2RS12

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
b'GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1200
2WS93 3NAPC 5L7OA 1QJX1 1VBE2 4SBVA 5D8AA 4AEDA 5ABJB 1ZBE1 5C4WC 1OOPB 3VBSA 1ND2A 4Q4W2 1NCQA 4GB32 2RM23 2WS91 4YVSB 1COV1 5BNOC 4YVWB 4PDWC 3VBFC 1VBA2 2MEV2 4IV3C 1SMVA 1EAH3 3VBOA 4WM7A 4LLFA 1AL0G 1R1A2 2RS13 4RR3B 4CDQA 2RM21 4CDWB 2XPJA 3CJIB 1VBD1 1Z7S2 2HWB3 1RUJ3 4Q4Y2 2HWC3 4FTSA 1FMD1 1TMF2 1RMU3 3JD73 1RUD3 1EAH1 3VDDA 5BNPB 1HXS1 1MQTB 2IZWA 2RS11 2HWE1 3VBRC 1QJU2 1AL23 1RB8G 2RS33 1VB2A 1RUJ1 2HWC1 2GH8A 1RMU1 3JD71 4IV1B 4QPIB 1RUD1 3J8F3 2PLV3 3VBHC 3TN92 5L7OC 1F2NA 1QQP1 3LOBA 2R062 2Y26A 1MEC3 2RS31 5D8AC 3ZFFB 4AEDC 2BUKA 4Y5Z0 5DDJ2 1ND2C 2R073 2VQ0A 5FMOS 3VBSC 1VRH2 5LK7B 2HWD1 5BNNB 5ACA2 1FPN3 4NWWA 2RMU1 1POV3 1PO13 5J96B 1RHI2 1PO22 5CFDA 3VBOC 2R071 1AR72 4QPGA 4WM7C 4CDQC 1R082 1AR61 1FOD1 1RUI3 2WS92 1FPN1 3ZFFC 3VDDC 3M8LA 4Q4V2 1OPOA 5AC93 1ND3B 2RM22 1RUI1 1BEV2 5A33A 1NA1B 4JGZA 4RS5B 1RUC3 1EAH2 3NAPB 1AR92 5AC91 2RS12 1TME3 1VBC1 2WFF3 5C4WB 1VB4A 2HWB2 1RUJ2 2HWC2 1K5MA 3JD72 1B35A 1AYN1 3DPRA 2ZAHA 2ZZQA 1QJX3 1RUH2 5BNOB 1TME1 4PDWB 3VBFB 1AL22 4IV3B 2RS53 1ZBE3 2RS32 5FMOL 3JBG3 1AR81 5CFDC 4QPGC 4EJRA 1X36A 1PIV2 3J8F2 4CDUA 4RS5C 2PLV2 2HWF3 1VBB1 1COV3 2RS51 1MEC2 1C8NA 3JBG1 4CDXA 3VBRB 4JGYA 2HWF1 1PVC3 1WCDJ 1A6CA 1VBD3 4Q4X3 5K0UA 1FMD3 2FZ2A 5JZGA 4JGZC 3VBUA 3S6PA 3VBHB 2RR11 1PO12 1HXS3 1ZBA1 2HWE3 5L7OB 4GH4A 1PVC1 1RUG3 4CEWA 1X33A 1V9U2 1M06G 4Q4X1 5D8AB 4AEDB 1RUI2 3VBSB 1ND2B 2X5IA 1K5MC 1NCQB 1PGL1 1B35C 3DPRC 1C8M2 4FTEA 1RUG1 1QQP3 1ASJ2 2XBO3 1NY72 1PGW1 1W39A 4WM7B 3VBOB 3JB4C 5C8CA 4CDQB 2HWD3 4CDUC 1RUC2 2ZTNA 5A32A 2R041 2RMU3 1TME2 2XBO1 1HRI2 2WFF2 3VDDB 1D4M1 4FSJA 1BMV2 4CDXC 1R091 1NCQC 1HX6A 4JGYC 1RVF2 1AR63 1FOD3 1BBT1 4RHV2 4N43A 1QJX2 5K0UC 5JZGC 3VBUC 4RQPA 1H8TA 4WM8A 2RS52 1ZBE2 3ZFGA 3JBG2 4GH4C 1RUE1 4GB33 4GMP1 1NOVA 5CFCA 1COV2 2X5IC 1VBE1 2DF7A 3JB8A 1IHMA 5C9AA 1NCRA 1PVC2 1VBC3 1VBD2 4GB31 4Q4X2 5CFDB 4QPGB 5C8CC 1FMD2 1AYN3 1VBA1 2MEV1 1HXS2 2HWE2 4N53A 1R1A1 1RUG2 3ZXAC 1VAKA 4CEYA 1AR83 1RMU2 1PGW2 1RUD2 1RUF3 4Q4Y1 1HRV3 1AUYA 5A33B 1VBB3 4N43C 4JGZB 4Y4YA 1QQP2 2BPA2 5GKAC 3ZFEA 2XBO2 1H8TC 4WM8C 4GMP0 1RUF1 3ZFGC 1HRV1 2HWD2 4Z92B 5ABJA 3TN91 5CFCC 1K5MB 1OOPA 2RR13 1B35B 2RMU2 3DPRB 2R061 1ZBA3 4YVSA 2R072 1NCRC 1AR62 4YVWA 1VRH1 1FOD2 4BCUA 5ACA1 1AYM3 1FPN2 4CDUB 4RR3A 1HQNA 3HAGA 4CDWA 1CD3G 3CJIA 