2RS12

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
molecule tags Virus
source organism Human rhinovirus sp.
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1200
1BBT2 2DF7A 1BBT1 4RFT0 5LK7B 1R1A2 1PGL1 4Q4W2 1R1A1 4Q4W1 5C4WC 1PO23 1ND3B 2XBO1 4YVWB 2BPA2 1GFF2 2HWD2 2HWD1 2RMU3 2R041 3CJIC 1HRI2 4NWWA 1HRI1 1NCRA 1AL23 1RHI2 4N43C 3VDDA 3VBSC 4QPGC 3JBG2 3JBG1 1R092 1R091 1RUC1 1EAH3 1DDLA 2HWB3 2R072 1MQTA 1PGW2 4CDUC 1PGW1 1VB2A 5D8AB 5AC92 5AC91 1NCQB 1OOPB 1V9U3 3J8F3 2R063 1WCDJ 5BNPB 2X5IA 1ND2A 2BFUS 2Y26A 1RUH2 1PVC3 2GH8A 1D4M3 1SMVA 5C4WB 3CJIB 1K5MA 5ABJA 5DDJ3 1AR92 1PO13 1QJY2 1QJY1 5C8CA 3VBSB 2RR11 4QPGB 1X36A 1C8M1 5C9AC 1RUI2 1RUI1 1H8TA 4IV3A 4CDUB 1AR83 2WFF1 2WS93 1QJX2 1RUF2 1RUF1 4Z92B 4FTSA 1AR63 1AYM3 2RS52 1FOD2 2IZWA 4GB32 1MEC2 4GB31 1MEC1 1W39A 2WZR3 2BUKA 1HRV3 1R082 3VBOA 1R081 4Q4Y1 4WM8A 5CFDA 5L7OA 1RUD3 2RS32 2TBVA 2RS31 2RM23 4CDWC 1FMD1 1COV2 4AEDC 2MEV3 1NY72 3IDEA 1NY71 1ZBA3 4WM7C 1F8VA 2HWE2 2HWE1 5C9AB 2RS13 1F2NA 2HWC3 1HXS2 1HXS1 1EV13 1BMV1 1BBT3 1ND2C 4JGYC 1R1A3 4N53A 4Q4W3 4YVSA 1VBB2 4Y4YA 1VBA2 1VBA1 2HWD3 4FTEA 1RUE2 1RUE1 1HRI3 1VBE2 4CEYA 1VBE1 5FMOL 1B35C 1RHI3 1K5MC 4BCUA 1NCRB 1RUJ2 4CDWB 4QPIC 3ZFFA 4AEDB 3JBG3 3TN92 1R093 3TN91 4GMP1 1A6CA 2QQPA 4WM7B 3ZFGA 2R073 3ZFEA 5AC93 1PGL2 5A33A 3VBUC 2XBO2 1Z7S2 1VBC2 1Z7S1 4RHV1 1VBC1 2R042 1RUH3 2X5IB 1ND2B 4JGYB 4FTBA 1RUC2 4WM8C 1POV3 5CFDC 1B35B 1CD3G 4RS5C 1K5MB 1AR93 1QJY3 4QPIB 4Q4V2 4Q4V1 1AYN2 1FPN1 4CDXA 1AYN1 5C8CB 5JZGA 2HWF1 1E57A 4PDWA 1VAKA 4CDQC 4IV3B 1QJX3 1RUF3 5A32B 2VQ0A 4LLFA 3VBUB 5BNNA 2RS53 1FOD3 4GB33 1MEC3 4N53C 1ZBE2 1RMU2 1R083 1ZBE1 1RMU1 1ND3A 4YVWA 3VBHA 1AL0G 2RR12 3M8LA 2RS33 4WM8B 4CEYC 5CFDB 2RMU1 1C8M2 4RS5B 1AL21 1COV3 5CFCA 2WFF2 4Y5Z0 4JGZC 2HWE3 1IHMA 3ZFGC 4SBVA 2HWB1 5D8AA 3ZFEC 1HXS3 1NCQA 1OOPA 4CDQB 1NG0A 1NA1A 5BNPA 4Q4Y2 3ZXAC 1PIV2 1PIV1 1M06G 3VBRA 1RVF2 1RVF1 3LOBA 1VBB3 1NCRC 1OHFA 4CEWA 1VBA3 1FMD2 4N53B 2XPJA 5C4WA 3JD72 1D4M1 5ACA2 3FBMA 3JD71 5ACA1 1RUE3 1VBE3 3VDDC 2ZAHA 3CJIA 4GH4A 4CEYB 1RUG2 1RUG1 1RUJ3 3VBFA 5DDJ1 4N43A 1MQTC 3VBSA 3NAPA 4QPGA 4GMP3 4JGZB 1BMV2 5JZGC 3ZFGB 2X5IC 4CDUA 3ZFEB 5K0UA 2XBO3 1Z7S3 1VBC3 1AR81 2PLV2 2PLV1 2R043 5BNNC 5ABJC 1AR61 2WZR1 1HRV1 2ZZQA 3DPRA 3JB8A 3VBHC 5C8CC 1RUC3 3VDDB 1ASJ2 1ASJ1 5BNOA 4RQPA 1TMF2 4Q4V3 1TMF1 1H8TC 4IV3C 1AYN3 1MQTB 1AR72 1AR71 4IV1A 4RHV2 1OPOA 5C9AA 1ZBA1 5JZGB 1BEV2 1BEV1 1X33A 5FMOS 1QQP2 1TME2 1QQP1 1TME1 3VBOC 1EV11 5BNNB 1VBD2 5L7OC 1POV0 1VBD1 3VBRC 5ABJB 1ZBE3 1RMU3 2WWSA 4CEWC 2RR13 5J96B 2BFUL 1FPN2 2BBVA 3VBHB 1C8M3 4GH4C 4RR3A 1QJU2 2WLPA 2HWF2 1QJU1 1RUI3 4CDWA 1RHI1 3VBFC 4AEDA 2WFF3 1HQNA 1H8TB 5CFCB 4FSJA 3NAPC 4WM7A 3S6PA 4Q4X2 4Q4X1 1VRH2 2R071 1VRH1 5FOJB 4Q4Y3 4YVSC 5K0UC 2GSYA 1NA1B 1PIV3 3VBOB 5J98B 1PO22 1PO21 1RVF3 4JGYA 2RMU2 1RUH1 5L7OB 1FMD3 3VBRB 3JD73 1AL22 5ACA3 1VB4A 4CEWB 3ZFFC 1NOVA 3DPRC 1RUG3 1B35A 1AUYA 4GH4B 1EAH2 1POV1 1EAH1 2FZ1A 2HWB2 5BNOC 4QPIA 4RQPC 3VBFB 1AR91 4N43B 1HX6A 3NAPB 2FZ2A 4IV1C 1V9U2 3J8F2 1V9U1 3J8F1 2R062 2R061 3HAGA 5A32A 1PVC2 1PVC1 2PLV3 1D4M2 3VBUA 4YVSB 1QJX1 5K0UB 1CJDA 1RB8G 2RS51 1FOD1 5DDJ2 2ZTNA 3TN93 1PO12 1PO11 4NWVA 3ZFFB 1ASJ3 3DPRB 4GMP0 4CDXC 4RS5A 4RR3C 1TMF3 5BNOB 4PDWC 4RQPB 1AR73 1COV1 3JB4C 1AR82 4RHV3 5A33B 2WS92 2WS91 4IV1B 1BEV3 4CDQA 1AYM2 1AR62 1AYM1 1QQP3 1TME3 2WZR2 1HRV2 1ND3C 4YVWC 1VBD3 1QJZA 1RUD2 1RUD1 2RM22 2RM21 1VBB1 1FPN3 5CFCC 1C8NA 2MEV2 5GKAC 1QJU3 2HWF3 2MEV1 4CDXB 1ZBA2 4RR3B 1RUJ1 2RS12 4PDWB 2RS11 5D8AC 4JGZA 1NCQC 1OOPC 2HWC2 2HWC1 4EJRA 1NA1C 1EV12 5BNPC 4Q4X3 1VRH3
chains in the Genus database with same CATH superfamily
1BXHA 4I01A 1XNBA 4WVWA 3T3YA 4Q1RA 3MLLA 2XL7A 2JB4A 4OYUA 5F5QA 4YG3A 1FT9A 1MS9A 2I74A 1AXYA 4Q0QA 5JMCA 2HWD2 2HWD1 3NV4A 4P5YA 5FMBA 4ZZ8A 3CJIC 1MS4A 3ZM8A 4DY3A 1ZA4A 3UKNA 4WBBA 5FTTC 4Y5TA 4OI0A 4FPEA 4K3UA 4A44A 4UF0B 1UZ0A 3OYWA 2UWBA 2P3JA 1JZ3A 4QPGC 3ZXJA 4CP0A 5K9YA 5HBAA 1PX3A 2JDAA 1Q56A 1RUC1 4LXLA 2DBNA 4EROA 1G9BA 3WDTA 2WABA 4JZRA 2HWB3 5F3CA 3KV4A 2NMNA 2Y0IA 3E5XA 5DPNA 2XWJB 2R072 5IUQA 5A7SA 3VD7A 1MQTA 2ZHKA 1D7PM 1WMDA 3VUOA 4KWUA 4AEKA 5F5CA 4QHBA 3H7JA 1UW8A 1V9U3 5ERLA 5A3WA 1YYNA 3IMNA 4YW5A 5BNPB 5GLTA 1LTEA 1ND2A 3ZYFA 1GBGA 1UWWA 1PVC3 4AF9A 2EF6A 5IK8A 3OTFA 3DUIA 3T1LA 2VM9A 3WHUA 3O5SA 5C4WB 3KQ4B 1GMMA 2VXJA 1UU6A 4HN1A 1UY3A 5FP3A 1KRIA 2WNOA 2GC0A 5GLWA 1K5MA 3GBWA 2XJUA 1U5IA 1PX4A 2WA3A 1QJEA 1S55A 1M4WA 5A3PA 1MS3A 3KZ4C 4INDA 3VBSB 2RR11 3GJAA 1TNFA 4B7EA 2JKBA 2HBUA 2WNVB 1GQGA 1C4RA 1X36A 2W52A 3U0ZA 4IEVA 3O1RA 1C1LA 5FPBA 4XCAA 3B69A 1AR83 2MNGA 2WS93 5KBFA 1EPWA 5LEJA 1WZXA 2QVSB 2VJXA 4EN0A 2A3XA 4DQAA 2D44A 1W8TA 5KC5A 5A7OA 1J83A 2PXJA 3HT1A 3LB9A 1AYM3 4LBNA 5IHRA 1BVVA 1JU3A 5FMDA 1MEC2 1MEC1 2ZA9A 2G9ZA 4MX3A 2PA7A 4QDQA 5GLZA 1LNSA 5I91A 2BYVE 5FO8B 4ASMB 5I8TA 5L7OA 4WVMB 3BVCA 2TBVA 1OQEA 4AVCA 3CO2A 1W3VA 3KD4A 4IEZA 3LEGA 2E7TA 2CSGA 2FDKA 1F4AA 3VGIA 2FMDA 3C2UA 4W6YA 1APNA 1UZYA 