2RS12

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1200
3ZFEA 3VBFA 1NA1C 1R081 4GH4A 1R1A3 1PO21 1RVF3 1PVC1 1PGL1 2RS12 3VBUB 2RR13 2DF7A 2MEV1 5BNNC 5ABJA 1FOD3 4Q4Y1 5BNNA 2HWC3 4CEYA 4QPGC 1MEC1 4YVWB 2RS32 1RUJ1 2BFUS 1FMD1 1NA1B 4FTBA 1VBC3 4GH4C 5CFDB 3DPRC 1ND2C 4Q4Y2 3JB8A 1HXS2 1PVC2 1VBC1 2BUKA 5FMOL 1AL23 4CDXC 3VBSB 5JZGB 4Y4YA 2RM23 4QPIB 1PGW2 1VRH2 2XBO1 3IDEA 3ZFGB 1F2NA 1COV2 1MQTB 3ZFFA 1AR92 2HWD3 5AC92 3VBFB 4JGZA 5J96B 4RFT0 5GKAC 2VQ0A 1ASJ3 4GMP0 1HRV1 1BEV2 3DPRA 1ZBA3 3NAPC 1C8M2 2R072 1RUH2 1H8TA 2R042 4CDQB 4GMP1 1ND3B 3NAPA 1RUD1 3NAPB 1PIV1 1EV12 4N43B 2WFF2 4RHV1 4YVSA 2HWB3 1RHI2 1V9U1 5D8AA 1COV3 3VBFC 3LOBA 2GH8A 1MQTC 3ZFGC 3CJIA 5AC93 5JZGC 3VBSC 4WM7A 5C9AB 2WLPA 5L7OA 2MEV2 1K5MB 2WFF1 1D4M2 4AEDA 1E57A 1Z7S2 3TN93 5JZGA 4GB33 1PO22 4CDXA 4AEDB 1QJU3 5CFDC 1FOD2 1AR83 1MQTA 4EJRA 5DDJ2 3VBHC 5FOJB 1DDLA 1R092 4GMP3 4JGYA 4QPGB 1C8M1 5A32A 1PO12 1TME2 1VBC2 4BCUA 1RHI3 3VBUC 1TMF2 5J98B 2R071 1A6CA 1HRI3 4N53C 2GSYA 2WZR3 4YVSB 4WM8A 4CEYB 5ABJC 3VBOB 4CEWC 5C4WC 2X5IA 4PDWB 2R073 3VBRB 1FMD2 5CFCA 5CFDA 4YVWA 2BPA2 2FZ1A 1PGW1 1VRH1 2XBO2 1NA1A 2RMU1 4Q4W3 1RB8G 1AUYA 2QQPA 1COV1 1D4M3 1NCQC 1EV11 3JD73 1QQP3 2WS93 5C8CB 4JGZC 1AR82 2Y26A 1ZBA1 1QJU2 1AR72 1NCQA 2RMU2 2HWE2 2R063 1F8VA 1NCQB 1MEC2 4RQPC 5D8AC 5L7OB 4RS5A 1QJU1 1EAH2 1EV13 1VBE1 4RR3C 1IHMA 1BMV1 3VBRC 1AR61 2HWB2 4WM8B 4Z92B 4YVSC 3JB4C 1POV3 5C4WB 4N53B 3JBG2 3VBOC 4CEWB 4CEYC 2HWF1 4IV1C 4JGYC 4CEWA 1NCRC 3VDDC 4CDUC 1AR62 1VBD3 2IZWA 4Q4X1 1CD3G 2WZR1 2RR12 3VBUA 1AYM2 3JD71 1V9U3 4CDWA 2X5IB 1RMU3 3VBHB 4AEDC 3ZFEC 4FSJA 3TN92 4Y5Z0 2RMU3 1AR93 1OOPB 1QJX3 4QPIA 1B35B 5BNPB 1RUJ2 4WM7C 1RMU1 1K5MC 1AL0G 4Q4V2 4IV3C 3ZFFC 1PGL2 1RUG3 1PVC3 1VBE3 5K0UC 1R082 2FZ2A 4Q4W1 1VRH3 4NWVA 1RUI2 1HX6A 4QPGA 2PLV3 1ND3A 4SBVA 1VBD2 1AR71 4N43A 1RUC2 1V9U2 4RHV3 1BEV3 1QQP1 1ND3C 1RUF2 4CDQC 3VBRA 2PLV1 1ZBE3 1PIV2 5BNPA 4Q4V1 5CFCB 1R1A2 5LK7B 1RVF2 1QJZA 3CJIB 2HWD2 1MEC3 1D4M1 1X36A 4FTSA 1ASJ1 1HRV2 2HWB1 1NG0A 2MEV3 3VBSA 1HXS1 1FPN1 1K5MA 1RMU2 4GB32 1VB4A 5C8CA 4CDXB 1B35A 3ZFFB 1AYN1 1QJX2 1ND2A 4QPIC 5BNOB 5A33A 3S6PA 4FTEA 4CDWC 4WM7B 1VBA2 1AR81 5BNPC 2WZR2 1OOPC 5DDJ1 1RHI1 4Q4X3 3DPRB 2X5IC 2WFF3 2ZAHA 1AYM3 1Z7S1 4N53A 4YVWC 5BNNB 3HAGA 2RS33 1POV1 1FMD3 4JGYB 1VBB1 2TBVA 5A32B 1BMV2 4CDQA 1NY71 1POV0 1ZBA2 2RS11 1AYM1 3JD72 4RR3B 3ZXAC 1ZBE1 4CDWB 1PIV3 1R083 2R043 5L7OC 1AR91 1NOVA 1AR73 1PO11 1TME1 4NWWA 1VBA3 2R062 5BNOC 1OHFA 1SMVA 1VB2A 5A33B 1VBA1 1AL21 5K0UA 1FOD1 4Q4Y3 2R041 2PLV2 1AYN2 1HRV3 5C8CC 2HWF3 5ACA2 3CJIC 1VAKA 1FPN2 1TMF1 3J8F2 5CFCC 2ZTNA 1VBB2 1RUE1 2WWSA 1RUE3 1AR63 2XBO3 1H8TC 4Q4W2 4PDWC 1X33A 5ABJB 2HWD1 1C8M3 4RR3A 1R091 4IV1A 1RUD3 5DDJ3 3VBHA 2R061 3JBG3 1OOPA 4RS5C 1RUH3 1WCDJ 2WS91 1RUG2 1BBT1 1M06G 1AYN3 5K0UB 1QJY2 2HWC1 2RS52 2RS31 5C9AA 5ACA1 1FPN3 2RR11 4Q4X2 3J8F3 5ACA3 4IV3B 4RQPA 1Z7S3 1PO23 1RVF1 2ZZQA 5BNOA 1BBT2 1R1A1 5C9AC 1RUG1 1RUJ3 1GFF2 1B35C 4Q4V3 3ZFEB 4RHV2 1PO13 1TME3 2BBVA 1QQP2 1VBE2 4RS5B 1NCRA 3VDDA 1ZBE2 4CDUA 1RUD2 1EAH1 1CJDA 1NCRB 3VDDB 4CDUB 1QJY1 2HWC2 3VBOA 4N43C 4IV1B 4LLFA 1RUI3 4PDWA 1VBD1 1RUH1 1OPOA 4GB31 1H8TB 1RUE2 5FMOS 1HQNA 1QJY3 5C4WA 3TN91 4WM8C 1R093 1TMF3 3M8LA 1HRI2 1ASJ2 1RUC3 2RS13 5AC91 5D8AB 4RQPB 1BBT3 2HWF2 3FBMA 1HRI1 2HWE3 1VBB3 1W39A 2RM21 1RUF1 2XPJA 3J8F1 1QJX1 1C8NA 4JGZB 1RUC1 2RS53 1BEV1 1EAH3 4IV3A 2RS51 1HXS3 1NY72 3ZFGA 1RUF3 2RM22 1ND2B 2WS92 1RUI1 1AL22 2BFUL 3JBG1 2HWE1 4GH4B
chains in the Genus database with same CATH superfamily
3D82A 3ZFEA 2DVFA 2GP3A 3HNYM 1NA1C 1JZ2A 2QDNA 2VGDA 4AFMA 5JMOA 2Y6HA 4W4ZA 3RYKA 2VVFA 4MXVA 1UOFA 2RR13 5BNNC 4QQLA 3SH5A 3IDCB 5FYYA 1TEIA 2ZGMA 1X9TA 2XJVA 2EIGA 4YVWB 2RS32 5FY0A 3U4SA 2O8QA 5KXDA 2AC1A 3KT1A 4MXWB 1NA1B 3GCXA 3JZVA 2L9LA 1UY1A 2SBAA 2BERA 3GBFA 5FP3A 3H0OA 2UWCA 2VMEA 5F5CA 1UU4A 3AVRA 3IDBB 3I2JA 3WDWA 2Y0OA 4CP1A 2QE3A 3WUCA 2YDEA 2JE9A 3PVBB 2DUOA 3A0KA 4AOCA 1PVC2 3POYA 1UX7A 5DAPA 4Q8KA 4Z2AA 1I9RA 1AX1A 5JZGB 4Y4YA 2RM23 4QPIB 4WZFA 4BISA 3C7GA 3ZFGB 1RJ8A 4IERA 3WQ7A 3PIGA 1JYNA 1DHKB 1F2NA 3SEEA 4BQXA 3VLBB 5KXCA 1LAJA 4I3GA 3RI9A 1SG3A 1YQ2A 5JSOA 2DVBA 5J96B 3CZJA 4ONUA 1UNBA 4RFT0 4BQ1A 1HLCA 3ILNA 4N7IA 2XJQA 3WW1A 3RPQA 1JYVA 4Q26A 2XLGA 1W3XA 4NPMA 2IXKA 2V4VA 3ACGA 4GMP0 1CESA 4IE6A 5IK4A 4YYOA 3HQXA 3UYJA 4IEWA 2PHFA 1KDMA 4ASKA 5JI9A 3IWZA 1GLHA 2BVBA 4LK7A 1W8TA 1EY2A 4M3CE 2JDKA 1GNYA 1JUHA 1RUD1 4HK8A 5F37A 3NAPB 1QOTA 5KC6A 3J7NA 1F9KA 2YY1A 5E8AA 1QKQA 1GUIA 3FLRA 2ES3A 3EJKA 2QCSB 4GIQA 3O1PA 4C1WA 3AJZA 4EN6B 5D8AA 4QXHA 3T0AA 3AP6A 4AI1A 1GR3A 3D3AA 4AQTA 1SPPB 1OPMA 1S2BA 2FDFA 3WNNA 3ZXJA 3LOBA 2GH8A 1MQTC 2HKXA 4DINB 1R1ZA 4KMQA 3TYJA 4D8MA 1LOCA 3ZFGC 3CJIA 4D7SA 5AC93 4Q5OA 5JZGC 4WM7A 1QXJA 1PZ8A 3ES4A 5C9AB 2ZGNA 1M06G 4YSFA 2YC0A 5I8SA 1RYYA 1M4WA 2XL7A 4FT8A 2ZGOA 1PK6B 3OPWA 1L3JA 2JWPA 1OLRA 2OS2A 3LAGA 4FFFA 1PO22 1O3RA 2BWAA 2OX0A 2RJLA 4CDXA 2BVVA 4Y5SA 1AR83 1MQTA 1YJKA 