2RS12

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1200
1OHFA 4CDUC 1MEC3 1B35A 1QQP3 1K5MC 1R1A3 1FMD2 5FMOS 1HXS3 3TN92 2R042 1R093 1B35B 2RS31 1RHI1 5BNPC 1AR82 3LOBA 4LLFA 2MEV1 4YVSA 2IZWA 2R072 3VBRB 1ASJ3 1PIV2 1QJU2 1HRI3 1RUJ3 3JD71 4IV3A 5K0UC 1MQTB 1VBC1 4Q4X3 1NY71 1AR73 1C8M1 1VBD1 1H8TB 5BNNA 2RS32 1TMF3 1DDLA 1VRH1 2ZTNA 1AR93 4JGYC 1ZBA1 3CJIC 2MEV2 4RQPA 5JZGA 1RUC3 4Q4W2 2X5IB 1BEV3 3JD72 4SBVA 4RQPB 1VBC2 2FZ2A 4CDXA 5JZGB 1NY72 2WFF2 1C8M2 5C4WA 1QJY1 1VBD2 2RMU2 1ND3A 1FOD1 1NCRA 1VRH2 1QJZA 4RR3B 1ND3B 2HWE3 3VBOB 1PO21 1NCRB 3VBSB 1Z7S3 1BMV2 4RHV3 4WM8A 3VBFC 4RFT0 4CDUA 5ACA1 1QJY2 1K5MA 2HWC1 3S6PA 1FOD2 3IDEA 1PO13 1RUE1 2R061 1WCDJ 5C9AB 4IV1A 1PO22 5C8CC 5CFDC 5BNPB 4PDWC 1AYM1 1PVC3 4GB31 1VBB2 2Y26A 3ZFEB 5ACA2 3FBMA 5FMOL 1QJX3 1ZBE1 2HWC2 5K0UB 4GMP0 2WWSA 1RUE2 2R062 2HWB1 4GMP3 2WZR1 1OOPA 2ZAHA 3CJIA 5L7OC 1C8NA 1AYM2 4GB32 4JGYB 3CJIB 4IV3C 1ZBE2 3VDDC 5AC92 1AYN1 1RVF3 1BBT1 4AEDA 2HWB2 1OPOA 5GKAC 1TME3 2WZR2 2BPA2 1VB2A 3TN93 2R043 1EAH3 1VBE3 4Z92B 1AR83 5J96B 4Y4YA 1FPN1 1NOVA 1AUYA 1AYN2 2WS93 1BBT2 2RM21 2RS13 3VBFB 3ZXAC 5C8CA 5CFDA 1NCQC 5ABJC 1RHI3 4PDWA 2PLV2 2R071 5CFDB 1QJU1 1FPN2 2MEV3 2XPJA 3ZFGC 4PDWB 1COV1 3JB4C 2RM22 4CDQC 3HAGA 1RUG1 1VB4A 1C8M3 5L7OA 4IV1C 2QQPA 1ND2C 2ZZQA 4WM7A 1HQNA 4Q4W1 1ZBA3 5L7OB 3VDDA 1COV2 4YVSB 1AR62 2WFF1 1PGL1 4IV3B 4NWVA 1RUF3 3VDDB 2RMU1 1AL21 2RR13 1RUG2 1V9U2 4Q4V1 1RUD1 1OOPC 1D4M1 3J8F3 5BNNB 1POV1 3VBUA 5FOJB 1R082 1VBA3 3DPRA 2VQ0A 1QQP1 1BMV1 1R1A1 1RUI3 2BFUS 1PGL2 5A33A 5BNOA 1HRV1 1AL22 2XBO3 4AEDC 4CDXB 4Q4V2 2HWC3 2DF7A 1IHMA 5C4WB 1RUD2 3ZFFC 2BUKA 1D4M2 1NA1C 5A33B 5LK7B 1NCQA 5ABJA 2R063 1ASJ1 4Q4X1 1NCQB 1QQP2 1M06G 1VBB1 1R1A2 3ZFGA 3NAPA 1HXS2 4GB33 1R092 4CDQA 1HRV2 4GH4A 5D8AC 4WM8B 3ZFGB 4CDUB 4WM8C 1K5MB 1EV11 4CDQB 1RUC1 4CDWC 1ND2A 2HWB3 1BEV1 1ASJ2 4Q4X2 1RMU1 1GFF2 4IV1B 4CEYC 1W39A 1ND2B 1AR72 5AC91 1F2NA 1TMF2 1F8VA 1EV12 1PGW1 1RUC2 1BEV2 2HWD1 4WM7C 1RMU2 4RHV1 1OOPB 5CFCC 2RS53 2FZ1A 2GH8A 4FSJA 1PGW2 2RM23 3ZFFA 1NA1A 2HWD2 4AEDB 1FMD3 1PVC1 3VBUC 1Z7S2 4RHV2 4YVWA 2PLV1 1NA1B 2BFUL 1QJX1 3DPRC 1AL0G 2R073 5D8AA 1PIV3 1QJU3 5BNOC 1CJDA 3VBHA 4Q4Y1 5D8AB 1PVC2 4CDWA 4CEWC 2RS33 1RUG3 5DDJ1 1QJX2 4CEYA 5C8CB 4N43C 4CDWB 1RUH1 3M8LA 1NG0A 1RVF1 3NAPC 4Q4W3 1AR61 4CEYB 3JBG1 3JD73 2BBVA 4GH4C 1TME1 1VBC3 4QPIA 2WFF3 4Q4Y2 1V9U1 1VBD3 2HWF1 1EAH1 2RMU3 5DDJ2 1R081 1POV0 1VRH3 4Y5Z0 1RUD3 1RUH2 5CFCA 1RVF2 4RS5C 4WM7B 3JBG2 5CFCB 1TME2 4FTSA 5C9AC 1QJY3 1CD3G 2HWF2 1EAH2 1VBE2 1HRV3 4N53C 4FTBA 1FOD3 3VBRA 3ZFEC 1MQTA 1MEC1 4BCUA 1PO23 2WS92 3VBUB 2RS12 1H8TA 1HXS1 3DPRB 1R091 1VBB3 5ACA3 2TBVA 1RHI2 5BNOB 4CEWA 2X5IA 5J98B 1VAKA 1RUE3 1EV13 1X36A 1X33A 1HRI1 1RUJ1 4YVWC 1MEC2 4N43A 4CEWB 5ABJB 1AR71 1AYM3 1RUF1 1RMU3 4N43B 2GSYA 1TMF1 2RR11 1HX6A 1ZBE3 3NAPB 1AR91 5AC93 4RR3A 3J8F1 3VBOA 3VBHC 4GH4B 1ZBA2 3VBSA 1VBA1 1HRI2 1RUJ2 2WZR3 2HWD3 1RUI1 4RS5A 1RUF2 2RR12 2XBO1 4RS5B 1AR92 3J8F2 5C9AA 1AYN3 2HWE1 4QPIC 4JGZC 5BNPA 1BBT3 4N53A 1A6CA 1VBA2 3JB8A 1Z7S1 4QPGC 3ZFEA 4N53B 1RUI2 5K0UA 2PLV3 2XBO2 1B35C 1PO11 1FPN3 1RB8G 2HWE2 4JGYA 3VBRC 3ZFFB 4Q4Y3 1MQTC 4YVSC 4EJRA 5DDJ3 4YVWB 1H8TC 4FTEA 1PO12 2WLPA 5A32A 1RUH3 4GMP1 1COV3 1AR63 3JBG3 5BNNC 5A32B 2X5IC 3VBHB 1V9U3 2RS51 4RQPC 2HWF3 5JZGC 1SMVA 1R083 3VBFA 4CDXC 5C4WC 4RR3C 1FMD1 4JGZA 1ND3C 2R041 3TN91 3VBOC 1E57A 1NCRC 1VBE1 1AL23 3VBSC 4QPIB 1AR81 2RS52 4Q4V3 4JGZB 4QPGA 1D4M3 1POV3 2WS91 4QPGB 2RS11 1PIV1 4NWWA
chains in the Genus database with same CATH superfamily
5JAXA 2D6LX 4NHYA 1QQP3 2LM3A 1IS6A 1K5MC 2CNAA 3QOPA 5FZCA 3UGHA 4E4DX 3BVCA 1HXS3 4IEPA 2XUEA 4CCNA 4K8FA 4Z82A 5I93A 1EP0A 1N3PA 5EJZB 2LALA 1ZZBA 2G1MA 3LOBA 3A23A 4LBOA 2CWMA 1VMHA 2A7AA 4W4ZA 4AHXA 3G6JB 3R6SA 3ZXEA 1FYUA 2IZWA 2R072 5G04L 5C33A 1WBFA 2A73B 3VBRB 5K0UC 4OQ8A 4IV3A 4HVOA 3FL7A 3SCFA 5HCFA 1VBC1 5DZGA 5IK8A 2Z79A 4QDRA 3WX5A 3HQUA 1C8M1 2DUPA 5FREA 5JOWA 2BWCA 2JDAA 1UOFA 3K3NA 1SBFA 2A6WA 4LBQD 2LRPA 2JE9A 3WP6A 4ZHNA 1NAEA 3O1MA 1KFUL 1VRH1 2ZTNA 3KCCA 3MW4A 4XBQA 3NRUA 4B7KA 1W8OA 1MR5A 2MEV2 5GJ6A 4RN5A 4XURA 2Y64A 3AL5A 3FN9A 5FZ9A 4CP1A 5JZGA 4P08A 1BEV3 4E27A 2C24A 4QX1A 4P14A 4CP0A 2FZ2A 1FX5A 3MIHA 4OHYA 5JZGB 1C5IA 2YC0A 5L36A 4HANA 3MV01 5G05L 2YYOA 3KB5A 1ND3A 1Q5OA 3I2FA 3SC7X 1ULDA 1XRUA 5DABA 5FOBB 1ST8A 1QJZA 1JN2P 3THCA 3P5BA 1AJOA 2NQYA 4LOTA 2PQSA 1J84A 1ND3B 1ZZ7A 2PHTA 2BOJA 4NRMA 4GIQA 3U37A 3VBOB 4DOUA 3U1XA 5J36A 4XBLA 5FO7B 1XE8A 2E9QA 2H6BA 1BMV2 4XDQA 2PAMA 3VBFC 4RFT0 5I0DA 1W2AX 3MDPA 2Q8CA 3UKVA 4D69A 3S6PA 3THTA 3UKTA 1ENXA 2Q1FA 4YYOA 1V6NA 1UOJA 1QOOA 5L9RA 2TEPA 3IDEA 4E8DA 3OUIA 1WMDA 1CX1A 3NNJA 5C9AB 5C8CC 4XMAA 1F5FA 1QJEA 5BNPB 3FUOA 2R0FA 4J6GA 1AYM1 4JRLA 4A44A 4M00A 5EP9A 3MIDA 1JYWA 5ACA2 3N9QA 1QJX3 3PVOA 4L92A 1LGBA 1NE4A 3CQOA 2E26A 2VG9A 3FHIB 3O7OA 2WWSA 3AK0A 3MFCA 3RFRA 1E5IA 2R062 3K4DA 1DGRN 2HBUA 1W99A 4AEMA 4IE4A 3CJIA 1PK6B 1XB9A 2IXLA 2SBAA 1C8NA 3N9MA 3Q8AA 