWC1 4CP9A 4QT6A 3WP5A 1JYIA 5FUNA 3UGHA 2W9XA 3AKPA 4CDWB 1WD3A 3ZYFA 4ZS2A 5H9PA 4YVWB 3MLLA 3KVBA 3ETQA 1RMU3 5FV3A 1ACCA 1HXS2 1Z7S3 2VVFA 1LOFA 2XJRA 3RFRA 4YSFA 2VNOA 3UJOA 4OHYA 3GXUA 1COV2 4CCNA 3ZXEA 4HBNA 4DXRA 4KWJA 2AENA 2P17A 4OUMA 5H9SA 1NCRC 1G9FA 2IXJA 4W6WA 2CTVA 2Z79A 5KHHA 4S2FA 4WZFA 5JSPA 2FDGA 1POV3 1PIV2 3WF1A 3I2OA 3V65A 1UU6A 2JD4A 1AR73 1R64A 5DZFA 4CXXA 2VG9A 3KGZA 2XWJB 4NMIA 3BTYA 4R4XA 1OC1A 4Y4RA 2C24A 3C2UA 1Y7BA 4L9BA 3USSA 1AZDA 1YQ6A 4QX8A 4BCUA 3PMSA 2CGPA 1U5YA 3SKJE 2ARCA 4D8MA 4NHLA 4CU7A 1JZ7A 4AVTA 1AR91 4UFIA 5FYMA 1D2SA 2DCJA 4N53B 2WN3A 4MLOA 4YWAA 5A7OA 4CSWA 1M4WA 4GAZA 1EV13 1NYWA 1HRV1 2LALA 3D5OA 4QDQA 2X8KA 5LRSA 3KMHA 5CU1A 4OULA 1XE8A 4R9AA 4XUPA 5FRAA 1N1SA 2ZGKA 1C5HA 1AYN3 4LBKA 2ZHMA 5FFOC 2A3XA 2L9LA 4CCLA 4QKDA 3WD5A 2EIEA 2Y34A 2RS13 4MGYE 4FP2A 4P14A 5FAXA 4L92A 3LSEA 3ZDSA 1VRH2 3RVHA 2YROA 1UO9A 2W87A 4AZZA 3AYAA 4DPNA 1X8EA 2TEPA 2VVDA 2ZGMA 1R1ZA 1LR5A 3WSOA 4P5YA 4CXYA 5D21A 3K46A 3T1MA 3RRDA 4MHUA 2LS6A 2WFPA 1NLSA 1Q8PA 2HWD3 3WQ0A 2E51A 3SH4A 4BB3A 5IK5A 2RS51 1S0EA 1E5IA 3I3DA 5FXWA 4H2AA 1QJFA 3LSDA 3IN9A 4M00A 4P9XA 3S7IA 3IIIA 2GMPA 1YJLA 2XUMA 4A44A 1VBD2 4Y1YA 5L7OA 2DWRA 5CADA 5FYSA 5HPOA 5ABJC 2J1TA 2XBO1 3MO4A 1ZZBA 4DNYA 3ROUA 1ASJ1 5FY8A 3AJYA 2ZXQA 1JZ8A 1W90A 3AZYA 1PM4A 3DYPA 4OHXA 5LBBA 2VZQA 1PGL1 1EUTA 1S2BA 1VMJA 2QQWA 4YVWC 1PIV3 2OPWA 1DQ4A 1PO12 4Y5TA 1VAKA 4RYDA 1A8DA 1IS6A 3K2OA 4XYXA 5KHGA 1RL3A 5C5TA 4QGNA 2JJ6A 2ZMLA 3AL5A 4YZ5A 5LATA 3AYDA 2EXJA 1FOD2 2P6CA 1YEWA 4LA3A 4LOSA 1O4YA 4MHRA 4XFFA 2A75A 2OXBA 2D6KA 5B2GB 4D6QA 1ND3C 1TZOA 1WGPA 4EJRA 3M3IA 4RSUA 5K4LA 3H0OA 3T0DA 4CP0A 2JXAA 3PUHA 1DIWA 5LA9A 1J58A 5FYIA 5LZ6A 2BEOA 3SCHA 4F83A 3DCQA 2GP3A 4W4ZA 3ZYRA 4D7TA 4TSVA 3WNOA 1W9WA 1E57A 2W91A 4NROA 2F4LA 