5FY5A 3I2DA 4QX8A 1SDDB 5C9AB 5C5UA 2A73B 1IKPA 2WWJA 1SLCA 4NHLA 5AFBA 5T5JA 2XVGA 3QACA 4B4RA 1ALYA 4ZS2A 1VE0A 1EV13 1PZ8A 4ZU7A 5KXEA 3A0NA 3PTYA 3ILRA 1MVEA 3WNLA 5K4LA 2E51A 1MACA 3SKJE 5KHKA 4JGYC 3H9AA 2IFWA 4O65A 3SKVA 1DQ6A 2B46X 2EAKA 2VL4A 3CL1A 4ORFA 4JRAA 4QKFA 2BNNA 3VKFC 4KGQA 4DXTA 2HWD3 5J09A 4FTEA 1WUVA 1CAUA 2E26A 1RUE2 1RUE1 2PHXA 3ZX7A 1B35C 2DVFA 3RI8A 5DG2A 3AZXA 2GP5A 2VUJA 4JC1A 4Y1XA 3WHTA 4BCUA 4FPJA 4FI9A 4QPIC 4AG4A 2XJTA 5JMOA 1DBNA 4KQ7A 5GLUA 5EWSA 1BYHA 2FDHA 2QQKA 4GMP1 4NPMA 4PT6A 2QQPA 2OQ7A 1W8NA 4OQ9A 1RJ8A 4BJ0A 2R073 4LHLA 1OMIA 4XAAA 1URXA 3AFKA 3DN7A 4CCMA 3MW3A 4DUVA 3RFRA 2YC4A 2JENA 2GDFA 4L92A 4RD7A 3UYJA 1PGL2 3HR9A 4IUGA 3RS6A 4QKDA 4LHNA 2AREA 5D1IA 4RHV1 1CX4A 3NV1A 4CCCA 2GC3A 3CZUA 2JG8A 3INAA 5JR2A 1IPJA 5A7PA 5C3OA 4OQ8A 2Y6HA 3SQOA 4C1XA 4XFFA 2EVXA 2ADEA 2WAAA 3URFA 2O8OA 4QHZA 4FAGA 3DCQA 5LW9A 2D5HA 2PAKA 5LZ6A 2LW8A 3CU7A 3FN9A 3N3HA 3I2IA 3ZR6A 5FP7A 3C7HA 2QDRA 4WM8C 3ZXEA 5CFDC 1AZDA 2VAUA 4LKFA 1W6NA 4NIHA 4AFMA 2BWAA 1XSRA 3J26N 1YCIA 3MLKA 2XHNA 3AYEA 5FZOA 2R7EB 4LO8A 2PN5A 3BB6A 4ET7A 5C8CB 1Q8VA 1WWYA 2DUPA 3POGA 5I0TA 4MGIE 5JZGA 4CVUA 3MIFA 1AVBA 1ENSA 5FWEA 4PDWA 5FUNA 3WNPA 2ZGMA 1BQPA 1VAKA 4IETA 3AMNA 4CDQC 4IV3B 3BODA 4UFMA 5FQ0B 1IS4A 4LLFA 4N7IA 3WF0A 1AF9A 3Q8EA 1OKQA 2EXJA 3LSDA 5BNNA 1MS5A 4I3GA 3K2OA 4YW3A 1MEC3 3I59B 2RDQA 2R32A 2RHPA 5KR7A 1ZBE2 1RMU2 4QHOA 1ZBE1 1RMU1 5JOZA 4NIAA 4M4RA 4Q0PA 4YVWA 4OZOA 5JSPA 1OD5A 4LE3A 5LB6A 4Y3OA 4EYUA 4ZZ5A 3G7DA 3CIHA 1LOEA 1H1AA 3WG3A 1DGWA 4AI2A 2ZXQA 1U5YA 5FO9B 1UKGA 3TEWA 1UY0A 4Y4RA 2JG9C 4DIQA 2WNUC 2BGPA 1AL21 5CFCA 1W2AX 2WFF2 2ZX1A 2J22A 4Y5Z0 3RWNA 4A2UA 5JAXA 3IDCB 3THDA 3VL8A 5FYYA 1Q8PA 2R49A 2W5FA 4JQRA 1GLHA 2ZCWA 1IHMA 2J1AA 3ZFGC 3ZO0B 4AAXA 3U4XA 1OPMA 2YXSA 5FWJA 3ZDSA 5FPXA 3E6CC 4BXFA 1QGLA 3VD5A 1OOPA 1VAVA 3U07A 2ZX3A 1BK1A 1T6GC 3H3LA 4KL1A 4L9BA 4M01A 5EYYA 2WKKA 3KS7A 5F39A 4CP9B 1I5PA 1OQDA 3NKGA 4QQLA 3ZIXA 2VUDA 2Y8KA 3AM2A 4AZZA 1JUHA 5J36A 1R64A 2WO1A 3BPSA 3VBRA 5FPUA 1CZVA 2VGDA 3ME2A 4YM0A 1DIWA 4CEWA 4COWA 1UMIA 5FZ3A 5FY0A 2V72A 2ZEYA 1D4M1 3CQOA 5LEKA 1RUE3 2CAVA 4P9XA 2DVBA 3VDDC 4A6OA 5CBLA 4IGPA 3TNQA 5F5AA 4LBJA 2EICA 2BVBA 2W1WA 1N1YA 4HPKB 2YU1A 3BIWE 3ILNA 4QU2A 5DDJ1 1Q8QA 4N43A 1EUTA 1Q8SA 4N90A 1GOFA 4YZ2A 4GMP3 4JGZB 3KCCA 3PUIA 1ULPA 5IVCA 2V4AA 3MIEA 4YW7A 3CNAA 4JVAA 3V0BA 3WLUA 4IEOA 5FZCA 2WO2A 4CDUA 4K9SA 5KC6A 2VECA 3U11A 5A7WA 2XLFA 1ZRDA 5K0UA 2WZEA 3ZSLA 3ACLA 5J7MA 4KWKA 2CTVA 2XG3A 3IPVA 2X8KA 3FBYA 3RVHA 2DDUA 4EE2A 1AR61 4UW4A 3RDIA 1UZVA 4ZXKA 1D0GA 2Q0AA 2QQVA 2WZR1 3OYWB 5L36A 1J58A 2X53S 3DPRA 3JB8A 5CNAA 1LU1A 4XJUA 2ARBA 2GNBA 1ASJ2 2O0OA 1ASJ1 3MPBA 2ZX2A 4DXZA 2VZUA 1OD3A 5FMCA 4HVQA 5FKBA 4RQPA 4XUQA 1TMF2 1TMF1 3LZZA 1H8TC 1MQTB 3OGRA 3GNEA 4M00A 5LRSA 3M70A 5FXVA 4IV1A 4MADA 3O1MA 5FK8A 5LY1A 4FPKA 1ZYBA 4YZ5A 4PLNA 3M2MA 1C3HA 5HCFA 1ZBA1 4AVAA 3V64A 1F15A 3MLJA 4AVTA 1ULEA 5C3SA 1Q3EA 1OF3A 1X33A 4UBHA 2L9LA 3LGRA 4J25A 5IW0A 1GOHA 2GU9A 4BIOA 1OLQA 1EPZA 1XC6A 3H7YA 4NHMA 3PU8A 5A7NA 3UK9A 1S4CA 2IUWA 1VBD2 4YWAA 1VBD1 1UOJA 1WD3A 4GIQA 1YI7A 1RMU3 1ZBE3 2WWSA 4A3ZA 1KDKA 2DFBA 3ZYIB 3TB0A 1O91A 2XLAA 2FDIA 2Y34A 2R1DA 3H42B 1FPN2 4P9YA 2GALA 3VBHB 4QPWA 3I49A 3H3UA 3M3QA 1XNTA 2WLQA 2C26A 1QJU2 1TE1B 2HWF2 1QJU1 4GH4C 4RR3A 1RUI3 3KVAA 2W68A 2XL9A 5EJ3A 5FBJA 5FY4A 5JPNB 4LPLA 3B9CA 3VBFC 2WFF3 3S30A 5FXXA 2A6YA 4N7UA 3OBAA 4TLGA 2GC2A 2DCZA 1C1FA 1NZIA 1UQXA 5CAZA 1Y7BA 1ULGA 4BPZA 2DVGA 4HVRA 4FPGA 2H0BA 4Q4X2 4Q4X1 3UETA 1VRH2 5IVJA 1VRH1 3LWCA 2PMWB 4PBOA 4F83A 1H0BA 4R9DA 4C0BA 3LA2A 3A21A 2GSYA 2BRTA 2DBIA 2MPFA 4XFAA 5L9VA 2UYBA 2W95A 3U10A 3K4DA 5BNQA 2WT0A 3ZYHA 4CYDA 1DZRA 1RUH1 2NM1A 2ZHNA 3GYDA 5L7OB 1QOTA 1CIWA 4UF0A 4V1PA 5FDBA 4I2OA 1HN1A 2R1BA 4WZCA 1UYXA 3ZFFC 1IS6A 2VNOA 2VOTA 2XVLA 1I1EA 2VNGA 5LRRA 4BK4A 2GNTA 2IXJA 1EAH2 3A4UA 1YLLA 1EAH1 1VJ2A 1YO8A 3B93A 2IXIA 2OT7A 4XOGA 5A6YA 5L9RA 5BNOC 5I0RA 3QLQA 4MVTA 2IXLA 4CUBA 3WF4A 3IZOA 3TNPB 5JWPA 3AXDA 2ARCA 1DYPA 2GC1A 3I3QA 5FZGA 2Z4FA 1PK6A 3E1F1 5LCWL 3O1VA 5L19A 2VZRA 2BNMA 4AI0A 5C70A 1W0PA 3MIGA 4LEJA 4ZS3A 3HJRA 4QXKA 1GQPA 3POIA 3Q8CA 3WP6A 4A41A 5FKCA 5F32A 3DXTA 2VBDA 1CAUB 3WDVA 4AGRA 4LKDA 4HSLA 3KHBA 1S2KA 2CNAA 1J84A 4XACA 4YLZA 1FOD1 5JOWA 3WG2A 1AJKA 2UWAA 4LORA 1WW4A 4QDRA 3PLQA 3OPWA 4QDSA 3TN93 4BQ4A 5DQ0A 1ASJ3 2WR9A 1HQWA 2ZAAA 4CDXC 5FFOC 3U14A 4BOWA 4M0NA 3RMXA 3HT2A 4CA9A 1X8MA 1TMF3 1OVPA 2W92A 2VMGA 4D6QA 3J7LA 3GZTB 2ZMLA 3FX3A 4LKSA 4DUXA 1US3A 3APBA 4BK5A 5CZKA 1RXFA 3K4ZA 2ZZJA 3WY6A 1NLQA 3H8UA 4AYUA 1X8EA 4P9WA 1WMEA 3ACHA 3B01A 2OS2A 1GSLA 1DHKB 1JODA 2JG8B 4XF1A 2JDPA 1WW6A 1O5UA 3H1MA 2J42A 1HRV2 3EB7A 4LQRA 4ONUA 2DTWA 1F9KA 2ADDA 2F6BA 3PUHA 5J1XA 1GZ9A 1OBNA 3OPZA 4KU8A 4XEZA 1VBD3 4ZU5A 4AI1A 3VD3A 4ASKA 3W5MA 1NXMA 3MW2A 3BCWA 2JDZA 3PUQA 4EWEA 2Q8EA 4YM3A 1PMJX 4ZHNA 4RL7A 3RG0A 4JAAA 1VBB1 2PHDA 3MPPG 3KV5A 1FPN3 2E53A 2YZ4A 3OUJA 3X29B 3SCHA 1JZ5A 1UXXX 1Y43B 2VZQA 4XXPA 5FZOB 