5L7OC 5FP8A 2GU9A 4AFBA 3UKNA 5JWPA 2H0BA 5FV3A 3CJIB 2EALA 2XKOA 2JDYA 2XQRA 3AYCA 2BW8A 1ZNPA 3ZYIB 3I3MA 4AAXA 1RVF3 2VD7A 1A34A 4H3WA 4AEDA 2WT2A 5GKAC 2DV9A 4UW5A 5CZKA 1W06A 2WZR2 5M0TA 3N9PA 4AEJA 1LGCA 4XF9A 3TN93 1R1ZA 5CG9A 2YV8A 5LY2A 3E6CC 1W0NA 1AZDA 3WG1A 1U5ZA 4Z92B 3QACA 4E4SA 5LA1A 5KXBA 3RZHA 3UJQA 1CPNA 3ZYHA 1OA4A 3DYPA 4AHYA 2RM21 1IS5A 2OA2A 4ATEA 3IDAA 2IFWA 5ANQA 1JI6A 3ZXAC 4BXSV 3H3LA 3M1HA 2UY8A 2G4IA 2FDGA 2OPWA 4JQTA 4LBKA 1GNYA 2ZXQA 1U12A 1NCQC 2JDHA 2VXRA 5ABJC 3AB0A 4OI2A 2PLV2 3TYJA 2XOMA 3CHXA 4AQ2A 2K0GA 5FY9A 4OHVA 3N7JA 3SHRA 2C9KA 1QJU1 3Q8EA 1FPN2 1JOPA 4FXGB 1UW8A 2YROA 5FXXA 2WABA 1PGSA 1DZRA 3K48A 2L9LA 4CZSA 1OQEA 2FCTA 1KJRA 4P5HA 1OH4A 1HJGA 2QQUA 4A7ZA 2XLFA 3ABZA 3SXWA 3NV4A 2HBTA 4FPOB 1GOHA 1C8M3 2A3YA 2WO7A 1ZRFA 5FP7A 2YGMA 1KJLA 3T3YA 1PZ8A 1JUIA 5KBFA 4EN8B 1W2TA 2ZZQA 3K4ZA 1RINA 2VECA 1LESA 4XFCA 1FNYA 4GWMA 3VDDA 3ZLIA 4OZXA 5I0SA 2JICA 3NMBA 5H9QA 4XQWA 2DU0A 4AFMA 4NWVA 5DAQA 2DCJA 3VDDB 3POFA 1HV0A 4ATFA 3MIEA 1RUG2 2ZCWA 3LIGA 1V9U2 4FT8A 1BK0A 4Q4V1 4DS0A 5JI9A 2CGPA 1PNFA 1LEDA 5HCBA 4XJAA 1OOPC 1D4M1 3ELNA 1POV1 2PHUA 1UZ0A 1R082 3AKRA 1S0BA 4META 2ZX0A 4LT5A 4NOTA 3DPRA 4I0AA 2VQ0A 4Q1PA 3Q8CA 5A3OA 1C28A 1Y43B 2VVFA 2CTVA 4NRQA 2NP0A 1JXNA 1I5ZA 2W91A 3D8CA 1FV3A 4R9DA 3J4UH 1KS5A 1TEIA 1T6GC 4PT6A 4XJ9A 3ZX7A 1CAWA 1AL22 4CDXB 3U11A 2PAEA 4OI1A 1CAWB 1HN1A 1W04A 1ASJ1 5F2SA 2BZDA 1UWWA 3ACFA 1APNA 4PLMA 5KHGA 1M06G 1VBB1 2VW0A 4EV0A 5GZFA 2BQPA 4OULA 4GH4A 1SLTA 2W68A 4K3UA 1N3OA 2P2KA 3BPSA 1K5MB 3AMQA 4IE7A 1V6KA 5FJKA 3Q9OA 2D98A 5H9SA 1ND2A 2QJVA 4MV2A 5EXOA 4KGQA 1RMU1 4IV1B 1ND2B 2UWAA 3OD0A 4IESA 4B29A 4B8EA 1H30A 1YXWA 2D3RA 1F2NA 3HR9A 3TB0A 2DCYA 3HIFA 3ZR5A 3RZKA 3KF3A 1SBDA 2NYYA 4I0BA 4I0WB 3UNPA 1EV12 3AX4A 2UYAA 2AC1A 2BJSA 5DAPA 3DGTA 3UJOA 1SZBA 1O5LA 5FZ1A 3I2OA 1UKRA 2ZEYA 2RS53 4F83A 2Y0OA 1AXZA 3IZOA 1BVP1 4FAGA 1H2LA 4XUOA 4ONUA 2A6YA 1GWMA 4B1LA 1WLTA 2YFUA 4YRDA 4DUXA 4KU8A 2GNBA 3J7LA 3PVEA 4AQSA 4PCRA 2AEZA 1PGW2 2RM23 1NA1A 1GICA 2X8KA 2BNMA 2VZPA 4GWJA 3TEXA 1PVC1 1DCSA 1Z7S2 5LRSA 4IEOA 4GAZA 4RHV2 5C71A 1NA1B 3NO8A 4LKEA 5D21A 5FYCA 2W46A 4O9GA 1XSQA 3DF0A 2GMEA 5FZOA 4BQ4A 1ACCA 4JDNA 4BMEA 3ZM8A 4DUWA 2XHKA 4XOGA 1PIV3 1QJU3 3I3DA 4AI3A 4UFJA 5FDBA 1J1TA 2YY1A 3NJZA 4ARXA 4COUA 3ZKYA 1CJDA 2GC3A 5IVCA 4Q4Y1 5FZ6A 3HT1A 5JR7B 2VUAA 4AAPA 3FMGA 1JHJA 3CL1A 3LB9A 3PDQA 3DUIA 4LO4B 4N7IA 1X9TA 1BYHA 4ZS3A 5LB6A 4YZ4A 5DDJ1 1A8DA 1D2SA 1W9TA 1YFUA 5C8CB 1US2A 2VH9A 1ULFA 2VZOA 3CLPA 3RZJA 2QQNA 4AI8A 3U75A 2IVJA 1AR61 1NQJA 3A21A 4QGMA 3JD73 1AX0A 2PXJA 3OBZA 3U78A 5GLTA 1OFNA 1PNGA 3QH6A 3KQ4B 2CAVA 3LD8A 3LZZA 3DYOA 1FAYA 1VBD3 2WQZC 4XACA 1UPIA 4BQYA 1JYXA 5J37A 2AH2A 1V00A 2XXZA 3HJRA 1JOJA 3D0SA 2QQIA 3I97A 3LPFA 5FMBA 4NRPA 1G7YA 4WM7B 3GF6A 1P8JA 4OYUA 5C8WA 1UYPA 2VMHA 3E1F1 3N9LA 4P9XA 2CL2A 3HMYA 1OKQA 1CD3G 4R4XA 3HEIA 5CKQA 1EAH2 3IIIA 1VBE2 4ASKA 1EPZA 1LOBA 2WIIB 3N9NA 1WD4A 1NLQA 2G9ZA 2VUDA 3OJBA 1FOD3 1GP6A 2D6KA 1YWKA 2EICA 1EY2A 3MIBA 1N3QA 4P00B 3D82A 3EBRA 3RYKA 3AVSA 3VBUB 4OUSA 3MIGA 4CU7A 5I8TA 5LWBA 2FD8A 2YUEA 3NNLA 4L2NA 1R091 1DGWX 4TLFA 1VBB3 2W08A 1DQ2A 5KHIA 3ZIXA 4AF9A 2TBVA 4CPBA 2BGCA 4XQDA 5FZAA 2P3IA 4Q27A 1LHUA 2FQPA 3ETQA 4LUMA 4A42A 5F5AA 3B7MA 2VBPA 1QY4A 5J98B 2ZGNA 2D5FA 1MS9A 2DVDA 4Z1VA 1X36A 2B39A 1HRI1 1UYXA 5DAWA 3ZSEA 1MEC2 2J42A 3SITA 5ABJB 3WQ0A 1RXGA 5F5QA 2HH9A 4LNVA 3I8TA 5EJ3A 4FI9A 4X6QB 1RMU3 2JE7A 4A4AA 3D5OA 2F4PA 4CP9B 4ITCA 2D7FA 4FCAA 4XTMA 4IUGA 4RR3A 4OFGA 3ST7A 2AYHA 3ASIA 1BHGA 2XVKA 5FPLA 1DQ1A 4S2FA 5FZ4A 3WDTA 1XSRA 2WO1A 4B4QA 4D7YA 4MGIE 1BZWA 1ZBA2 3EO6A 4MGSA 3VN4A 5FK8A 1LENA 4AFCA 1D0GA 1YNAA 2BV4A 1E5RA 2ET7A 3FE5A 1HN0A 4UOJA 1RUI1 2Y6JA 4YW2A 5C3SA 1MACA 1RUF2 5E8AA 1KQRA 1XYNA 4NN0A 3O1VA 4HMZA 3I59A 1W6NB 3ACIA 3C2UA 3J8F2 4YPJA 3RPQA 3H8RA 4W6XA 3IT8A 5FYHA 4M4RA 1BBT3 2NLRA 5CU1A 4N53A 1VALA 1ZZCA 2EVXA 3I59B 3KV4A 4MH0E 4BDVB 3RZLA 1CAUB 3JB8A 2K2SA 4J25A 2VMFA 4QPGC 2VOWA 3HPNA 3UK9A 3ZXFA 3KVAA 2Z42A 4HVRA 4N53B 4BQ2A 1XNCA 4E2SA 2WWJA 3JU9A 1S0DA 5IW0A 2VQAA 1PO11 1O7FA 1S55A 2DWRA 3PUAA 3PVBB 4FFHA 1W2UA 3ZN6B 1IG3A 2HWE2 1RB8G 4P9LA 4CXYA 2ZJCA 3KMHA 5DZFA 1JBCA 1CIWA 4I3PA 1NE6A 2HLEA 5CBLA 1H2MA 2P17A 4XDOA 3GJBA 3VBRC 4DFSA 4DNYA 3TEYA 4Q4Y3 3AJZA 2CHHA 4AHWA 2QCSB 1JZ6A 5DDJ3 1FV2A 5CISA 1UXXX 2WLPA 2Q8OA 1W6QB 3ILFA 3W21A 5IYYA 3BOWA 3WF3A 1COV3 5A70A 1XNBA 2PHRA 1AR63 1F5JA 1QNYA 3LE0A 4TLGA 5JOYA 3RI9A 3G7DA 1LODA 3B93A 3VZKA 4XJZA 1DHKB 3MLJA 1KFXL 2WO3A 3VBHB 3ZXJA 1CWPA 3DECA 3PUSA 1H2NA 5JZGC 1F15A 4B4PA 1ZRCA 3S57A 4YW5A 3ZXGA 3T4HB 1SMVA 2Q4SA 3WF2A 4DXSA 2XJSA 3BB6A 4RGAA 3RS6A 3LA7A 5CA6A 4BIFA 1ONAA 1UMHA 4JGZA 1ND3C 4K1ZA 3VBOC 5FRAA 3ATGA 1N1VA 4FVVA 4RGKA 2P3KA 5HXVA 1Q8SA 3ZSLA 1PMHX 4JGZB 4R8HA 2FDFA 1QH7A 1G9CA 3ZO0B 5IK4A 4M0NA 2WS91 3USUA 3AMPA 4FPEA 5B4XA 3OTFA 1IS3A 4HFSA 5SV5A 2VBDA 4EYUA 5FP4A 1R1A3 1CX4A 3GBWA 4IW3A 5A6XA 5FMOS 4EWEA 4HK8A 5C3RA 2YU2A 3I2IA 4X8NA 1R093 