1QMJA 3TWIA 3WHUA 3WQBA 3W58A 4GMP3 2Q8DA 4JGYA 4U36A 4QPGB 4LIVA 4XDOA 2RDRA 5GM0A 1MS5A 1N1TA 2YC2A 1PO12 1TME2 2TNFA 2BTVC 2WSVA 1W2UA 2NLRA 1GP4A 2ZPXA 4XW3A 5DAXA 3RZZA 3A7QA 4H55A 1LEDA 2G19A 2JDUA 1LCLA 2PHLA 4IXLA 4QGLA 5JI7A 3SH3A 5C4WC 2W95A 2FCUA 4FQ4A 1KQRA 5IAVA 2R073 2WR9A 3VBRB 1WCKA 5JXIA 1ZM1A 2PHTA 4XUNA 4BHPA 2VMDA 1ZZBA 3KVAA 2JB8A 4CCCA 2FZ1A 1TNRA 4XFHA 4DZGA 4M01A 2E33A 2JKBA 2RMU1 4Q4W3 3RYRA 1AUYA 2E31A 2QQPA 3AL5A 4CCMA 4F3JA 5IVCA 2ZA9A 2WN3A 3WG1A 1ZZ7A 4XFAA 1DGRA 3KQ4B 4EN0A 1UPSA 3WF4A 3SCGA 3L2YA 2NYYA 4JQTA 2Y26A 1LECA 1ZBA1 3ACFA 3KSCA 3IAPA 4GQ7A 4XJUA 2NQYA 1C3HA 2FQPA 2RMU2 2BGOA 1NCQB 2A75A 5FZFA 1W8HA 5CKMA 3O0VA 1LOGA 1H2KA 4Y3OA 5L7OB 5DAWA 5TSWA 4DUWA 2NP0A 4CRQA 4IW3A 1LESA 5A7PA 3AK0A 1AHSA 1ULGA 1VBE1 3H1YA 3IDAA 4RR3C 5KHHA 4BLJA 4MX3A 2HWB2 1H8VA 1TG7A 2HYKA 1YC61 2OUJA 3VZKA 5EZWA 4GXLA 1UY0A 3JB4C 3ZYPA 4LBOA 4PLOA 3C8XA 3OGVA 3VBOC 4CEWB 2HWF1 4W6XA 1E5RA 2Q1ZB 4OMDA 5A3OA 4AEMA 5CG8A 2LW8A 5I0RA 5F5IA 1XNDA 4AI9A 2WYSA 2RR12 3UT0A 2W68A 1EPWA 5C3QA 2J22A 1QXPA 1RMU3 2E26A 3QOPA 4HT1T 1LNSA 4KWKA 4QX3A 5JXGA 2A7AA 1J84A 1YLLA 2P17A 2RMU3 1V6IA 5A3NA 5C70A 5FZEA 4BXFA 4CSWA 5JR7B 1H30A 1BYHA 2AR6A 4CTEA 1GZTA 3WSOA 2VECA 5CEHA 4IV3C 1JZ6A 3JXSA 3RZJA 3RZLA 4L97A 2AGSA 3OTFA 1YRZA 4QX7A 5FO9B 2A1XA 1LU1A 2CL2A 2N7GA 3TNQA 4DXZA 5C3OA 3NNMA 1HX6A 4QPGA 4YRDA 3K3NA 2XLAA 4LNVA 4FFIA 1SQ4A 1DLCA 2PLV3 1IOAA 4OVEA 4SBVA 5A6XA 1UXXX 5IWFA 2CYFA 2RHPA 4ES9A 5BNQA 1GYKA 3OUHA 3E5QA 4FPCA 4RHV3 1ODMA 1QQP1 1ND3C 1OURA 1T6GC 3GZUC 3VBRA 3ZLIA 3ZYJB 2Y8KA 1DFQA 4NPLA 4Y22A 4CUCA 3SCFA 5EJ3A 4NAMA 5FUPA 3WCRA 4CU8A 3MICA 2ZAAA 2RV9A 2VZRA 5F2SA 4D3WA 5CFCB 1W6NB 3J9SA 2OKXA 3KCCA 1RVF2 3PDQA 1QJZA 1AXZA 3VD7A 2D93A 1O8PA 2VTXA 3SMHA 1X36A 2I2SA 3NNJA 1ASJ1 5FP7A 1UX6A 2CU5A 3V64A 1NG0A 2ZGQA 5E89A 3HEIA 2JD4A 3M2MA 5A1FA 1ZREA 1GANA 3DXTA 1YFWA 5C8CA 1W6MB 2GNBA 4COWA 4LO6B 1QJX2 4YGEA 1PNGA 4QPIC 5FWEA 5BNOB 1O59A 5C3PA 2YXSA 2A70A 3SNMA 1VAMA 4CDWC 3KQRA 4LT5A 2Z69A 3DKQA 2D3RA 1OOPC 4NRMA 4XXPA 2VQUA 3GNEA 1RHI1 1XSQA 5JXHA 4Q4X3 1REEA 4PLNA 3PL0A 4AHXA 2W1WA 3KS7A 1DCSA 3B93A 3CNAA 5DUWA 4CP9B 4E4DX 2XQRA 2ZEYA 2WLQA 4LUMA 3UJQA 1Z7S1 2DDUA 3VHPA 2ZX2A 4H3WA 4O61A 5FJKA 1IKPA 1QDOA 2YGMA 4YVWC 3JUUA 5GLUA 1CVNA 2K2SA 4HG6B 5A7QA 4KBBA 2H6CA 4M3CA 1ZVFA 1ONAA 5FIXA 1VBB1 3WDTA 2TBVA 2A3YA 1J59A 1BMV2 3BU7A 1GZ9A 3LFMA 5CG9A 5LA9A 5K8SA 3WNOA 1NY71 2YUEA 2JICA 1OLQA 1JU3A 4WVZA 4YGDA 4EE2A 1AYM1 3JD72 3U0ZA 4URTA 4QX2A 2NMNA 1OLME 1S4CA 4CDWB 1PIV3 5A3TA 1R083 3TEZA 3C7EA 4JVAA 1AR73 4I3PA 3LQCA 4CCJA 5FPVA 3ZXGA 4DB5A 2FDIA 1VBA3 1VLNA 2PAKA 1RUOA 4XDPA 1WCSA 3ZR5A 3N9LA 3ZSMA 1DYPA 3USUB 4AGRA 3QACA 1FOD1 3H8OA 2UY9A 2R041 4IE4A 5L9RA 1XE0A 1GOHA 1YO8A 4CZSA 1HRV3 1ST8A 1ZRRA 2R30A 2YBKA 3U11A 1CONA 2Y6JA 1LODA 1EYBA 2HWF3 1W6OB 5LEJA 2B9UA 1I6XA 1GP6A 5A6YA 1VAKA 3GXUA 5FUIA 2X53S 4A6OA 5GZDA 3TEXA 3J8F2 2GNTA 2XR4A 1N3QA 5CFCC 4HETA 4MVTA 3HOBA 3PTRB 4TWTA 4Q1RA 2P3JA 3ZR6A 1JH5A 3JU9A 4AHZA 1AR63 1HB4A 2FHRA 4LBQA 1VP6A 2QVSB 4EN7B 1XBFA 2WO3A 2GNDA 2DTYA 4MGIE 1H1IA 5IAXA 1JS9A 2IFWA 2DUQA 4AR2A 3B69A 2YPDA 1UAIA 3VZJA 5ABJB 5FZMA 5F2WA 5C7GA 2VW2A 4CCDA 1RUD3 2CSGA 4XIOA 2LUWA 1RUH3 2J1SA 2WS91 5LRRA 3AP7A 1OFNA 4ZZ5A 2BQPA 4QU1A 1U12A 2Z79A 1GOFA 3RDIA 1JZ7A 3USUA 1QJY2 5DZFA 4XCAA 3SKVA 1UU5A 2KXLA 1R64A 4XJ9A 5ACA1 1W8NA 3KWVA 1FPN3 1ULPA 1PK6C 2ORXA 4Q4X2 3J8F3 3WUDA 1F5JA 4RQPA 4ZU5A 3AKQA 5LWBA 1CAUA 5BNOA 1R1A1 2B45X 2ETEA 1RUJ3 4UFHA 2OQ7A 4N9IA 5IK8A 2QFEA 3LD8A 4U2AA 1B35C 1FNYA 4GALA 3GGLA 3MGUA 4UWDA 4XACA 3ECQA 2QQMA 4LHNA 3NO8A 3B94A 1O5LA 3ZFEB 2ZHKA 5HV4A 3NV1A 2Z42A 5HV0A 4BK4A 3L2HA 2A3XA 3K2OA 3VDBA 1HDKA 4LOSA 4OHWA 3U75A 4E27A 1CJDA 4OYUA 4IESA 3LA7A 3LPGA 3VDDB 1YQCA 2WFPA 1LGBA 2YBSA 2VVDA 2HWC2 2GNMA 2QBXA 3ASIA 3MW2A 4R4ZA 5FZ0A 2DWRA 2WDBA 4TN7A 2OT7A 4DIQA 2ZX4A 3MIDA 1YJLA 3FE5A 3HN3A 3ZIXA 1H8TB 1RUE2 1UY2A 4O65A 1QJY3 4XVHA 3TN91 3ZYGA 4AQ6A 1F31A 2W52A 4HPKB 4FQZA 1XC6A 4PIYA 2E32A 2QQOA 5FO8B 5JAXA 3EBRA 1G9FA 1ASJ2 2VW0A 1A34A 2IUWA 2VTFA 2WO1A 3MI8A 5JIUA 4LE3A 5AC91 4Z07A 1WGPA 5LASA 4V1PA 3ZPOA 2JDNA 4RQPB 2HWF2 2YU2A 1MACA 5FQ0A 4Y20A 2FCTA 4YW6A 2AACA 3GHNA 4EYUA 1STMA 3DYPA 1HRI1 1SACA 5LBBA 2EXIA 5J09A 3ZN4A 4W6WA 2P3KA 3AKPA 1HIXA 3NRUA 1SLIA 1Q3EA 3J8F1 5FY9A 1RUC1 1H9PA 2W91A 3IKWA 2IWGB 5AVPA 4RGGA 4IV3A 1ZA7A 2RS51 3LDBA 3WDUA 1G9CA 2FBEA 1CAXA 1SLTA 1RUF3 5AFBA 2LRPA 4QD2A 5GZFA 4CU6A 4XUOA 1RUI1 4Q29A 2XONA 5SV5A 3JBG1 4MGKE 4B8EA 4COZA 2VXJA 2IXJA 5T5LA 4N9HA 2ILMA 3VBFA 4NPRA 4P9XA 4AI2A 4LBKA 4GH4A 3AKSA 3H50A 3NJXA 4W6YA 2VZQA 3MIBA 1JYCA 3AVSA 1V6LA 1WA6X 4YZ3A 1FI2A 1YI7A 1GMMA 3AYEA 3VBUB 1RC6A 2DF7A 3POIA 4M00A 1XU2A 4XE9A 2GU9A 3FX3A 5C5UA 5KHJA 4Q4Y1 1NT0A 1QOSA 4C8DA 2XHNA 1GQGA 2ZEZA 4H7LA 4QPGC 1MEC1 4CEYA 4LKSA 5BNNA 3FUQA 1O3QA 2ZBJA 4AVAA 1D2SA 5HCHA 1ZA4A 4FTBA 2VCMA 1EP0A 4GH4C 3VB9A 5CFDB 1G9AA 5F3GA 1F4AA 4CA9A 2OPKA 4AE2A 5CKQA 3FWEA 3CKHA 4FFGA 1PZ9A 2IC1A 3JB8A 