1SPPA 1XNAA 2H0VA 1QJU3 2HWF3 2XJVA 3NNMA 4FOYA 1MZEA 4BLJA 1YFXA 2PHLA 3L9JT 3WW1A 2YBSA 4M0HA 1OVSA 2XLGA 2Y6LA 4XDOA 4XIKA 5CB7A 4PDWB 1LAJA 5D8AC 4MSVA 5E1RA 4YG0A 4EJRA 1NCQC 1AX1A 4XFGA 1NA1C 2JKXA 4XAEA 1W0OA 2DVAA 4XFHA 4Q4X3 2QQMA 2Y6FA 1SLIA 3WOGA 1S0CA 1VRH3 3N7MA 1NYWA 4LBQB 3LOBA 1DP0A 1O4ZA 5CVRA 5LK7B 1IKQA 1GKBA 1W99A 1QY4A 1R1A2 3LD8A 1MZFA 1R1A1 3HWJA 3OB8A 1REFA 2ID4A 4IEWA 3KSCA 3MEPA 3RRDA 2XBO1 4YVWB 2OPWA 3JQWA 1N1TA 5JSOA 1K5JA 1UN1A 2R041 2BOIA 4MZUA 5AVAA 1HRI2 3AP5A 1LODA 1HRI1 2IXKA 2YBKA 4NWWA 3T09A 3DF0A 4BYYA 4MHUA 2VOWA 1RINA 1RHI2 2ZEZA 3HD8B 4NRQA 4CPBA 4GWNA 2FMYA 4TXWA 2DCYA 5EPAA 1XYOA 3EQEA 1J3QA 1OFNA 5KXCA 4PLMA 2H6BA 4YNIA 1XB9A 3JBG2 3JBG1 3ZSKA 1EAH3 1ODNA 5DZEA 3FFZA 1RTVA 4XURA 1NAEA 1G9AA 2CYFA 5AC92 3D3AA 5AC91 2UY9A 1OOPB 4Q8KA 5EXOA 4M4PA 5FK7A 4JKMA 1N1SA 5FYBA 1VP6A 4D6RA 1UX7A 3P1IA 3HVDA 2OA2A 4IEUA 4D7TA 3FJSA 2YDEA 1ULCA 2WFPA 1LULA 4NN0A 3RI9A 4COUA 3MFAA 5H9RA 3I3EA 4QX1A 3WQ1A 2P17A 3H8RA 3ZKUA 5IK4A 2AR6A 2TEPA 1LR5A 4LBMA 2W1SA 2DU1A 4JV4A 3ZXGA 3ENRA 2D6KA 1IPSA 1QJY2 3B94A 3HQUA 1QJY1 4W6XA 5FZDA 5C8CA 3BGAA 5FZKA 2D93A 3VLBB 2W47A 3ZYGA 5KHGA 1UPSA 4QX2A 1LB2A 1LHVA 3F2ZA 1C8M1 1KD7A 5FY8A 1WLCA 5K8SA 2Z5WA 3V0BB 5FAXA 5FZ4A 4KWLA 2PFWA 4IV3A 4GXLA 5CKMA 2HYXA 4PLOA 3U1XA 4CDUB 4AQTA 5FQ0A 1QJX2 1RUF2 4IESA 1RUF1 2D6OX 2VCCA 2O8QA 2WIIB 4H14A 5FRAA 4FPCA 3DYPA 2RJKA 3PHMA 3LAGA 4PCRA 4G4FA 4BE3A 2W9XA 3O0VA 3PUAA 2RS52 5FZ6A 3IPVB 2EIBA 1Y9MA 4LR4A 5BV6A 3R4UA 2BUKA 3ZXFA 2E31A 1HRV3 2NPIA 2D98A 5EJ1B 2VCAA 1R082 2WINB 5FYVA 1R081 4Q4Y1 3DYOA 3UNPA 1JU4A 3C7FA 4QU1A 2FD8A 3ZYBA 4BH9A 4RN5A 1IOAA 2ZGTA 4D7SA 4QM8A 5FP8A 4CTEA 4CDWC 4LO5B 1WW7A 1FMD1 2JDUA 3SLIA 4BB3A 1COV2 4AEDC 3OEBA 3FLTA 1NY72 3FLRA 3IDEA 1NY71 3OY8B 4QD2A 3U37A 4UFHA 3K77A 4WM7C 4MGSA 4A45A 1F8VA 4ATFA 5IFPA 1QOSA 4JCKA 4RGKA 2K9ZA 1UMZA 1GZCA 1DFQA 2XB6C 4NHKA 3NNJA 3ON7A 3PJYA 4AFDA 4IE7A 4A7YA 3POFA 1BMV1 2W2IA 1QNWA 3N7KA 3S7EA 2D6NA 2VOKA 4F3JA 1ND2C 3RWKX 3WP4A 3I2JA 2YB7A 1R1A3 3LEMA 2G19A 1AX2A 3IWZA 2CY6A 4BQ2A 4COVA 5C71A 3GZAA 4O9GA 4M3CF 4Y5SA 3WZ1A 4Q5OA 2VZOA 4E4ZA 2VMHA 1HRI3 2XWBB 2X05A 1RHI3 3KT7A 1K5MC 4GQ7A 5C33A 3M3IA 2LROA 1SQ4A 2W94A 1RUJ2 5DAXA 2YBPA 4AOCA 2A1XA 1GANA 1LRHA 1D2QA 3JBG3 4OFGA 2WYFA 1SLTA 2ZGNA 2WO7A 2K2SA 3PURA 1ZZBA 3EXUA 1GP4A 1V6MA 4JKKA 1UKRA 3GGLA 5AC93 4GWIA 3ST7A 5HV4A 4GD4A 5A33A 3AB0A 3G6JB 4RSUA 1DG6A 1LGNA 3I7DA 3VBUC 3MFCA 3CZJA 1ULDA 2CWMA 5DZGA 2WUHA 3MZHA 3I3DA 4R9CA 5EIYB 4ZKTB 4HSJA 5FPVA 4CCEA 5IVYA 3LCPA 1JZ2A 1I9RA 2QQNA 4A3XA 1RUC2 3KT4A 1FI2A 1POV3 2XONA 3C7EA 3AKQA 4NR1A 5ANQA 5F3IA 4DRVA 1EP0A 1YNAA 3M4FA 4RS5C 4XVHA 5T54A 2XKOA 4AHYA 3CMGA 1QJY3 1F5FA 1Q5OA 3RQ0A 2WT2A 1NT0A 4HK8A 4Q4V2 4SLIA 4UBGA 4Q4V1 5IVFA 1KFUL 2X10A 4KH9A 4X6QB 4OCTA 3TBDA 3THPA 2Z2SB 4R52A 1H2NA 5C3RA 3RPQA 4CXYA 1PK6B 1H9PA 4FP2A 5FP4A 2XR4A 4QMAA 5GALA 1J59A 3V0AA 2WC2A 1QJX3 1RUF3 3JUUA 5EV7A 3N9NA 3OF1A 3SITA 4XFCA 2DTYA 1XSQA 5C3PA 1GUIA 1CR7A 2RS53 3PTRB 2JX9A 3RZGA 3QCWA 1CVNA 4XETA 1YQCA 3CEWA 2Y6KA 2IVIB 2WZ8A 1R083 3W21A 1ND3A 3VBHA 3S0MA 2RR12 1KS5A 3JQXA 3MF9A 3THCA 2BV4A 3TEXA 3M8LA 1UY1A 3BTXA 5F6KA 2ZGLA 2RMU1 5KHHA 2QQIA 2XUMA 2FDFA 4L0PA 3NJYA 3OGGA 3IDAA 3SC7X 1NXD1 1FYUA 1COV3 1RYYA 5HCBA 2PHTA 4PIXA 5FIXA 1AJOA 3ZXDA 4OMCA 3RJ2X 3KCYA 4BZ4A 3AC0A 1EUUA 1ZRIA 3OBTA 3UGHA 3I8TA 2ZGRA 1S1AA 1LOFA 4F7ZA 4PHZA 2GN3A 1GICA 4GALA 3N7LA 4LO6B 3RZJA 3CBNA 3A22A 2OXBA 1NG0A 1YRZA 4TZDA 5EHDA 1VALA 1H2MA 3IKWA 2P3YA 3ZXAC 5JXIA 3IAPA 1PIV2 1PIV1 1YUDA 4OHWA 2YMZA 5LA2A 1JUIA 1RVF2 4HOOA 3T0AA 1RVF1 5LASA 3IT8A 4DPNA 3N9PA 1NCRC 3RYPA 1SCRA 4N53B 4W50A 3USUB 4L11A 5ACA2 3FBMA 5ACA1 1S0GA 2I07B 2AYHA 1OKOA 1HJFA 1UU5A 1W8HA 3CJIA 4G9SB 2VVEA 3ALQA 1SPPB 1N47A 4CEYB 1PGSA 3HNBM 1RUG2 1RUG1 1RUJ3 4LA3A 1XRUA 1VAMA 4XTPA 5E88A 1XBFA 5I0UA 4QPGA 1YWKA 1ZZ8A 2PHWA 2YYOA 1GWLA 3WEZA 2EALA 2ZS6B 1JZ4A 2C24A 4BU2A 3WXPA 3W20A 1G9DA 5JZGC 4HANA 4JDMA 2X5IC 4DO0A 3FFQA 4FFHA 3ZFEB 3FMGA 4JRLA 3SH5A 1CQ9A 1E5SA 1LECA 2AEZA 3LKJA 2V4VA 1Z78A 1QHDA 1ZNPA 1YQ6A 5BNNC 2C9KA 4XFBA 5ABJC 3WCSA 4YW4A 4C1WA 4DRRA 4LO4B 3V56A 3POYA 4O61A 3N36A 2WQ8A 3GBGA 2DVDA 4ZPIA 3ZXKA 4NHYA 5FY1A 1RUC3 3HIFA 1NUKA 1ENRA 2DV9A 5IFTA 3VZKA 4JTOA 4PIYA 2Q4SA 4Q0UA 4YM1A 4XMIA 5F2SA 3LSEA 3N9OA 4GZ9A 3ZYRA 5FLIA 4AFAA 4Q4V3 1XNCA 4UYBA 4WV8A 2DYCA 4HN0A 4DS0A 2D6PA 3C7OA 5L73A 1UIKA 3AK0A 4RHV2 3WNXA 1N1VA 1OPOA 2WQZC 4L99A 3TAYA 3CLPA 4URAA 5FR3A 2WSUA 2BGCA 4C0HA 3KF5A 3N9LA 4DEVA 3FUQA 4BISA 3PU3A 1QQP2 1QQP1 4XCBA 5GJ6A 2VQTA 4Y1ZA 4B4PA 4K21A 2RV9A 4HT1T 3VBOC 1HKDA 4CZSA 5AVPA 4D7YA 5KHJA 4DMIA 5IT6A 4TTGA 3VBRC 3NVCA 5FV3A 1JYIA 2WNEA 2EIDA 1IS3A 4F8AA 4CEWC 4H2AA 2RR13 5EP9A 2CU5A 2BBVA 1OXCA 4UT5A 1MS0A 2PYTA 3D82A 3SCFA 3PDQA 1CAWA 4XZPA 4FXKB 4FQ4A 2VNRA 4DNYA 3WG4A 4CPBD 2EIEA 2Y38A 4KG0A 4MGZE 4UXAA 4P00B 4LUKA 2E7QA 3J9SA 4Y20A 3VV1A 4QPYA 3HPNA 2ENRA 2Q1ZB 2JB8A 3OEAA 4LBQA 4X6RB 3S6PA 2VQUA 2W1UA 2D3PA 1QEXA 4GWMA 1SACA 2Z79A 4A42A 