2BP6A 4INDA 1RHI1 2WNOA 5BNPC 1GQPA 4S2DA 2GC1A 1AR82 4CA9A 2VR4A 3LF7A 4AI0A 1ZA4A 4CCDA 1WLDA 1GU3A 2DVAA 2VMIA 2MEV1 3K77A 3R4DB 1W8WA 1ZVFA 3PIGA 4N9IA 4YVSA 2YC2A 3AMMA 1YQ8A 2CSGA 4I02A 1HKDA 5FZLA 3ZYFA 2JD4A 1HRI3 4O9EA 1MQTB 2WNVA 1IS4A 4H2AA 4Q4X3 4QX0A 3X29B 3FBYA 2BNNA 4PIXA 1WCKA 3N3HA 5LASA 1H8TB 5F3CA 5BNNA 1PK6C 2RS32 2WNVB 3IDBB 1W0PA 3W5MA 3H1MA 3F2ZA 1FI2A 2VVDA 4MXWB 2ILMA 2AZ5A 2XVLA 3RI8A 4TSVA 1PM7A 4QDQA 3CJIC 1IPSA 1L7LA 2QDNA 4RGGA 4RQPA 1UAIA 2DFBA 4I3GA 2C26A 1RUC3 4IXLA 2X5IB 1CR7A 2DUOA 4K20A 1OKOA 3C7EA 4Q4W2 4SBVA 3S5QA 1S0CA 4RQPB 1IPKA 2BRTA 2WFF2 4L8QA 1Q43A 4U36A 4Y26A 1YQCA 3FLPA 2EF6A 2GALA 5D1IA 4ZS2A 2IXJA 4LJHA 5C7GA 4FQZA 4D94A 3LA2A 3H0OA 2HEVF 1H8VA 1FT9A 5T5LA 3PJQA 4M3CA 3I49A 1UU6A 4UFHA 3KV6A 1Q8PA 1VE0A 2Y34A 5IATA 2EXHA 4OMDA 1UZZA 1VJ2A 3EYPA 3VBSB 2YGLA 2VQTA 1F4AA 1UCXA 4AG4A 1SLAA 4A6SA 5ACA1 1S0IA 2ZKLA 4P9YA 1QJY2 1GZTA 3D4KA 4MVTA 5A80A 4A2UA 1IPJA 1YRZA 2CU5A 3Q8BA 1PO13 2BGPA 1O5UA 2R061 1LULA 1WCDJ 3F95A 2JG8A 1PO22 3FLTA 4AHZA 3IAPA 2ZGKA 4C1XA 3NL1A 1W9SA 3V0BA 4QX7A 1YQ6A 2VTXJ 1GZWB 1WGPA 5JSPA 1UY4A 2EAKA 4URAA 5FO9B 5FLHA 4LO6B 3HBKA 1IKQA 3V0BB 2OX0A 4LBNA 2XKPA 3WT3A 1WCQA 1CESA 4GMP0 4CRQA 2D40A 1RUE2 2RE9A 4BQ5A 4QKNA 2DTYA 4XILA 1QWRA 4AVSA 5T5JA 2VO5A 2WZR1 1Y9QA 2P5BA 4XFAA 5FY8A 3WXPA 2KA3A 3AZWA 3AXDA 2XH6A 3B9CA 4JGYB 4QM9A 2WWUA 1OMIA 5IVEA 1ZBE2 3C7FA 2X05A 3VDDC 4K9SA 2G9GA 3GGLA 4I30A 5AC92 3LFIA 3BUCA 4COYA 5IVFA 2KXLA 1XNAA 1J1LA 1RJ7A 4EROA 4ARYA 3P1IA 1ULGA 2E32A 1TME3 2PFWA 1CAVB 3MZHA 3ITQA 3I2DA 3FLRA 3GBGA 3A0NA 3RZMA 5LW9A 4UF0B 2IXKA 4CCJA 1K3IA 2J1AA 2GP5A 3O1TA 2HKXA 2Z69A 1OF3A 4WVVA 5J96B 4BHPA 3VD3A 4Y4YA 2NN8A 1FPN1 1NOVA 4QD2A 1AYN2 2VXJA 2KD7A 2WS93 3AFKA 5JPMB 4WZFA 5HCHA 3PUQA 2R32A 3BYWA 5I0RA 1OH3A 4D6SA 1AJKA 4YG6A 3H8OA 1HDKA 2VZSA 3IWZA 4DMIA 1UKGA 4QHBA 1JZ7A 1JZ2A 1RHI3 1JYIA 1XYOA 5LK5A 3DCQA 1ZREA 5FZBA 5LBBA 4OHZA 3BKZA 3HQRA 2MEV3 4BU2A 3JB4C 1N1SA 4GZ9A 3U4XA 4RFRB 3HNYM 5JOXA 3S5AA 3PUIA 2VMCA 4ZKTB 4EE2A 1YYNA 4DO0A 2O8OA 3N9OA 3HAGA 3H3UA 1RUG1 1VB4A 1RTVA 1UN1A 2F4LA 4QXCA 2UWBA 4IV1C 4X8PA 1ND2C 3WF4A 3CBNA 3AMHA 3VZOA 3OEBA 4OUMA 3U07A 3FC0A 5A3LA 2GNMA 2JENA 3WVJA 4CXWA 3ROUA 1VP6A 3WUCA 3WUDA 2QZ2A 1XBFA 4IV3B 4QGNA 1W8ZA 3VV1A 4DIQA 1I6XA 3M4FA 2RMU1 1AL21 2RR13 1X50A 3MLLA 4HK9A 4QKDA 2WSUA 3KHCA 2IFRA 2W1WA 3LWCA 2XJTA 3I54A 2K9ZA 4JZRA 1ENQA 5FYVA 4ES9A 2ADDA 5L9BA 1C1LA 1VBA3 4IL7A 4EN0A 2FDIA 3INAA 2DUQA 2E51A 4HN0A 4QPWA 1KGYA 2QQVA 4TZDA 3ZIWA 3N7LA 3CNAA 2BFUS 4G9SB 4JKMA 3AC0A 3SKJE 4MGZE 5BNQA 5A33A 1Y9MA 2VZ3A 2VMEA 2JDUA 5BNOA 2XBO3 2O1QA 3BALA 3DN7A 4U2AA 1DF0A 4N8MA 4YGCA 2VM9A 1WMXA 1W3XA 4I01A 1RC6A 2DVFA 1NA1C 2R30A 4GULA 4IGPA 3VGIA 5A33B 2WJSA 3AP5A 3B02A 3ALQA 3H1YA 5FCCA 2R063 1MZ6A 1BK1A 3BN6A 1NT0A 1QQP2 4KGGA 4HKWA 4YFZA 3O0XA 3ZFGA 4OVEA 3NAPA 1HXS2 4BQ1A 1RUNA 2ZGLA 4CDQA 4JTOA 4LA2A 5SV8A 1H9PA 1HRV2 1DGRA 4ZXEA 4KG8A 2VU9A 3WDWA 3O1SA 1GYKA 3ZFGB 1N47A 3OPWA 3KQRA 4LBJA 5A1LA 1NLSA 1EV11 3CU7A 4CDQB 1O3TA 1Z78A 4D6QA 3RZGA 4FPLA 1WW5A 2MHFA 1Q8VA 1MZ5A 4O65A 5FPAA 4IEVA 4XUNA 1F35A 4QB6A 1HB4A 3FHAA 3L2HA 1JUHA 3O1OA 1GFF2 4IE0A 1W03A 5F3GA 1LAJA 1O8SA 3OUJA 3P3NA 2WUHA 1H1MA 3WEZA 2D6NA 4Y4RA 5ERLA 3SMHA 4ES8A 3MBWA 2A70A 3KD4A 1OUXA 5L73A 1WD3A 2AENA 2K46A 5D2AA 4SLIA 1PGW1 2Y6FA 1L3JA 5F3IA 1BEV2 3FZ3A 1SDWA 3WSOA 3WZ1A 1O4YA 2B9UA 2IXCA 2VAUA 5FWEA 2BGOA 3MPPG 2OS2A 3LAGA 4IGOA 4WM7C 5CNAA 4FFFA 4RHV1 3WG4A 3WDUA 1NLRA 5JPNB 3WNOA 3WG2A 4AQTA 4JC1A 1HLCA 2YMZA 3A7QA 4HKLA 2FZ1A 2BOIA 1TVGA 1MVQA 3T08A 2JDZA 2C4XA 2GH8A 3H50A 4Q26A 4QMAA 4W8JA 4D6RA 1ZA7A 3BOPA 4QKBA 2VOTA 3MICA 5FKCA 4GJZA 4AGRA 2A71A 5E88A 1FMD3 1F4HA 5H9RA 4AEDB 5KWRA 5FUIA 3IAQA 3JQWA 2WR9A 2WQ4A 3PHMA 3VBUC 1JZ8A 4YVWA 2Z2SB 4LK7A 4UW3A 2XGXA 4YM1A 3POSA 1LHNA 3AXEA 1KXGA 4COVA 5E1RA 2ZEZA 2FCUA 3GALA 2FMDA 2W92A 5D8AA 4CU6A 3U4SA 2Q1ZB 3OGVA 5JXGA 3QBQA 2OZJA 5D8AB 1XU2A 1LNSA 1OC1A 4A7KA 4CDWA 3NKTA 1C57A 1MS3A 1RUG3 4C0BA 2RDNA 5CKMA 1QJX2 4EWDA 4CDWB 1TG7A 4CCCA 2NPIA 2AREA 4JHTA 3POYA 4M3CE 5APAA 5FTTC 2D43A 4TTGA 4DQAA 2VNRA 4QQLA 1VBC3 1YFYA 5C5TA 3NNGA 4K40A 4QPIA 4BA6A 1X8EA 4NIHA 1EAH1 4JKKA 2RMU3 3KSCA 1VRH3 3BI3A 4Y5Z0 3VDBA 5FMCA 3ON7A 2VCBA 1UZWA 3U10A 2EAAA 1RVF2 2OUHA 3SH3A 3JBG2 5F37A 1LTEA 4BWOA 1VAVA 4KNCA 3VZMA 1J3PA 1DQ6A 4FTSA 4E4HA 2EXKA 5LA9A 1SACA 2WYFA 4GWNA 4EZ4A 4IEWA 3VD7A 4XVHA 3VL8A 2JDKA 4E2QA 3S7EA 4FOWA 4N53C 4ZU4A 3WD5A 2NZ9A 2P3YA 4LITA 3ZN5A 1K42A 1GKBA 1G6NA 4YG3A 4EN6B 3ZKUA 1QH6A 1MEC1 3H9AA 5A7OA 3RMXA 1REEA 1UIKA 4HSLA 4D7SA 3E5QA 4NIGA 4PQQA 1DQ4A 1K45A 3DPRB 1VMJA 3QD6A 2XLGA 4HN1A 4OI4A 3WNKA 4CCKA 4XIOA 3T09A 3IIAA 1KS4A 3ZMOA 2A6XA 2ARBA 5CKNA 2ZPXA 4CEWA 1UIJA 4YW7A 4JCKA 1EV13 1VMFA 2W95A 5GZCA 5A3TA 1XNTA 1PX4A 3POIA 1K12A 4N43A 5F3EA 5CADA 4CEWB 1UPSA 4QXHA 1U5XA 4Q5OA 3TOJA 1AR71 4LPLA 3IMMA 2QE3A 3N36A 1AYM3 1XE7A 1BQPA 2CDPA 2J1RA 3P6BA 1RUF1 1Y4WA 3MW3A 5F6KA 4N43B 4GD4A 2GSYA 4E9KA 1TMF1 5FO8B 2CWSA 