1LAJA 1XE0A 1UW8A 4BQ4A 3ASIA 3TAYA 3KT4A 3OY8A 1US2A 5T3NA 1SPPA 1FMD3 4IV1B 4COVA 4HMZA 2HBUA 5FZDA 1GICA 2ZAAA 4C0BA 1AXYA 1SCRA 2YGMA 1F4AA 2VD7A 2D3RA 2R073 1KFXL 1VRH3 2IXCA 2Z69A 3J26N 2ET7A 1NZIA 3VHPA 5FDBA 3O0XA 1AUYA 3I2FA 3ZXAC 4N9HA 3B3QE 3ELNA 2VZRA 2UY8A 3S5QA 1GOFA 1OQDA 1QDCA 1US3A 5LBCA 5ACA1 4QB2A 4BDVB 3DPRA 2AH2A 2HWB1 2PAKA 3Q8AA 1QKQA 1JU3A 2YFUA 3Q8FA 4PDWB 1V6MA 4LE3A 3OBTA 2PHLA 3SH5A 1Q43A 3H1MA 2P3IA 1VE0A 3OUIA 1PMJX 1VBD3 2FHRA 3O5SA 3WDWA 1NY72 3N35A 4GJYA
chains in the Genus database with same CATH topology
2VMIA 3D4KA 2P34A 1CAXA 1NLRA 1DYKA 4BMEA 5KXEA 4LHNA 2RR11 4HKLA 4YM3A 3MFAA 1W6OA 4R9CA 1ZYBA 2X53S 2VUAA 4YRDA 5C9AA 4L2NA 4DRVA 4X8PA 1F2NA 1R1A1 1S0IA 1PO13 4XBLA 3AMMA 3QCWA 2P3KA 1APNA 1O4TA 4W6YA 4Q0SA 4P9WA 2RE9A 4Q8LA 3KB5A 4FTBA 3BIWE 4GXLA 1ULGA 1ZA4A 4DOUA 3I2DA 2AYHA 5AVAA 5EWSA 3OTFA 3U11A 4GB31 5DG1A 3BB6A 3UK9A 3WCSA 5BUVA 3MW3A 5LRRA 3RG0A 4YGBA 2Y0OA 4JCKA 1FPN3 1ULEA 2ENRA 1F31A 3IMNA 1S1AA 3AZZA 2PHTA 4R4ZA 3MYXA 3LCPA 4QQOA 1AR81 3N36A 1M06G 5K8SA 3JQWA 4Q4Y3 3R4UA 4LO6B 3M3EA 1A3KA 4KU8A 1F8VA 4LO4B 3T2TA 4XEZA 1QOOA 3WQ1A 4WVVA 2GSYA 1LKNA 2A6XA 1H1AA 4B8EA 5BNPA 3AM2A 4IV1C 1LCLA 4PLNA 3EO6A 4XBNA 1QJY2 1QXRA 4P5HA 3M3OA 1HV0A 2B39A 1XNBA 5TSWA 2BGCA 1GSLA 1V9U3 3NAPA 4KG0A 1VBC2 2JICA 4UBHA 5HXVA 3LA3A 1WCKA 5J36A 1O3RA 4AI0A 3MIHA 3ILNA 4PDWC 5T5PA 1OOPA 4FCAA 1V6LA 3MIBA 3VBHA 3UKTA 4KWKA 5A3MA 4LA2A 2XB6C 2ZX0A 4MXWA 2W39A 3QH7A 4X6RB 3IPVA 5JZGB 1AR63 5BNNA 2HWE2 2RMU3 2YGLA 1WMFA 3SMHA 3AX4A 4LUMA 3CO2A 5FO8B 1H9PA 2FZ2A 2WC2A 2V5YA 4LT5A 2D6OX 2XJVA 1AYM1 1ENQA 1XNDA 2YDEA 2D5FA 3MEPA 3VGIA 4WVMB 2FMYA 2PTMA 1WW5A 2VECA 4LR4A 3WINE 3NSTA 4H55A 2GC0A 4UW5A 3NKGA 2RS31 4URTA 3AMNA 3L2YA 5CFDB 4YZ3A 3JD72 4I3GA 4BH9A 1W0OA 2MEV3 1S0GA 