4MO3M 4Y24A 2QQUA 4YVSC 3RYKA 5K0UC 3AMMA 1H1MA 1UIJA 1NA1B 2QZ3A 4V2VA 4BQWA 1PIV3 1QMJA 1UMHA 1VMJA 2JD9A 1PO22 1L7RA 4UFKA 1PO21 5J98B 5J3UA 1RVF3 4JGYA 4XUTA 3I2HA 4OZXA 1KS4A 2VUAA 2XH6A 2Q8CA 4CCOA 3AX4A 3HNMA 5E89A 5ACA3 1AL22 3PMSA 4ISQA 5A70A 1CWPA 2VMDA 2DUQA 2JE7A 3GBFA 1I3HA 3LDBA 4K8RB 3KCXA 3DPRC 1H1IA 1RUG3 1B35A 2VW0A 4IL7A 3O1PA 4QX3A 2JE8A 5J37A 3OUIA 4XPVA 1QDOA 3D4KA 5KWRA 2D5FA 4Y33A 4LNVA 3WQBA 4HKLA 2C0ZA 4QPIA 1XE7A 4RQPC 2ZHLA 1AR91 2F17A 4YSFA 5IVBA 4QM9A 3WW4A 3NAPB 1OC1A 3DKQA 3ZVXA 2FZ2A 4IV1C 3J8F2 4XF0A 2XQRA 3H0OA 3J8F1 4LO7A 3F95A 3D0JA 2VCBA 4PBPA 2XJPA 2R6QA 1GQHA 4HONA 3NQHA 1YC61 4AI9A 2BU9A 4AFCA 2LS6A 2FBEA 4FOWA 1GZTA 3KV9A 2YROA 2E9QA 1D4M2 4QGNA 1O59A 1SEFA 4XW3A 1HJGA 2KA3A 5LA1A 2Q30A 4BWOA 2Q8DA 2JICA 3MYXA 4QQPA 3NSTA 2OX0A 3Q8AA 5DAWA 3BOWA 5T5PA 5EYXA 4CP2A 1KDMA 1Y3TA 2WYSA 3WF3A 5DDJ2 4BLIA 2ZTNA 3P6BA 4ARXA 1H2KA 3EBRA 1W90A 4NMIA 1PO12 4ES9A 1PO11 3ITQA 4NWVA 3T0DA 4UW3A 4GMP0 4BIFA 3AKTA 4RR3C 3PNAA 5CISA 2Q8OA 3RMYA 3ASIA 2P3IA 2D3SA 3EHKA 3E5UA 4LK7A 1OF4A 4NO4A 3SHRA 2YC0A 4B3NA 4ZY9A 3NRUA 4RHV3 4ASLA 5A33B 1UY2A 1JTZX 1W9TA 3VKNA 2AH2A 2ZKLA 4XFIA 1DLCA 1HLCA 5E16A 5GZFA 1W6MA 3LDKA 5A80A 1KEXA 1WCQA 3OGVA 5B4NA 4FXGB 4HXCA 3POBA 4CDQA 1AR62 1U0AA 1GOGA 1QQP3 5D2AA 5FZHA 4XUPA 1DGRN 2WZR2 3T4HB 4ZU4A 3LQCA 3VDAA 4Q0VA 2E33A 3MUY1 1JYXA 1KFXL 3M3EA 2C4XA 4BQYA 4DUWA 1L7LA 3HEIA 2A6ZA 4AE2A 1DGRA 1QJZA 1RUD2 1RUD1 1SLBA 4XQDA 4IE0A 3U4SA 2RM22 2RM21 1W8OA 2OZ6A 4MV2A 3OY8A 4YZ3A 3SH3A 2KD7A 1OUSA 4M3CE 1C8NA 3ES4A 4L8QA 3ZSMA 2MEV2 2MEV1 4XF4A 1HB2A 3PVEA 2E6VA 1OA4A 3SH4A 4A4AA 2W08A 4FQZA 1ZBA2 2JG9A 3KWVA 2WNUA 4NIDA 1CGPA 5DUXA 4XABA 5A1FA 1QXPA 5A3UA 2NZ9A 2RS12 2VZ3A 2RS11 1CZSA 4Y22A 3OCPA 5HCAA 1REDA 1XXNA 2HWC2 3O14A 5T5LA 2HWC1 4O7XA 3V0AB 4Y1UA 3IAQA 1S0DA 1QXJA 2PQQA 5BNPC 3GM8A 5K7PA 4K1ZA 3O0WA 3USSA 1FATA 2DF7A 4D6SA 1ZA7A 3LPGA 5ANNA 1AX0A 4KBBA 5F6LB 4HG6B 4Q4W2 4Q4W1 5I0DA 4G3YC 3HBZA 3NJVA 5C4WC 1PO23 1ND3B 1CZTA 1U5XA 2W87A 1D4VB 2FCUA 2KM2A 1RUNA 2BPA2 1JOBA 1WLDA 4NE9A 4AVSA 5FUIA 4W6WA 1TZOA 3MW4A 3MV01 1AL23 1O6UA 3WQ7A 4FBFA 4LBKA 4O9EA 3FE5A 1J1LA 1KJRA 4IERA 5FZAA 3E6BA 4AK3A 3VDDA 3VBSC 1W2OA 2HJIA 1HB1A 4HBNA 1H8VA 2WNVC 5BY5A 1DDLA 4NRMA 1UF2C 3RYRA 2B42B 1ONAA 4LUMA 1C5IA 3M3OA 1DZTA 1PGW2 2CDOA 1F31A 1PGW1 1VB2A 5CADA 2YFZA 4ITCA 4IE6A 1MS1A 5CU1A 2VR4A 3J8F3 4I0BA 4N9HA 3O1SA 1WCDJ 2ZABA 1V70A 1RGSA 4PI0A 2BFUS 2Y26A 3E5QA 5IATA 2E63A 1RUH2 2VBPA 1WD4A 4QKBA 1PM7A 4XYXA 3D0SA 1JH5A 1SBEA 1W8ZA 1D4M3 3BOPA 5SV8A 3BN6A 3S5AA 5GZGA 1WA4A 1L3JA 2P5BA 4FO9A 4P9JA 5F1RA 3RZKA 3WNNA 1FNZA 3VHNA 3CJIB 3DEMA 1GYKA 1W05A 2XJSA 5DDJ3 5KHIA 3OUHA 3IIIA 5CEHA 1PO13 4PQQA 1OT5A 2A3WA 3HNYM 4QPGB 2NN8A 2F4PA 1KGYA 1XPWA 2CGNA 4TSVA 4WZFA 5C9AC 3P3PA 4J1XA 1NKGA 1WGPA 2PAEA 1UO9A 1H8TA 1V6KA 1V6OA 5FZIA 1Q8OA 4CCNA 3KM5A 3NW4A 3K3NA 1JYWA 1GV9A 1CONA 1W9YA 2AENA 2G9GA 5DN2A 4Z92B 1WCSA 3ZN6A 4AW7A 1NE6A 4IDZA 3ZKYA 3B9IA 1AR63 4KWJA 5F3EA 1FOD2 3WF1A 1W8WA 2WZR3 4YW6A 5JXGA 2RDNA 2ZBJA 2WN3A 2QNKA 2VVFA 4XHXA 1RJ7A 4AHXA 5AFEA 3MV11 2GNMA 2JDNA 1RUD3 3EO6A 3T2QA 1LHWA 2RM23 2XQXA 5FYZA 4D8MA 3DECA 1I5ZA 1TEIA 2QUOA 2EXKA 2MEV3 1W8UA 5SV5A 3AZZA 2B8MA 3AFGA 4I3PA 3PVNA 3J4UH 5LBCA 1ZBA3 3POJA 1W06A 2HWE2 3E6DA 1LHNA 2HWE1 2RS13 5EQUA 3UKVA 3ZXLA 3KVBA 2QQOA 4XTMA 2HWC3 3QOPA 5JDBA 1HXS2 1HXS1 4DEQA 1UCXA 5FO7B 4LT5A 1UL9A 3OD4A 2WAOA 2BNOA 3ACGA 2YFUA 1VIWB 2ARAA 4Q29A 2RJ2A 4CU7A 3IN9A 1C57A 3EJKA 5I8YA 2VU9A 4X8PA 5DMYA 1O8PA 4QB2A 4QXHA 4TYSA 3TEZA 4LIVA 4N53A 4Q4W3 4FOQA 3USUA 3WSOA 1JHJA 1VBB2 2V73A 4QGLA 4Y4YA 5DAQA 1JZ8A 1XYPA 4DXRA 4C91A 2AZ5A 3VZLA 1H6YA 4CEYA 3WQ0A 3KV6A 1RXGA 4D0QA 4HFSA 3K51A 1CAWB 1T6BX 1YEWA 1UOGA 3GHNA 4COZA 4DOUA 4CU8A 1NCRB 1MR5A 3J7HA 1LHOA 5ISLA 3ZFFA 5IAVA 1YFUA 2D6MA 2UURA 2ZGUA 2D40A 4I02A 4OUSA 1X9TA 3MF6A 3S57A 4Y20B 1LGCA 3KB5A 4GAZA 1SBDA 4PJYA 3ROUA 3W58A 5IVEA 4Q1PA 2GZWA 3ZFEA 1BCXA 4MXVA 3VKLA 1J3RA 4LMFA 4YARA 2JXAA 4U2AA 4EWDA 4QX0A 1OA3A 2XBO2 1XE0A 1Z7S2 1VBC2 1Z7S1 4NIIA 1VBC1 2R042 4AQ2A 1RUH3 4A7KA 5IYYA 3BKZA 2VUCA 1JW6A 2WJSA 2X5IB 4JGYB 2BERA 2IWGB 3NKTA 4XJWA 1ZZCA 2DUOA 1OQ1A 2KXLA 4I30A 3A23A 1W2NA 5FZ8A 3KF3A 4Q27A 2I45A 4OUMA 4XIOA 4D3WA 4Z07A 3RNSA 3VB9A 3RZLA 1SDWA 4XUOA 1DF0A 4QWNA 1B35B 2VD7A 1V6NA 5JI9A 4GULA 3R05A 2BQPA 5JR7B 2CGOA 2J1SA 5LBFA 1S0FA 4QPIB 4MUVA 2A75A 3HBKA 1QJFA 4OLLA 1AYN2 4CDXA 1AYN1 3OBZA 2CWSA 2FDJA 3FHAA 4AEMA 2OIIA 3JCIA 1XU2A 4GJZA 2JDYA 4KBZA 2BDRA 1BLZA 1SFPA 1S0IA 2J7MA 1HV1A 4AHWA 5HPOA 1LKNA 2PAMA 2UWCA 3QBQA 2VQ0A 2OYZA 4MHRA 1T2XA 4YPJA 3RZZA 4XDQA 3WNKA 4LBQD 1O7FA 1FOD3 4HETA 2LTNA 3WV6A 1HDKA 3O7OA 3I2KA 1JYCA 2JDHA 1XJAA 4YW1A 3KMHA 1UU4A 4WM8B 1EY2A 5CFDB 1UX6A 1C8M2 1HIXA 4LITA 4NUBA 3LPFA 1MPXA 2NLRA 3ZSEA 3ZIWA 1IQAA 4LBLA 3FHIB 5FPLA 5FUPA 4JGZC 2ZX0A 1NX9A 2DU0A 1UAIA 5FYMA 1TNRA 2HWE3 1OA2A 4S2FA 2FCVA 2XPJA 4K20A 1LU2A 3NJXA 4YW2A 3H50A 2HWB1 5D8AA 1W6MB 1HXS3 1X50A 3I2FA 1NCQA 4EN6B 1DLLA 1YQ5A 4HK9A 1SFYA 