4Q4Y2 4XUTA 1IS5A 2WJSA 2H6BA 4ZS2A 2VZVA 2KD7A 5F39A 2VNVA 2IVIB 1AL23 1K45A 1EUTA 2JDMA 4B4QA 1OUSA 1E5IA 1WMEA 3W21A 5C3SA 4GWJA 1CAXB 2XB6C 5EFUA 4QDRA 5IFPA 5FYVA 5KBFA 3N9PA 1MQTB 1MVQA 1PZ7A 2C26A 3OD4A 3VUOA 2FDGA 1W2NA 1UYPA 5A3WA 4HMZA 5KR7A 4XHBA 2C24A 1DYOA 3UV9A 4AGVA 5L73A 3VBFB 2EVXA 2D44A 1PMHX 1WA4A 4PJYA 1EUUA 1JHJA 1ASJ3 2ZMLA 5F6LB 3EHKA 1GWLA 1QEXA 1YFUA 4NIDA 1LHVA 3NQHA 5DAVA 4UFJA 1C8M2 2B5HA 2QJVA 2R072 2ZKNA 2WIIB 1HV0A 1LR5A 2J1AA 3PNAA 4B4PA 4FOWA 1H8TA 4BB3A 1OQEA 3M70A 3F95A 5B4NA 1L7LA 4GMP1 3AMPA 1J3QA 3KHCA 3MIFA 5IVBA 2VOKA 1Q8SA 3ILFA 2Y33A 1UXZA 4QM9A 4AFBA 5LRSA 4RHV1 4YVSA 3RG0A 4GWNA 4A42A 3A4UA 4A44A 1V9U1 1JZ8A 1SCSA 1X7NA 3GCWA 1COV3 4AK3A 3CMGA 5FMDA 3T3YA 2PQQA 5K0UB 2ZX3A 1KS4A 5GLWA 1SDWA 4FP2A 4DEVA 4E2QA 1LOAA 3PVNA 4Y1YA 4YM0A 1BVVA 2JDZA 3WP3A 3VBSC 1TVGA 3THDA 4AI0A 1LGNA 3RI8A 1IPJA 5JOYA 5FRAA 3HNMA 1UW8A 3NKGA 5CISA 4R9DA 5L7OA 4MGZE 2MEV2 2QTWB 1RUNA 1MZ6A 1ULEA 4XOGA 1E57A 3MUY1 2UWBA 3TN93 2ZGUA 2XHKA 3MW4A 4XMIA 5DN2A 3H7JA 3ZDVA 4CP2A 2VOXA 4AEDB 2E53A 4NN0A 3SHRA 4AZZA 4QU2A 4FAGA 5F5AA 4XJAA 1FOD2 2QZ3A 4EJRA 2KM2A 5DDJ2 3WP5A 3VBHC 4NO4A 1R092 3WW3A 1C28A 4YG3A 4S2GA 2DCYA 4XXAA 4AFDA 1PMIA 4XBQA 1RHI3 4MH0E 3VBUC 1KFUL 2DYCA 1W2TA 1HRI3 3NV4A 4FVVA 1F5FA 2GSYA 1O6UA 2I07B 1W9WA 4YVSB 4XZUG 4CEYB 2JG9C 1HQLA 3FMGA 5FYSA 3VBOB 4CEWC 5FZ7A 1NUKA 5IFTA 1OD5A 2ZGTA 1E5SA 5FXXA 3H3UA 4PDWB 4HBNA 5FY1A 4M4RA 2EICA 4MOAA 3G7DA 2GZWA 5CFDA 3WINE 4YVWA 4FPOB 5I0UA 1LGCA 2GC0A 1BXHA 3S0MA 2RVAA 1W0PA 3VZLA 4CP0A 1NA1A 3VD9A 3FLPA 3KF5A 4XABA 2WUHA 1OI6A 1UZZA 1COV1 2BDRA 2VU9A 2XDVA 2YZ4A 5ANNA 5IJRA 1O4ZA 1CAWA 1UIJA 4BJ0A 1AXKA 4LLOA 1OT5A 1WW5A 4XQDA 2EAKA 5LK5A 2ARBA 3KF3A 5BUVA 2CHHA 2W1UA 2ARAA 4P5HA 2BNNA 1F8VA 2RDNA 2VC9A 1OA3A 2WAAA 1MEC2 3TEWA 5D8AC 3APBA 5CADA 1Y3TA 5SV8A 5HI0A 1UKGA 5CU1A 4P5YA 3N3HA 1QJU1 4OUMA 1RXGA 3CEWA 2P1BA 1XYOA 1DQ1A 5FWJA 1V70A 2WABA 2ZGPA 3U14A 1EV13 3HBZA 1DZQA 4ASMB 1UN1A 1ACCA 1AR61 2JG9A 2VE1A 3OGJA 4HK9A 1D0GA 1UPIA 3AYAA 1TQ5A 4PF5A 2WYFA 4YFZA 2MPFA 4Z92B 4YVSC 3MBWA 1SLLA 2ZCWA 1POV3 2XWJB 1AZDA 3M3CA 1DF0A 1WMDA 5FP9A 5GJ6A 5IVYA 5C4WB 3TEYA 1QNYA 5FLJA 2WQZC 5T5JA 3MFAA 4CEYC 4QQOA 4IV1C 1W6PA 4JGYC 4I02A 3I54A 2CDPA 1WLWA 2R0HA 4UW5A 4XF9A 4LEJA 4K1YA 3B02A 1VBD3 5I8TA 2IZWA 4B7KA 2WZR1 4OI4A 1AYM2 3JD71 2BGCA 2DBIA 3MF6A 4LXLA 5I91A 5DG2A 4LK6A 2JEMA 5HPOA 4R9CA 3S30A 4XF4A 2UWAA 2ZXQA 3DF0A 1CPMA 4X6QB 4AEDC 4B1MA 5JOWA 4OQ8A 1W8UA 3TN92 4QDQA 1RIRA 1YIFA 1AR93 1JUIA 1Q8VA 1QJX3 2LROA 1QH7A 1RGSA 2R0FA 1OF3A 3HNBM 2LTNA 1RXFA 4LO7A 3NMBA 3WG3A 3BTZA 1MS0A 2ZGSA 3MW3A 3OBZA 2ZOEB 2W9XA 3LA2A 1I5PA 1RMU1 2VVEA 2WT0A 4QB1A 1K5MC 5FK7A 1AL0G 3PVEA 4Q4V2 4QX5A 4A4AA 4D7YA 5AFEA 5BYNA 4HKOA 4BE3A 1UF2C 3OYWB 4Q0SA 3AP5A 4OLLA 2HEYF 4ZXEA 1US2A 1OC1A 2QNKA 1KGYA 3RRDA 3RZHA 1BZWA 2AENA 3HMYA 4DNYA 1VRBA 4KH9A 3LIHA 3POWA 5K0UC 3E6CC 3HPNA 4KWJA 1A8DA 3DGTA 1MR5A 2EXJA 3VKOA 1PK6A 5FZ4A 2J1VA 1RUI2 1FNZA 1OA2A 4CCKA 2HBTA 2TEPA 5IYYA 3FLTA 3ZSEA 1ND3A 1S0GA 3OPTA 3WDYA 5HCAA 3OGRA 1VBD2 2AZ5A 1Y9MA 4K9SA 4MSVA 3EYPA 1XSRA 4UI9L 1AR71 1P8JA 1LKNA 1RUC2 2QQWA 1HB2A 5FZDA 4CE8A 3NJYA 4XFIA 4CDQC 3BGAA 4JTOA 4AQ2A 5J7MA 3V65A 4HONA 1B09A 2D6KA 2ZACA 4HOOA 4DEQA 3ZIWA 3P6BA 1OF4A 2B8MA 1V0AA 3I2IA 1PX4A 3UKTA 4CCEA 2XKOA 5IVEA 1Q8PA 3RZKA 5F3IA 3BKZA 5FYTA 4P9JA 4I30A 1IS6A 1W9FA 1UKRA 2PHWA 4BZ4A 1R1A2 3DN7A 1IS4A 3T0BA 1YFXA 2E6VA 1MS8A 1MEC3 3J7MA 2VOTA 1F4HA 5CKNA 3BVCA 4HVRA 2BYVE 2OW4A 1CZVA 1J3PA 2HWB1 2MEV3 4DY5A 3VBSA 4EN8B 1HXS1 1G86A 2QQVA 4QKFA 2VMHA 1RMU2 4JX0A 2DCJA 1W6OA 2X09A 1VB4A 4Y20B 1UZVA 4M4PA 4AG4A 3DUIA 5I0SA 4X6RB 2HLEA 1ND2A 4YNIA 4Q0PA 1LHNA 3K51A 4H7MA 4HVOA 3ON7A 4UOJA 3TRSB 5T55A 3ZYHA 3ZXKA 2VZPA 4FTEA 4QXKA 3EXUA 3I2KA 3HJRA 4ZONA 1H6XA 1H2NA 1OSGA 2JDPA 2V5DA 4WM7B 1AR81 3LEIA 4YWAA 5BNPC 3HT2A 4P9LA 5KC5A 1HN0A 2VNRA 3FHQA 3MLKA 4INDA 3MEPA 4NHYA 4E9KA 4PT6A 3VN4A 1L7RA 3MLJA 2C9KA 2E7AA 3W5MA 2BNOA 4FPLA 3OBAA 4FPFA 4QXBA 2FDJA 2EXHA 2VD7A 1XYPA 3MF9A 5EP9A 3ZOIA 3O1OA 1IPKA 4MGYE 2JG8A 4QPWA 4KGGA 2RS33 1POV1 3AZVA 4UT5A 4JGYB 1BK0A 2ZEWA 2ADDA 3MIEA 2GALA 1IQAA 1OKQA 3ACHA 3AYCA 4N8MA 1CQ9A 3OJBA 1W99A 2WWJA 4NOTA 1J58A 2XH6A 1DGRN 2VBPA 3V0AB 2BOIA 3AKTA 1OVPA 2PTMA 3GZTB 3J4UH 1ZBE1 3GHMA 1Q5OA 1IS3A 2BGPA 2OIIA 2VUCA 2R043 2O1QA 1CAUB 5DZGA 4XMAA 1AR91 1NOVA 4R4XA 2JDAA 3TNPB 5BNOC 4FO9A 1OHFA 1VB2A 3BIWE 3L9JT 2Z2SB 3W5NA 3I2FA 2WZPP 5JUVA 3I2DA 1AL21 3N7LA 4UBGA 3WEZA 4P08A 5FPBA 4NE9A 3NV2A 1AYN2 1J3RA 1QY4A 1YIPA 1YNAA 4M0HA 4KI5M 4E8DA 2WNEA 1VMFA 2VULA 3LSDA 3S5AA 4M0NA 2VCAA 1T6BX 1TMF1 3LDRA 4JKKA 4ZZ8A 2ZTNA 1VBB2 4EROA 4LTAA 3ME2A 4BQ4A 4N7UA 3Q8AA 1DBNA 2ZGKA 3FHIB 3R0RA 1SHWB 3PIJA 1RUE3 1WCQA 5EJZB 4K21A 2VMIA 4J6GA 3ZXDA 1V6MA 5F6KA 3WHTA 4HPKA 2ZMKA 1W0NA 4C1XA 1JU4A 3ABZA 3URFA 3ST7A 1JW6A 2CY6A 3D8CA 3T2TA 4AVTA 4F83A 3ZSLA 3ZX7A 1UMHA 1X33A 1BCXA 3V0AA 1VALA 4LBNA 3AMQA 2B9VA 4BQWA 4LR4A 4YGCA 5FYBA 1R091 5CVRA 2XJUA 5DDJ3 3VBHA 