1RHI1 1PO21 4N53C 1AR71 4Q4V3 1R081 1AYM1 4CEYC 4CDXB 5BNPA 1MQTA 1BEV3 4JGYB 1OHFA 1NG0A 3FBMA 5K0UB 5AC92 2R043 5JZGB 4QPIA 1AR93 2FZ1A 4IV1A 3VBUB 4Q4V1 3ZFEC 1VBC2 1D4M3 2BBVA 2WZR3 1R093 2GSYA 1BEV1 4GH4B 2BFUS 4CEWB 1BBT3 1AYN2 2TBVA 3ZFFA 5ABJC 1EV13 2X5IB 1AR91 1OOPC 1RUH3 4RFT0 1QJY3 2WZR1 5BNNA 1AR82 4YVSC 4NWVA 1RUE3 1RUF2 2HWB1 1GFF2 1HRV2 4YVWC 1PIV3 4GMP3 1VBB2 1EV11 5C8CB 1VBE3 1RUH1 4RR3C 1QJY1 1AL21 4CDWC 1CJDA 3CJIC 1F8VA 4CEWC 5A32B 2HWF2 4Q4W3 1PIV1 3J8F1 3IDEA 2PLV1 5BNPC 1MQTC 2RR12 1VBA3 1ND3A 2MEV3 1ZBA2 1MEC1 4N43B 1R1A3 4Q4W1 4QPIC 1NA1A 4IV1C 2QQPA 4RQPB 5J98B 1H8TB 2WWSA 4WM8B 4RS5A 1V9U3 1Z7S3 3ZFGB 3NAPA 1AYM2 4Q4Y3 1TMF3 1PGL2 1POV1 1PO11 1C8M3 5C4WA 5CFCB 1QJU3 4FTBA 1ASJ3 5FOJB 1V9U1 1Z7S1 5BNNC 2BFUL 5C9AB 1TMF1 1NCRB 5BNOA 4PDWA 3VBFA 4IV3A 1C8M1 3TN93 2R042 1QJU1 4RQPC 1ASJ1 2R063 1D4M2 2WZR2 1R092 1HRI3 1NY71 4N53B 5DDJ3 1VRH3 1BBT2 1E57A 1QJZA 2WLPA 1DDLA 1RVF3 4CEYB 5ACA3 4RHV3 1RUC1 1EV12 3VBRA 1QJY2 1ND3C 1RHI3 1HRI1 5C9AC 2WFF1 1PO23 5DDJ1 1AR73 1BMV1 1RUE2 1NA1C 3ZFEB 1R083 1RVF1 3VBHA 1POV0 4RHV1
chains in the Genus database with same CATH superfamily
2G1MA 4HMZA 3JXSA 5FXZA 1BK1A 3MPPG 4E4HA 1VBE2 3VD4A 1XBFA 1F31A 2XH6A 2IXCA 4BISA 3GDBA 5FPVA 3RRDA 3WW2A 1NAEA 1C1FA 1OOPB 2ZHNA 3T1LA 4V2VA 1YWKA 4GB32 4QPYA 4RD7A 2QQWA 4EZHA 1PMJX 3C2UA 2HEWF 2QQUA 3WNLA 3C3VA 3EYPA 1AJOA 3AKTA 3KHBA 2GMPA 3FUQA 1IS5A 2XXZA 5A6QA 3NKTA 1EAH3 1XRUA 3OD4A 1QHDA 4R9CA 1ULPA 4WM7A 4LQRA 4B8EA 5ERLA 1GZCA 4OHXA 5L36A 4PF1A 1AXKA 1LOEA 1Z7S2 4M3CE 4DOUA 4HZFA 3O1SA 4NIHA 3C7OA 3JQWA 1RUD3 4UFJA 3PVOA 1HB4A 2VQTA 1CZTA 1EAH1 3O1RA 3DKWA 5CKNA 3EO6A 1LOBA 4IXLA 3RFRA 2E26A 4FPEA 4ZU4A 3VBRC 4BQWA 4HVQA 4QKFA 2A3YA 3WR0A 4Q5OA 1BXHA 2YGLA 4O7XA 5FWEA 2WIIB 2IFRA 2W1UA 1CAXA 3CHXA 3WNOA 4BYYA 1K3IA 3RZGA 5FWJA 5IUQA 1RUD1 4ASLA 2PLV3 2ZHKA 2J42A 4AWDA 5IHRA 1W6NA 4LO8A 3WQ0A 3T2PA 3AZVA 5F2SA 4Y1XA 4H14A 2D93A 1QQP1 2XVLA 2ZZJA 4LMFA 2XJQA 3LGRA 2J1UA 3AMMA 3O0VA 2VW1A 3POIA 1UX7A 2DU1A 3AMPA 2BUKA 4YM0A 1W6MB 2DFCA 3SHRA 4RGAA 5LK7B 3D0JA 2HWD1 3CMGA 3ES4A 3ACFA 4XUQA 3TBDA 4P9GA 5ACA2 3AJYA 4Y1UA 4NVPA 3WZ1A 1PNFA 1FPN3 2OYZA 3VZMA 1TVGA 4FOVA 2JIJA 4CU8A 1SBDA 1WMFA 2ZGOA 4Y5SA 1N1SA 2UY9A 1DBNA 4WM7C 1AR72 5J37A 1W6PB 5GLZA 3DYPA 3AFGA 4N8MA 3V56A 4L97A 4IE5A 4BB3A 4IW3A 1JZ4A 2D3SA 1FPN1 4LKSA 3O1VA 4L99A 5IVBA 4AAXA 4L92A 5ANNA 3B69A 2AENA 1DGWX 1DLCA 1OD5A 1S0JA 3AVRA 2UU8A 3M3OA 4XURA 