4KG0A 1HQWA 1SLLA 1KD7A 2W2IA 2F17A 2IWGB 2WZPP 1V6IA 1BVVA 1JTZX 3J8F1 4FPHA 4IQPA 3VBHC 4B4RA 1DQ5A 4GH4B 5I8YA 5J3UA 3M7AA 3VZJA 3POJA 5FIXA 2ERFA 3R05A 5C6CA 1UQXA 1DG6A 2A75A 1RUJ2 5A7NA 3S7IA 2QQMA 1ZX5A 1LOGA 5K4LA 2OQ6A 1H2KA 1QJFA 4ZONA 3SQOA 4RS5A 4ZZ8A 5IHRA 4QHZA 1W6PA 2VBBA 5JIAA 4UWDA 3LGRA 1JYNA 2PYTA 1SLBA 3PNAA 2QUOA 2CV6A 4RS5B 4XFIA 1AR92 2CYFA 1DQ0A 1QOTA 4Y5TA 2QZ3A 3RMYA 2HYXA 2HWE1 1IKPA 4BLIA 4JGZC 4COZA 3C7OA 2QQOA 4Z07A 4CYDA 1A6CA 5K9YA 1UOGA 3BTAA 4Z2AA 1OQDA 4LE3A 1CZVA 5JIUA 5JSOA 2EIDA 5F8PA 3ZFEA 4O61A 3ENRA 4CPBD 2VMGA 3KCYA 1Q8QA 4J1XA 5K0UA 1J58A 4Q0QA 3SEEA 3C8XA 3BGAA 4AVBA 4CP2A 2VTXA 4XAAA 5FYBA 5AFBA 1Q3EA 1S2BA 2ZMLA 4YSFA 1W05A 2ZS6B 5C3OA 5LEJA 2OKXA 4DZGA 4GA9A 2ZGPA 5A6QA 5KXCA 3T2QA 2OQ7A 2XUMA 2CY6A 1WUVA 5IVJA 3HBZA 5H9PA 3WF0A 1MQTC 1JYTA 1ENSA 1Z0HA 2Y6LA 1CONA 2DCKA 4IGQA 2JIJA 2YFZA 1KEXA 1WWYA 2XJVA 4YVSC 5T5PA 3RYRA 1UY0A 3FJSA 1H4HA 2V72A 4MHRA 1I1EA 4MSVA 1H8TC 5A3WA 3LEKA 2WNVC 4QM8A 1CJPA 5JMOA 5CAZA 5LZ6A 5FZOB 4YZ1A 2ZGMA 1L7QA 1REDA 5BNNC 5JOZA 4QB2A 3QH7A 5FKBA 4BE3A 2X5IC 4KU7A 2KR2A 1HV1A 5FPVA 2XL7A 1DBNA 1VIWB 4NUBA 4RQPC 3VL9A 5EJ1B 3JUUA 4CCEA 2VPVA 2MNGA 1A8MA 2N7GA 4XYXA 5GZEA 3VBFA 1UYYA 4A3ZA 1RUOA 2ZEXA 3DV8A 2J1UA 1D7PM 1QF3A 4FXKB 4HPKA 5JLVA 2R49A 4DEQA 2WAAA 3ILNA 4XZPA 3WR0A 4B3NA 3LSEA 2QFEA 3VBSC 1AR81 2RS52 4HPKB 4Q4V3 1DLCA 3PU3A 3NJXA 3U14A 1X82A 4L97A 1D4M3 1POV3 2A6VA 3DEMA 3S0MA 1LU2A 3MUZ1 4NHMA 5F5CA 3AP6A 2OXBA 2RS11 4NWWA 5JMCA 1MEC3 3MYXA 4Y1UA 4R4ZA 2XJQA 4NMIA 1GP4A 2R0HA 4PJYA 5FBJA 5FAXA 4JHZA 3IMNA 3O1RA 2R042 3JZVA 1PHMA 2RS31 1OFSA 5LATA 5FY0A 4A6OA 3WQ7A 1DZQA 3M70A 2JG8C 4LEJA 4LLFA 3CIHA 1JW6A 4CVUA 1AF9A 1XU1A 2JJ6A 4Q1RA 2WKKA 3KF5A 1ASJ3 1PIV2 1M4WA 1QJU2 3KS7A 4UW6A 3RYPA 3WCSA 4FFIA 1S0EA 3PIJA 4XJ8A 4AQ6A 4IE6A 1UO9A 2ZX4A 1AR73 1W90A 3GJAA 3VKMA 3C3VA 3H8UA 1UZYA 4AVAA 2GN3A 1GWKA 1TMF3 2C1FA 4KL1A 4R9AA 5I0UA 1DDLA 1LOFA 4M0HA 4JGYC 4MADA 5FQ0A 3IBMA 1W8UA 3ETPA 3WQ1A 2RJLA 4BXFA 3O0VA 3OY8A 3TEZA 3JD72 3P3PA 1O3QA 5HPOA 1NY72 2V4VA 4YLZA 2YZ4A 5KC6A 5C4WA 1QJY1 1VBD2 5A3PA 1DP0A 3ZYBA 3L9JT 4DXRA 1HQLA 3AKQA 1JYCA 1J83A 2W94A 3W5NA 1NCRA 2EXJA 4H7MA 1NX9A 2UWCA 4RR3B 4HT1T 2HWE3 3GZUC 1PO21 3M2MA 1GMMA 1NCRB 1XC6A 4ZPIA 2OUJA 2RDSA 2WAOA 4UYBA 1ULCA 3UT0A 4XTPA 3B9IA 1T2XA 2YC4A 5FP9A 4WM8A 4JVAA 4CDUA 3DYMA 3T30A 5L9VA 2JDPA 5F1RA 4LO8A 3AKTA 3OBTA 4LHNA 4PF1A 1FOD2 1RUE1 4AK3A 1D2QA 4LTAA 1GSLA 4OQ9A 1OBNA 1HB3A 2Y0IA 2XJRA 4LMFA 2XQXA 1W9WA 2XWBB 1TE1B 1V6LA 1PVC3 3LDRA 4QGLA 1W8NA 4LK6A 1VBB2 5A3MA 4Y22A 4GQ7A 3BU0A 3FBMA 5FMOL 1ZBE1 5KHHA 3SISA 2HWC2 1IQDC 2XVGA 2ORXA 3POGA 1NYWA 5FY4A 4CSWA 2QQKA 2CAUA 1QNWA 3PUHA 4BB3A 3OD4A 4Y22B 1R64A 4BZ4A 2GMMA 2WN2A 2VC9A 2VMDA 5JR2A 5ISLA 5BV6A 3PTRB 3D6EA 5DMYA 5I91A 1OOPA 5CVRA 1ODNA 3ZR6A 4NHKA 2E7TA 3H3ZA 4GB32 2EA7A 1UU5A 2TNFA 5LBEA 1PZ9A 4URTA 2ZMNA 2B9VA 3OPTA 4A3XA 4IV3C 2XWJB 3HNMA 2BDRA 1U5YA 2ZEWA 3VD9A 5EFUA 3T1LA 1JODA 1AYN1 2IVIB 3ACHA 4YW1A 3R0RA 4P9GA 4LHLA 4KWJA 2HWB2 3GBFA 2NM1A 4FPFA 4YM0A 5IAXA 1VB2A 2P6CA 1X7NA 2VULA 1J3RA 3NKGA 2JDMA 2YG0A 4JQRA 4NAMA 2W5FA 1YUDA 1LHWA 3WP4A 4PLOA 2GH2A 1ULOA 4FPYA 2JB8A 1AR83 3CF6E 4QQHA 4C0HA 1S0GA 4M3CF 3NQHA 1AUYA 2GC2A 1BBT2 1MS0A 3B01A 2RS13 3MV11 4PF5A 4OHWA 3T0DA 2PAKA 3VB9A 5FZ0A 3T0BA 4BJ0A 1D0HA 2BVVA 1HIXA 2X53S 4Q0VA 5CFDA 2NMOA 1ZZ6A 1RJ8A 2VL4A 4PDWA 1J3QA 4ISRA 1JU3A 4CXXA 3ME2A 4DEVA 1G9DA 2I74A 3V0AA 2R071 4XJWA 4QQ2A 4W6YA 5CFDB 1UL9A 5T54A 3VZLA 4PDWB 3ZFGC 3LQCA 5FPBA 4CDQC 3USUB 1H9WA 1W6MA 1XYPA 2PHWA 5DG1A 3HN3A 2WZEA 2ORZA 2Y6HA 2ZA9A 4NHLA 3VLBB 1E5HA 5E16A 4OZOA 4D7TA 1W6MB 2ZGRA 5LCWL 5LEKA 4QPYA 4XCAA 2QQPA 1YLLA 5FY5A 3O0WA 1PZ7A 1LHVA 3WNMA 4PBOA 2WSVA 3BTYA 1O6UA 3B94A 1QDOA 1S0FA 4NR1A 4IEZA 2I2SA 4L0PA 4FPJA 1COV2 4YVSB 1PMJX 1QU0A 4K21A 1AR62 4MGQA 3VHNA 1XNKA 5FYYA 4YFWA 2PN5A 1RITA 5DAVA 1O91A 1OPMA 1WW6A 3HT2A 4KMQA 1RXFA 4COWA 2X10A 4UT5A 2J1SA 3GXUA 4AGVA 1OF4A 3SLIA 4MGKE 3LEIA 3K51A 2H6CA 2LROA 5LA2A 1I9RA 3B00A 5FY7A 4HKOA 2B4KA 3ZYRA 4YG0A 5BNNB 4NPMA 5JXJA 1OLQA 2JEMA 4E8CA 4OCTA 5DUXA 4RD7A 2RHPA 5A7WA 1RGSA 2FDJA 5F32A 4WVMA 1QQP1 1WLWA 1BMV1 3NV3A 4NHXA 4ZY9A 5EIYB 1RUI3 2WLQA 4AZZA 1PGL2 1MS8A 4MGYE 4Y24A 1WKYA 4ASLA 1HRV1 2UURA 4AEDC 1F9KA 1OD5A 2UYBA 5FZMA 2DF7A 1IHMA 1WA6X 2PHDA 3HWJA 3WNXA 2G19A 1RUD2 2ETEA 2BUKA 3EHKA 1JOBA 2JKXA 4KWKA 2JX9A 4LIUA 4XJUA 4XHXA 3WW3A 1VLNA 3WNPA 4EN9B 2ZMKA 4LXLA 4BISA 4JV4A 4LKFA 4Y20A 4M3CB 1Q56A 1R1A2 3DXTA 3FUQA 1SHWB 3OSDA 2YBSA 5FYSA 1STMA 3ZSJA 1R092 3SEPA 3WDVA 3KZ4C 2ZX2A 4XPVA 5D8AC 5AVPA 4A7YA 2RJKA 2V4AA 4GJYA 3RJRA 4OI0A 1GZ9A 4PIZA 5BPXA 2VUCA 3UV9A 3H42B 3S30A 4NROA 1EUUA 3A22A 2LTNA 1UZVA 4CDWC 1BEV1 2AGSA 5FYZA 4Q4X2 2JG8B 1YFXA 1W39A 2B8MA 1O8PA 4IE5A 5IJRA 3OG2A 2D5HA 5CB7A 1RYYA 3J26N 4FPKA 2V09A 4BQ3A 1W9FA 5JXIA 1F8VA 3IKWA 5EPAA 5EYXA 4UI9L 3KM5A 5FYTA 2B5HA 4Z2WA 1AVBA 3PLQA 4P9JA 3ZXLA 1QEXA 1RUC2 2QTWB 1WMEA 2WNUA 2VY0A 3LKJA 2J1VA 1SFNA 5F5IA 1O3RA 5C5UA 