4CUBA 3LB9A 4RD7A 2EALA 5JOXA 4J25A 4JZRA 1OOPA 1S0IA 3KGZA 1D4VB 5IATA 5FZ3A 2GC3A 4XYXA 3F2ZA 1QXRA 1RUG2 4ZXKA 3B5LB 2JDHA 4QX0A 4AEKA 1AYN3 3TBDA 1XRUA 3MFCA 3FC0A 3U10A 1S2EA 3UL2A 5C8WA 1FV3A 4OCTA 1LJ7A 3UK9A 5IHRA 4CXYA 1YXWA 4FAHA 2RR11 4IV3B 2WNOA 3H1MA 3N36A 1GU3A 2LS6A 1PO23 1RVF1 2V73A 4DQAA 3K4DA 5C9AC 1RUG1 1GFF2 3NV3A 4DXTA 1W6MA 3M4FA 5J3UA 4JAAA 3T1MA 1X8MA 4CXWA 4DO0A 1DGLA 1SFYA 4Q4V3 1IGOA 1XNAA 4COYA 1YFYA 1AX2A 4N90A 4IE7A 4XEZA 3OBRA 1GZWA 2P4EA 1APNA 4K8RB 2BV4A 3IIIA 4RHV2 4KL1A 1PO13 1TME3 2XQXA 2YPJA 4B1LA 4BK5A 2BBVA 4FI9A 4A3XA 2C6SA 5FY8A 1VBE2 3KV6A 1NCRA 4BWOA 4CDUA 5JPNB 2G9GA 1WD4A 1FXZA 1V6JA 2PHDA 4I0WB 3QBQA 4JQRA 4R9AA 3O7OA 2OXBA 1CIWA 4XBLA 3R4DB 5FZHA 1BK1A 3WW4A 4LLFA 1RUI3 2TUNA 1RUH1 3N7KA 4OHZA 1CGPA 3CLPA 5FMOS 2GMEA 3PUSA 5C4WA 4NMIA 2P3IA 2VNOA 4NHLA 4IEUA 3B00A 2X05A 5C3RA 3RS6A 5F3EA 1FT9A 4DPNA 4QX8A 5FP4A 2RS13 5LA2A 3UJOA 4IEZA 2J7MA 2R49A 1BBT3 5I0DA 1QOOA 5FZOA 1VAVA 3QH7A 5AVAA 2OQ6A 2HWE3 2R6QA 3CZUA 2EXKA 2W0XA 1Q8QA 2XUEA 1RUF1 4EZ4A 2Z4FA 1PMJX 1LOFA 4FCAA 4KQ7A 3A22A 2RS53 3CBNA 4OUSA 2D6MA 3IN9A 4YZ4A 1IPSA 1GWMA 1RL3A 4L99A 2VAUA 3CF6E 5CNAA 3D0JA 1H2LA 1UU6A 3GM8A 3LE0A 4FOQA 4XJWA 5LY2A 3UGHA 1QGLA 1H4GA 3DL3A 4WVMA 2BFUL 2GN3A 2QDRA 4BMBA 1BHGA 3B3QE 3USSA 1RJ7A 3IB3A 3LDKA 3POJA 3VHRA 4D0QA 4E2SA 5CAZA 2DFBA 3HBKA 4LBQB 5K7PA 1PO21 1RVF3 3Q8CA 3T2OA 1SLAA 2PQSA 2C0ZA 1C57A 1PVC1 3K4ZA 3R4UA 2RS12 5A6ZA 4NHKA 2WA3A 3I2OA 1CPNA 1O3SA 1TNFA 2MEV1 5FMCA 1SZBA 1T2XA 5ABJA 4Q0VA 2ARCA 2HWC3 2DCTA 5KHIA 2VCCA 4MXWA 1QJFA 2VPVA 3AM2A 2D6PA 2BFUS 4QKNA 5FZ8A 3M3QA 1O4YA 5E1RA 3O1VA 1SEFA 2W5FA 4YW4A 1W8OA 3O1MA 4TLGA 1OUXA 4NROA 4PBOA 4FXKB 1JOPA 3NNLA 1H2MA 1JXNA 4QDSA 4QT6A 3TB0A 3VD4A 2CAVA 4M3CF 4NHXA 4X8PA 3LWCA 1GP5A 3BPSA 5FY4A 4CPBD 1VBC1 2WWUA 4L9BA 3IBMA 4BMEA 4ISRA 1POQA 3VBSB 2ZGRA 2ZHNA 2D43A 4HKLA 2G9FA 3CHXA 3IDEA 5G04L 5FZBA 2Q8OA 5I0TA 4AEJA 3VD3A 4RFRB 3KGLA 4AVCA 1AR92 4YW1A 3ZN5A 4RA0A 1G8WA 3RYPA 2X10A 5AC92 4Q1PA 4QKDA 2A6VA 4IGOA 1V6KA 3N9MA 1LHUA 3B01A 4RYDA 5T54A 2VQ0A 3VHOA 4ET7A 4LO5B 5DZEA 4Y5TA 1HRV1 2XJTA 3N9OA 4YM2A 1ZBA3 3BALA 2GDFA 3H8XA 2XXZA 4OUEA 1RUH2 3ZMNA 4JHTA 3ZKYA 4V2WA 4CDQB 5G05L 1ND3B 1U5IA 3NAPA 4ZS3A 2D5FA 5DUUA 2CGNA 5K9YA 4Y24A 2JD9A 4YW7A 1OQ1A 1XJAA 4GA9A 3RZGA 1PIV1 2LALA 4F7ZA 4AF9A 2A71A 4PQ9A 5T50A 2HWB3 3T1LA 2WQ4A 2WINB 3KCXA 1XNBA 1CAWB 2K46A 1OQDA 1UOBA 2AREA 2CGPA 1HN1A 5FZOB 2V4AA 1HQWA 1IZ3A 1QWRA 2FCVA 4LPLA 3AP9A 4QHZA 3VBFC 4CCOA 2RDQA 2D5HA 5BV6A 2JDYA 1PM4A 5LEKA 3BPZA 3BTXA 4ORFA 5L9VA 3BCWA 4SLIA 1O3TA 1TZOA 2F4LA 4CCLA 5JWPA 2JJ6A 2PXJA 1WBFA 1XE7A 4G3YC 3T2PA 1DQ6A 1L7QA 1WMXA 3AL6A 1Y7BA 1RINA 2JE7A 3KM5A 4JRLA 2WLPA 3AFGA 4ATEA 1W05A 4LHKA 3RNSA 5HXVA 3NWKA 3WVJA 1D4M2 3KB5A 4K20A 5JXJA 1O7FA 2ZMNA 4GULA 4GB33 2C5DA 1FATA 3BYWA 2OA2A 5FREA 3WP4A 3HVDA 3ENRA 1Y9QA 4WVWA 1KDKA 2UYAA 3M3IA 5FOJB 4K1ZA 1Q56A 5FY5A 3EQEA 1EPZA 1C8M1 4YGBA 3KHBA 5A32A 5EQUA 2XJSA 4BCUA 4HN0A 2E7TA 4YG0A 3THCA 4XC9A 1TMF2 2DFCA 5EV7A 5J98B 3Q8FA 1A6CA 4KBZA 5BY5A 4N53C 3OUIA 5IK5A 1CIYA 2JECA 3OBTA 4NIHA 5C6CA 1N3PA 3S7EA 5ABJC 2Q30A 4P9YA 3LZZA 1QDCA 3JQXA 3ZYFA 4OI1A 3WDVA 3CJXA 2E7QA 4Y1ZA 3SISA 1OVSA 3WNLA 3CIHA 1N47A 4LA3A 3R05A 4CPBA 2ZEXA 3VL8A 5A1AA 1MS9A 2PAEA 2VOWA 3RJRA 1SBFA 4BU2A 1D4M3 4LULA 5ANQA 2BU9A 5EJ1B 4AFAA 2BW8A 2WL1A 2WNVB 1DGWX 3WNMA 3JD73 4UFIA 4OHYA 1QQP3 5A7SA 2VW1A 4ARXA 5FOBB 1DQ5A 2EIBA 3IMMA 1AR82 2PN5A 1XU1A 3I97A 3IM0A 2GC2A 3H8RA 2W47A 2ZX1A 5A7OA 5IVVA 1AR72 2VTXJ 1NCQA 2YU1A 2HWE2 4IGPA 5E6HA 3C7OA 5H9PA 1BKZA 3MV11 3O1SA 3C7FA 4AGGA 1W8FA 4FPHA 3PU8A 1SDDB 1TE1B 2XMLA 2WT2A 2FD8A 1DIWA 1GZWB 3LFIA 3JCIA 3S5QA 5FZLA 3TOJA 1IHMA 3RZMA 4IEXA 4UFMA 3VHNA 4DUVA 1WKYA 4HLTA 4BIFA 1NLQA 1NXD1 2JIJA 3DECA 4N53B 1MS3A 3VGIA 1Y4WA 2NZ9A 3JBG2 5FZCA 4YW3A 1F15A 2VZSA 3AMMA 1MS4A 1XE8A 4GAZA 4K6BA 4CEWA 2GP5A 2WZEA 2YYOA 2PHUA 4A2UA 1NCRC 2I74A 2W94A 5GLZA 4CDUC 4QXCA 1A8MA 4PIXA 4Q4X1 1CD3G 3VBUA 1IQDC 3LGRA 1U0AA 1OBNA 1PVXA 2X5IB 2W39A 4L2NA 4QGMA 4Z82A 3VBHB 3ZKUA 4Y5Z0 1S0EA 1OOPB 5E88A 5FP8A 4L0PA 3ZN6A 4IUGA 1VE0A 4Q8LA 4MO3M 2P37A 1RUJ2 1W04A 4WM7C 3SQOA 2J42A 2P34A 4NRQA 1FAYA 4XUPA 1N3OA 5H9SA 2DU0A 5JIAA 1DP0A 3N9QA 3NNGA 4FOVA 5FR3A 1PGL2 3H42B 1RUG3 3ITQA 2QQJA 1PVC3 4D6SA 1LOFC 3PUAA 2VR4A 3K75B 3DV8A 1R082 2FZ2A 2VM9A 4IE5A 4Q4W1 4LHSA 4ZPIA 3RGBA 4NWVA 4YW2A 3WY6A 3MYXA 2AUYA 2JENA 3VKLA 4ATFA 4D7TA 2YC4A 3ZMOA 5A80A 3OF1A 4LBLA 3N9NA 3M3EA 3U78A 1IG0A 5CIRA 3OEBA 3T08A 1JYTA 4CXXA 4N43A 3ZVXA 3BODA 5H9RA 1KD7A 4OZOA 1KITA 4COUA 3UESA 1GBGA 5F1RA 4FPYA 4P9GA 4WZCA 4BOWA 2WNUB 4LKFA 5GZGA 2J1UA 3PUQA 4C90A 1S0CA 2PELA 2ZZJA 5J1XA 3B9CA 5KHKA 1BQPA 2RJ2A 3LIGA 4OHVA 4Q4V1 3SEPA 5KWRA 5LK7B 3O12A 1OFSA 1JOJA 1PNFA 4A7ZA 2G9ZA 2HWD2 3MPBA 1D0HA 3GZAA 5FDBA 1BJQA 1D4M1 2QQLA 3OD0A 1G7YA 4Q27A 1UY4A 1DZTA 3WW2A 2QQIA 2W2IA 3NKTA 1WW6A 2XOMA 1FPN1 3VZMA 1XYNA 1K5MA 3Q9OA 3WOGA 4GB32 2IXCA 5JSRA 3DEMA 1B35A 1XNKA 3ZFFB 3I2GA 4IETA 4UW4A 