2UWCA 3AMQA 3APBA 3RMXA 2TNFA 5JI9A 3V0BB 3AMHA 1KDMA 2UYBA 2ZKLA 5GLUA 2E7QA 1DZQA 4XW3A 2ZTNA 4FAGA 3UV9A 2R063 2VOWA 2A6ZA 3MF6A 4YG6A 1FX5A 2DYCA 1DGWA 2R32A 4OI0A 2OW4A 3RZZA 4LBQD 2ZHLA 2OUHA 4W6XA 1GBGA 1NA1C 3NV2A 4BIFA 3VBRB 4XF3A 1NZCA 1G8WA 1KS5A 5JIUA 3KS7A 5BNOB 1BXHA 4YW3A 5KHKA 2W68A 1GLHA 1EPWA 1U5IA 1W0PA 3INAA 3DV8A 2X29A 2CAVA 4RHV1 4WM7A 4YYOA 2A7AA 2JKBA 1QF3A 1SFNA 1YYNA 3AFGA 4GA9A 3W9AA 3FLTA 3SLIA 3A0KA 3IDEA 4Y1VA 2A5ZA 1CONA 3ALQA 1LTEA 1TME1 1YFXA 1UAIA 4BLJA 1PO21 2O0OA 3LOBA 1V6NA 1CAUB 4DQAA 4GWNA 3HT1A 1KJLA 3K48A 2RJLA 2YZ4A 1PVC2 1RUG2 1RVF3 4AVSA 3USUB 1YXWA 4B4PA 2IZWA 3H3UA 5JZGC 3BOPA 4FPFA 4XIOA 1VBB2 4IETA 3ZFEA 3GF6A 2NMOA 3FBMA 1NXD1 5DUWA 2JG9C 2WQ4A 5CB7A 2WLPA 1C8M2 4QQ2A 1U5XA 4DMIA 3QOPA 1RUI3 1BBT1 1PMIA 1S0FA 1B35B 4LO7A 4GULA 3HIFA 1S2KA 1H9WA 4NR1A 3UKVA 2ZMNA 5DDJ1 5T52A 2ZBJA 3WVJA 1AVBA 1AL22 5FLJA 4I01A 5JI7A 5CFDC 2QCSB 2PHXA 1ZZ7A 5F9TA 1DLLA 4HZFA 3I8TA 3PHMA 1C1LA 4FPCA 3GBFA 3ZN5A 3VKMA 5FOBB 1DQ1A 3I4IA 4FBFA 1X8MA 2XVGA 4XFBA 4CDWA 1HRI2 2Q30A 2D93A 5DZEA 1C4RA 1MEC1 1DGLA 3JU9A 1WLCA 1VB2A 3KCYA 2NYYA 1ENRA 1XYOA 1QU0A 5KHIA 3WP4A 1MZEA 3VBRC 2ZHNA 4XTPA 1D4M1 5IK4A 4YVSB 1SCSA 4GKYA 4XF4A 5AVPA 3MIDA 1OHFA 5BNOC 1RUH2 1YIFA 4FPOB 4HFSA 3ST7A 4EWAA 3D0JA 3W59A 4B4RA 4PLMA 4AWDA 1CAVB 3FHIB 4HVQA 5I8YA 5FPZA 1NCQB 4Q4V1 2ZABA 4Z2WA 1QJU2 1VBB3 4Y22B 1ND2B 3GHNA 1FT9A 1R092 1JTZX 3I54A 1KDKA 3JBG1 2D5HA 3TBDA 4OHVA 5I8SA 4AGVA 3VZMA 2GAUA 4N53A 2RM21 4JDNA 1EP0A 2XVLA 1UCXA 3ZN6B 1CAWA 3SISA 4Q4X1 3KD4A 1QWRA 3U0ZA 4KL1A 1DQ2A 1AL23 5BYNA 1QHDA 2Z5WA 3WDXA 2QDNA 3VBSC 1I3HA 2BTVC 4XJ8A 3DUIA 1B35C 5LEKA 1CX4A 1G86A 1UIKA 1AX2A 4YW2A 4RS5A 2ZGLA 3MF9A 1W6QA 3OF1A 2WLQA 1UMZA 4FXGB 4AGRA 3KLSA 1NE6A 3CJXA 3TN92 2ETEA 3BU7A 5JIAA 2WS91 2CWSA 4IESA 