1TQ5A 4ET7A 2ZHKA 3KT4A 1UXZA 1I3HA 2WNUB 4LBLA 4XDPA 3M3IA 3TBDA 3V65A 2GNDA 4QHOA 1V6JA 1CGPA 1MS5A 2YBPA 4K8RB 5EZWA 2VZRA 4Z8BA 1WBLA 1WCUA 5C3QA 5K8SA 4XXAA 4FSJA 1S4CA 2ZOEB 2IXIA 2VOVA 2A5ZA 1YC61 3M3CA 3ZFFA 2OZ6A 2VW1A 4AW7A 1VR3A 2HWD2 2QKDA 3BODA 2PLV1 3ORJA 1UF2C 1V0AA 2BFUL 1QJX1 1MS4A 2C5DA 3DPRC 2V73A 3IN9A 4V2WA 3APBA 4BM8A 4YGEA 2Q5TA 3WNLA 2ID4A 2R073 4XE9A 2DU1A 3J7HA 3W59A 3CDZB 4IEQA 4QKFA 4OHXA 5F6LB 4FPCA 2VUJA 1IZ3A 1OA3A 3K4AA 1JU4A 3MPBA 3PTYA 5TSWA 3C7HA 2WN3A 1TNFA 5FBZA 4CEWC 1CAXA 3ACGA 1UY3A 3NVCA 3TEWA 3KLSA 3AKPA 5LBFA 5LRRA 2J7MA 4CEYA 4N43C 3B5LB 2FBEA 2WDBA 4EN7B 1V6OA 1NG0A 2BTVC 4HXCA 1RVF1 4LHKA 2QDRA 3O12A 1AXKA 4YGDA 3JBG1 4R9CA 1W3VA 4CEYB 5FZEA 5A3NA 2BBVA 4GH4C 1UYZA 1CN1A 5FR3A 4C8DA 5J09A 1T6BX 2GNTA 3GHNA 2E6VA 3CO2A 3I3QA 3OGJA 4L99A 3AP7A 5DZEA 2I07B 1V9U1 4XFFA 5T3NA 2DBIA 3TAYA 3WDYA 2C9AA 1BCXA 3KGLA 3ES1A 4YZ3A 3CZJA 4KQ7A 1R081 1POV0 1W8FA 1YFWA 3VHOA 3M3OA 2VCAA 3GZEA 5DUUA 2YB7A 3PVNA 1RUH2 4LHSA 4DUVA 2WRAA 5CFCA 4RS5C 1H4GA 1X8MA 4QX5A 5B4NA 3TWIA 4DRRA 4NPLA 4MLOA 3GCXA 5GM0A 1YI7A 1TME2 5CFCB 4MG2A 1GBGA 3W20A 3AYEA 3I3EA 1OA2A 2VZVA 4AVTA 1N1TA 2HWF2 1ZRIA 5AVAA 3RJ2X 1HRV3 2DVBA 3CKHA 3VKFC 1LECA 5F7UA 2V5DA 3LPGA 3VBRA 5FLJA 4XHBA 3ZFEC 3T0AA 1OLRA 4K1YA 5FXVA 3WHUA 1XXNA 4BCUA 3OCPA 2WS92 2XDVA 5EQUA 5IFTA 1OD3A 3WP3A 2JE8A 2W0XA 4LQRA 5L19A 4QQOA 5HCAA 2I45A 4OUEA 4XFHA 3OF1A 5F2WA 1OURA 4JAAA 5ACA3 2XG3A 5A1AA 3LDKA 1S0JA 2ZGTA 1RHI2 3RVHA 5BNOB 2B42B 3AZZA 2E53A 3KCXA 4HL0A 4LO7A 4MZUA 3RGBA 3OGGA 3SNMA 2Y8KA 1VAKA 5CYYA 1US3A 1RUJ1 2VZ1A 3LOIA 4BIOA 4FOYA 5C3PA 4UFKA 5GLZA 2Y6KA 2ZHLA 3TRSB 5HXMA 4NPRA 3WINE 1NZIA 2VZTA 2W52A 2D44A 3D3AA 1DGLA 3O14A 2P3JA 3NAPB 1AR91 1WLCA 1QHDA 2DFCA 5GZDA 1H0BA 3VBOA 1OVSA 1YHFA 4WVZA 2VOXA 5IVVA 2PHLA 3UGGA 4HOOA 3MF6A 2V5YA 3ZPOA 4P9IA 3WDXA 2W47A 4TYSA 2O0OA 2XHNA 1ENRA 4ZU5A 1JZ4A 5IK5A 2WZR3 4G3YC 2RVAA 1GNHA 2W39A 2E7AA 1VAMA 2QNKA 1PMIA 1PVXA 1XPWA 2O8QA 4MXVA 2IUWA 1HB1A 1IGOA 2RR12 5JCTA 4QXBA 3T2TA 3WLUA 2AR6A 4MUVA 3RSJA 2ZX1A 3PJYA 4YARA 5C9AA 1ZZ9A 3HD8B 1GUIA 2MPFA 5FZGA 5BNPA 4AFDA 4HBNA 3FX3A 4QAWA 5I8SA 4RA0A 4CUBA 2PTMA 4CU8A 1VRBA 3AKSA 1VBA2 4HONA 4FOQA 3T2OA 2WL1A 2R16A 1Z7S1 4XF0A 1SCRA 1ULPA 4Q8KA 4ZZ5A 1F31A 1GQHA 2YPDA 4DB5A 2PLV3 2XBO2 5FWJA 4XUQA 4LA3A 3O1PA 1GANA 3AVRA 5HV4A 1O3SA 1FPN3 5C70A 1PK6A 3MLKA 2GMPA 2GAUA 2CGNA 3EJKA 4NE9A 3M3EA 4ORFA 4EZHA 1UU4A 3HQXA 4XFBA 1UOBA 2VZUA 3L2YA 2W3JA 4DXTA 2D6OX 4DXZA 4MX3A 5KHKA 4NJ4A 4LOSA 2UY9A 3JXSA 4YVWB 4CCLA 2XJPA 5JXHA 1MZFA 2ADEA 3N7MA 4NO4A 5A32A 5FZFA 4GMP1 2B7YA 3AM2A 3LCPA 2J1EA 3H7YA 3JBG3 2BYVE 1YO8A 5FLIA 5A32B 2YPJA 5FZ7A 2ZGUA 1NXMA 1GLHA 4XC9A 5IAVA 1LOFC 1V9U3 2RS51 5KHJA 4Q0SA 1GZCA 5EV7A 5FYUA 3AFGA 3A4UA 4MO3M 5DUVA 2E7QA 3D0JA 2QQJA 3WCRA 3VD5A 1W9YA 4LBQA 1R083 4UW4A 4XMIA 4PIYA 2TUNA 4QQPA 5C4WC 4HSJA 4LBQB 2RDRA 5GALA 4DRVA 4FOVA 5J7MA 5LY1A 4RR3C 2VVEA 4GXLA 4MYEA 4UFIA 2R041 3KWVA 4Y1XA 1E57A 4QU2A 2VNOA 1YQ5A 4YZ2A 1NCRC 1VBE1 1HJFA 1AL23 1O4TA 2RV9A 4IEUA 5FZDA 4ZXKA 5I0TA 1OLME 4QPIB 4H7LA 5HV0A 2Z5WA 5EWSA 1UMIA 1VPHA 1GNZA 2OPKA 1SQ4A 2ES3A 2ZAAA 2Y6GA 5GLUA 4CE8A 1LOEA 2C6SA 1PIV1 1GWLA 3BU7A 4HZFA 3VUOA 4WM8C 1OHFA 4CDUC 1LOAA 1B35A 5JSRA 4RSUA 5LA0A 3VHPA 1LJ7A 1FMD2 3TN92 2FHRA 5B2GB 3E5XA 4A45A 4AI9A 1B35B 2RG4A 3THDA 3EMRA 3SCHA 5J48A 3HNBM 2W87A 5JI7A 2LW8A 3W58A 4UBHA 4F7ZA 1G86A 4S2GA 2DYCA 3MFAA 3KVBA 2B45X 1RUJ3 3JD71 3USSA 3NJVA 3AP4A 1YEWA 1NY71 1EUTA 4QX8A 4NIIA 2P34A 3K3OA 5BY5A 5T55A 1VBD1 4BK5A 1AX2A 5KXDA 4MGTA 4IERA 1UNBA 4CCOA 1W2NA 3H1WA 5FZHA 4LIVA 3OYWA 1AR93 4H55A 2JIGA 1ZBA1 2W1UA 3AJYA 3RWKX 3E5UA 3T4VA 3GM8A 3H8XA 2JDNA 2WNEA 3OYWB 3VKNA 3ZSMA 4BQWA 1E5SA 2QBXA 4YZ5A 2XR4A 1ULEA 1VBC2 4MHUA 4CDXA 1GQGA 5FYMA 2ZKNA 2XMLA 3E6DA 1C8M2 3DKQA 4MOAA 1CZTA 1QXJA 1H1IA 3ES4A 4FQ4A 4XAEA 4TWTA 1ZYBA 3GZTB 2RMU2 4NIAA 5CIRA 4J1WA 1OQ1A 1FOD1 1GP5A 1POQA 1VRH2 2Y33A 1WMFA 2JG9A 4S2HA 2LS6A 4W50A 3OEAA 4QX2A 5DG2A 3IDCB 4DPNA 1CPMA 4W65A 1XNDA 2IC1A 1CZSA 1A78A 2GC0A 5FUPA 2D97A 3POBA 3NNFA 2JG9B 5BYNA 1ZRRA 1WA4A 2WQ8A 4Q8LA 5FK7A 3LSDA 5DAXA 1Z7S3 2OW4A 4RHV3 2SLIA 2JXAA 1K5MA 2HWC1 3O1UA 1W6PB 4ISQA 4JTNA 2YXSA 2UU8A 2A3WA 4XF1A 5FZ3A 3LIHA 3ECQA 3R4UA 4IEYA 3M3QA 4E2GA 4WBBA 3WG3A 4IV1A 3OGRA 3MUY1 5CFDC 4WV8A 1CVNA 1DLLA 4PDWC 4GB31 4EWAA 2XB6C 4YNIA 3WW4A 3OGSA 2Y26A 2D3SA 4BLJA 4LUKA 3ZFEB 4AVVA 2A3XA 3I2HA 3K75B 5FXWA 1AX1A 2HEYF 4Q29A 5IK7A 1CQ9A 5K0UB 2Y38A 1DU3D 1G9BA 3ZVXA 2HWB1 4KWUA 4GMP3 4FPGA 3T2PA 4FP3A 3FHQA 2ZAHA 5FYIA 3TNQA 4Q0PA 5J1XA 1J59A 1AYM2 3POWA 4YW3A 1TZOA 4AXOA 3Q8FA 5GLVA 2WC2A 1X9PA 3JCIA 3VKOA 4YGBA 3AZXA 2D6PA 3DL3A 3BTXA 3CZUA 4FO9A 1BBT1 2WZ8A 4AI1A 4RL7A 2VCMA 1OPOA 4V1PA 1OUSA 4WVWA 2HEWF 2P1BA 2QQLA 2BPA2 2Q8DA 4M01A 1MZEA 1ZZ8A 3PL0A 2R043 5FPUA 2A6ZA 5GZGA 3ILRA 4GWIA 1EAH3 1VBE3 2ZACA 3JQXA 3NNMA 3QCWA 4O7XA 3AZYA 3ZOIA 4C1WA 1G9FA 3B3QE 2VOKA 4QB1A 3AYAA 4FAHA 3VBFB 4KBBA 1LU1A 3HOBA 3MGUA 3ZSKA 1W0OA 4R52A 3C7GA 