3WHUA 4D94A 5DZEA 4Q4V2 3AMHA 1K5JA 4FPLA 1OUXA 3KF3A 2VPVA 3IDBB 2RM22 3D82A 5FFOC 3CJXA 2CHHA 3LAGA 1MZFA 2AUYA 3KT4A 4XBNA 4BDVB 1NA1B 1ZNPA 3KCYA 3WNKA 4FI9A 1E5HA 4RS5B 4RA0A 5LRRA 1JYCA 5A3NA 3HQXA 2D6KA 1CVNA 1UZZA 4HN1A 4M4PA 5IAVA 5FO8B 2WNVA 5J1XA 1NKGA 4ITCA 4ZXEA 3IZOA 4R9BA 1VBC1 2VECA 1BVVA 5EWSA 3OY8B 3GCWA 3VHRA 1GUIA 3FWEA 5C4WB 2HWB2 1AHSA 4JKLA 3UKTA 4CXYA 4LOTA 4QQOA 1TEIA 2BGCA 1AYN1 1I1EA 1ULOA 2W91A 2GAUA 5JOZA 2ZAHA 1F9KA 3T30A 3QBQA 1RUH2 4HOOA 4CRQA 5BNOB 5FMBA 5A7NA 2K0GA 3J4UH 4JV4A 3WF4A 4AI9A 5JPMB 4K6BA 1AL22 4P9IA 4IV3B 3OPWA 5F2WA 4OQ9A 3MFCA 3MI8A 3FUOA 2C4XA 3VKFC 2GH2A 4XUPA 2G4IA 1X36A 1VAVA 3DGTA 3J8F2 3OB8A 4RS5C 3S57A 2IXIA 4J1WA 4BH9A 5A6YA 4XQDA 3U1XA 1GICA 2YROA 1JUIA 1NLSA 1H6XA 1U5YA 3GCXA 4META 3VKLA 1MEC2 1C8NA 3KQRA 2JG9A 1LKNA 1YC61 3V0AA 4QAWA 3I3QA 3TAYA 4MH0E 2V5DA 5E1RA 3I7DA 1PVC3 3K4ZA 4AQ6A 1WCDJ 3M3QA 1VBD3 5FAXA 4LT5A 1W3VA 4Q4X3 2W2IA 3ZN6B 4CU6A 2FZ2A 5LA0A 3LA3A 4YZ4A 5JZGA 3HOBA 1DQ5A 1JYIA 1DLLA 3H3LA 3NNGA 4A45A 2EF6A 3KZ4C 4BIFA 4ZZ5A 4D6SA 2JDHA 4NO4A 1PVC1 1J83A 1RUG3 1UAIA 1X33A 2WNVC 5FY8A 2ZABA 2D5FA 1M06G 4Q4X1 2B45X 5D8AB 1JZ6A 2GC0A 4GWJA 2VAUA 2A7AA 4QHZA 2JE9A 2X5IA 3B5LB 3IAQA 4YW3A 4CPBA 5A3PA 2E33A 1GLHA 1NLRA 1UO9A 5CG8A 5DMYA 1E5RA 2P34A 1HV1A 1UZWA 3KD4A 4FTEA 1U5XA 1RUG1 1DGRA 4LJHA 5FY5A 1ASJ2 4DY5A 4GZ9A 1MACA 4Q1PA 4XQ4A 4RSUA 4XJ8A 3P3PA 2JECA 5EJZB 5C70A 1PGW1 3VBOB 1HQWA 2WR9A 1OI6A 4YGCA 4CDQB 3ILRA 1LEDA 1POQA 5FCCA 4QQHA 1S4CA 2UWBA 1JYNA 2NMOA 3PDQA 2RMU3 1OLRA 2ZACA 1JYWA 3MBWA 1A8DA 1HRI2 2JG8A 2WFF2 2JG9C 2FDKA 1EYBA 3IDAA 2YY1A 4FPCA 1WMDA 3T09A 4A44A 4QKNA 1FOD3 4OHVA 3H8OA 1UL9A 5IJRA 2Y6GA 4N43A 5HXVA 1QJX2 2Z69A 4K40A 5JZGC 3PNAA 4KNCA 2IXKA 5EP9A 2WL1A 4RQPA 3SXWA 1E5SA 3VKNA 5FR3A 1SLBA 1ZBE2 4XFBA 1AZDA 3JBG2 3LF7A 5A7QA 3OBTA 4EZ4A 5J7MA 2XLFA 3WNXA 2NM1A 4XAEA 1OVSA 5FZFA 3RZMA 1HB3A 2ZEZA 4JVAA 2PN5A 3URFA 2V4AA 2VOWA 2X5IC 1LECA 3DV8A 2GNBA 3WQ1A 5AFBA 4BMEA 5KXCA 3R4DB 5FK7A 3MIGA 4E2GA 1IHMA 5LY2A 4EROA 1KRIA 1C3HA 3H8XA 2DUOA 2HBUA 4W6YA 4Y24A 3SMHA 4D7TA 5FYYA 3MLJA 4TN7A 5K4LA 4W6WA 3O1MA 1UOFA 3PVNA 2W5FA 1TE1B 4QPGB 4E2SA 1FMD2 5FZEA 2ET7A 1D2SA 3ZN4A 1W6OB 4D7YA 3N36A 4XDPA 4NRPA 1HXS2 1LGBA 1T6BX 2VG9A 2HBTA 2W94A 4MYEA 1R1A1 3POBA 1RYYA 2WAOA 2WWUA 3D6EA 4MGIE 1KDMA 2JG8C 3A7QA 1NQJA 2Y6LA 3OGRA 3MZHA 1UU4A 3O1TA 3ZYFA 1RUF3 3H7YA 2ETEA 2P3KA 3WDUA 1WA6X 1QGLA 1AUYA 3ZYGA 3PVEA 4YM3A 5FQ0A 5A33B 