1CR7A 3EHKA 4G3YC 4LLFA 4DZGA 1MQTB 1SEFA 2JDZA 2IFWA 3QACA 4BA6A 4XFAA 1YO8A 1WBLA 4XZPA 2ZS6B 3U10A 4ATEA 5KXBA 3ZFGB 2HWF2 3RJ2X 4YVSC 1YI9A 1R093 1UPIA 2ATFA 2H6BA 4HPKB 4N43B 4Y5Z0 4FXKB 1WMEA 4LUKA 1H8TA 1LU2A 3O14A 2ZGPA 5T54A 4R9DA 2XJPA 4Y1UA 1QGLA 1Z7S1 2A6YA 1ZRRA 5FQ0A 2NQYA 4Y20B 5C4WC 3V64A 1RUF3 4LBMA 5BPXA 1NCRB 4XBQA 3NO8A 1V70A 3AXEA 4OVEA 1GFF2 2BVVA 4JGZB 2XJSA 2DV9A 3GZTB 4E2SA 3IT8A 2WFF3 4Z92B 1KRIA 2JG8A 4IEYA 2GC2A 5JOWA 4AK3A 1POV1 3SNMA 4AVBA 4DXZA 1AR71 4XXPA 2VH9A 2ZKNA 4R9BA 4XQWA 1ZBA2 5DZGA 2YHJA 2PLV2 1N3QA 5AC92 1TNRA 2H6CA 4AQ2A 2XKPA 4AVVA 4HK9A 2DU0A 2D3PA 4RR3A 2YUEA 3RJRA 1VAMA 3FBYA 3QD6A 4MZUA 4PIZA 2AGSA 4M3CA 4N7UA 4UW4A 4CDQB 5CNAA 1SLAA 2MPFA 2YC0A 1OA3A 1BVVA 1AYN1 1EAH1 1RTVA 2QJVA 3J8F2 1SDWA 1CJDA 1DDLA 3ZSLA 1H0BA 4DS0A 2DFCA 1RUE3 2DUPA 1PZ8A 4AFBA 5JLVA 1Q3EA 2XG3A 2JE9A 4FQ4A 2F4PA 3FC0A 1KD7A 3VZJA 1H1MA 3WX5A 2D44A 4K9SA 4FT8A 2P3JA 4LNVA 2FBEA 1MQTC 3SCGA 4JGYA 4AHYA 1RUD2 1N3OA 1G7YA 2R16A 1XNCA 1BEV1 4K1YA 5GJ6A 2PFWA 3UL2A 1KXGA 2PAEA 2B5HA 4KU7A 3RDIA 3WOGA 3ZFGC 2CL2A 4QU2A 4N43C 4Y1XA 3WW3A 2WZR2 4UW3A 4Q4W2 1EAH2 2WT2A 1HKDA 3Q9OA 2VW0A 4GIQA 3QLQA 4RD7A 2ZGNA 2QUOA 1PK6A 4QPIC 4E27A 1VBE3 5A32A 5KC6A 2I2SA 4SBVA 1ND3B 1TE1B 4COUA 2R49A 3CNAA 4JGZC 4XJWA 1RUC2 3ZYIB 2DF7A 3IWZA 1RUNA 1VIWB 3BPZA 2EAKA 4JRLA 1V6KA 3ZYJB 5F5QA 1QQP3 1C5IA 4CDXA 5E1RA 1BEV2 3OD0A 3ZYGA 4ISQA 2WNUA 1I9RA 4CZSA 2VMHA 1C1FA 2DUOA 2O8OA 5E16A 1QJX1 5GZCA 3TWIA 1NG0A 1UKGA 3GZUC 1S55A 2D43A 2HWC2 1FMD1 3D8CA 3RWNA 4K1ZA 2NLRA 3ILFA 2R071 4WM8A 4LBLA 5H9RA 1JN2P 1KJRA 3HAGA 3AKRA 4CDQC 1R083 2O8QA 1Q8OA 3LOIA 1OA4A 3VLBB 1YUDA 1GQHA 1SLLA 2QDRA 3E6DA 2CAUA 5FMOS 5CA6A 1YNAA 1J3PA 3CU7A 5AFEA 1XQNA 3VKOA 4YFZA 3RNSA 3R05A 2E63A 2WZR3 3HN1A 3MPBA 2XLAA 5FLHA 1HXS3 