1JS9A 4L11A 3UL2A 4JDOA 1SLIA 4C91A 5C8CA 1W28A 1YIFA 2RDQA 1SLCA 1Y7BA 1YCIA 2ENRA 1N1YA 3R4SA 1LKNA 2PHFA 1SG3A 3NSTA 5JUVA 2BERA 5EYYA 1JMUB 2XPJA 4IETA 2FMYA 1COV1 5JVVA 4QWNA 2RM22 3VD4A 1NKGA 3CJXA 4LLOA 3BIEA 1UY1A 1U0AA 4KI5M 3RWNA 2JECA 3ZYPA 2A1XA 1KRIA 2RJ2A 3W9AA 3BPZA 1QOSA 4XEZA 4UFMA 1XQNA 5L7OA 1JZ5A 1QKQA 5FFOC 4WM7A 3BCWA 1W8HA 2LUWA 1REFA 1HQNA 2AACA 4Q4W1 4XZUG 4ZU7A 1ZBA3 5L7OB 1QXRA 4Y1YA 1JHNA 2R1BA 1LEMA 3B69A 1NXD1 4JX0A 2YHJA 2J22A 2WFF1 1PGL1 1YIPA 5T52A 3WV6A 3THPA 4YM2A 1RUF3 2GN7A 1MVEA 4GKXA 3GDBA 1ZM1A 2OVUA 2BWAA 3LA3A 4UXAA 1RUD1 1Y3TA 3J8F3 4N7UA 4XF4A 2WNUC 2WINB 2VZQA 3EXUA 3VBUA 5FOJB 1C1FA 4H14A 3SCGA 2WA3A 3PU8A 5A6YA 4K7JA 3FWEA 3EB7A 1H6XA 5FQ0B 2X09A 3MF9A 3URFA 4NVPA 5FZIA 1R1A1 5FPXA 3LDBA 3OY8B 1LCLA 1JH5A 4LULA 3SKVA 3I2GA 1DYOA 5A3UA 4UBGA 1A3KA 2W1QA 1GOFA 3VHRA 4F3JA 4Q4V2 2HWC3 3I2KA 3FFQA 3PMEA 2E31A 2ARCA 2VNVA 5C4WB 3N7KA 4QDSA 2ATFA 1D4M2 3ZFFC 1NCQA 5FJHA 5ABJA 3KT1A 1XJAA 5F39A 4NAOA 1B09A 4N9HA 3QLQA 3WW1A 4YW4A 4B1MA 1ZRDA 1QMJA 2EXIA 1NCQB 4Q4X1 4L9BA 1AXYA 4CP9A 1KDMA 4GB33 2WO2A 4R9BA 5KR7A 3J9SA 5HI0A 3RRDA 5F9TA 1XOYA 1V6MA 2PQQA 3CEWA 4OLLA 4WM8B 3BIWE 1IOAA 4CDUB 5FP3A 2WBKA 3KV9A 3OPZA 4TXWA 4X6RB 3ZDSA 3GCWA 4V2VA 2EIGA 1RUC1 4JKLA 4QT6A 1QDCA 2HWB3 2X29A 3MIFA 1ASJ2 4HG6B 2FDHA 3MI8A 4BH9A 2DCTA 4HVQA 1SCSA 2R1DA 1DYKA 3K2OA 4CEYC 1HW5A 1AR72 2R7EB 4G4FA 4XUPA 3V56A 2BNOA 1W6NA 1MPXA 2E33A 2Q8EA 4ASMB 1FATA 5AC91 1YI9A 1TMF2 3HVDA 1CIYA 3I7DA 1JYVA 3GNEA 1WW7A 4EQVA 2VNGA 3I2JA 1FNZA 5T50A 1WCSA 1CAUA 4Q2FA 1S1AA 3MO4A 1OI6A 2PMWB 3KV5A 3DXUA 2HWD1 3WQBA 4XBNA 4BMBA 2ZX3A 5E6HA 1QIQA 3T1MA 3I4IA 1RMU2 4AOCA 2DVGA 5GLWA 3WOGA 4B7EA 1OOPB 1XE0A 1NUKA 3E6BA 3ZDVA 5CFCC 1W8TA 3WP5A 2ZGQA 3NV2A 2JB4A 1S2EA 4CUCA 4LKDA 1OXCA 4HLTA 4K6BA 3ZN6A 2GDFA 3J7NA 4W6WA 4LO5B 3ZN4A 1SFYA 2FDKA 2ZGOA 4P02B 2P4EA 4LE4A 3RZZA 4BK4A 1W6OA 2E63A 1H6YA 2ARAA 4KWLA 4DY3A 2WT0A 3J7MA 4QU1A 4D8MA 4PBPA 2ZHNA 1W6OB 1PX3A 2CDOA 2D6MA 5DQ0A 5A7PA 3LEMA 4P5YA 2Q30A 4AI2A 2VGDA 1W6QA 2XONA 3K46A 3V64A 1MS1A 1YJLA 3ACLA 1AL0G 4AGGA 3UESA 2AEYA 5BNOC 4XABA 5IUQA 1V70A 5T5OA 4PI2A 2BEOA 2IXHA 4QX3A 3POEA 3VBHA 3WNNA 1SDDB 1PVC2 3LEGA 4BQXA 1G8WA 1RIRA 2QQWA 4DY5A 2RS33 4A41A 4RYDA 2EIBA 2WA4A 3OOXA 4FFGA 2QVSB 1C4RA 5FXZA 1OVPA 2O14A 3E97A 1RUH1 4XUTA 3M8LA 4PHZA 1YJKA 4XFGA 3CMGA 3NAPC 3V0AB 4Q4W3 1LRHA 5E89A 2HJIA 3DKWA 5FUNA 2VTFA 1TME1 4IDZA 1LR5A 2W1SA 2WFF3 2XJUA 4Q4Y2 5AFEA 3VDCA 2F6BA 1BLZA 5IFPA 2HWF1 4FP2A 1LGNA 3AL6A 3A0KA 3WF1A 4BOWA 1DFQA 2ZGSA 5DDJ2 3MW2A 2D3PA 1LOCA 1RUD3 2ARXA 1H1AA 2BVBA 4CU9A 2R6QA 3MEPA 2G9FA 2WFPA 2DCZA 3OBAA 2VJXA 4Y1ZA 2WT1A 5IVBA 1DYPA 3VKLA 1SEFA 1SFPA 5FZKA 1U5IA 3GZAA 2XL9A 5C9AC 1QJY3 5DN2A 4GALA 1SBEA 2ZHMA 4NIDA 3IM0A 1OT5A 1QXPA 3NW4A 5CG8A 4FTBA 1PM4A 4XXPA 5DPNA 2JD9A 1MQTA 4JRAA 4BYYA 5EHDA 2VQUA 1PO23 3PURA 1ODMA 1OSGA 4AYUA 3O5SA 4Y3OA 2RS12 5A7WB 1H8TA 1HXS1 4YWAA 4I09A 5A7QA 4Q0UA 4WVMB 1S2KA 2EIEA 4MXWA 2D93A 3OUHA 2YU1A 4M4PA 3H7JA 1GV9A 3SH5A 2PA7A 4D3WA 3AP9A 2Q1MA 2JKBA 3WW2A 2BBAA 2X5IA 1C3HA 1URXA 2DDUA 1X33A 1RUE3 3MHZA 5FZ8A 4XQ4A 2WYSA 5BUVA 1G9AA 4YVWC 4UFLA 4XETA 4PLNA 2JWPA 4AEKA 4CUGA 1FXZA 3GYDA 5A7SA 1UX6A 1UD1A 1QGLA 3HN1A 4CUAA 4AVCA 2OT7A 4Y20B 2YDEA 2J1TA 2RR11 3KHBA 1HX6A 1OLMA 1ZBE3 1IG0A 5AC93 4F8AA 4LORA 4CCMA 1NZCA 5IVYA 3ZXKA 2DURA 4Y5SA 3KGZA 1GR3A 4P9WA 4YM3A 1UY2A 3RDIA 3VBSA 1VBA1 1HRI2 2W9XA 3EQEA 4AFAA 1WZXA 1NQDA 1D4VB 4AWDA 4OMCA 2XLAA 3AZVA 2HWD3 2ET1A 4TN7A 4AR2A 2FCVA 1BJQA 1EPWA 2XBO1 4WZCA 1KITA 2OIIA 2P37A 4LKSA 2PELA 2P6HA 3AMNA 4KBZA 1AYN3 1BKZA 2H0VA 4QPIC 5BXXA 3ZYJB 3VZNA 1WW4A 5K7PA 2AUYA 3VDAA 1TNRA 1BXHA 1LHOA 4IEXA 2VE1A 2DBNA 3GHMA 3LFMA 1ALYA 1GZWA 4XIKA 1L7RA 2DTWA 1RUI2 3RG0A 1O4ZA 1LB2A 3ZXDA 4LR4A 1AHSA 1HB2A 2ZZJA 3U0ZA 2Y60A 2BU9A 2B46X 3BTZA 1B35C 2C0ZA 4AE2A 4GKYA 4UAPA 4Y1VA 3AYDA 1DGWA 1GOGA 2ZBJA 3OBRA 5A6ZA 2YBKA 4PI0A 5CEHA 4D0QA 4JGYA 4AL9A 3ZFFB 3RNSA 1JZ3A 1UMZA 3N35A 3IB3A 4QXKA 1DZTA 3I3BA 3PMSA 4EJRA 2ZABA 1C5HA 1I5PA 3WY6A 4FTEA 1PO12 5FPZA 1RUH3 2PHXA 4XCBA 3UETA 5JDBA 1CAVA 4XF3A 3ZMNA 3NV1A 5FMDA 3SH4A 1IQAA 4UF0A 1K5JA 4I2OA 3FFZA 3N4MA 1KDKA 3NWKA 2GZWA 5KC5A 2HWF3 4LBMA 2VCCA 4FBFA 5DXDA 1CAXB 3UYJA 3ZPYA 2CGOA 4JDMA 3ZYGA 1O59A 5ANNA 4DINB 2KM2A 1RL3A 5A1FA 4HETA 1SPPA 4CDXC 3KT7A 2VW2A 4Y33A 4CTEA 5FY1A 2GP3A 4N90A 1FMD1 1SPPB 1W2OA 3TN91 1Q8OA 4KH9A 4PQ9A 4XW3A 1UX7A 1YQ2A 5DUWA 2HYKA 3UGFA 3OB8A 2NMNA 4BPZA 4E4ZA 3IPVA 4C90A 5KXEA 2JG9C 3RQ0A 5LK7B 1DIWA 2Z4FA 5HBAA 4QPGA 4YW6A 5IT6A 3WHTA 1EYBA 5IWFA 3IPVB 3TNPB 2OYZA 2Q0AA 4QPGB 3NJYA 1Y9GA 5LBCA
chains in the Genus database with same CATH topology