1VBB3 2W3JA 1QMJA 4N43C 1O3QA 4JGZB 2J7MA 3D0SA 4QXBA 5GKAC 5H9SA 4FPKA 4YWAA 5BUVA 4GMP0 4FP2A 3BTZA 1RUF1 1MVQA 2A6VA 2ZBJA 3VV1A 4JDMA 2WNUA 3W21A 3X29B 4E2QA 5FYBA 1AF9A 1EPWA 1WBFA 3MIDA 3ENRA 3EXUA 4AVBA 1AX1A 5ABJA 2MHFA 3ZYJB 5C6CA 5F6KA 1Q8VA 4QM9A 1CJPA 2ADEA 5CG9A 3DPRB 5AVPA 3LSEA 4LKFA 2VCBA 3OGGA 5FOBB 1UZVA 1OSGA 4YVSA 3ILFA 4BM8A 2I74A 3OGSA 3WDWA 1LGNA 1W2AX 1VRH1 4H3WA 2A1XA 1UY1A 1H9WA 5LB6A 1H2NA 2JDMA 4LTAA 1ZRRA 2WWJA 4R52A 4CDUB 2XOMA 4RR3A 3LOIA 4M3CA 4QD2A 1W8OA 1CD3G 4CDWA 1NE4A 4PQ9A 3NSTA 2AH2A 1PO21 3K77A 4BHPA 1SQ4A 4I02A 2ZHMA 1SDWA 4XEZA 3TYJA 1XPWA 2G9GA 2OW4A 2DCKA 2DDUA 3POYA 2W47A 2VMDA 4FAGA 1O4ZA 2ZEXA 2D7FA 3PTYA 5T55A 3VDBA 2OXBA 3W20A 2JENA 3MGUA 4IQPA 3BCWA 4K3UA 5A7WB 3DKQA 1WD4A 4JRAA 4J1XA 5LY1A 4FPOB 3ZR6A 2R043 3I2KA 3B9CA 3S5QA 4J25A 2FZ1A 3U0ZA 2WO3A 1W0OA 4XFHA 1K12A 1ZZ6A 2LW8A 2IWGB 4XW3A 5FXXA 1D4M3 3ZSMA 5IT6A 1R093 4XCBA 3WP5A 4GH4B 1W2NA 4Y20B 4D8MA 4COWA 2WNUC 1A8MA 4PJYA 3UKVA 4CA9A 1S55A 1MS0A 4QB1A 1CAUB 2NP0A 3WY6A 5ABJC 1XNAA 1ULEA 4A6OA 1VE0A 4PLMA 2PAKA 4RFT0 2PHXA 5F39A 1QJY3 2P17A 4EN9B 4ES8A 3RYKA 1AR82 1UYZA 2VMGA 4UW4A 4YVSC 3CU7A 1VAMA 5F3IA 3NRUA 3ZX7A 5SV5A 4PT6A 2NMNA 1VALA 1HRV2 4LITA 1PIV3 3FMGA 1MVEA 3IPVB 3M4FA 3MF9A 1W90A 4QWNA 4GMP3 1AVBA 4CXXA 4GWNA 5T5OA 4XF9A 2BJSA 2CAUA 3CIHA 5FLHA 3WP4A 4RR3C 1QJY1 5E8AA 2XL9A 5DQ0A 3NJXA 1F4HA 1JOBA 1YHFA 2ZXQA 1ZZ7A 4CDWC 4CUGA 5FZIA 2Y0IA 3HVDA 4KWLA 4HKLA 2E7QA 5EYYA 2VTXA 2HWF2 3AFKA 3KS7A 1XNDA 2QE3A 1PIV1 4DXRA 2NLRA 2A6XA 4DPNA 4BOWA 2GMMA 1O6UA 4Z1VA 1IQDC 5JI7A 2JIGA 2VULA 2A5ZA 4NPMA 1BLZA 1W8ZA 1S0BA 2MEV3 4MSVA 4I01A 3DYOA 3VUOA 3A4UA 1ZBA2 3O0WA 5FY9A 3AJZA 1NXMA 1EUTA 3LPGA 5FP3A 3AK0A 4EWAA 5M0TA 1JOJA 2I45A 2JDNA 3C7HA 4AHXA 4KWJA 4EN7B 4ZPIA 1Y3TA 1H9PA 1V9U3 4XJ9A 4Y1VA 3NAPA 4Q4Y3 2R7EB 1PGL2 3FBYA 1C1LA 4KI5M 1CAWA 3I3DA 5EIYB 4DQAA 3MUY1 3UL2A 3GYDA 4FFHA 1MPXA 1YI9A 5CFCB 1FNYA 4COYA 2BZDA 3TRSB 2LM3A 4FTBA 5F32A 1R64A 5GZCA 2IVIB 1AX0A 1V9U1 3NV1A 4X6QB 4L9BA 3P1IA 2XG3A 3BOWA 2OIIA 1NCRB 1HQLA 3H3UA 1QDOA 4JAAA 4PDWA 3KLSA 3VBFA 1WLDA 1LHNA 4XACA 4Q0UA 4PIZA 1YJLA 4QX2A 5AFEA 5HXMA 1UWWA 2A73B 2QUOA 3H8RA 2BV4A 3B7MA 5FPUA 5IFTA 2LROA 1QH7A 5CVRA 4J6GA 5LBEA 5JIUA 1W2UA 4OYUA 2WJSA 2QBXA 5LBCA 4NMIA 1MS1A 1NY71 1YQ2A 2DVAA 1W8TA 5DDJ3 4QGNA 5FO9B 2RJKA 3HQRA 3ZYPA 4LR4A 3MEPA 1SACA 1QJZA 3DCQA 2WLPA 2XUMA 3N9NA 3KGZA 3P5BA 4MLOA 3K3NA 4XUOA 4B7KA 5JXHA 1CZSA 3H50A 3OBZA 