5LBFA 2VJXA 4JHZA 4XF0A 4MYEA 3OUJA 4YFWA 4ARYA 4D6QA 5F7UA 1OA4A 3IPVA 4DUXA 1VBA2 2Q0AA 4UXAA 1FV2A 3LCPA 2WZR2 5DDJ1 2DV9A 1W0OA 3C3VA 2JE8A 3Q8BA 2VQAA 4ASLA 2JXAA 1C4RA 3HWJA 3DPRB 5FPZA 4PBPA 2X5IC 4MZUA 2WFF3 2ZAHA 4IQPA 5FKBA 5FZKA 1W6QB 4META 4ZY9A 4XQWA 4KNCA 4QB6A 4G9SB 2XGXA 4N53A 3WLUA 1OLMA 4QHBA 3IIAA 3C2UA 5DQ0A 1ULOA 5L19A 4UW3A 3J26N 3O5SA 2R1BA 2OZJA 4JDMA 4CDQA 3WT3A 1KJRA 2Y6FA 2B7YA 4XILA 4OFGA 5IUQA 5JDBA 2UYBA 3ETQA 4OMCA 4PCRA 2EAAA 1YCIA 4CYDA 1POV0 2P6CA 1C1FA 3EO6A 4LIUA 1S0FA 1ZBA2 1O91A 4ES8A 4RR3B 4I09A 2VBDA 3ZXAC 3UGFA 2MNGA 5GZCA 2OVUA 1RITA 1GNHA 2W92A 3LEMA 3VDCA 4AL9A 4XTMA 4YM1A 3POEA 2Q8CA 5J37A 5L7OC 5DAQA 1PO11 1TME1 2ZS6B 3V0BB 3N7JA 2P2KA 4NWWA 3ZXLA 4DXRA 4PF1A 1LU2A 3POFA 4LQRA 1LOEA 2IFRA 3IPVB 4BA6A 4JCKA 4Q4Y3 3LKJA 2WSUA 1ZZ6A 2PLV2 4HZFA 4TYSA 1J83A 2F6BA 4AHYA 1MVEA 1E5HA 4TTGA 4AYUA 2VZ1A 4YZ5A 4JTNA 3FN9A 4YZ1A 3CJIC 5FFOC 1Q8OA 5FZ9A 5C5TA 3U4XA 1FPN2 1W6QA 4COVA 3O0XA 3KV5A 3CU7A 3MUZ1 3I3DA 1RUE1 4KWLA 4YW5A 5GALA 5L36A 2Q5TA 4Z1VA 1AF9A 3KZ4C 1ZRFA 3V56A 2HJIA 5BPXA 4UFKA 3T09A 1AX0A 4C0HA 1LHOA 1D2QA 3WF2A 2XBO3 3ALQA 4K7JA 1H8TC 4PDWC 1MZ5A 2JG8C 2WBKA 1S55A 5EPAA 4BM8A 2CWSA 3SKJE 5CYYA 2GMMA 3NL1A 1CX4A 1FYUA 2VZOA 3GZEA 3H7YA 4TLFA 2PHXA 3U1XA 2HWD1 4KU8A 4EWEA 1C8M3 4RR3A 2CTVA 2W3JA 1U5YA 3X29B 3FFZA 3M7AA 2R061 1SPPA 1GQHA 3JBG3 1KFXL 3EMRA 4RS5C 4YLZA 2WO2A 5ERLA 4LO8A 1KRIA 5GLTA 4S2DA 4XFCA 1S1AA 4LHLA 4AQSA 1NKGA 2VUAA 2J1RA 1BLZA 2BBAA 2A6ZA 2RS52 2VNGA 4JKLA 1NX9A 5C9AA 5FYMA 3OOXA 2VO5A 1W3VA 5DABA 4XETA 3RFRA 4CU7A 2C4XA 2WN2A 5T3NA 3SLIA 4Y33A 3VKFC 4AVVA 1Z7S3 2VMCA 1DZRA 1H0BA 1DQ0A 2X8KA 1Y9GA 3VKMA 2K9ZA 3ETPA 2RG4A 1JZ4A 3S57A 2D3PA 5FPXA 2J1EA 3ZM8A 2J1TA 1W8WA 4P9IA 1UZYA 3HQUA 4WVVA 3U07A 4BQ2A 2JX9A 1GWKA 4IEOA 4CVUA 1U5ZA 1K12A 5T5OA 1IKQA 5JSPA 3E5UA 2CWMA 3H8UA 4R8HA 3SXWA 1QQP2 2XWBB 1AXYA 1I3HA 3BTAA 1ZZ8A 3ACIA 1ZBE2 3VDDA 1RUD2 4URAA 4O7XA 4P14A 2D97A 4RSUA 1ZZ9A 2D3SA 3LOIA 1REFA 2XJPA 3MPPG 2QQKA 4ITCA 2VXRA 1LHWA 3LSEA 4N43C 5LA1A 4KGQA 1ZRCA 2Y6LA 3KMHA 4BH9A 4LOTA 1VBD1 2OUHA 2HEWF 1WLCA 1ULDA 4Q2FA 2JG8B 1DU3D 4UFLA 4GB31 1NZIA 3FJSA 4UF0A 4WBBA 1N1SA 5FV3A 2V5YA 1FX5A 4WM8C 1DQ2A 1HRI2 3CDZB 2H0VA 3DXUA 3FHAA 2ZABA 3I3QA 1JYIA 2LM3A 1UYXA 3CO2A 1WLDA 5CBLA 1K5JA 1K42A 5IT6A 5A7NA 3OPZA 5FPUA 2V72A 1OH3A 2ET1A 4EV0A 5FJHA 5A6QA 3FBMA 1A3KA 4HXCA 3ORJA 5LCWL 3TAYA 3I3BA 1SLCA 5FQ0B 3QCWA 1OXCA 5HCFA 4BDVB 4AI8A 4DFSA 1VMHA 4QAWA 2XKPA 3BOWA 3WXPA 5KXEA 2O8OA 2C9AA 3GJBA 4IEQA 1C8NA 5DXDA 3OEAA 5JVVA 4AWDA 5IVFA 4BLIA 3AFKA 1BEV1 2BNMA 1EAH3 2BP6A 2Y6GA 1XQNA 4LBQD 1HXS3 1NY72 4PI2A 3W59A 4DXSA 3MO4A 1UOGA 1ND2B 4TZDA 2WQ8A 3E6BA 1AL22 3I59A 2UY8A 4E2GA 4GH4B 5LY1A 3THPA 4P00B 1OD3A 4LE4A 1H6YA 3CL1A 4D94A 1R081 4GD4A 5D21A 3THTA 4UF0B 4HVQA 3MIGA 1R1A3 3LPFA 1JODA 2IXHA 3P3NA 4KWUA 4E8CA 1PGL1 1KEXA 4JDNA 3D5OA 4JDOA 4YG6A 5K4LA 4GWMA 3FBYA 5CB7A 3MIHA 3O1TA 3BI3A 1FOD3 4QQ2A 4GJYA 3T0DA 3Q8EA 4UW6A 1GV9A 3WG4A 1RUJ1 3GBWA 2WNUA 2VCBA 5FUNA 3WQ0A 1W8ZA 1FMD1 3WX5A 4CUAA 3RWNA 5EIYB 2H0BA 1VBC3 2A6YA 3FZ3A 5CA6A 3RVHA 3DPRC 4XHXA 1W06A 3M1HA 3BTYA 4FFHA 5A3UA 1DGWA 4PI0A 1ND2C 5C71A 3C7HA 1HXS2 2W46A 2VH9A 3AKRA 5FBZA 4DS0A 3LEGA 5EYYA 2BUKA 3POBA 4LITA 5FMOL 5FZIA 3E1F1 3PUHA 3WD5A 4CDXC 1X8EA 4NUBA 4GJZA 5LW9A 3ZN6B 4A6SA 1MPXA 1PGW2 1VRH2 2XBO1 1QIQA 4HSJA 4NHMA 1COV2 5FPLA 4EN9B 4XUQA 3ZFFA 3T30A 2R16A 1NYWA 2XVGA 2HWD3 4XJ8A 3T4HB 3LF7A 4JGZA 2BJSA 4J1WA 5FXZA 3QLQA 1S0DA 3WG2A 3FL7A 1JYXA 3VV1A 2D7FA 1YEWA 4XFBA 1US3A 2P3YA 1UOJA 4IEVA 2VUJA 5GKAC 4A45A 3PMSA 4NIIA 3WF0A 5EXOA 3AXEA 3HD8B 1BEV2 3DPRA 4QMAA 3NAPC 5APAA 2Z5WA 1CR7A 4FP3A 4JRAA 5FZ6A 2Y6KA 1WZXA 1H1MA 2A3WA 2WNUC 3OSDA 2R042 3MZHA 1ZNPA 2IXIA 5F9TA 2WAOA 1REDA 5DUXA 3PURA 5FYUA 3ZDSA 1SBEA 5FXVA 1SFNA 5FCCA 3K4AA 3FUOA 4OULA 2HYXA 4BXSV 1EV12 2CV6A 4N43B 1LOBA 2WFF2 5D1IA 1WMFA 4OQ9A 2XVKA 2D98A 3H3ZA 1RHI2 1Y43B 2PFWA 4C91A 1AJOA 4LJHA 3SCHA 4K40A 1N1YA 1NE4A 1YYNA 2E63A 4H2AA 4XDQA 5FBJA 4Q0QA 1KJLA 5FYCA 4Y26A 1UYYA 1JZ3A 4NAOA 3I49A 4AFCA 4RGAA 2EIDA 5FPAA 5LZ6A 2VQTA 4XFGA 4QPYA 3MHZA 3AZZA 4R52A 4B4RA 2ZKLA 2B39A 3DYMA 5KXBA 4PIZA 1MS1A 1K5MB 2WFF1 3H9AA 3K46A 4LKEA 4MGSA 1Z7S2 4AEDA 2WZ8A 5JZGA 2VY0A 4HFSA 4PHZA 4CP9A 1LULA 5GZEA 3D6EA 1QJU3 1W9TA 3MLLA 1MZEA 5CFDC 3ZO0B 4I2OA 3I7DA 1JN2P 4V2VA 4QHOA 1WLTA 4AAPA 3MDPA 2AEZA 4BQ5A 1DDLA 3T2QA 4P9WA 4M3CB 5J36A 4S2FA 1VMJA 1WWYA 1SCRA 5LBEA 4QKBA 2YGLA 1VBC2 2O0OA 2NN8A 1H4HA 2BZDA 4I01A 1XXNA 2R071 1CX1A 4LKDA 2PAMA 1HJGA 3O1UA 2WZR3 2YFUA 4WV8A 4WM8A 1Z0HA 3B9IA 2R32A 2RJKA 4Y22B 5I8YA 1I5ZA 2X5IA 4QQHA 3ILRA 2HEVF 1FMD2 5CFCA 1LRHA 4DRVA 5ISLA 4FBFA 5A3LA 4MG2A 1NQDA 2XG3A 3DKWA 3LA3A 4AI3A 2BPA2 4XPVA 1QHDA 2G1MA 1PGW1 1VRH1 2F17A 2XBO2 1RB8G 3CQOA 5FK8A 4JC1A 4UBHA 2CGOA 4A41A 4L92A 3ZPYA 5IVJA 4NR1A 4PQQA 5A3MA 1NCQC 5F32A 1EV11 5JLVA 4MHUA 2W87A 2R1DA 2WS93 1GICA 3ES1A 4XZPA 4JGZC 5C8CB 1NQJA 4ZU7A 3E5XA 1JTZX 3BB6A 4J1XA 5FMBA 1W28A 4P02B 1QJU2 2FDHA 1UY3A 