1CAXA 4CDQB 1G6NA 2YC2A 4QGMA 1NA1A 5A3NA 2JECA 5EFUA 4Q4Y2 2WL1A 5A7QA 5D21A 1FNYA 1V6LA 1PZ9A 4HZFA 1ST8A 2DWRA 1LOCA 1A34A 3K3OA 1VBB3 1OHFA 1JHNA 1FMD2 4QQOA 3NMBA 1GWMA 2WO3A 3NNLA 5FJKA 5C5TA 4I09A 4IE5A 5DABA 2LM3A 2VTXJ 2WA4A 4YG6A 2V09A 4LK6A 3BTZA 1UOBA 5DUVA 2VMCA 3VZJA 4TN7A 4DFSA 5JCTA 5KXDA 2WQ4A 1OLME 2JG9B 3AJYA 2VQAA 2WNUB 4MGTA 1SHWB 3AL5A 1MQTC 1YIFA 1G8WA 1BVP1 2IXCA 1FAYA 2VOXA 1GP5A 3NAPA 4IGOA 4Y22B 4CUGA 5A3LA 2WN2A 4M3CA 1BMV2 3Q9OA 3UV9A 2BOJA 4TWTA 2Y33A 3ZFGB 4R9BA 4YZ4A 2ZMKA 3LFMA 3VKMA 3CJXA 4XXAA 2XBO3 2AEYA 1Z7S3 5CG9A 1VBC3 1AR81 1CPNA 2R043 1OI6A 4LKEA 5T52A 4NVPA 3M3CA 4B1LA 3WCRA 1VRBA 2D7FA 4JDNA 3ZYJB 3WG1A 2DCJA 2JEMA 1JXNA 3POEA 5T55A 1O3QA 1H4GA 4Q2FA 1WA6X 1DQ1A 3VZNA 2VZVA 3LEKA 2QZ2A 4Y26A 2ZZQA 1R1ZA 3VBHC 2AACA 4BQ5A 1RL3A 2GNDA 3VDDB 3BIEA 3RGBA 1V6IA 4U36A 4RFRB 3M1HA 4Z82A 2ZEXA 3PIJA 4BQ1A 4AQ6A 4Z1VA 1Q43A 3ZDVA 1CN1A 1W6QB 1AYN3 3SNMA 1AR72 1AR71 2QTWB 1MZ6A 5FYTA 3VD4A 1SBFA 1S2EA 3DXUA 2VG9A 5FBZA 3E97A 3VHRA 3K46A 2B45X 2VZTA 1W9WA 2D3RA 2HLEA 4XHBA 4P9GA 5A6XA 5FMOS 3UJQA 5BPXA 1ZZ6A 2JD4A 1TME2 1LOAA 1LOBA 1TME1 3GCXA 3LDRA 3W9AA 3GJBA 1KJLA 3N9QA 2GP3A 3WD5A 4E2QA 1EV11 3SEEA 3DYMA 1O3TA 4BDVB 1K3IA 1W3XA 1MS8A 5T3NA 3GXUA 2XJQA 4C90A 4P08A 5L7OC 3I4IA 1POV0 2GN7A 3GALA 5JIUA 3SXWA 4JDOA 5TSWA 4D69A 1JZ6A 5JIAA 3I3BA 5LATA 1FX5A 3AKSA 2BFUL 4NAMA 4XZUG 3AZWA 3AXEA 3KQRA 1C8M3 2ILMA 4FAHA 1GNYA 3H1WA 4CDWA 3AMPA 4BMBA 1H6XA 5DXDA 1V0AA 4TLFA 4AEDA 1N3PA 1H8TB 1PVXA 4FSJA 3LIHA 5KXBA 4WM7A 2V5DA 1TG7A 4UFJA 4EZHA 3BI3A 2ZX4A 1VMFA 1A8DA 3V65A 3ZN6B 5IK7A 1HN0A 2R071 5FOJB 1OH4A 2YUEA 3KT1A 3OJBA 3EYPA 4OVEA 4E27A 1POQA 3T1MA 4Q4Y3 3WP5A 5BUVA 4JHZA 3N35A 1OURA 2YPDA 5FCCA 3T2TA 3OSDA 1BZWA 4MXWB 2ZGOA 1P8JA 2RMU2 4QB6A 3T2PA 1DQ2A 5H9SA 1FMD3 2P4EA 2GAUA 3AP7A 4Y1YA 4BMEA 2VTFA 1VB4A 2QQJA 4I0WB 3OGJA 1CX1A 2QKDA 4B1MA 1NOVA 4MG2A 3WR0A 2G9FA 1AUYA 4GH4B 4QAWA 1IQDC 4NPLA 5IWFA 2ATFA 3UKTA 1DCSA 4JKLA 4XBQA 3D8CA 1W6OA 3VBFB 2A70A 3WUDA 4XJ9A 2GMMA 3BPZA 1FXZA 1O4TA 1HX6A 1ZZ7A 2JE9A 2R16A 4L2NA 1DQ5A 2JIJA 3C3VA 1UXZA 2MHFA 2R062 4JTNA 4OHVA 2R061 3MDPA 4CXWA 3W59A 2JG8C 1XYNA 3HN1A 5A32A 2WT1A 4FCAA 4FP3A 2NQYA 3C7GA 4WVZA 5EJZB 3VBUA 1WW5A 4Z8BA 5FYIA 5IAXA 2P3KA 1NQDA 4GKXA 1FV3A 4K8FA 2ZGSA 4FT8A 4PF5A 2XKPA 3FWEA 3LFIA 3ZFFB 5C8WA 3ETQA 4BHPA 5E6HA 2ZGQA 2PELA 2VMEA 2WDBA 4W4ZA 2C6SA 1RUOA 4RS5A 3DGTA 2ZEWA 5FYCA 2XJRA 1HB4A 1JYNA 5B2GB 3K48A 5JLVA 4W65A 5BNOB 4PDWC 4CE8A 4WVVA 4NPRA 3CF6E 1AR73 1JOJA 2TNFA 4OULA 4XC9A 4OI1A 4PQ9A 4KI5M 2OW4A 4IGQA 4HKOA 4JQTA 5JOXA 4QQHA 4CP1A 4UW6A 5FZ7A 2ZMNA 2CV6A 4P02B 5GM0A 4DINB 1BKZA 4LHKA 4YFWA 2J1RA 4H3WA 4ISRA 1AHSA 1TME3 1RC6A 2W0XA 4D94A 1WCKA 5A1LA 1OLRA 3PVBB 4I0AA 4YVWC 5DUWA 4IXLA 3IBMA 2OKXA 1O3SA 2DFCA 4IEXA 2VZ1A 4J6GA 3TWIA 5FZ0A 5IK5A 3CDZB 5CFCC 2QQLA 5BYNA 2VVDA 1SLAA 3HN3A 5J48A 3ILFA 4K1YA 3WW3A 1C5HA 4E4DX 4XQ4A 2JDKA 5GKAC 4CDXB 2XMLA 2JIGA 1MVQA 3DL3A 1PMHX 2CAUA 2Y60A 1SG3A 1ZVFA 4XF9A 5FREA 1OOPC 4XJZA 3ZN4A 4XE9A 2J1TA 4S2GA 1XOYA 1YIPA 1JZ7A 2F4LA 1DZQA 4XJ8A 4LULA 2BGOA 1GP6A 3ZMNA 1LOGA 1BBT2 2CL2A 1BBT1 3QH6A 4RFT0 3JU9A 1PZ7A 3P5BA 1PGL1 2N7GA 4AGGA 4JHTA 4GJYA 1HQLA 2B9VA 3O1TA 1STMA 3MIHA 3HQRA 1GFF2 2FCTA 1GNHA 2QDNA 2RMU3 3U78A 4AEJA 5CG8A 2ZGPA 1QXRA 2JWPA 2Q1MA 3OD0A 1NCRA 4EV0A 1UZWA 2IVJA 1KQRA 1SZBA 1ZREA 1W2UA 2ORZA 3MIBA 3NNGA 3LEIA 1E5IA 4XUNA 2C1FA 3VZOA 4N43C 3WW2A 3NV3A 1G9FA 1R092 4UI9L 1R091 1ZRFA 3WP3A 3ABZA 4LJHA 4CU6A 3GZEA 3T4VA 3IDBB 4QXBA 2B9UA 1WLWA 3LF7A 3KHCA 3R4DB 4CDUC 5D8AB 3H3ZA 4OI4A 1NCQB 3T0BA 4LE4A 3LIGA 3U75A 1CAXB 4B8EA 2QFEA 1ZRCA 5H9PA 4LA2A 1V6JA 1UYPA 2R063 4FFFA 2BP6A 4UFLA 4CXXA 1XE8A 2A6VA 2TUNA 2WSVA 2X5IA 5F9TA 2YY1A 1LGBA 3ORJA 2VBBA 1YJKA 2GH8A 4BA6A 1SMVA 3FZ3A 3B5LB 2YV8A 1CJPA 2RDSA 2H6CA 3TYJA 4FPHA 5FZ1A 2CGPA 4KU7A 3ES1A 3AVSA 5I8SA 2HEYF 2K0GA 3B00A 3TRSB 2QQWA 4FOVA 2AGSA 3ZSJA 3ZR5A 5ABJA 1NQJA 1US2A 4DB5A 4N9IA 1AR92 1DYKA 2A6XA 3AYDA 2VW1A 4OHZA 4MGKE 1O8SA 1YFWA 3OGSA 2B7YA 2SLIA 4ZXEA 4AI8A 1X82A 4AAPA 1H9WA 4M3CB 3BU7A 1W2TA 3FC0A 2ARXA 1RUI2 4DZGA 3BTAA 1OLMA 1RUI1 2G4IA 3M7AA 5T5OA 4S2DA 2UU8A 1ZZ9A 2OVUA 2YHJA 2WFF1 1YQ8A 2J1VA 2XUEA 3GF6A 3H8XA 2ZHMA 1G86A 4QQ2A 2ORXA 2LRPA 3AZVA 4FTSA 1U12A 2WWUA 4Q26A 4ES8A 5FY7A 1UPIA 1F4HA 2IZWA 4GB32 3AVRA 1A78A 1W39A 2QE3A 4GB31 1HW5A 4OMDA 2XVKA 4CCDA 2Q1FA 1MZ5A 2VMFA 2X29A 3LOIA 3RJRA 3VBOA 3BYWA 1KXGA 4WM8A 5CIRA 5CFDA 4N8MA 3WDUA 3RZHA 1VPHA 2RS32 1ULOA 2RS31 3AP9A 1FV2A 2I2SA 4IEPA 2XDVA 3GCWA 4XDPA 1G7YA 1JS9A 1ZX5A 2BTVC 2P6HA 5DAVA 3I2OA 3OBRA 3LA7A 3J7MA 1HB3A 4CCKA 3MICA 4FPYA 1W6PA 3WVJA 3AZYA 3MGUA 4XMAA 2B39A 4ATEA 5JOYA 3RZMA 5LK5A 1F2NA 3N4MA 1ZRRA 4AVVA 1PMIA 5LWBA 1O5LA 2DURA 4NAOA 4AHZA 4E2SA 2CHHA 2EAAA 2ET1A 2OPKA 2X09A 2Z42A 3ECQA 4AL9A 1HV0A 1D0HA 3ZPOA 2V5YA 3BU0A 2Q5TA 2XXZA 3GHMA 4P9LA 1BBT3 1U5ZA 2RJLA 1H30A 3MHZA 3UGFA 4LLOA 1DQ4A 2C9AA 3UGGA 4KNCA 3WNOA 4H7LA 3MBWA 2VW2A 1JOPA 2FQPA 5DG1A 4YVSA 3WDXA 5FZEA 4CUCA 4OUEA 1VBA2 5F5IA 