5LA2A 4HN0A 2DCTA 2YUEA 2D6MA 4JKKA 1EY2A 3T2QA 2Y6JA 5IATA 2PAEA 1JS9A 1TG7A 4DS0A 3LDBA 5JVVA 5DDJ1 3ZYBA 4W8JA 1RUE2 1ZX5A 1H1MA 1R083 2VTFA 3VBHA 2ORXA 2PHTA 4COVA 1MZ5A 3NAPC 4QT6A 1GMMA 4NHXA 5GLVA 2ET1A 4Y33A 5JSRA 1KS4A 4P08A 4BWOA 4MZUA 3WHTA 4SBVA 2Q30A 5FDBA 1UYXA 3ZN5A 5A3MA 1BZWA 1ND2A 4IEOA 4NAOA 3IIAA 4LEJA 3J7NA 3ZKYA 3N4MA 1W06A 3EMRA 3F95A 3N9LA 4FPYA 1HN0A 5FO7B 1ZZBA 4LK7A 3S7EA 1COV1 2VZPA 5FPXA 4QX1A 4PDWC 3VBFC 3U37A 1VBA2 2E53A 4FQZA 2PHUA 1SMVA 4YZ5A 3I3MA 4FQ4A 1NT0A 2VBDA 3JU9A 5FYSA 4LHLA 3I97A 4NIIA 4IEUA 5A1LA 3POWA 4GWIA 3Q8BA 2DCZA 3BIWE 4GA9A 1V6NA 3PU3A 3GHMA 3CJIB 3WNMA 5CISA 1UY4A 3B93A 3I59B 4MADA 1OH3A 1TMF2 3O7OA 1RMU3 3JD73 4G3YC 1N3QA 2IFWA 3H9AA 3R4UA 5GZEA 5T52A 1RJ8A 1LHWA 3VDDA 5FMDA 2IZWA 3BVCA 1KGYA 2HWE1 4Y22A 3UV9A 4YARA 3BU7A 3FLRA 1RB8G 4X6RB 3ZSJA 2XJSA 3B01A 2RS33 1VB2A 5FZOA 3ZIXA 1OQDA 2GH8A 1RMU1 1DGWA 2V72A 3JD71 1VPHA 3OGJA 4IV1B 4DRVA 4LKDA 5DAXA 1JZ7A 2KM2A 4MX3A 3VBHC 2L9LA 3TN92 2NPIA 2Q8DA 5CADA 3L2HA 1NXD1 1ST8A 4IEXA 2R062 3MICA 1SCRA 2RS31 3M2MA 4H7MA 3ZFFB 1Z78A 1CIYA 4Y5Z0 5FMOS 1ND2C 1NZIA 2R073 5A7PA 4HFSA 2N7GA 2YGMA 1XXNA 3IDCB 4AGGA 4NN0A 4AVSA 5BNNB 2KD7A 4MXWA 4AVAA 5FBJA 5DUVA 4EWEA 1BCXA 3L2YA 4XUNA 2XHKA 2EIGA 3RZLA 4NWWA 2GP5A 1W6QB 4Z82A 1PO13 3ZSLA 1RHI2 3ROUA 3ZYRA 5CFDA 2R071 4IDZA 4WVMA 2EIDA 4I2OA 3J9SA 4LULA 3LB9A 1AR61 2A3XA 3I54A 3ABZA 4HL0A 4BQ1A 4N90A 4D7SA 1TQ5A 3T1MA 3ACLA 1S0DA 1MS5A 5HPOA 1GQPA 2X09A 4OI1A 2PELA 4QX0A 3OPTA 3OUHA 5HBAA 3K4AA 1BK0A 4M3CF 3MIHA 3ZFFC 4LE3A 4B1LA 2CGPA 3VDDC 2Y38A 4AFAA 5LRSA 1HKDA 4UFMA 3ITQA 1XYPA 1RL3A 2J22A 4U2AA 3QACA 2VNRA 3AYDA 5EJ1B 1BEV2 4Y4RA 5JIAA 1GWLA 3RDIA 1H4GA 1ULFA 2VTXJ 3ZMOA 2GN3A 1S0GA 4QGMA 3WDTA 1YI7A 3NVCA 4Q26A 4BPZA 1GZWA 2B42B 1RUC3 1EAH2 3OEAA 4PI0A 5FXVA 3WX5A 2R16A 1PNGA 4IEZA 2XJPA 2VR4A 1J3QA 2VH9A 3GBFA 4AVTA 5KBFA 3WF0A 1WLCA 3VHNA 4EN8B 1ENSA 2QFEA 2YPJA 3SH3A 3WG3A 1VB4A 2CY6A 3B94A 4LO5B 5C7GA 3IM0A 3TEWA 3RZKA 1K5MA 2A6ZA 3M3EA 4ET7A 4E27A 1W9FA 1LNSA 4IEPA 5A70A 5HV4A 2Y33A 2J1VA 1O59A 2QQVA 2ZZQA 4XABA 2OQ6A 4QKBA 2XONA 2ZJCA 5KHJA 4W50A 1JMUB 1MS4A 4UW6A 1SPPB 1YFYA 4GKYA 1LB2A 5FMOL 5CFDC 2HH9A 4R9AA 3VL9A 3IT8A 1P8JA 3H3ZA 3MW2A 2PLV2 3N7LA 5DZGA 3VHPA 2VVDA 1VLNA 2XQRA 3BIEA 4KU7A 1EP0A 4LA2A 4PQQA 4QQPA 1WMEA 5FP4A 2D3PA 2ZAAA 3USUA 2WQ4A 5IK5A 1D0HA 4E9KA 1W05A 4COUA 4MGYE 4YLZA 2FDFA 3PUAA 2H6CA 4SLIA 3KWVA 4CDXA 3TNPB 3VBRB 3CZUA 5IK7A 1A6CA 1YNAA 