4O9GA 3V0BA 2VG9A 3H1WA 2HH9A 1XOYA 1JMUB 2R063 3HIFA 2ZJCA 4ZHNA 3A0NA 4FPEA 4OHXA 4GZ9A 1YHFA 3N7MA 4RN5A 1S0BA 4JV4A 3PHMA 4FPJA 4E4SA 2VOVA 3VDAA 4RQPC 2WC2A 4IDZA 2WNVC 4ISQA 4X8NA 3VZNA 4RS5A 2CDOA 1VIWB 1G6NA 4B29A 1X50A 3OG2A 4UAPA 1EAH2 2I45A 4HSLA 1S2KA 3PJQA 1W2OA 1X82A 4XF3A 2DVGA 4IGQA 2ID4A 3VBRC 3WNXA 1BMV1 4WM8B 3IZOA 3AMNA 2IVJA 2JG9B 2ARXA 3K48A 2KR2A 2ORZA 5KHGA 3I3MA 5FZ1A 4MADA 2YHJA 4XAEA 3VD5A 4QGNA 4AW7A 2WO7A 5F3CA 4Y1XA 4JKMA 1F35A 4I0AA 4QB2A 4PLMA 3AZXA 4G4FA 3VDDC 1NXMA 1AR62 1W6PB 3HR9A 1QF3A 5F8PA 4GWIA 4C0BA 1V9U3 4KG0A 5DUVA 2R7EB 4A3ZA 2NM1A 4CDWA 3AJYA 1WD3A 1O4TA 1PM7A 2B46X 2W1SA 3J7LA 3ZFEC 4FSJA 3UKVA 1VPHA 3PUIA 3WNPA 4QPIA 1K3IA 2MHFA 5A7WB 1B35B 4EWDA 5BNPB 1OH4A 4MV2A 1GKBA 2K0GA 2W08A 3OYWA 3AXDA 3G6JB 3HT1A 4HN1A 4D6RA 1CZSA 4OZXA 2OZ6A 3ZSKA 3KT7A 4Z8BA 1O8SA 1YI9A 3ZFFC 2DCZA 4Q0UA 2DVDA 1ULFA 3VZOA 1ULCA 2WT1A 3R6SA 4YM3A 1V00A 1VBE3 3SITA 2DUPA 2Q1FA 4KU7A 4HKWA 4IE0A 1VRH3 2FMYA 2XJRA 3LEKA 2Q8EA 3O1RA 1GQPA 4LMFA 3OY8A 1O5UA 1WW4A 1XNTA 2BOJA 2ZHLA 2XVLA 3AP4A 3AZWA 3PJYA 1HB1A 5F5QA 4D69A 5FXWA 2P5BA 3A23A 3ZYBA 1WW7A 3QD6A 3GBGA 3GALA 4XURA 2D40A 3BN6A 3UKNA 3I2HA 5M0TA 5E16A 1VR3A 4UYBA 3VKNA 5EWSA 1HV1A 1ALYA 3PTYA 1V9U2 3WCSA 4XBNA 1BEV3 3M3OA 3E97A 1RUF2 1LTEA 1QU0A 3FFQA 5CZKA 1UIKA 3P5BA 4MLOA 5LATA 2PLV1 3RMXA 1ZBE3 1H9WA 1PIV2 3HN1A 4XAAA 5LA0A 1KXGA 2Y0IA 2EA7A 3I4IA 5B2GB 4GKYA 3GF6A 3WR0A 5BXXA 2X29A 1J1LA 1GSLA 3UGGA 1UCXA 2WKKA 5BNPA 2FDKA 2D6OX 2W1QA 4ZKTB 4NIGA 4BIOA 2QQUA 3CJIB 4TXWA 2GMPA 5FKCA 1QNWA 4OI0A 4Y1VA 2XLFA 4LORA 5FYIA 2VZTA 4FTSA 5D2AA 1HRV2 3INAA 2JKXA 1CJPA 5HBAA 1UWWA 3BIEA 2WNVA 4XF1A 5JOZA 1SLBA 4QWNA 2GH2A 1LEMA 3N35A 4CDXB 4AVBA 1G9BA 4YARA 3DCQA 4E4ZA 1AYN1 1ZRDA 4DOUA 2VMGA 3P3PA 1W2AX 4LBMA 5A33A 1ZZCA 3S6PA 3WF3A 4EWAA 3SH4A 3A21A 2VL4A 4BYYA 5A1LA 5EHDA 1JZ5A 1RTVA 2NPIA 1W9YA 4GKXA 4A7KA 2AYHA 2ENRA 4LUKA 5IW0A 2O14A 2AEYA 1XPWA 2VBBA 1OKOA 4W8JA 1Z78A 3RSJA 3T4VA 4B7EA 4E4HA 2DVAA 1CWPA 2Y38A 1UO9A 2CAUA 2QUOA 1AYM3 3KVBA 1GNZA 2GC1A 2PMWB 1UL9A 4XIKA 1NAEA 5A3PA 5BNNB 1UZ0A 2D6LX 3IAQA 3HAGA 4BQYA 3MV01 2ZGLA 4W50A 1FMD3 1UYZA 1NE6A 4K8FA 2A6WA 1V6NA 5A32B 4NRPA 3UNPA 4RL7A 3KV9A 1YQ5A 3RQ0A 1UMIA 5DG1A 2VZ3A 3R4SA 3OCPA 5T5PA 3NVCA 2RE9A 2IXLA 1MZFA 2DCKA 1YQ6A 2DU1A 2YG0A 2RS11 2ATFA 4YPJA 5FLIA 3ZYRA 2YBPA 1HKDA 5A7WA 5J48A 3N4MA 1LENA 3BOPA 3PMEA 1C1LA 4DY3A 3RJ2X 2KA3A 2SLIA 2EF6A 3QH6A 1DG6A 3I8TA 3WF1A 3AC0A 4S2HA 1GZCA 2R062 3KCYA 5FYZA 4HL0A 4W65A 1SMVA 3NJZA 5A33B 1ENRA 1VBA1 2PYTA 4F8AA 2YROA 3ACLA 4H14A 1JI6A 2Y60A 5H9QA 5K0UA 4FOYA 5DMYA 5LB6A 2QQNA 2ADEA 1OMIA 3RMYA 3VL9A 4CUGA 3ZSJA 4DMIA 5A70A 5C8CC 2PA7A 2DURA 4KG8A 3GYDA 4I0BA 5IK7A 2GAUA 5FTTC 5ACA2 3ATGA 2NMOA 1JOBA 2YV8A 4ZU4A 1SBDA 3K3OA 5FYHA 3WV6A 2WWSA 4FPKA 2G4IA 2WRAA 3ELNA 3AZYA 1UZWA 2CNAA 1UD1A 3PLQA 3WQ1A 5LBCA 1H1AA 1CAVB 2GN7A 4QM8A 4XJZA 3ROUA 4MGTA 4L11A 2XL9A 1VJ2A 1SFPA 1URXA 2HBUA 3HQRA 2YMZA 4XFFA 4Q4W2 4Y1UA 5FAXA 1UMZA 4L8QA 2WA4A 1JHNA 1PGSA 3NNFA 5DPNA 4HANA 2Y64A 1AJKA 2A73B 4IV1A 3B7MA 4CCNA 3DYOA 4MHRA 3AYDA 1W03A 4TSVA 3KV4A 1X9PA 1ZRIA 4XTPA 4IEPA 3S7IA 3BU0A 1GOGA 2C1FA 2ET7A 3W20A 1WCDJ 3ZYIB 2DBNA 4EZHA 4QQPA 2YFZA 5HCBA 1BBT1 1DLLA 2ZX0A 4AXOA 1C5IA 2B42B 2Y34A 3WZ1A 5FLHA 2UURA 5I93A 1JBCA 3KLSA 3WP6A 2HWC1 3EB7A 3GJAA 5EYXA 1WUVA 4CU9A 1ODNA 2RS31 1ZX5A 4FXGB 4RGKA 1NLRA 5FZGA 1I1EA 3POSA 1CN1A 1YWKA 4IL7A 4AHWA 5ACA3 1WBLA 1AVBA 3BUCA 2VMFA 5B4XA 2ZZQA 1S0JA 1BBT2 2F4PA 3IT8A 2UU8A 1W90A 2E51A 3PU3A 4O9EA 4Z2WA 4DRRA 3W9AA 1HW5A 4FPGA 3I59B 1QH6A 2VZUA 1DYKA 3POGA 3NSTA 2EIEA 1YUDA 2OPWA 2Q4SA 1CAVA 2B4KA 3KD4A 3OB8A 5HXMA 2D6NA 1G9DA 3ZXFA 2JB4A 2RDSA 3RWKX 3SC7X 1ZYBA 4RS5B 1DQ4A 3AB0A 2BRTA 3NW4A 4A7YA 1HJFA 1EAH1 3UETA 3E6DA 4MGQA 1HB3A 1NCRB 5FZAA 4CDUB 3WNKA 1QJY1 4AAXA 2ZHMA 4LA2A 3VBOA 2QKDA 4IV1B 3P1IA 4IEYA 2A6XA 2ERFA 4PDWA 3O0WA 2BEOA 4NVPA 3D0SA 1V6OA 3KT4A 5FY7A 1OPOA 2E9QA 1HQNA 1NLSA 4NIAA 2JIGA 4EQVA 5JPMB 1W6NA 1PHMA 1PX3A 3U37A 1R093 1U5XA 2V09A 1TMF3 1ENSA 1J1TA 3M8LA 3AMHA 1N1VA 1RUC3 3J7HA 1Q43A 1W9SA 3NJVA 2QZ2A 3H3LA 1QJEA 3JQWA 2VUDA 4Y4RA 2A5ZA 4BQ3A 1IG3A 2Q1MA 5D8AB 5JCTA 1LB2A 3OGGA 1D7PM 1NZCA 3AX4A 3GDBA 3K77A 4K3UA 5C33A 4NJ4A 5L9BA 1ENXA 1VBB3 2AH2A 1W39A 5T52A 2OYZA 2RM21 2P6HA 1CZTA 1ENQA 4BPZA 1UQXA 5JMCA 5GLVA 2FMDA 2XPJA 1QJX1 1A78A 3IMNA 4JGZB 3OGSA 2XUMA 5FO7B 4QX1A 4XCBA 3PVOA 3ZXEA 2PHRA 1KS5A 2BWCA 2DTWA 4LO4B 3ZFGA 4B3NA 4OI2A 4YZ2A 2RM22 3D4KA 2WS92 4LBJA 1YQ8A 2YB7A 1XNCA 4R9BA 4XQ4A 4AVSA 1WCUA 3WDXA 1C5HA 1XB9A 3O14A 5JR2A 1JYWA 3OY8B 4MUVA 2HWE1 4WVMB 1BVP1 3I3EA
chains in the Genus database with same CATH topology