1VBA1 4LIUA 3VN4A 1OFSA 4R4ZA 3NO8A 1QH6A 5LBEA 1VBE2 4EWAA 1VBE1 1ZM1A 5FMOL 4HL0A 1GU3A 1NZCA 3BUCA 1EYBA 1TQ5A 2OQ6A 4UAPA 2G1MA 1LCLA 4XQWA 5FZ9A 4QT6A 4CDWB 5C3QA 4XBNA 3MO4A 3UL2A 2K46A 1OH3A 2OUJA 4AEDB 4AWDA 4BQXA 3TN92 1R093 3TN91 1OUXA 1A6CA 2EXHA 3H8OA 4WM7B 3ZFGA 3NL1A 1I6XA 4HVOA 1JYVA 1PK6C 2A7AA 4P5HA 3L2HA 2VOVA 1QKQA 2W46A 3POSA 4AVBA 5M0TA 4COYA 1X7NA 1H2LA 4YM2A 4HKWA 1LJ7A 1BHGA 1JYTA 5CYYA 2C5DA 1NLRA 4NJ4A 2A6WA 4B4QA 1QF3A 3AP4A 4NHXA 1ND2B 5APAA 2GMPA 1DYOA 1RIRA 3HMYA 5FZLA 2E7AA 1GZWA 1IZ3A 2R0FA 4E9KA 5HCHA 1WMFA 3R4SA 3T2OA 4FTBA 4R4XA 5DZFA 2W91A 1ULFA 2ET7A 5FYUA 3VD9A 2YGLA 4H7MA 2Y6GA 1CD3G 1K5MB 2ZJCA 2IXHA 1AR93 1W6QA 1N3QA 2A5ZA 2AC1A 5FZBA 4YZ1A 1Z0HA 1PNGA 4E4HA 1W6OB 4GWJA 1XU1A 1FPN1 3JZVA 4LOSA 5G04L 4CSWA 2W3JA 2HWF1 1DGWX 2RG4A 5HXMA 1E57A 3N9MA 2IC1A 2VZPA 1WMXA 1XNKA 3K75B 4BQ3A 5A3TA 1IS5A 4KMQA 4A7ZA 5A32B 2W39A 1A3KA 2J1EA 2YGMA 3AP6A 1CAVA 3VBUB 1H4HA 4CCJA 1LEMA 3R0RA 4LHSA 3OG2A 1PNFA 2FHRA 3EMRA 4CCLA 2O1QA 4GB33 1IPKA 1V00A 2KR2A 4XJAA 5GZCA 4N53C 4AFBA 2QBXA 3BALA 4A6SA 1A8MA 3FL7A 1C28A 3BTYA 1AL0G 1GWKA 1OSGA 1CPMA 2HBTA 3FHQA 4EQVA 4LTAA 2A71A 2VE1A 2RS33 3VZMA 4CEYC 2WZPP 1Y9QA 4RS5B 3VKOA 2PTMA 2P34A 3ACIA 3O12A 4MOAA 4EN8B 1K42A 3Q8FA 3NWKA 2LUWA 2XHKA 4RGGA 4UWDA 5FLJA 3B02A 1WLTA 1LESA 2PHRA 1Y4WA 3UT0A 1W9SA 4YGBA 2JJ6A 5JI7A 5A1AA 2Y6JA 4P9IA 2ZGKA 1S0BA 2HH9A 5A6QA 5LA9A 2P6CA 4SBVA 3RSJA 5FZMA 4X8NA 3ZFEC 3PVOA 4NRPA 3A7QA 2FDGA 5JXJA 1KITA 1GNZA 4S2HA 4AGVA 1JMUB 2DCTA 3IB3A 3KLSA 3D5OA 3P3NA 1IGOA 1JI6A 3AYCA 2P2KA 3I54A 4IE4A 4MXWA 2QJVA 3TOJA 1WBLA 2D43A 4AR2A 1M06G 1YQ2A 2ZACA 3T30A 4HMZA 3ZLIA 1IG0A 1VBA3 4PIZA 3NNFA 3PIGA 5C4WA 3K4AA 3JD72 2BBAA 2ETEA 2ES3A 3JD71 3QD6A 1ODMA 1J3PA 2LALA 4R8HA 1VBE3 1UYYA 2ZAHA 3SMHA 1TVGA 5DUUA 4GH4A 1JBCA 1UZZA 5JVVA 2UY8A 2WBKA 2EXIA 1PHMA 4META 2JDMA 5FP9A 4B29A 2PHFA 4CUAA 1W8FA 1O3RA 5FOBB 4CU9A 2A3YA 2ZPXA 3VBFA 3ZOIA 3R6SA 4Z2WA 2SBAA 3IM0A 3ZYPA 5F37A 3VBSA 4Z2AA 5IVVA 2WNVA 4LBOA 4E8DA 1ENQA 3ELNA 4P14A 3TEYA 4ZONA 4IEYA 4IW3A 5A6ZA 1AXZA 4FVVA 1W04A 2BWCA 4RA0A 1UD1A 1BK0A 3O0XA 2PLV2 5FXZA 5FPAA 2PLV1 3ACFA 2NYYA 2VY0A 4ARYA 2VH9A 5A3OA 2Z69A 1QNYA 4FFIA 5F8PA 1CESA 5CKQA 4UOJA 1E5HA 4E4SA 4YGDA 3AMHA 1HRV1 1NLSA 2EIGA 4V2WA 5LY2A 4YYOA 4WVMA 5C8CC 5HI0A 2QCSB 5C7GA 5FY9A 3VHOA 2YG0A 5BNOA 3VDBA 3O1OA 1W6NB 1ACCA 5GZDA 3SEPA 5FPZA 1IG3A 3CHXA 4IV3C 2BW8A 2ZOEB 4MH0E 2Y0OA 4MGQA 3DV8A 1K45A 4XBLA 1F35A 2UYAA 4RYDA 4QKNA 2AUYA 2ZKNA 3S7IA 5C9AA 4QX7A 4JX0A 1LEDA 2YU2A 5JZGB 1G9CA 4AI3A 4MYEA 1SFNA 1BEV2 1BEV1 1B09A 2HKXA 2NP0A 1JN2P 1W03A 3JXSA 3MIDA 2R0HA 4Q0SA 4YGEA 5GLVA 5EZWA 3I2GA 1QH7A 3ETPA 5FXWA 5BNNB 3LE0A 2VTXA 1VLNA 2WRAA 3ATGA 4K6BA 5F2WA 2B4KA 5FYHA 5ABJB 1VMHA 2YPJA 1N3OA 4EZ4A 5HV0A 3UESA 1BJQA 2BVVA 4Q8LA 2PQSA 5J96B 4L97A 5LA0A 4XF3A 2HEVF 3NV2A 4GKYA 4AXOA 2GH2A 3GZUC 4NOTA 4EN7B 2WLPA 3VHPA 2VXRA 4FFGA 3WDYA 2O14A 4Y1VA 2P37A 3KGZA 5HXVA 4DY5A 1RHI1 3QH7A 1YI9A 3Q8BA 1YHFA 1HQNA 1K12A 5CFCB 2VO5A 2HEWF 3IIAA 1S2BA 3HOBA 3NAPC 2VNVA 3PMEA 3WUCA 5JUVA 4OHYA 3FUOA 2VULA 5F7UA 5FLHA 5I93A 5E8AA 3NJZA 3PL0A 2RE9A 3AKPA 5B4XA 2IFRA 1WCUA 4IQPA 3T08A 2HYKA 3WINE 3MI8A 3VBOB 2PHUA 3PUSA 4KG8A 3AJZA 3ZN5A 4OI2A 1UY4A 3VBRB 2B5HA 4IEQA 5JPMB 2RDRA 3JD73 5BXXA 3H1YA 3KGLA 4K7JA 4CEWB 2VPVA 3WT3A 5FJHA 2CDPA 2BEOA 1QWRA 2J1UA 3B3QE 3HQXA 2GMEA 4URTA 1POV1 2FZ1A 2HWB2 1W6PB 4CRQA 4GA9A 3THTA 2BZDA 3WF2A 5FZFA 4YGCA 2VCMA 4N43B 2P1BA 5CKNA 1J1TA 3WX5A 1PM4A 1AXKA 1QIQA 3SISA 1V9U2 3L2YA 4RGAA 1V9U1 4QX5A 3ZMOA 1GR3A 3HAGA 2E32A 2XOMA 4OHXA 3UJOA 1DU3D 5JSRA 1PVC2 1D2SA 4PI2A 1L7QA 1PVC1 5FYSA 5A7WB 2PLV3 5G05L 4YVSB 1QJX1 4HLTA 5K0UB 1CJDA 5H9QA 2R30A 4UFIA 2RVAA 1S0EA 3WNMA 1YJLA 4C8DA 3LA3A 3I59A 3GDBA 1LHUA 4E8CA 1RB8G 1UNBA 2RS51 3W5NA 3SCGA 4R9AA 1SLLA 5LBBA 3A0KA 1YFYA 3AL6A 1X9PA 4QB1A 2W1QA 3VL9A 1UOFA 3D6EA 2D6LX 3DPRB 4YRDA 3OOXA 4B7KA 3IMMA 4H55A 4NROA 4EN9B 1DGLA 3N7JA 3MUZ1 5JXHA 3VDCA 4KGGA 4K40A 2XGXA 1O4YA 1SCSA 4RQPB 2VMIA 1COV1 3O1UA 1F5JA 4W8JA 3JB4C 3J7NA 1XNDA 1AR82 1REEA 2WS92 2WS91 5I0SA 3C8XA 4FPOB 4BM8A 1VR3A 4IV1B 2OUHA 1BEV3 2D97A 4XILA 4QXCA 1AYM2 4FPLA 1AYM1 4UW5A 1ENXA 2NMOA 4CP9A 1XQNA 1GZWB 4FPFA 1E5RA 3AYAA 4LOTA 4PF1A 1ND3C 1W9FA 3AMQA 1DQ0A 4MGYE 5T50A 4NIGA 1QOOA 4E2GA 3WDWA 2Y64A 5L9BA 3B7MA 3PJQA 1LENA 2DCKA 3OPTA 3POWA 4MLOA 1RITA 3ZPYA 3AKRA 4AQSA 5GZEA 2EA7A 3CKHA 4J1WA 1W28A 2OZJA 2BJSA 5DAPA 5IJRA 4HPKA 1Y9GA 3FLPA 2VZSA 4RR3B 1LOFC 1QDCA 4BXSV 1QU0A 1CIYA 1RUJ1 5CA6A 2VC9A 1YXWA 1NE4A 1WBFA 1WKYA 4JGZA 2ERFA 4DXSA 1S0JA 4YFZA 3DKWA 1EV12 3I97A 3S5QA 5BNPA 1W0NA 5C6CA 3I3MA 1CAVB 5F3GA 1UYZA 5A3MA
chains in the Genus database with same CATH topology