1LHOA 3E6CC 5IW0A 4LBOA 3BODA 3CBNA 1RINA 5K0UA 3PU8A 1HN1A 1SLLA 4LXLA 2VUJA 2BU9A 3ZYHA 4CP9B 2RR11 3VL8A 4CCMA 3HD8B 3CDZB 5FZ7A 2B4KA 5FY4A 4TTGA 1H1AA 1IS6A 3KCXA 4O65A 3WNPA 2F4LA 4FCAA 4TXWA 4NAMA 4Z8BA 1YUDA 5A3TA 2X53S 1LEMA 1QXPA 5JUVA 4P5HA 4NPRA 1V6KA 2EAAA 1K5MC 3BTAA 1N3PA 4M0NA 2MNGA 4XC9A 3ZOIA 1MS8A 3AL6A 1WMXA 1LHVA 4CCCA 1QQP3 5FKBA 4Q29A 4UFKA 4HONA 2CNAA 2XBO3 3KGLA 3SEEA 4B4RA 2K9ZA 4B3NA 3ZO0B 4C1XA 4WM7B 4XHXA 3JB4C 1UF2C 1UOGA 4M4RA 4AI8A 1KS5A 2HWD3 4V2WA 4L0PA 3RMYA 1PK6A 4WV8A 5ISLA 3K3OA 4S2DA 3I2DA 3SCHA 4LE4A 4NROA 2Z4FA 1W0NA 2YC2A 5DN2A 1FYUA 4GJYA 5CKQA 1HB2A 1J1TA 2XBO1 3N9OA 5DPNA 3O1UA 1GKBA 5E16A 2YFUA 3E6BA 3WW3A 4FSJA 2BTVC 1BMV2 4CDXC 4BLJA 3AX4A 1OF4A 1BBT1 1JN2P 1NX9A 4QM8A 1CAXB 2PXJA 4JQRA 4JZRA 4ONUA 3IB3A 4AL9A 2TEPA 3SCFA 4YW1A 5K0UC 3PUSA 5FIXA 1YQ8A 3RI8A 3ECQA 2EALA 2ARBA 1W9TA 4DUVA 5JR2A 4OHYA 1FI2A 1VIWB 4IGPA 4OULA 1IPJA 2ZKLA 4WM8A 1W6NB 1AXZA 1B09A 2WSVA 1D4VB 2ZMNA 5A7OA 1YO8A 1O3RA 2Q1FA 2BP6A 1LRHA 4I0AA 5G05L 3I2IA 4GB33 1AJKA 3MW4A 4YG0A 1NOVA 4L11A 1PMIA 2WO7A 1VBE1 1XNKA 1JU3A 3JB8A 1C28A 5BXXA 3WUCA 4GAZA 1ZRFA 1Q43A 5ANQA 5FYTA 5C9AA 3AXDA 3BALA 5JOYA 5KR7A 2VCAA 1PVC2 1I9RA 2PA7A 2ZGPA 1VBC3 2E9QA 5FZGA 1JYVA 2GNDA 3S30A 1VBD2 3FJSA 4GB31 4AI1A 4Q4X2 2Q1ZB 1NZCA 4A7ZA 3LPFA 2RVAA 1ZM1A 3Q8AA 5BV6A 1GWMA 2VW0A 2PAMA 1XYOA 5FYIA 4INDA 3GJBA 3AP9A 1AYN3 4IE6A 5F5CA 5A3UA 1PK6C 1Q56A 2EVXA 1OFNA 1FX5A 4N53A 4XF1A 2JICA 1WW4A 3IWZA 1RUG2 5JOXA 2VOVA 2XVGA 2IVJA 3U14A 5EYXA 2WA4A 2XDVA 1NE6A 2YZ4A 5FP8A 1PGW2 4YGEA 3PHMA 3GZEA 1Y9QA 1NQDA 5LASA 2AGSA 2YXSA 1HJFA 4XZPA 3LA2A 1QNYA 2VNVA 2BPA2 2BNOA 4KGQA 5A1AA 1HB1A 1QJFA 2BW8A 4DFSA 4HANA 1QOSA 3AKPA 3MW3A 3H1WA 4RGKA 4WM8C 4OHZA 4OMDA 5GJ6A 3I49A 4KG8A 2WNVB 3NL1A 4FXGB 1UU6A 5F8PA 5JWPA 3OCPA 4Z92B 3D4KA 1LAJA 2FCUA 3QH7A 1DP0A 4W4ZA 3HBZA 2VW2A 4YW7A 4XFIA 4K8FA 1BKZA 5DAPA 2TNFA 3OTFA 4XDOA 4YNIA 3FHAA 2RMU2 4R9DA 4NIDA 2O8QA 4GXLA 3VZOA 4AFMA 1UIKA 3U07A 1CGPA 3N7KA 3CF6E 4M01A 2OQ7A 2XL7A 3FN9A 2CDOA 1N1YA 1FOD2 4YVWA 5FZDA 5I91A 3ALQA 2SBAA 1UCXA 4NRMA 2PHFA 5ACA1 2UURA 1BQPA 1JOPA 2VM9A 4ZXKA 1V6LA 5I8TA 5I0RA 5JMCA 1UXXX 1UNBA 4MXVA 3HN1A 1GNZA 4N53C 3CLPA 2DCYA 5FZBA 1AR71 4JX0A 1IPKA 2W08A 1O8PA 2IXHA 4KU8A 3ZXGA 1JBCA 2BBAA 4Q4V3 4WVVA 1Q8OA 1DZRA 2JG9B 1CZVA 3V0AB 4JDNA 5BNPA 2AZ5A 1MQTA 3FL7A 4IERA 4A7YA 1H1IA 2Y64A 2V73A 3AYEA 4B29A 1O5LA 5AC92 1S1AA 4TLGA 1ULGA 5JZGB 2H0BA 4QPIA 5DZFA 