3D82A 3ZFEA 2DVFA 1NA1C 2QDNA 2VGDA 4AFMA 3RYKA 2VVFA 4MXVA 2RR13 5BNNC 4QQLA 3SH5A 3IDCB 1TEIA 2ZGMA 2XJVA 2EIGA 4YVWB 2RS32 2O8QA 5KXDA 3KT1A 4MXWB 1NA1B 3JZVA 2SBAA 3GBFA 3H0OA 2UWCA 1UU4A 3IDBB 3WDWA 2Y0OA 4CP1A 2QE3A 3WUCA 2YDEA 2JE9A 3PVBB 2DUOA 3A0KA 1PVC2 3POYA 4Q8KA 1I9RA 1AX1A 5JZGB 4Y4YA 2RM23 4QPIB 4WZFA 3ZFGB 1RJ8A 4IERA 3WQ7A 1DHKB 1F2NA 3VLBB 5KXCA 4I3GA 3RI9A 5JSOA 2DVBA 5J96B 4ONUA 4BQ1A 4RFT0 1HLCA 3ILNA 4N7IA 2XJQA 3WW1A 3RPQA 4Q26A 2XLGA 2IXKA 4GMP0 1CESA 5IK4A 4YYOA 3HQXA 4IEWA 2PHFA 1KDMA 5JI9A 3IWZA 1GLHA 2BVBA 1EY2A 4M3CE 4HK8A 1JUHA 1RUD1 5KC6A 3NAPB 1QOTA 1F9KA 2YY1A 5E8AA 1QKQA 3FLRA 2ES3A 3EJKA 2QCSB 4GIQA 4C1WA 3AJZA 4EN6B 5D8AA 3AP6A 4AI1A 1GR3A 4AQTA 1OPMA 1S2BA 3ZXJA 3LOBA 2GH8A 1MQTC 2HKXA 4DINB 1R1ZA 3TYJA 1LOCA 3ZFGC 3CJIA 4D7SA 5AC93 5JZGC 4WM7A 1QXJA 1PZ8A 3ES4A 5C9AB 2ZGNA 4YSFA 2YC0A 5I8SA 1M4WA 2XL7A 4FT8A 2ZGOA 1PK6B 1L3JA 1O3RA 1OLRA 3LAGA 1PO22 2BWAA 2RJLA 4CDXA 2BVVA 1AR83 1MQTA 1YJKA 1QMJA 3TWIA 3WHUA 3W58A 4GMP3 4JGYA 4U36A 4QPGB 5GM0A 1MS5A 1N1TA 1PO12 1TME2 2TNFA 2BTVC 2WSVA 1W2UA 2NLRA 2ZPXA 4XW3A 3RZZA 4H55A 1LEDA 1LCLA 2PHLA 4IXLA 4QGLA 5JI7A 3SH3A 5C4WC 4FQ4A 1KQRA 2R073 3VBRB 1WCKA 1ZM1A 2PHTA 4BHPA 1ZZBA 4DZGA 2FZ1A 1TNRA 4XFHA 4M01A 2JKBA 2RMU1 4Q4W3 3RYRA 1AUYA 2QQPA 4F3JA 2ZA9A 3WG1A 1ZZ7A 4XFAA 1DGRA 4EN0A 1UPSA 3SCGA 3L2YA 2NYYA 2Y26A 1LECA 1ZBA1 3KSCA 4GQ7A 4XJUA 2NQYA 1C3HA 2FQPA 2RMU2 1NCQB 2A75A 3O0VA 1LOGA 1H2KA 5L7OB 5TSWA 2NP0A 4CRQA 1LESA 3AK0A 1AHSA 1ULGA 1VBE1 3H1YA 4RR3C 5KHHA 4BLJA 4MX3A 2HWB2 1H8VA 2HYKA 2OUJA 3VZKA 5EZWA 4GXLA 3JB4C 3ZYPA 4LBOA 4PLOA 3VBOC 4CEWB 2HWF1 4W6XA 2Q1ZB 4AEMA 5CG8A 5I0RA 1XNDA 2RR12 2W68A 1EPWA 1QXPA 1RMU3 3QOPA 4HT1T 4KWKA 2A7AA 1YLLA 2P17A 2RMU3 1V6IA 5JR7B 1H30A 1BYHA 2AR6A 4CTEA 2VECA 4IV3C 4L97A 2AGSA 3OTFA 1YRZA 5FO9B 1LU1A 2CL2A 2N7GA 3TNQA 4DXZA 1HX6A 4QPGA 4YRDA 2XLAA 4LNVA 1SQ4A 2PLV3 1IOAA 4OVEA 4SBVA 2CYFA 2RHPA 4ES9A 5BNQA 1GYKA 4FPCA 3E5QA 4RHV3 1QQP1 1ND3C 1T6GC 3GZUC 3VBRA 3ZYJB 4Y22A 1DFQA 3SCFA 5EJ3A 3WCRA 3MICA 2ZAAA 4D3WA 5CFCB 1W6NB 3J9SA 3KCCA 1RVF2 1QJZA 1AXZA 2D93A 3SMHA 1X36A 2I2SA 1ASJ1 1UX6A 3V64A 1NG0A 2ZGQA 5E89A 2JD4A 3M2MA 1ZREA 1GANA 1YFWA 5C8CA 1W6MB 2GNBA 4COWA 4LO6B 1QJX2 4YGEA 1PNGA 4QPIC 5BNOB 2YXSA 2A70A 3SNMA 1VAMA 4CDWC 3KQRA 4LT5A 2Z69A 2D3RA 1OOPC 4XXPA 3GNEA 1RHI1 4Q4X3 1REEA 4PLNA 3KS7A 3B93A 4E4DX 3CNAA 5DUWA 4LUMA 3UJQA 2WLQA 3VHPA 1Z7S1 2ZX2A 4H3WA 1IKPA 1QDOA 2YGMA 4YVWC 3JUUA 5GLUA 1CVNA 2K2SA 4KBBA 2H6CA 4M3CA 1ZVFA 1ONAA 1VBB1 3WDTA 2TBVA 2A3YA 1J59A 1BMV2 3BU7A 1GZ9A 5CG9A 5K8SA 1NY71 2YUEA 2JICA 1OLQA 4WVZA 4YGDA 1AYM1 3JD72 3U0ZA 4URTA 2NMNA 4CDWB 1PIV3 1R083 4JVAA 1AR73 4I3PA 4DB5A 3ZXGA 1VBA3 1VLNA 2PAKA 1RUOA 1WCSA 3ZSMA 1DYPA 3USUB 4AGRA 3QACA 1FOD1 2UY9A 2R041 1YO8A 4CZSA 1HRV3 1ZRRA 2R30A 3U11A 1CONA 1LODA 1EYBA 2HWF3 1W6OB 2B9UA 1I6XA 1VAKA 2X53S 5GZDA 3J8F2 2GNTA 5CFCC 1N3QA 4HETA 4MVTA 4TWTA 4Q1RA 2P3JA 1JH5A 3JU9A 4AHZA 1AR63 2FHRA 4LBQA 1VP6A 2QVSB 4EN7B 2GNDA 2DTYA 4MGIE 1H1IA 2IFWA 2DUQA 3B69A 1UAIA 3VZJA 5ABJB 2VW2A 1RUD3 4XIOA 2LUWA 1RUH3 2WS91 5LRRA 3AP7A 1OFNA 2BQPA 1U12A 2Z79A 3RDIA 3USUA 1QJY2 5DZFA 1UU5A 2KXLA 4XJ9A 5ACA1 1FPN3 1PK6C 3WUDA 4Q4X2 3J8F3 1F5JA 4RQPA 4ZU5A 3AKQA 1CAUA 5BNOA 1R1A1 2B45X 2ETEA 1RUJ3 4N9IA 5IK8A 2QFEA 4U2AA 1B35C 1FNYA 4GALA 3MGUA 3ECQA 4LHNA 3NO8A 3B94A 1O5LA 3ZFEB 2ZHKA 3NV1A 2Z42A 3L2HA 2A3XA 1HDKA 4OHWA 4E27A 1CJDA 4IESA 3LA7A 3VDDB 2WFPA 1LGBA 2VVDA 2HWC2 2GNMA 3ASIA 3MW2A 4R4ZA 2DWRA 2ZX4A 3MIDA 1YJLA 3FE5A 3ZIXA 1H8TB 1RUE2 3TN91 3ZYGA 1QJY3 4AQ6A 1F31A 2W52A 4HPKB 4FQZA 4PIYA 5FO8B 5JAXA 3EBRA 1G9FA 1ASJ2 2VW0A 3MI8A 5JIUA 4LE3A 5AC91 4Z07A 1WGPA 4V1PA 4RQPB 2HWF2 1MACA 5FQ0A 4Y20A 3GHNA 1HRI1 1SACA 2EXIA 5J09A 3ZN4A 4W6WA 2P3KA 3AKPA 1HIXA 1SLIA 1Q3EA 3J8F1 1RUC1 1H9PA 3IKWA 2IWGB 5AVPA 4RGGA 4IV3A 2RS51 3WDUA 1G9CA 2FBEA 1CAXA 1SLTA 1RUF3 5AFBA 4QD2A 5GZFA 1RUI1 4Q29A 5SV5A 3JBG1 4MGKE 4B8EA 4COZA 2IXJA 5T5LA 4N9HA 2ILMA 3VBFA 4NPRA 4P9XA 4AI2A 4LBKA 4GH4A 3AKSA 3H50A 4W6YA 3MIBA 1JYCA 1V6LA 4YZ3A 1FI2A 1YI7A 3AYEA 3VBUB 1RC6A 2DF7A 4M00A 1XU2A 4XE9A 2GU9A 3FX3A 5KHJA 4Q4Y1 1QOSA 5BNNA 1GQGA 4CEYA 4H7LA 4QPGC 1MEC1 1O3QA 3FUQA 2ZBJA 4AVAA 1D2SA 1ZA4A 4FTBA 1EP0A 4GH4C 5CFDB 1G9AA 2OPKA 4AE2A 3FWEA 4Q4Y2 1PZ9A 2IC1A 3JB8A 1IS5A 2WJSA 2H6BA 1AL23 4B4QA 1WMEA 1CAXB 2XB6C 5EFUA 5KBFA 1MQTB 1MVQA 1PZ7A 3OD4A 3VUOA 4HMZA 4XHBA 3UV9A 4AGVA 5L73A 3VBFB 2EVXA 2D44A 1WA4A 4PJYA 2ZMLA 1ASJ3 5F6LB 3EHKA 1YFUA 1LHVA 1C8M2 2B5HA 2QJVA 2R072 2ZKNA 2WIIB 1HV0A 1LR5A 3PNAA 4B4PA 4FOWA 1H8TA 1OQEA 3M70A 4GMP1 3AMPA 1J3QA 3MIFA 2VOKA 1Q8SA 3ILFA 4QM9A 4AFBA 5LRSA 4RHV1 4YVSA 3RG0A 4GWNA 3A4UA 1V9U1 1SCSA 1X7NA 1COV3 4AK3A 2PQQA 2ZX3A 1KS4A 5GLWA 1SDWA 4FP2A 4E2QA 1LOAA 3PVNA 4Y1YA 4YM0A 1BVVA 2JDZA 3WP3A 3VBSC 4AI0A 1LGNA 3RI8A 1IPJA 5JOYA 5FRAA 1UW8A 3NKGA 5L7OA 4R9DA 1RUNA 4MGZE 2MEV2 1MZ6A 1ULEA 4XOGA 1E57A 2UWBA 3TN93 2ZGUA 2XHKA 3MW4A 4XMIA 4CP2A 3H7JA 2VOXA 4AEDB 2E53A 4NN0A 3SHRA 4FAGA 4QU2A 4XJAA 1FOD2 2QZ3A 4EJRA 2KM2A 5DDJ2 3WP5A 3VBHC 4NO4A 1R092 3WW3A 1C28A 4YG3A 4S2GA 2DCYA 4XXAA 4AFDA 1PMIA 4XBQA 1RHI3 4MH0E 3VBUC 1KFUL 2DYCA 1HRI3 3NV4A 4FVVA 1F5FA 2GSYA 2I07B 4YVSB 4CEYB 2JG9C 1HQLA 3FMGA 3VBOB 4CEWC 1OD5A 2ZGTA 3H3UA 4PDWB 4HBNA 3G7DA 2GZWA 5CFDA 3WINE 4YVWA 4FPOB 5I0UA 1LGCA 2GC0A 