1S0JA 1MZ6A 1UF2C 4E4DX 1AR92 3V0AA 1COV3 1JHNA 3AK0A 5JCTA 1WLDA 1HRV2 4Y4YA 4IV3B 4K6BA 4MVTA 2E6VA 5I0TA 1RUC3 2E7AA 3IIAA 4WVZA 5CFCB 3SITA 3LB9A 4NHMA 4L99A 3E97A 1O7FA 3ZFFA 5BNOA 5JSOA 2UU8A 4Q26A 1LESA 4A2UA 1Y43B 3H1YA 4AXOA 4Z8BA 1RUOA 2ERFA 1WCSA 3DN7A 4GWMA 2RS52 3B02A 3WG2A 5GM0A 3E5QA 4Y24A 4C1WA 3VBOA 3NVCA 5C8CA 4Q4Y1 3OJBA 1SFYA 4S2DA 3B9CA 2XBO2 2WNEA 2KXLA 5T5OA 1LB2A 1ASJ2 1YFWA 1DQ0A 4ZXKA 4DRRA 1HW5A 2OUJA 4AF9A 4I0BA 1IS3A 1CPMA 4AE2A 3SHRA 5IUQA 4FPLA 4GH4C 4MGIE 5EZWA 3VBUB 1PGL2 1W6NA 1SLCA 4CEYB 5A3LA 5K7PA 4QPGB 4AEDA 2VU9A 1F5FA 1W6MB 3CJIA 1V9U1 2K0GA 4AQTA 4A3XA 1GZWB 2WT0A 1DGRN 3HR9A 4HSJA 2G9FA 4INDA 3LA7A 4RGAA 3O0VA 4COYA 4YW1A 1AR93 3FJSA 2XHKA 1AR61 2RMU1 2X5IA 4AYUA 3TYJA 4CDUA 4N9IA 3NWKA 4UW6A 5T5JA 5JAXA 4FOWA 2LUWA 4X8NA 3S30A 3THTA 1DQ6A 1OFNA 1FOD3 3KCCA 3WDUA 4OZXA 5ACA2 2MHFA 3FMGA 2ZGSA 3ZXGA 2CV6A 3WG4A 2WSUA 4PQ9A 4IV3C 5K0UA 4RL7A 2HWB2 3H3ZA 5A33B 3I59B 2YYOA 2VOKA 4Q29A 3TRSB 5T5LA 3VDDA 3AKTA 4YW4A 1O5LA 2C9AA 4ISRA 2MEV1 1W6PA 2HJIA 5CFCC 4J1WA 1MZ5A 1YIPA 2R041 1OQEA 4HVRA 2RR12 4H7LA 2IXIA 1RHI1 2R061 2B46X 4LE4A 4HKOA 5D8AB 3P3PA 4N7IA 2V09A 1CAVA 1RJ7A 3BTAA 5BXXA 1NA1B 4ZKTB 4XFIA 2GNBA 1NCQA 2LM3A 1R1A2 2Q1ZB 4H3WA 3UJQA 1ND2A 1D0HA 2ZAHA 4CYDA 4LBJA 5HCBA 1N1VA 4L8QA 2GN7A 4P9LA 3JUUA 1GQGA 3IDBB 1K5MB 4FPYA 4YGEA 3N7KA 1X33A 3EJKA 1A6CA 1U0AA 2ILMA 5EYXA 1BKZA 1IHMA 3B01A 2XPJA 3VBUC 4GB32 4CEYC 4QPGC 4KGGA 4EROA 2E53A 2BUKA 1AXZA 1I6XA 4C0HA 1AR82 1WD4A 2NM1A 4XFGA 4IEOA 3WDVA 4DFSA 3AP9A 3U07A 1RVF1 3O0WA 1H4HA 2BW8A 2WIIB 3POYA 1AJOA 2ZX1A 2JEMA 4EN7B 4F3JA 2JG9B 3MGUA 4XF0A 1ULCA 1RUI1 2WKKA 1UPSA 2BFUS 4EWDA 2RR13 3ZVXA 2EXIA 1FNZA 1HQWA 1RUJ1 4P9YA 1X82A 4HN0A 4ASLA 4FPGA 1LOCA 4ZU7A 1DZTA 2IXHA 1SBFA 2A3WA 1XU2A 3VZLA 3OYWA 1LGCA 3EXUA 