5JAXA 2D6LX 1QQP3 2LM3A 1IS6A 1K5MC 2CNAA 3QOPA 4E4DX 1HXS3 4IEPA 5I93A 4K8FA 4Z82A 1EP0A 1N3PA 2LALA 1ZZBA 3LOBA 4LBOA 2CWMA 2A7AA 4AHXA 3G6JB 3R6SA 3ZXEA 1FYUA 2IZWA 2R072 5C33A 1WBFA 2A73B 3VBRB 5K0UC 4IV3A 4HVOA 3SCFA 5HCFA 1VBC1 5DZGA 5IK8A 2Z79A 3WX5A 1C8M1 2DUPA 5FREA 5JOWA 2BWCA 1SBFA 2A6WA 4LBQD 2JE9A 3WP6A 1KFUL 1VRH1 2ZTNA 3KCCA 3MW4A 4XBQA 4B7KA 1MR5A 2MEV2 5GJ6A 4CP1A 5JZGA 1BEV3 4E27A 4P14A 4CP0A 2FZ2A 1FX5A 3MIHA 4OHYA 5JZGB 1C5IA 2YC0A 4HANA 2YYOA 3KB5A 1ND3A 1Q5OA 5FOBB 1ULDA 1XRUA 1QJZA 1JN2P 1AJOA 2NQYA 1ZZ7A 1ND3B 2PHTA 3VBOB 4GIQA 4DOUA 5J36A 4XBLA 5FO7B 1XE8A 2E9QA 2H6BA 1BMV2 4XDQA 2PAMA 3VBFC 4RFT0 3MDPA 3UKVA 4D69A 3S6PA 3THTA 3UKTA 1ENXA 4YYOA 1V6NA 1QOOA 2TEPA 3IDEA 1WMDA 5C9AB 5C8CC 4XMAA 1F5FA 5BNPB 3FUOA 2R0FA 4J6GA 1AYM1 4JRLA 4M00A 3MIDA 5ACA2 1QJX3 3PVOA 4L92A 1LGBA 1NE4A 2VG9A 3FHIB 3O7OA 2WWSA 3AK0A 3MFCA 2R062 1DGRN 4AEMA 3CJIA 1PK6B 2IXLA 2SBAA 5L7OC 1C8NA 2GU9A 4AFBA 3UKNA 5JWPA 2H0BA 3CJIB 2EALA 2XKOA 3AYCA 2BW8A 1ZNPA 3ZYIB 1RVF3 4H3WA 4AEDA 2WT2A 5GKAC 2DV9A 4UW5A 2WZR2 4AEJA 1LGCA 4XF9A 3TN93 1R1ZA 5CG9A 2YV8A 3E6CC 1AZDA 3WG1A 1U5ZA 4Z92B 3QACA 4E4SA 5KXBA 3UJQA 1CPNA 1OA4A 4AHYA 2RM21 1IS5A 2OA2A 4ATEA 2IFWA 3ZXAC 3M1HA 2UY8A 2G4IA 4LBKA 1U12A 1NCQC 2VXRA 5ABJC 3AB0A 4OI2A 2PLV2 3TYJA 4AQ2A 2K0GA 4OHVA 3N7JA 3SHRA 1QJU1 1FPN2 4FXGB 1UW8A 2YROA 1PGSA 1DZRA 3K48A 4CZSA 1OQEA 1KJRA 4P5HA 4A7ZA 2XLFA 3SXWA 3NV4A 4FPOB 1ZRFA 1C8M3 2A3YA 2YGMA 1KJLA 1PZ8A 1JUIA 5KBFA 4EN8B 2ZZQA 1RINA 2VECA 1LESA 4XFCA 1FNYA 4GWMA 3VDDA 5I0SA 4OZXA 2JICA 5H9QA 4XQWA 2DU0A 4AFMA 4NWVA 2DCJA 3VDDB 1HV0A 4ATFA 3MIEA 1RUG2 2ZCWA 2CGPA 1V9U2 4FT8A 4DS0A 4Q4V1 5JI9A 1PNFA 1LEDA 5HCBA 4XJAA 1OOPC 1D4M1 3ELNA 1POV1 2PHUA 1R082 3AKRA 1S0BA 4META 2ZX0A 4LT5A 4NOTA 3DPRA 4I0AA 2VQ0A 4Q1PA 1C28A 1Y43B 2VVFA 2CTVA 2NP0A 1JXNA 1I5ZA 3D8CA 1FV3A 4R9DA 3J4UH 1KS5A 1TEIA 1T6GC 4XJ9A 3ZX7A 1CAWA 1AL22 4CDXB 3U11A 2PAEA 4OI1A 1CAWB 1ASJ1 1APNA 4PLMA 5KHGA 1M06G 1VBB1 2VW0A 4EV0A 5GZFA 2BQPA 4OULA 4GH4A 1SLTA 2W68A 4K3UA 1N3OA 2P2KA 1K5MB 3AMQA 1V6KA 3Q9OA 2D98A 5H9SA 1ND2A 2QJVA 4MV2A 5EXOA 4KGQA 1RMU1 4IV1B 1ND2B 2UWAA 3OD0A 4IESA 4B29A 4B8EA 1H30A 1YXWA 2D3RA 1F2NA 3HR9A 3TB0A 2DCYA 3HIFA 1SBDA 2NYYA 4I0BA 4I0WB 1EV12 3AX4A 2UYAA 3DGTA 3UJOA 1O5LA 1UKRA 4F83A 2RS53 2Y0OA 1AXZA 1BVP1 4FAGA 1H2LA 4ONUA 2A6YA 1WLTA 4YRDA 4KU8A 2GNBA 3PVEA 4AQSA 4PCRA 1PGW2 2RM23 1NA1A 1GICA 2X8KA 2BNMA 1PVC1 1Z7S2 5LRSA 4IEOA 4RHV2 1NA1B 3NO8A 4O9GA 3DF0A 2GMEA 4JDNA 4BMEA 2XHKA 4XOGA 1PIV3 1QJU3 4AI3A 5FDBA 1J1TA 2YY1A 3NJZA 4COUA 1CJDA 2GC3A 4Q4Y1 3HT1A 5JR7B 2VUAA 3FMGA 3CL1A 3LB9A 4LO4B 3DUIA 4N7IA 1BYHA 4YZ4A 5DDJ1 1A8DA 1D2SA 1YFUA 5C8CB 2VH9A 1ULFA 3CLPA 4AI8A 1AR61 1NQJA 4QGMA 3JD73 1AX0A 5GLTA 1OFNA 1PNGA 3QH6A 2CAVA 3LZZA 1FAYA 1VBD3 2WQZC 5J37A 1UPIA 2AH2A 1V00A 1JOJA 3D0SA 1G7YA 4WM7B 3GF6A 5C8WA 2VMHA 4P9XA 2CL2A 3HMYA 1OKQA 1CD3G 4R4XA 1EAH2 1VBE2 1EPZA 1LOBA 2WIIB 1WD4A 3OJBA 1FOD3 2D6KA 1YWKA 1EY2A 3MIBA 1N3QA 3D82A 3EBRA 3RYKA 3VBUB 5I8TA 4OUSA 3MIGA 2YUEA 4L2NA 1R091 1DGWX 4TLFA 1VBB3 2W08A 1DQ2A 5KHIA 3ZIXA 4AF9A 2TBVA 2BGCA 4XQDA 2P3IA 4Q27A 1LHUA 2FQPA 3ETQA 4LUMA 3B7MA 1QY4A 5J98B 2ZGNA 2D5FA 1MS9A 2DVDA 4Z1VA 1X36A 2B39A 1HRI1 3ZSEA 1MEC2 3SITA 5ABJB 3WQ0A 5F5QA 4LNVA 3I8TA 5EJ3A 4X6QB 1RMU3 2JE7A 3D5OA 2F4PA 4ITCA 2D7FA 4FCAA 4XTMA 4RR3A 4OFGA 3ST7A 2AYHA 3ASIA 2XVKA 3WDTA 1DQ1A 4S2FA 4D7YA 4B4QA 4MGIE 1BZWA 1ZBA2 3EO6A 3VN4A 1LENA 4AFCA 1D0GA 1YNAA 2ET7A 4YW2A 3FE5A 1RUI1 1MACA 1RUF2 5E8AA 1KQRA 1XYNA 4NN0A 4HMZA 3I59A 1W6NB 3C2UA 3J8F2 3RPQA 4W6XA 3IT8A 1BBT3 2NLRA 5CU1A 4N53A 1VALA 1ZZCA 2EVXA 3I59B 4MH0E 1CAUB 3JB8A 2K2SA 4QPGC 3UK9A 2VOWA 3ZXFA 2Z42A 4HVRA 4N53B 1XNCA 4E2SA 3JU9A 1S0DA 2VQAA 1PO11 1O7FA 1S55A 2DWRA 3PVBB 1W2UA 3ZN6B 1RB8G 2HWE2 4P9LA 2ZJCA 3KMHA 5DZFA 1JBCA 1CIWA 4I3PA 1NE6A 5CBLA 1H2MA 2P17A 3VBRC 4DFSA 4DNYA 4Q4Y3 3AJZA 4AHWA 2QCSB 5DDJ3 1FV2A 2WLPA 2Q8OA 1W6QB 3ILFA 3BOWA 1COV3 1XNBA 2PHRA 1AR63 1F5JA 1QNYA 5JOYA 3RI9A 3G7DA 1LODA 3B93A 3VZKA 4XJZA 1DHKB 3MLJA 1KFXL 3VBHB 3ZXJA 1H2NA 5JZGC 4B4PA 1ZRCA 4YW5A 3ZXGA 1SMVA 2Q4SA 2XJSA 3BB6A 4RGAA 3RS6A 3LA7A 5CA6A 4BIFA 1ONAA 4JGZA 1ND3C 4K1ZA 3VBOC 5FRAA 3ATGA 1N1VA 4FVVA 2P3KA 5HXVA 1Q8SA 3ZSLA 4JGZB 4R8HA 1QH7A 1G9CA 3ZO0B 5IK4A 4M0NA 2WS91 3USUA 3AMPA 4FPEA 3OTFA 1IS3A 4HFSA 5SV5A 1R1A3 1CX4A 3GBWA 5FMOS 4EWEA 4HK8A 4X8NA 1R093 5BNPC 4INDA 1RHI1 4S2DA 2GC1A 1AR82 4AI0A 1ZA4A 1WLDA 4YZ1A 2DVAA 2VMIA 2MEV1 4N9IA 3R4DB 1ZVFA 5T55A 4YVSA 3AMMA 4I02A 1HKDA 2JD4A 1HRI3 4O9EA 1MQTB 2WNVA 1IS4A 4Q4X3 3X29B 3FBYA 2BNNA 4PIXA 1WCKA 3N3HA 1H8TB 5BNNA 1PK6C 2RS32 2WNVB 3IDBB 1W0PA 3H1MA 1FI2A 2VVDA 4MXWB 2ILMA 2AZ5A 2XVLA 3RI8A 4TSVA 1PM7A 3CJIC 2QDNA 4RGGA 4RQPA 1UAIA 2DFBA 4I3GA 4IXLA 1RUC3 4Q4W2 2X5IB 1CR7A 2DUOA 4K20A 4SBVA 1S0CA 4RQPB 1IPKA 2WFF2 4L8QA 1Q43A 4U36A 4Y26A 3FLPA 2EF6A 2GALA 5D1IA 2IXJA 4FQZA 4D94A 3LA2A 3H0OA 2HEVF 1H8VA 1FT9A 5T5LA 3PJQA 4M3CA 1UU6A 1Q8PA 2EXHA 1UZZA 1VJ2A 3VBSB 2YGLA 1UCXA 4AG4A 1SLAA 5ACA1 1S0IA 2ZKLA 4P9YA 1QJY2 3D4KA 4MVTA 4A2UA 1IPJA 1YRZA 1PO13 1O5UA 2R061 1LULA 1WCDJ 2JG8A 1PO22 3FLTA 4AHZA 2ZGKA 4C1XA 3NL1A 3V0BA 5JSPA 1GZWB 1WGPA 5FO9B 2EAKA 5FLHA 4LO6B 1IKQA 3V0BB 4LBNA 2XKPA 3WT3A 1CESA 4GMP0 4CRQA 2D40A 1RUE2 2RE9A 4XILA 2DTYA 1QWRA 4AVSA 5T5JA 2WZR1 1Y9QA 4XFAA 