1BXHA 4I01A 1XNBA 4WVWA 4Q1RA 3MLLA 2XL7A 5F5QA 4YG3A 1FT9A 1MS9A 2I74A 1AXYA 4Q0QA 5JMCA 2HWD2 2HWD1 3NV4A 3CJIC 1MS4A 4DY3A 1ZA4A 3UKNA 4WBBA 5FTTC 4OI0A 4FPEA 4K3UA 3OYWA 2UWBA 2P3JA 4QPGC 3ZXJA 4CP0A 5K9YA 5HBAA 1Q56A 1RUC1 4EROA 1G9BA 3WDTA 2HWB3 2NMNA 2Y0IA 3E5XA 5IUQA 2XWJB 2R072 1MQTA 2ZHKA 1WMDA 3VUOA 4AEKA 4QHBA 3H7JA 1UW8A 1V9U3 1YYNA 3IMNA 4YW5A 5BNPB 5GLTA 1LTEA 1ND2A 1GBGA 1PVC3 4AF9A 2EF6A 5IK8A 3OTFA 3DUIA 3T1LA 3WHUA 3O5SA 5C4WB 1UU6A 4HN1A 1KRIA 2GC0A 5GLWA 1K5MA 3GBWA 2XJUA 1U5IA 2WA3A 1S55A 1M4WA 1MS3A 3KZ4C 4INDA 3VBSB 2RR11 1TNFA 4B7EA 2JKBA 2WNVB 1GQGA 1C4RA 1X36A 2W52A 3U0ZA 4IEVA 1C1LA 3B69A 1AR83 2MNGA 2WS93 5KBFA 1EPWA 5LEJA 2QVSB 4EN0A 2A3XA 4DQAA 2D44A 5KC5A 3LB9A 3HT1A 1AYM3 4LBNA 1BVVA 1MEC2 1MEC1 2ZA9A 4MX3A 2PA7A 5GLZA 5I91A 2BYVE 5FO8B 4ASMB 5I8TA 5L7OA 4WVMB 2TBVA 1OQEA 4AVCA 3CO2A 3KD4A 4IEZA 2E7TA 3VGIA 2FMDA 3C2UA 4W6YA 1APNA 1UZYA 3I2DA 5C9AB 2A73B 1IKPA 4NHLA 1SLCA 5AFBA 5T5JA 2XVGA 3QACA 4B4RA 1ALYA 5KXEA 1EV13 1PZ8A 4ZU7A 3A0NA 3PTYA 3ILRA 1MVEA 2E51A 1MACA 5KHKA 4JGYC 3H9AA 2IFWA 1DQ6A 2B46X 2EAKA 3CL1A 4ORFA 4JRAA 2BNNA 3VKFC 4KGQA 5J09A 2HWD3 4FTEA 1WUVA 1CAUA 1RUE2 1RUE1 2PHXA 3ZX7A 1B35C 2DVFA 3RI8A 5DG2A 3AZXA 3WHTA 2VUJA 4JC1A 4Y1XA 4BCUA 4FPJA 4QPIC 4AG4A 2XJTA 1DBNA 4KQ7A 5GLUA 5EWSA 1BYHA 4GMP1 2QQPA 1RJ8A 2R073 4LHLA 1OMIA 1URXA 3AFKA 3DN7A 3MW3A 2JENA 2GDFA 4L92A 4RD7A 1PGL2 3HR9A 3RS6A 4LHNA 2AREA 5D1IA 4RHV1 1CX4A 3NV1A 2GC3A 3INAA 2JG8A 1IPJA 4C1XA 4XFFA 2EVXA 3URFA 2O8OA 4FAGA 2D5HA 2PAKA 3CU7A 3N3HA 4WM8C 2QDRA 3ZXEA 5CFDC 1AZDA 1W6NA 4AFMA 2BWAA 3J26N 1YCIA 3MLKA 3AYEA 4LO8A 2PN5A 3BB6A 5C8CB 1Q8VA 2DUPA 5I0TA 4MGIE 5JZGA 3MIFA 1AVBA 1ENSA 4PDWA 2ZGMA 1BQPA 1VAKA 4IETA 3AMNA 4CDQC 4IV3B 3BODA 5FQ0B 1IS4A 4LLFA 4N7IA 5BNNA 1AF9A 1OKQA 2EXJA 3LSDA 1MS5A 4I3GA 4YW3A 1MEC3 3I59B 2R32A 2RHPA 1ZBE2 1RMU2 5JOZA 1ZBE1 1RMU1 4Q0PA 4YVWA 5JSPA 1OD5A 4LE3A 3G7DA 1LOEA 1H1AA 3WG3A 1DGWA 4AI2A 1U5YA 5FO9B 1UKGA 2JG9C 2WNUC 1AL21 5CFCA 2WFF2 2ZX1A 4Y5Z0 3RWNA 4A2UA 5JAXA 3IDCB 3VL8A 1Q8PA 2R49A 4JQRA 1GLHA 2ZCWA 1IHMA 3ZFGC 3ZO0B 3U4XA 1OPMA 2YXSA 3ZDSA 5FPXA 3E6CC 1QGLA 1OOPA 1VAVA 3U07A 2ZX3A 1BK1A 1T6GC 4KL1A 4L9BA 4M01A 5EYYA 2WKKA 3KS7A 1OQDA 3NKGA 4QQLA 3ZIXA 5J36A 3AM2A 1JUHA 3VBRA 2VGDA 3ME2A 4YM0A 1DIWA 4CEWA 4COWA 1D4M1 5LEKA 1RUE3 2CAVA 4P9XA 2DVBA 3VDDC 5CBLA 3TNQA 4LBJA 2BVBA 1N1YA 4HPKB 3BIWE 3ILNA 4QU2A 5DDJ1 1Q8QA 4N43A 1Q8SA 4N90A 4YZ2A 4GMP3 4JGZB 3KCCA 3MIEA 3CNAA 4JVAA 3V0BA 3WLUA 4IEOA 4CDUA 4K9SA 5KC6A 2VECA 3U11A 2XLFA 1ZRDA 5K0UA 3ZSLA 3ACLA 5J7MA 4KWKA 2CTVA 2XG3A 3IPVA 2X8KA 3FBYA 1AR61 4UW4A 3RDIA 4ZXKA 1D0GA 2Q0AA 2WZR1 3OYWB 5L36A 1J58A 2X53S 3DPRA 3JB8A 5CNAA 1LU1A 4XJUA 2ARBA 2GNBA 1ASJ2 2O0OA 1ASJ1 3MPBA 2ZX2A 4DXZA 4HVQA 4RQPA 1TMF2 1TMF1 3LZZA 1H8TC 1MQTB 3GNEA 4M00A 5LRSA 3M70A 4IV1A 4FPKA 1ZYBA 4YZ5A 4PLNA 3M2MA 1C3HA 5HCFA 1ZBA1 4AVAA 3V64A 3MLJA 4AVTA 1ULEA 1Q3EA 1X33A 4UBHA 3LGRA 2GU9A 4BIOA 1OLQA 1EPZA 3H7YA 4NHMA 3UK9A 1VBD2 1VBD1 1WD3A 4GIQA 1YI7A 1RMU3 1ZBE3 2WWSA 1KDKA 2DFBA 3ZYIB 3TB0A 1O91A 2XLAA 2R1DA 4P9YA 1FPN2 2GALA 3VBHB 3H3UA 3M3QA 2WLQA 4GH4C 4RR3A 1QJU2 1TE1B 2HWF2 1QJU1 5EJ3A 1RUI3 2W68A 2XL9A 5JPNB 3B9CA 3VBFC 2WFF3 3S30A 2A6YA 4N7UA 2GC2A 2DCZA 1C1FA 5CAZA 1Y7BA 1ULGA 4BPZA 2DVGA 4HVRA 4FPGA 2H0BA 4Q4X2 4Q4X1 1VRH2 1VRH1 3LWCA 4PBOA 4F83A 1H0BA 4R9DA 4C0BA 3LA2A 2GSYA 2MPFA 4XFAA 2UYBA 3U10A 5BNQA 2WT0A 4CYDA 1DZRA 1RUH1 2NM1A 2ZHNA 3GYDA 5L7OB 1QOTA 1CIWA 4V1PA 5FDBA 4I2OA 2R1BA 4WZCA 3ZFFC 1IS6A 2VNOA 2XVLA 1I1EA 2VNGA 5LRRA 2GNTA 2IXJA 1EAH2 3A4UA 1YLLA 1EAH1 1VJ2A 1YO8A 3B93A 2IXIA 4XOGA 5BNOC 5I0RA 3QLQA 4MVTA 2IXLA 5JWPA 3TNPB 3AXDA 2GC1A 1DYPA 1PK6A 5L19A 2BNMA 4AI0A 1W0PA 3MIGA 4LEJA 4QXKA 3WP6A 1CAUB 3WDVA 4AGRA 4HSLA 1S2KA 2CNAA 4YLZA 1FOD1 5JOWA 3WG2A 1AJKA 2UWAA 1WW4A 3PLQA 3TN93 1ASJ3 2ZAAA 1HQWA 4CDXC 5FFOC 4BOWA 4M0NA 3RMXA 3HT2A 1X8MA 1TMF3 2VMGA 3GZTB 2ZMLA 3FX3A 3APBA 2ZZJA 3WY6A 3H8UA 4AYUA 1X8EA 4P9WA 1WMEA 3B01A 1GSLA 1DHKB 2JG8B 4XF1A 1WW6A 1O5UA 3H1MA 1HRV2 4ONUA 2DTWA 1F9KA 2F6BA 1GZ9A 4KU8A 3OPZA 4XEZA 4AI1A 1VBD3 4ZU5A 1NXMA 3MW2A 3BCWA 2JDZA 4EWEA 4YM3A 4RL7A 3RG0A 4JAAA 1VBB1 2PHDA 3MPPG 1FPN3 2E53A 2YZ4A 3X29B 3SCHA 4XXPA 1Y43B 2H0VA 1QJU3 2HWF3 2XJVA 4FOYA 1MZEA 4BLJA 1YFXA 2PHLA 3L9JT 3WW1A 4M0HA 2XLGA 4XIKA 5CB7A 4PDWB 5D8AC 4MSVA 5E1RA 4YG0A 4EJRA 1NCQC 1AX1A 4XFGA 1NA1C 1W0OA 2DVAA 4XFHA 4Q4X3 1SLIA 3WOGA 1S0CA 1VRH3 3N7MA 1NYWA 4LBQB 3LOBA 1O4ZA 5CVRA 5LK7B 1IKQA 1GKBA 1QY4A 1R1A2 1MZFA 1R1A1 3HWJA 4IEWA 1REFA 3KSCA 3MEPA 3RRDA 2XBO1 4YVWB 5JSOA 3JQWA 1N1TA 1UN1A 2R041 4MZUA 5AVAA 1HRI2 3AP5A 1LODA 1HRI1 2IXKA 4NWWA 4BYYA 3DF0A 2VOWA 1RINA 1RHI2 3HD8B 4GWNA 2FMYA 2DCYA 1XYOA 3EQEA 1J3QA 1OFNA 5KXCA 4PLMA 2H6BA 4YNIA 3JBG2 3JBG1 3ZSKA 1EAH3 5DZEA 3FFZA 1RTVA 1G9AA 2CYFA 5AC92 5AC91 2UY9A 1OOPB 4Q8KA 5EXOA 1N1SA 1VP6A 2OA2A 4IEUA 4D7TA 3FJSA 2YDEA 1ULCA 2WFPA 1LULA 4NN0A 3RI9A 4COUA 3MFAA 5H9RA 3WQ1A 2P17A 5IK4A 2AR6A 2TEPA 1LR5A 4LBMA 2DU1A 4JV4A 3ZXGA 3ENRA 2D6KA 1QJY2 3B94A 4W6XA 1QJY1 5C8CA 2D93A 3VLBB 5KHGA 3ZYGA 1UPSA 1LB2A 1LHVA 1C8M1 1KD7A 3V0BB 1WLCA 5K8SA 2Z5WA 5FAXA 4KWLA 2PFWA 4IV3A 4GXLA 4PLOA 4CDUB 5FQ0A 4AQTA 1QJX2 1RUF2 4IESA 1RUF1 2D6OX 2O8QA 2WIIB 4H14A 5FRAA 4FPCA 3PHMA 2RJKA 3LAGA 4PCRA 4G4FA 4BE3A 3O0VA 2RS52 3IPVB 