1BXHA 3S0MA 4CP0A 1W0PA 3VZLA 1NA1A 3FLPA 1OI6A 1UZZA 1COV1 2VU9A 2YZ4A 1O4ZA 1CAWA 1UIJA 1AXKA 4LLOA 1WW5A 4XQDA 2EAKA 5LK5A 2ARBA 5BUVA 4P5HA 2BNNA 1F8VA 1OA3A 1MEC2 5D8AC 3APBA 5CADA 1Y3TA 5SV8A 5HI0A 1UKGA 5CU1A 3N3HA 1QJU1 4OUMA 3CEWA 1XYOA 1DQ1A 1V70A 2ZGPA 1EV13 3HBZA 1DZQA 4ASMB 1UN1A 1AR61 2JG9A 3OGJA 4HK9A 1D0GA 1UPIA 3AYAA 1TQ5A 4PF5A 4Z92B 4YFZA 2MPFA 4YVSC 1SLLA 2ZCWA 1POV3 2XWJB 1AZDA 3M3CA 1DF0A 1WMDA 5GJ6A 4AHXA 5C4WB 1QNYA 5FLJA 2WQZC 5T5JA 3MFAA 4CEYC 4QQOA 4IV1C 1W6PA 4JGYC 4I02A 3I54A 2R0HA 1WLWA 4UW5A 4XF9A 4LEJA 4K1YA 3B02A 1VBD3 5I8TA 2IZWA 4B7KA 2WZR1 4OI4A 1AYM2 3JD71 2BGCA 3MF6A 5I91A 5DG2A 2JEMA 4R9CA 3S30A 4XF4A 2UWAA 4X6QB 3DF0A 1CPMA 4AEDC 5JOWA 3TN92 1RIRA 1YIFA 1AR93 1JUIA 1Q8VA 1QJX3 1QH7A 1RGSA 2R0FA 4LO7A 4ZU4A 3WG3A 2LTNA 1MS0A 2ZGSA 3MW3A 2ZOEB 3LA2A 1RMU1 2VVEA 2WT0A 4D7YA 1K5MC 5AFEA 1AL0G 3PVEA 4Q4V2 4QX5A 5BYNA 4HKOA 4BE3A 1UF2C 3OYWB 4Q0SA 3AP5A 4OLLA 2HEYF 3RRDA 2QNKA 1BZWA 2AENA 3HMYA 4DNYA 4KH9A 3E6CC 3POWA 5K0UC 4KWJA 1A8DA 3DGTA 1MR5A 2EXJA 3VKOA 1PK6A 1RUI2 1FNZA 1OA2A 2TEPA 3FLTA 3ZSEA 1ND3A 1S0GA 3WDYA 5HCAA 1VBD2 2AZ5A 4K9SA 4MSVA 1AR71 1RUC2 1LKNA 4XFIA 4CDQC 4JTOA 4AQ2A 5J7MA 3V65A 1B09A 2D6KA 2ZACA 3ZIWA 2B8MA 3UKTA 2XKOA 1Q8PA 4P9JA 4I30A 1IS6A 2PHWA 1UKRA 4BZ4A 1R1A2 3DN7A 1IS4A 1YFXA 2E6VA 1MS8A 1MEC3 4HVRA 2BYVE 2OW4A 4DY5A 1J3PA 2HWB1 2MEV3 3VBSA 4EN8B 1HXS1 1G86A 2VMHA 1RMU2 2DCJA 1W6OA 4Y20B 1VB4A 4AG4A 3DUIA 5I0SA 4X6RB 1ND2A 4YNIA 4Q0PA 1LHNA 3K51A 4H7MA 4HVOA 3TRSB 5T55A 3ZXKA 4FTEA 4QXKA 3EXUA 1H2NA 1OSGA 4WM7B 1AR81 5BNPC 3HT2A 4P9LA 5KC5A 2VNRA 4INDA 3MLKA 3MEPA 4E9KA 3VN4A 3MLJA 2E7AA 2BNOA 4FPLA 4FPFA 2EXHA 3MF9A 1XYPA 1IPKA 4MGYE 2JG8A 4KGGA 2RS33 1POV1 3AZVA 4JGYB 3MIEA 2GALA 1IQAA 1OKQA 3AYCA 1CQ9A 3OJBA 4NOTA 1J58A 2XH6A 1DGRN 3V0AB 3AKTA 2PTMA 3GZTB 3J4UH 1ZBE1 3GHMA 1Q5OA 1IS3A 2OIIA 2R043 2O1QA 1CAUB 5DZGA 4XMAA 1AR91 1NOVA 4R4XA 3TNPB 5BNOC 4FO9A 1OHFA 1VB2A 3BIWE 3L9JT 2Z2SB 2WZPP 3I2DA 1AL21 3N7LA 4UBGA 3NV2A 1AYN2 1J3RA 1QY4A 1YIPA 1YNAA 4M0HA 2WNEA 2VULA 3LSDA 4M0NA 1TMF1 2ZTNA 1VBB2 4EROA 4LTAA 3ME2A 4N7UA 1DBNA 2ZGKA 3FHIB 3R0RA 1RUE3 4K21A 2VMIA 4J6GA 3ZXDA 1V6MA 5F6KA 3WHTA 4HPKA 2ZMKA 4C1XA 3URFA 3ST7A 1JW6A 2CY6A 3D8CA 3T2TA 4AVTA 4F83A 3ZSLA 3ZX7A 1X33A 1BCXA 3V0AA 1VALA 4LBNA 3AMQA 4LR4A 4YGCA 1R091 5CVRA 2XJUA 5DDJ3 3VBHA 3LB9A 4RD7A 2EALA 5JOXA 1OOPA 1S0IA 3KGZA 1D4VB 2GC3A 4XYXA 1QXRA 1RUG2 4ZXKA 3B5LB 4AEKA 1M06G 1AYN3 3TBDA 1XRUA 3MFCA 3FC0A 3U10A 3UL2A 5C8WA 1FV3A 1LJ7A 3UK9A 1YXWA 4FAHA 2RR11 4IV3B 3N36A 3H1MA 1PO23 2V73A 1RVF1 4DQAA 5C9AC 1RUG1 1GFF2 3NV3A 5J3UA 1W6MA 3M4FA 4JAAA 3T1MA 1X8MA 1DGLA 1SFYA 4Q4V3 1IGOA 4COYA 1YFYA 1AX2A 4N90A 4XEZA 3OBRA 1GZWA 1APNA 4RHV2 4KL1A 1PO13 1TME3 2BBVA 2YPJA 4A3XA 1VBE2 1NCRA 4BWOA 4CDUA 5JPNB 2G9GA 1WD4A 1FXZA 1V6JA 2PHDA 4I0WB 3QBQA 4JQRA 4R9AA 3O7OA 4XBLA 1CIWA 3R4DB 3WW4A 1BK1A 4LLFA 1RUI3 2TUNA 1RUH1 3N7KA 4OHZA 1CGPA 3CLPA 5FMOS 2GMEA 5C4WA 2P3IA 2VNOA 4NHLA 4IEUA 3B00A 3RS6A 1FT9A 4DPNA 2RS13 3UJOA 4IEZA 2R49A 1BBT3 1QOOA 1VAVA 3QH7A 5AVAA 2HWE3 2R6QA 2EXKA 2W0XA 1Q8QA 1RUF1 1LOFA 4FCAA 4KQ7A 2RS53 4OUSA 2D6MA 3IN9A 4YZ4A 1RL3A 4L99A 5CNAA 3CF6E 3D0JA 1H2LA 1UU6A 4FOQA 4XJWA 1QGLA 1H4GA 3DL3A 4WVMA 2BFUL 2GN3A 2QDRA 4BMBA 3B3QE 3USSA 1RJ7A 3VHRA 5CAZA 4E2SA 2DFBA 4LBQB 5K7PA 1PO21 1RVF3 1SLAA 2C0ZA 1C57A 1PVC1 3R4UA 2RS12 4NHKA 2WA3A 1O3SA 1CPNA 1TNFA 2MEV1 5ABJA 4Q0VA 2HWC3 2DCTA 5KHIA 4MXWA 2VPVA 3AM2A 2D6PA 2BFUS 3M3QA 1O4YA 5E1RA 1SEFA 4YW4A 4PBOA 4FXKB 1H2MA 1JXNA 4QT6A 3TB0A 2CAVA 4M3CF 4X8PA 3LWCA 1VBC1 4L9BA 3IBMA 4BMEA 4ISRA 3VBSB 2ZGRA 2ZHNA 2D43A 4HKLA 2G9FA 3IDEA 2Q8OA 5I0TA 4AEJA 3KGLA 4AVCA 1AR92 4YW1A 3ZN5A 4RA0A 1G8WA 3RYPA 5AC92 4Q1PA 2A6VA 1V6KA 1LHUA 3B01A 3VHOA 5T54A 2VQ0A 4LO5B 5DZEA 4YM2A 1HRV1 2XJTA 1ZBA3 3BALA 2GDFA 1RUH2 3ZMNA 4CDQB 1ND3B 1U5IA 3NAPA 5K9YA 2D5FA 5DUUA 2CGNA 4Y24A 1OQ1A 4GA9A 1PIV1 2LALA 4F7ZA 4AF9A 2A71A 4PQ9A 5T50A 2HWB3 3T1LA 2WQ4A 2WINB 3KCXA 1XNBA 1CAWB 1OQDA 2CGPA 2AREA 3VBFC 1HQWA 1IZ3A 1QWRA 5LEJA 3AP9A 5BV6A 2D5HA 5LEKA 3BPZA 4ORFA 3BCWA 4SLIA 1O3TA 5JWPA 2JJ6A 1WBFA 1XE7A 4G3YC 1DQ6A 1Y7BA 1RINA 2JE7A 3KM5A 4JRLA 2WLPA 3AFGA 4ATEA 4LHKA 3RNSA 5HXVA 3NWKA 3WVJA 1D4M2 3KB5A 4K20A 1O7FA 2ZMNA 4GULA 4GB33 2C5DA 1FATA 2OA2A 5FREA 3WP4A 3ENRA 1Y9QA 4WVWA 1KDKA 2UYAA 3M3IA 5FOJB 4K1ZA 1Q56A 3EQEA 1EPZA 1C8M1 4YGBA 5A32A 2XJSA 4BCUA 4HN0A 2E7TA 4YG0A 1TMF2 2DFCA 5EV7A 5J98B 5BY5A 1A6CA 5IK5A 4N53C 2JECA 3OBTA 5C6CA 1N3PA 3S7EA 5ABJC 2Q30A 4P9YA 3LZZA 1QDCA 3JQXA 4OI1A 3WDVA 3CJXA 2E7QA 4Y1ZA 3SISA 1N47A 4LA3A 3R05A 3VL8A 1MS9A 2PAEA 2VOWA 3RJRA 1SBFA 1D4M3 4LULA 4AFAA 2BW8A 2WL1A 2WNVB 1DGWX 3JD73 4OHYA 1QQP3 5FOBB 2VW1A 1DQ5A 1AR82 2PN5A 1XU1A 3IM0A 2GC2A 2ZX1A 1AR72 1NCQA 2HWE2 5H9PA 1BKZA 4AGGA 4FPHA 1TE1B 2WT2A 1DIWA 1GZWB 3JCIA 3TOJA 1IHMA 4IEXA 3VHNA 4HLTA 4BIFA 1NXD1 4N53B 3VGIA 1MS3A 3JBG2 2NZ9A 4YW3A 3AMMA 1MS4A 1XE8A 4K6BA 4CEWA 2YYOA 2PHUA 4A2UA 1NCRC 2I74A 5GLZA 4CDUC 1A8MA 4PIXA</