1OFSA 2N7GA 4XE9A 3M4FA 3JCIA 1LU1A 1GV9A 3VBFA 1YFYA 4V1PA 4N43A 5E8AA 3ZXKA 1JXNA 2H0BA 1VLNA 4DY5A 4XHBA 3JB8A 5D8AC 1AL0G 1QMJA 2QQPA 3ES4A 1QJY3 2D6NA 3EBRA 2EA7A 2ZJCA 5CG9A 4GB33 4LBQA 3RPQA 1AYM2 3KSCA 1VBC3 1NCRA 4ASMB 1VBA1 4NN0A 5KHJA 2F6BA 5L7OB 2ZPXA 3THPA 1H8VA 1ZZ8A 2GMEA 3ENRA 4PIXA 3WUCA 4AI8A 1K5MC 2RS32 4HN1A 4YZ2A 1NE4A 2TUNA 2BNOA 4GALA 4B4QA 4CEWC 4GMP3 4IEQA 3VKFC 2QNKA 3WHUA 1A8MA 3V56A 2R0HA 2BBVA 2HWE3 1O3QA 4AFCA 4ZU4A 1MACA 2GALA 3FFZA 4RA0A 5T55A 2DUQA 4FTSA 1LOFC 2D3SA 3RSJA 1BQPA 2VW2A 3H50A 2FMDA 3H1WA 3KQRA 4AI3A 1DBNA 3NKTA 4K40A 4IEUA 4QQPA 5I0UA 1O91A 2VPVA 3ZSKA 4K7JA 2GU9A 3JD73 2ZACA 2QVSB 1C8NA 3VBSB 3OY8B 2CGOA 4RHV2 4K20A 1KS4A 2DCYA 4XETA 1Q56A 1O5UA 3LKJA 4MV2A 1BMV1 1UU5A 2R1BA 3BALA 2DCTA 2Y0IA 1TME2 1REEA 1N1YA 1PO22 1PM7A 1WA4A 1MS0A 4I30A 4U2AA 3DPRB 5ABJA 2W52A 2ZHKA 2A3YA 3ZMOA 4KBBA 3DKWA 4EWEA 3GHMA 2ES3A 4FP3A 1X50A 4Q1RA 2JE7A 4U36A 1MS1A 4XJUA 3M70A 3QH6A 5I8TA 2CY6A 4K8FA 2ZCWA 4OHZA 1LHUA 2VVEA 1CAXB 2UY9A 5LEJA 4YVWA 1XYPA 2QKDA 4JV4A 2PA7A 1DG6A 1DF0A 1TNFA 1W6OB 3I7DA 3WLUA 5CIRA 5GLZA 5C9AB 1BBT2 1REDA 1W2UA 4XHXA 4YGCA 1F5JA 1ND3A 1DGRA 4QQLA 2WT1A 1Q8VA 1UL9A 1DFQA 5L7OC 5DDJ2 3KCXA 4MSVA 1PVC3 1RUG3 3SXWA 3M8LA 3PVNA 1EY2A 4XF1A 5C4WB 4FOQA 4P9IA 4XQ4A 2PAMA 4IEPA 2XJTA 1WUVA 1U5ZA 1YHFA 1LEMA 1RUF1 4C1XA 5J48A 5JPNB 1UD1A 4YM2A 5HCFA 3ZIXA 4E2GA 1C8M3 1GANA 4I2OA 4RHV3 1J59A 1SBDA 1MEC2 2WFF1 3ZYPA 1BYHA 4YZ1A 4YFWA 1TQ5A 3B94A 3WY6A 4QGMA 1RJ8A 4BOWA 2B7YA 3HBZA 1MS5A 2C0ZA 1D4M2 2ARXA 4KQ7A 5DUVA 4OI2A 1PO23 1ZBE1 1F9KA 2XKOA 2UWAA 3ZX7A 1IS4A 2PHFA 3GBWA 5T50A 1V6JA 5BNPB 4HL0A 5FO9B 1U12A 4Y1ZA 3RYPA 4Q4V2 2DCKA 4LBNA 5CG8A 2Q0AA 4AI2A 1DHKB 1HRI3 1LHNA 3AFKA 1GNHA 1PGW1 3NAPB 2HEYF 4IXLA 2D40A 3JBG2 5FO7B 2VNGA 3DPRC 4IEZA 3LAGA 