3WXPA 2KA3A 3AZWA 3AXDA 2XH6A 3B9CA 4JGYB 4QM9A 1OMIA 1ZBE2 3VDDC 4K9SA 2G9GA 4I30A 5AC92 4COYA 2KXLA 1J1LA 1RJ7A 4EROA 1ULGA 1TME3 2PFWA 1CAVB 3MZHA 3I2DA 3FLRA 3GBGA 3A0NA 2IXKA 2HKXA 2Z69A 4WVVA 5J96B 4BHPA 4Y4YA 2NN8A 1FPN1 1NOVA 4QD2A 1AYN2 2WS93 3AFKA 5JPMB 4WZFA 2R32A 5I0RA 1AJKA 4YG6A 1HDKA 3IWZA 4DMIA 1UKGA 4QHBA 1RHI3 1JYIA 1XYOA 5LK5A 1ZREA 4OHZA 2MEV3 3JB4C 1N1SA 3U4XA 5JOXA 4ZKTB 1YYNA 2O8OA 3HAGA 3H3UA 1RUG1 1VB4A 1RTVA 1UN1A 2UWBA 4IV1C 4X8PA 1ND2C 3AMHA 3VZOA 4OUMA 3U07A 3FC0A 5A3LA 2GNMA 2JENA 3WVJA 3ROUA 1VP6A 3WUCA 3WUDA 2QZ2A 4IV3B 4QGNA 3VV1A 1I6XA 3M4FA 2RMU1 1AL21 2RR13 1X50A 3MLLA 4HK9A 2WSUA 2IFRA 3LWCA 2XJTA 3I54A 2K9ZA 1ENQA 4ES9A 1C1LA 1VBA3 4IL7A 4EN0A 3INAA 2DUQA 2E51A 4HN0A 4TZDA 3ZIWA 3N7LA 3CNAA 2BFUS 4G9SB 4MGZE 5BNQA 5A33A 5BNOA 2XBO3 2O1QA 3BALA 3DN7A 4U2AA 1DF0A 4YGCA 4I01A 5A33B 1RC6A 2R30A 1NA1C 2DVFA 4GULA 3VGIA 2WJSA 3AP5A 3B02A 3ALQA 3H1YA 5FCCA 2R063 1MZ6A 1BK1A 1QQP2 4KGGA 4HKWA 4YFZA 3O0XA 3ZFGA 4OVEA 3NAPA 1HXS2 1RUNA 2ZGLA 4CDQA 4JTOA 4LA2A 5SV8A 1H9PA 1HRV2 1DGRA 3WDWA 4KG8A 2VU9A 1GYKA 3ZFGB 1N47A 3KQRA 4LBJA 1NLSA 1EV11 3CU7A 4CDQB 1O3TA 1Z78A 4FPLA 1WW5A 2MHFA 1Q8VA 1MZ5A 4IEVA 3L2HA 1JUHA 1GFF2 3P3NA 1H1MA 2D6NA 3SMHA 4ES8A 2A70A 3KD4A 5L73A 1WD3A 2AENA 4SLIA 1PGW1 1L3JA 1BEV2 3FZ3A 1SDWA 3WZ1A 1O4YA 2B9UA 2IXCA 3MPPG 4WM7C 3LAGA 5CNAA 3WDUA 4RHV1 3WG4A 1NLRA 5JPNB 3WG2A 4AQTA 4JC1A 1HLCA 2YMZA 4HKLA 2FZ1A 1MVQA 2JDZA 3H50A 2GH8A 4Q26A 4QMAA 3BOPA 3MICA 4AGRA 2A71A 5E88A 1FMD3 5H9RA 4AEDB 5KWRA 3JQWA 3VBUC 2WQ4A 3PHMA 4YVWA 2Z2SB 4UW3A 2XGXA 4YM1A 3POSA 1LHNA 3AXEA 1KXGA 4COVA 5E1RA 3GALA 2FMDA 5D8AA 2Q1ZB 3QBQA 2OZJA 5D8AB 1XU2A 4A7KA 4CDWA 3NKTA 1C57A 1MS3A 1RUG3 4C0BA 4EWDA 1QJX2 4CDWB 2NPIA 2AREA 3POYA 4M3CE 5FTTC 2D43A 4DQAA 2VNRA 4QQLA 1VBC3 1YFYA 4K40A 4QPIA 4BA6A 1X8EA 1EAH1 2RMU3 3KSCA 1VRH3 4Y5Z0 3U10A 2EAAA 1RVF2 2OUHA 3SH3A 3JBG2 1LTEA 4BWOA 1VAVA 4KNCA 3VZMA 1J3PA 1DQ6A 4FTSA 2EXKA 1SACA 4GWNA 4IEWA 3VL8A 4E2QA 3S7EA 4FOWA 4N53C 4ZU4A 3WD5A 2NZ9A 3ZN5A 1GKBA 1G6NA 4YG3A 4EN6B 1QH6A 1MEC1 3H9AA 3RMXA 1REEA 1UIKA 4HSLA 4D7SA 3E5QA 1DQ4A 3DPRB 3QD6A 2XLGA 4HN1A 4OI4A 4XIOA 3IIAA 1KS4A 3ZMOA 2A6XA 2ARBA 2ZPXA 4CEWA 1UIJA 4JCKA 1EV13 5GZCA 4N43A 5CADA 4CEWB 1UPSA 1U5XA 3TOJA 1AR71 2QE3A 3N36A 1AYM3 1XE7A 1BQPA 4LO8A 5F6KA 1RUF1 3MW3A 4N43B 4E9KA 2GSYA 5FO8B 1TMF1 2CWSA 4KG0A 1HQWA 1SLLA 1KD7A 2WZPP 2IWGB 1V6IA 1BVVA 1JTZX 3J8F1 4FPHA 4IQPA 3VBHC 4B4RA 1DQ5A 4GH4B 5I8YA 5J3UA 3M7AA 3VZJA 5C6CA 2ERFA 3R05A 2A75A 1DG6A 3S7IA 1RUJ2 1ZX5A 1LOGA 1H2KA 4RS5A 1W6PA 5JIAA 3LGRA 2PYTA 1SLBA 3PNAA 2QUOA 2CV6A 4RS5B 4XFIA 1AR92 2CYFA 1DQ0A 1QOTA 2QZ3A 3RMYA 4BLIA 2HWE1 1IKPA 4COZA 4JGZC 4CYDA 4Z07A 1A6CA 5K9YA 3BTAA 1OQDA 4LE3A 5JSOA 5JIUA 3ZFEA 3ENRA 2VMGA 3KCYA 1Q8QA 4J1XA 5K0UA 1J58A 4Q0QA 4AVBA 4CP2A 5AFBA 1Q3EA 1S2BA 2ZMLA 4YSFA 2ZS6B 5LEJA 4DZGA 4GA9A 2ZGPA 5KXCA 2XUMA 2CY6A 1WUVA 3HBZA 5H9PA 1MQTC 1ENSA 1Z0HA 3VHRA 1CONA 2DCKA 4YVSC 3RYRA 2XJVA 5T5PA 1I1EA 3FJSA 1H4HA 4MSVA 1H8TC 2WNVC 4QM8A 1CJPA 5CAZA 2ZGMA 1REDA 5BNNC 5JOZA 3QH7A 4BE3A 2X5IC 4KU7A 1HV1A 2XL7A 1DBNA 1VIWB 4RQPC 3VL9A 3JUUA 2VPVA 2MNGA 1A8MA 2N7GA 4XYXA 5GZEA 3VBFA 1RUOA 3DV8A 1QF3A 4FXKB 4HPKA 5JLVA 2R49A 3ILNA 4XZPA 3WR0A 4B3NA 3LSEA 2QFEA 3VBSC 1AR81 2RS52 4HPKB 4Q4V3 1X82A 4L97A 1D4M3 1POV3 2A6VA 3S0MA 1LU2A 4NHMA 3AP6A 2RS11 4NWWA 5JMCA 1MEC3 3MYXA 4Y1UA 4R4ZA 2XJQA 2R0HA 4PJYA 5FAXA 3IMNA 2R042 3JZVA 1PHMA 2RS31 1OFSA 3WQ7A 1DZQA 3M70A 2JG8C 4LEJA 4LLFA 1JW6A 1AF9A 1XU1A 2JJ6A 4Q1RA 2WKKA 4UW6A 1ASJ3 1PIV2 1M4WA 1QJU2 3KS7A 3RYPA 3WCSA 1S0EA 4XJ8A 4AQ6A 2ZX4A 1AR73 3VKMA 3C3VA 3H8UA 1UZYA 4AVAA 2GN3A 1TMF3 4R9AA 2C1FA 4KL1A 5I0UA 1DDLA 1LOFA 4M0HA 4JGYC 5FQ0A 3IBMA 3WQ1A 2RJLA 3O0VA 3OY8A 3JD72 3P3PA 1O3QA 1NY72 4YLZA 2YZ4A 5KC6A 5C4WA 1QJY1 1VBD2 3L9JT 1HQLA 3AKQA 1JYCA 1NCRA 2EXJA 4H7MA 2UWCA 4RR3B 4HT1T 2HWE3 3GZUC 1PO21 3M2MA 1NCRB 2OUJA 1ULCA 4XTPA 3B9IA 4WM8A 4JVAA 4CDUA 5F1RA 3AKTA 3OBTA 4LHNA 1FOD2 1RUE1 4AK3A 1D2QA 4LTAA 1GSLA 2Y0IA 2XJRA 2XWBB 1TE1B 1V6LA 1PVC3 4QGLA 1VBB2 5A3MA 4Y22A 4GQ7A 3FBMA 5FMOL 1ZBE1 5KHHA 3SISA 2HWC2 2XVGA 1NYWA 2CAUA 1QNWA 3OD4A 4Y22B 4BZ4A 2GMMA 5BV6A 3D6EA 5I91A 1OOPA 5CVRA 4NHKA 2E7TA 3H3ZA 4GB32 2EA7A 1UU5A 2TNFA 1PZ9A 4URTA 2ZMNA 4A3XA 4IV3C 2XWJB 1U5YA 5EFUA 3T1LA 1AYN1 4YW1A 3R0RA 4P9GA 4LHLA 4KWJA 2HWB2 3GBFA 2NM1A 4FPFA 4YM0A 1VB2A 2VULA 1X7NA 3NKGA 1J3RA 4JQRA 1YUDA 1LHWA 3WP4A 4PLOA 2GH2A 4FPYA 1AR83 3CF6E 4QQHA 4C0HA 1S0GA 4M3CF 1AUYA 2GC2A 1BBT2 1MS0A 3B01A 2RS13 4PF5A 4OHWA 2PAKA 1D0HA 2BVVA 1HIXA 2X53S 4Q0VA 5CFDA 2NMOA 1ZZ6A 1RJ8A 4PDWA 1J3QA 4ISRA 3V0AA 1G9DA 3ME2A 2I74A 2R071 4XJWA 4QQ2A 4W6YA 5CFDB 1UL9A 5T54A 3VZLA 4PDWB 3ZFGC 4CDQC 3USUB 1H9WA 1W6MA 1XYPA 2PHWA 5DG1A 2ZA9A 4NHLA 3VLBB 5E16A 4D7TA 1W6MB 2ZGRA 5LEKA 4QPYA 2QQPA 1YLLA 3O0WA 1PZ7A 1LHVA 4PBOA 2WSVA 3B94A 1QDOA 1S0FA 4NR1A 4IEZA 2I2SA 4FPJA 1COV2 4YVSB 4K21A 1QU0A 1AR62 3VHNA 1XNKA 4YFWA 2PN5A 1RITA 1O91A 1OPMA 1WW6A 3HT2A 4COWA