3VD9A 4Q4V1 3T3YA 4FXKB 3M3CA 4I0WB 2ZA9A 4XFCA 2BBVA 3G7DA 2WZR3 1WCUA 4DIQA 2VO5A 2KA3A 3AM2A 3POSA 3POFA 4XTMA 3VZNA 1S0IA 4FOQA 5JOWA 3HQUA 1DQ6A 1GWKA 3I2HA 1X9TA 1W2OA 3Q9OA 4WVWA 3G6JB 4MGZE 2X5IB 2CWMA 1G9DA 1RUH3 1H2LA 1UOJA 3I2JA 2X8KA 5EPAA 1OLQA 2WZR1 2VNOA 4OI0A 2B8MA 1W8NA 2P1BA 1RUF2 2HWB1 5FMCA 1GFF2 1UKGA 3LKJA 2QZ2A 4YVWC 5HCBA 5JAXA 3DXUA 3OOXA 1VBB2 5A6ZA 4AW7A 5KXBA 3NJVA 1QXRA 1RUH1 4XYXA 2AEZA 2GMEA 2XMLA 1YXWA 4GQ7A 1VMFA 1YIFA 2P3IA 1AL21 2Q0AA 3LEKA 4LLOA 4WBBA 3M70A 1PGSA 3CKHA 2WLQA 1JI6A 4DRRA 1BJQA 3I2GA 4DUXA 4Q4W3 4XE9A 3RG0A 3J8F1 3DUIA 1US3A 1W8FA 2JG8B 4OUEA 2ZX4A 1X82A 4JTNA 4HETA 5BNPC 5GLUA 3ACGA 1MQTC 2PYTA 4YW6A 5E89A 2Q8EA 2B5HA 4QDQA 1OKOA 1OURA 1ND3A 1MEC1 1T2XA 4N43B 4ASMB 5JXGA 1U12A 1G8WA 1WCSA 5KXEA 1R1A3 5DAWA 2AYHA 2D6LX 4Q4W1 4QPIC 5HCFA 4D0QA 2QQPA 2FDHA 1N1TA 2CV6A 4RQPB 4QU2A 5J98B 4DEVA 2DBNA 1WW7A 2D98A 4XMIA 4ZS3A 1OPMA 2WQZC 5IVYA 3CO2A 3POJA 4UFIA 5KC5A 2RE9A 1CPNA 2WINB 1SBEA 3MLKA 4XBLA 1POV1 2LRPA 1HW5A 1UMIA 1W9WA 2IC1A 4LOSA 4YZ3A 5I0DA 2AR6A 5F7UA 1WZXA 1C4RA 1QJU3 3V65A 2WT2A 1GQGA 2DVBA 1XNCA 2GNTA 1ASJ3 1SLCA 2C6SA 1Q5OA 3LEMA 5BY5A 2FQPA 5T3NA 2ZEYA 3CL1A 4LBMA 4A4AA 2WQ8A 2P37A 3RYRA 4YG3A 1TNRA 5CEHA 2W92A 2ZHLA 2OPWA 4A42A 3KMHA 1CIWA 2R042 1QJU1 1OBNA 2YBSA 5FZMA 3U78A 4RQPC 1DGLA 2JDUA 2IXLA 3ASIA 3BOPA 1ASJ1 4UBHA 1JHNA 4CP2A 1D4M2 1OKQA 4BQ3A 2JDAA 4OFGA 1R092 1HRI3 5K7PA 1VRH3 2VMHA 4AEMA 1C5HA 1DDLA 4PHZA 3J26N 4FFFA 1LOCA 1O91A 2V4VA 3H1YA 3PJQA 1UX6A 3KSCA 3PUHA 1RTVA 1GSLA 1Q8QA 2YG0A 1GNYA 1GANA 1QJY2 1ND3C 2J1RA 1CN1A 2P6CA 1V6OA 2E7AA 5FQ0B 4EN0A 1W9YA 3NJYA 1HRI1 2WFF1 1PO23 4JC1A 4NHLA 4QKDA 1ZZ8A 3H0OA 4NHKA 2BGPA 2DTWA 2CDPA 4P5YA 4QB2A 4PIXA 4MHRA 4XAAA 2WS93 1LU1A 2QQJA 1QJEA 3VKOA 4ZZ8A 5L7OA 1QJX1 2DTYA 2Y0OA 2WNUB 4CUAA 4HSJA 4EE2A 3MLLA 5SV8A 2W39A 3HJRA 1G86A 1WWYA 1GNHA 2VBPA 4AEDA 5ABJB 4CTEA 1ZBE1 1APNA 4L8QA 2W52A 4QDSA 3VBSA 2QZ3A 3WV6A 2P2KA 1NCQA 2VZVA 3HNMA 2VC9A 3N9QA 5FZ3A 1YLLA 5B2GB 4IGOA 5FKCA 2WS91 4YVSB 5CYYA 5FYHA 2ZCWA 5FZAA 5IVEA 1QOOA 1X8MA 4Q0SA 1OC1A 1QU0A 1DYPA 1QNWA 3EJKA 2AACA 2RDQA 3GM8A 3PUQA 4W6XA 5IVFA 1HIXA 2MEV2 3V0BA 1CX4A 4LLFA 4DMIA 2VZUA 2RS13 4RR3B 3AYAA 4M3CB 4S2HA 3SH5A 4XILA 2WYFA 4CDWB 1K45A 1RUJ3 4K1YA 4Q4Y2 2HWC3 1FMD1 4XXPA 1UN1A 4C8DA 1U5ZA 1JHJA 1UZYA 5FRAA 4EYUA 3T4VA 1G6NA 3ST7A 4UFHA 1HXS1 2RDSA 4HT1T 2RS11 5L9VA 1TNFA 1J3RA 5FY7A 4TWTA 2R1BA 4LBJA 2Q1MA 1C57A 1G7YA 3N35A 