1OOPB 1ZZ9A 2RHPA 2RM22 2A73B 2E9QA 1ENXA 1SMVA 2GH8A 4M3CF 1RUE1 4MXWB 2A71A 3PVOA 2B45X 4XJ9A 4DY3A 1RUH3 4KNCA 3IPVB 4Q4X2 5FOJB 5BNNB 4Q0PA 1PNGA 2AZ5A 2NMNA 5DUUA 3PMEA 4CP1A 4QXKA 2ZOEB 3NV1A 2XL7A 5C9AC 4RGGA 1QJU3 2JENA 3AZWA 3B69A 4I09A 2V73A 1TMF1 3PVBB 4GKXA 2OVUA 1LRHA 1OLRA 4I02A 2ZGRA 3AP6A 2DVFA 3WW1A 1MS8A 2VY0A 2HKXA 2Y26A 1C57A 5CVRA 1C28A 4LULA 4FPHA 3JZVA 1IOAA 1FATA 1UU4A 5AFBA 1RMU1 4QPIB 1QY4A 2WJSA 4BLIA 4X6QB 1OKQA 2ZGQA 3MLJA 4IV1A 4F8AA 1FI2A 2D97A 1AHSA 4AW7A 1H2MA 4AHXA 2WS92 1HDKA 5JOXA 1LOAA 3VZOA 4C90A 1QXJA 2GDFA 2D6MA 3AYCA 4XDQA 2VOVA 4FO9A 1W6MA 3E5UA 2CYFA 5L19A 1DZRA 1QQP1 4PDWA 4BE3A 1GZWA 4KH9A 5KC5A 3CLPA 5KXCA 1AXKA 2Q5TA 1IGOA 3NW4A 4R52A 3POSA 3PJQA 3AKSA 2PHRA 4NHKA 1O3TA 2DTYA 1J1LA 2RM23 5BNPC 3TN93 3KZ4C 3FFQA 1J3RA 4WM7B 2OA2A 1Z7S2 1EV11 5IT6A 1UZYA 4META 4AGGA 1NOVA 1R081 4LO8A 3NAPC 4Q2FA 3VHRA 4P9JA 3LA2A 1IPJA 2RS11 4MX3A 4A7KA 2IFRA 4J1XA 2WL1A 1OOPC 1NXMA 4FOVA 3M2MA 2HWF3 3VBHC 4J6GA 2XH6A 4XPVA 5BV6A 4N90A 1AR72 2HWD1 1MZFA 1D4VB 1JYCA 5FTTC 5BNNC 4A7YA 1N47A 4EN6B 2XL9A 3ZFEB 2IWGB 3OPZA 2BVBA 4BMBA 5KBFA 1HXS1 3R0RA 1T6GC 4XTMA 3L2HA 1OQ1A 4L11A 1AF9A 1COV1 1HQLA 1PVXA 3ACLA 1UX6A 3WZ1A 4Z07A 1OI6A 4G9SB 4NWWA 2XLGA 4ORFA 3FLPA 5H9QA 1WW4A 1NA1A 3U4XA 3HMYA 3R6SA 1GKBA 5GALA 1AYN2 1CESA 4XIKA 3RS6A 4Y26A 1LOBA 3WXPA 1OSGA 1PIV1 2BNMA 4B7KA 3GZAA 3VL8A 5IK8A 3PLQA 2VULA 4NVPA 3VKLA 2YV8A 1ZBA3 4HT1T 5EV7A 2PLV3 2GZWA 3MFCA 3NL1A 2R6QA 4QD2A 5FCCA 1D2QA 5SV8A 4MGZE 5AC93 5GZGA 1D0GA 4FPJA 2WNVB 1FYUA 5BY5A 3NV3A 3ECQA 3WHTA 5I91A 1V00A 2QE3A 2QZ3A 2W0XA 4LO5B 4PIYA 4OFGA 4M0NA 1YCIA 4WVWA 1G9BA 4JRAA 3WG1A 4FPKA 5CBLA 3M7AA 3POWA 1Q8SA 3J8F3 2YMZA 3G6JB 4MH0E 3MIFA 3MLKA 2BPA2 4GH4B 1ZNPA 1ULDA 2D98A 5JZGA 4PBPA 1VRH1 3N7LA 1G9DA 2YXSA 1SLIA 4D94A