4LR4A 5BV6A 3R4UA 2BUKA 3ZXFA 1HRV3 2NPIA 2D98A 2WINB 1R082 1R081 4Q4Y1 4BH9A 1IOAA 2ZGTA 4D7SA 4QM8A 4CTEA 4CDWC 4LO5B 1WW7A 1FMD1 3SLIA 1COV2 4AEDC 3FLTA 1NY72 3FLRA 3IDEA 1NY71 3OY8B 4QD2A 4WM7C 1F8VA 4ATFA 1QOSA 4JCKA 2K9ZA 1UMZA 1GZCA 1DFQA 2XB6C 4NHKA 3PJYA 4AFDA 4A7YA 1BMV1 1QNWA 3N7KA 3S7EA 2D6NA 2VOKA 4F3JA 1ND2C 3WP4A 1R1A3 3IWZA 1AX2A 2CY6A 4COVA 3GZAA 4O9GA 4M3CF 3WZ1A 4E4ZA 2VMHA 1HRI3 2XWBB 1RHI3 3KT7A 1K5MC 4GQ7A 5C33A 3M3IA 1SQ4A 1RUJ2 1GANA 1LRHA 1D2QA 3JBG3 4OFGA 1SLTA 2ZGNA 2K2SA 1ZZBA 3EXUA 1V6MA 1UKRA 5AC93 3ST7A 5A33A 3AB0A 3G6JB 4RSUA 1DG6A 1LGNA 3I7DA 3VBUC 3MFCA 1ULDA 2CWMA 5DZGA 3MZHA 4R9CA 4ZKTB 4HSJA 3LCPA 1I9RA 4A3XA 1RUC2 3KT4A 1FI2A 1POV3 4NR1A 3AKQA 4DRVA 1EP0A 1YNAA 3M4FA 4RS5C 5T54A 4AHYA 2XKOA 1QJY3 1F5FA 1Q5OA 3RQ0A 2WT2A 4UBGA 4HK8A 4Q4V2 4SLIA 4Q4V1 1KFUL 4KH9A 4X6QB 3TBDA 3THPA 2Z2SB 4R52A 1H2NA 3RPQA 1PK6B 1H9PA 4FP2A 4QMAA 5GALA 1J59A 3V0AA 2WC2A 1QJX3 1RUF3 3JUUA 5EV7A 3OF1A 3SITA 4XFCA 2DTYA 1CR7A 2RS53 2JX9A 3QCWA 1CVNA 4XETA 3CEWA 1R083 1ND3A 3VBHA 3S0MA 2RR12 1KS5A 3JQXA 3MF9A 3M8LA 5F6KA 2ZGLA 2RMU1 5KHHA 2XUMA 3OGGA 1NXD1 1FYUA 1COV3 5HCBA 2PHTA 4PIXA 3ZXDA 1AJOA 3RJ2X 3KCYA 4BZ4A 3OBTA 3I8TA 2ZGRA 1S1AA 1LOFA 4F7ZA 2GN3A 1GICA 4GALA 3N7LA 4LO6B 1NG0A 1YRZA 4TZDA 1VALA 1H2MA 3IKWA 3ZXAC 1PIV2 1PIV1 1YUDA 4OHWA 2YMZA 1JUIA 1RVF2 1RVF1 3IT8A 4DPNA 1NCRC 3RYPA 1SCRA 4N53B 3USUB 4L11A 5ACA2 3FBMA 5ACA1 1S0GA 2I07B 2AYHA 1UU5A 4G9SB 3CJIA 2VVEA 3ALQA 1N47A 4CEYB 1PGSA 1RUG2 1RUG1 1RUJ3 4LA3A 1XRUA 1VAMA 4XTPA 5E88A 5I0UA 4QPGA 1YWKA 1ZZ8A 2PHWA 2YYOA 2EALA 2ZS6B 3WXPA 1G9DA 5JZGC 4HANA 4JDMA 2X5IC 3FFQA 3ZFEB 3FMGA 4JRLA 3SH5A 1CQ9A 1LECA 3LKJA 1Z78A 1QHDA 1ZNPA 5BNNC 4XFBA 5ABJC 3WCSA 4YW4A 4C1WA 4DRRA 4LO4B 3V56A 3POYA 3N36A 3GBGA 2DVDA 3ZXKA 1RUC3 3HIFA 1ENRA 2DV9A 3VZKA 4JTOA 4PIYA 2Q4SA 4Q0UA 4YM1A 4XMIA 3LSEA 3ZYRA 5FLIA 4AFAA 4Q4V3 1XNCA 4WV8A 2DYCA 4HN0A 4DS0A 2D6PA 5L73A 1UIKA 3AK0A 4RHV2 3WNXA 1N1VA 1OPOA 2WQZC 4L99A 3TAYA 3CLPA 2WSUA 2BGCA 4C0HA 3FUQA 1QQP2 1QQP1 5GJ6A 4B4PA 4Y1ZA 4K21A 4HT1T 3VBOC 1HKDA 4CZSA 5AVPA 4D7YA 5KHJA 4DMIA 5IT6A 3VBRC 3NVCA 1JYIA 2WNEA 1IS3A 4F8AA 4CEWC 2RR13 2BBVA 1MS0A 2PYTA 3D82A 3SCFA 1CAWA 4XZPA 4FXKB 4FQ4A 2VNRA 4DNYA 3WG4A 2Y38A 4KG0A 4MGZE 4UXAA 4LUKA 2E7QA 3J9SA 4Y20A 3VV1A 4QPYA 2ENRA 2Q1ZB 4LBQA 4X6RB 3S6PA 2D3PA 4GWMA 1SACA 2Z79A 4Y24A 4YVSC 3RYKA 5K0UC 3AMMA 1H1MA 1UIJA 1NA1B 2QZ3A 1PIV3 1QMJA 5J98B 1PO22 1PO21 5J3UA 1RVF3 4JGYA 4OZXA 1KS4A 2VUAA 2XH6A 3AX4A 5E89A 5ACA3 1AL22 3PMSA 4ISQA 2DUQA 2JE7A 3GBFA 1I3HA 3KCXA 3DPRC 1H1IA 1RUG3 1B35A 2VW0A 4IL7A 5J37A 4XPVA 1QDOA 3D4KA 5KWRA 2D5FA 4LNVA 4HKLA 2C0ZA 4QPIA 1XE7A 4RQPC 2ZHLA 1AR91 4YSFA 4QM9A 3WW4A 3NAPB 3ZVXA 2FZ2A 4IV1C 3J8F2 4XF0A 3J8F1 3H0OA 4LO7A 3D0JA 4PBPA 2XJPA 2R6QA 1GQHA 4AFCA 2FBEA 4FOWA 2YROA 2E9QA 1D4M2 4QGNA 1SEFA 4XW3A 2KA3A 2Q30A 4BWOA 2JICA 3MYXA 4QQPA 3NSTA 3BOWA 5T5PA 5EYXA 4CP2A 1KDMA 1Y3TA 4BLIA 5DDJ2 2ZTNA 1H2KA 3EBRA 1PO12 4ES9A 1PO11 4NWVA 4UW3A 4GMP0 4BIFA 3AKTA 4RR3C 3PNAA 2Q8OA 3RMYA 3ASIA 2P3IA 2D3SA 3EHKA 3E5UA 4NO4A 3SHRA 2YC0A 4B3NA 4ASLA 4RHV3 5A33B 1JTZX 3VKNA 2AH2A 2ZKLA 4XFIA 1HLCA 5E16A 5GZFA 1W6MA 4FXGB 4CDQA 1AR62 1U0AA 1QQP3 1DGRN 2WZR2 4ZU4A 4Q0VA 1KFXL 3M3EA 2A6ZA 4AE2A 1DGRA 1QJZA 1RUD2 1RUD1 1SLBA 4XQDA 2RM22 2RM21 2OZ6A 4MV2A 3OY8A 4YZ3A 3SH3A 4M3CE 3ZSMA 1C8NA 3ES4A 4L8QA 2MEV2 2MEV1 4XF4A 3PVEA 2E6VA 1OA4A 3SH4A 2W08A 4FQZA 1ZBA2 2JG9A 2WNUA 1CGPA 5DUXA 1QXPA 2NZ9A 2RS12 2RS11 4Y22A 3OCPA 5HCAA 1REDA 1XXNA 2HWC2 3O14A 5T5LA 2HWC1 3V0AB 4Y1UA 1S0DA 1QXJA 2PQQA 5BNPC 5K7PA 4K1ZA 3O0WA 3USSA 1FATA 2DF7A 1AX0A 4KBBA 5F6LB 4Q4W2 4Q4W1 4G3YC 3HBZA 5C4WC 1PO23 1ND3B 1RUNA 1U5XA 1D4VB 2KM2A 2BPA2 1WLDA 4AVSA 4W6WA 3MW4A 3WQ7A 1AL23 4FBFA 4LBKA 4O9EA 3FE5A 1J1LA 1KJRA 4IERA 3E6BA 4AK3A 3VDDA 3VBSC 2HJIA 4HBNA 1H8VA 2WNVC 5BY5A 1DDLA 1UF2C 3RYRA 2B42B 1ONAA 4LUMA 1C5IA 3M3OA 1DZTA 1PGW2 1F31A 1PGW1 1VB2A 5CADA 4ITCA 1MS1A 5CU1A 3J8F3 4I0BA 4N9HA 1WCDJ 2ZABA 1V70A 1RGSA 2BFUS 2Y26A 3E5QA 2E63A 1RUH2 1WD4A 4XYXA 1PM7A 3D0SA 1JH5A 1SBEA 1D4M3 3BOPA 5SV8A 5GZGA 1WA4A 1L3JA 5F1RA 4FO9A 4P9JA 1FNZA 3VHNA 3CJIB 1GYKA 2XJSA 5DDJ3 5KHIA 1PO13 2A3WA 4QPGB 2NN8A 2F4PA 2CGNA 4TSVA 4WZFA 5C9AC 3P3PA 4J1XA 1WGPA 2PAEA 1H8TA 1V6KA 1V6OA 1Q8OA 3KM5A 3NW4A 1GV9A 1CONA 2AENA 2G9GA 4Z92B 1WCSA 3ZN6A 4AW7A 1NE6A 3B9IA 1AR63 4KWJA 1FOD2 2WZR3 2ZBJA 2QNKA 2VVFA 4XHXA 1RJ7A 4AHXA 5AFEA 2GNMA 1RUD3 3EO6A 1LHWA 2RM23 1I5ZA 1TEIA 2QUOA 2EXKA 2MEV3 5SV5A 3AZZA 2B8MA 3AFGA 4I3PA 3PVNA 3J4UH 1ZBA3 3E6DA 2HWE2 1LHNA 2HWE1 2RS13 3UKVA 3ZXLA 4XTMA 2HWC3 3QOPA 5JDBA 1HXS2 1HXS1 1UCXA 5FO7B 4LT5A 1UL9A 3OD4A 2BNOA 1VIWB 4Q29A 3IN9A 1C57A 3EJKA 5I8YA 2VU9A 4X8PA 4TYSA 4N53A 4Q4W3 4FOQA 3USUA 2V73A 1VBB2 4QGLA 4Y4YA 1XYPA 4C91A 2AZ5A 3VZLA 4CEYA 3WQ0A 4HFSA 3K51A 1CAWB 4COZA 4DOUA 3GHNA 1NCRB 1MR5A 1LHOA 3ZFFA 1YFUA 2D6MA 2UURA 2ZGUA 2D40A 4I02A 4OUSA 3MF6A 4Y20B 1LGCA 3KB5A 1SBDA 4PJYA 3ROUA 3W58A 4Q1PA 2GZWA 3ZFEA 1BCXA 4MXVA 3VKLA 1J3RA