2EIEA 4EV0A 2DYCA 1RUJ1 4BE3A 2HWC1 1REFA 4KL1A 4NRQA 5EJ3A 1PX3A 2WRAA 1MS3A 2BVBA 2WN2A 3SH4A 5L7OC 4HK9A 4AVVA 3LEGA 3HWJA 2JX9A 1REEA 4D6RA 4LHSA 4LUMA 1RITA 1DQ4A 1SHWB 2Y26A 3FHQA 3KV4A 4LIUA 3IAPA 1RIRA 3DYMA 1UY3A 3W9AA 4AEDC 1QDCA 2YMZA 4TSVA 4AZZA 4CE8A 3UJOA 5DDJ2 3AXEA 1HJGA 3VBSC 3OBRA 1EUUA 1ZRIA 3IN9A 1Q3EA 4DNYA 2XR4A 2IUWA 4P9YA 1VMJA 4AQSA 3JCIA 5FPLA 3LIHA 5BNQA 4PBPA 4AK3A 3T0AA 3SNMA 2ZKNA 3ZDSA 4CCKA 2JDPA 4BXFA 1SDDB 3O1PA 4AQTA 4XBQA 4JCKA 5J96B 3P3NA 3CZJA 4ARYA 3NNFA 4BQXA 3OYWA 1LOAA 3AP4A 3OF1A 1R082 3KV6A 2BNMA 2QTWB 4XVHA 2C24A 2BOJA 2G19A 2O8OA 5F5QA 1D7PM 1RUI3 1Y43B 2CYFA 3HT1A 1CQ9A 4HPKA 3ZYIB 5FP7A 5GLWA 4TYSA 1WUVA 4V1PA 1GYKA 1OUSA 4UF0A 3WNNA 5A80A 5I8SA 1UPSA 1OLME 4B4QA 1DYOA 2XVKA 1GOHA 1DCSA 3M8LA 4GWMA 3E6DA 1REDA 1OPOA 3AZXA 3KT7A 4LA3A 2XWJB 2Q5TA 5FZ9A 1RUI1 5T54A 3SITA 2K46A 2VCCA 3H8UA 3MYXA 1UY0A 3FHIB 5DUUA 3TNQA 3UJQA 4AFBA 2EICA 2DFBA 1AR92 2VCMA 3NAPB 4QDRA 4Q0VA 4CCOA 5C33A 3ZSKA 1QH6A 1JXNA 2OZ6A 3RJRA 1CAWB 2ZOEB 3J7HA 1TME3 5F6LB 4BXSV 3N9PA 3NNLA 3ILNA 2BYVE 5FYMA 1SCSA 3D5OA 2CL2A 4P02B 5B4XA 4BA6A 2JE8A 4I30A 3JD72 2QJVA 2CAVA 2VVFA 1B35A 3UGHA 5LEJA 4AF9A 3ON7A 3WG4A 4GALA 5F3CA 3KQ4B 2JWPA 1GZTA 3LIGA 2P3YA 3PVBB 4KWUA 1TME1 4PDWB 1SFYA 3VBFB 3IMMA 1UKRA 2VJXA 4E8DA 5CNAA 2RS53 1RXFA 2RS32 4JDOA 4FT8A 4MGQA 1ZREA 1AR81 3MUZ1 4EJRA 2JJ6A 4AI2A 5C8WA 3JQXA 3U11A 4OVEA 2HWF3 3B3QE 3R0RA 2VZTA 4MGSA 2VU9A 4BK4A 3RZZA 2QDRA 1JZ5A 1COV3 3TEZA 1FAYA 4YFZA 1DHKB 4KH9A 4KMQA 2RS51 1DGRN 1UYPA 3C7GA 2F4PA 1KFXL 4RGGA 4M00A 4ES9A 4ZKTB 5JSPA 4XZUG 3UKNA 3RI9A 4Y3OA 4JGYA 4U36A 1LOFA 2Y6HA 2QQMA 2HWF1 2YV8A 3BYWA 3ELNA 3GHNA 1W2TA 1PVXA 5TSWA 5BYNA 2O14A 4PLNA 5DXDA 3EB7A 3WOGA 4FPHA 1XE7A 3I3EA 1CR7A 3THPA 4R8HA 3VBUA 3VBHB 1ZRDA 2GN7A 3T4HB 3UT0A 1PO12 4S2FA 3T08A 3FE5A 1ZBA1 2HWE3 2QKDA 3Q8FA 4XJZA 3AMQA 4CEWA 3HIFA 2W1WA 1JZ2A 2WUHA 2PQSA 2EA7A 2JDKA 1ND2B 4Q8LA 3CQOA 2ZGKA 3OJBA 3NWKA 3WW1A 1PGL1 4DXSA 3U75A 1B35C 2W95A 2DWRA 4BU2A 1C8M2 4UBGA 2NYYA 3T2OA 4DEQA 2QQKA 2VE1A 1VMHA 1FT9A 1UZ0A 4QX7A 4P9WA 1JZ8A 1OH4A 2YU1A 1JYXA 1MS9A 1W39A 5FYZA 4JQTA 2D6NA 3BPZA 3LSDA 5C8CA 4WZFA 2DCJA 2EXJA 5T5LA 4W65A 1LODA 1XOYA 4IE7A 5FZ6A 5LEKA 3KV5A 1UXZA 1UW8A 1RUC2 1S0FA 1IZ3A 2ORZA 1OA3A 2RJLA 1ZZ9A 3DECA 4QQLA 4YW2A 3ZLIA 2BQPA 1CPMA 5A32A 1A3KA 5GZFA 2V5YA 2CU5A 5D2AA 2HJIA 4AEKA 1Q8SA 1FV2A 4KWKA 1UY2A 2Z79A 3VDDB 1WLTA 1H30A 1H2MA 2RDNA 1XE8A 2ARAA 4Y22B 3AZZA 4JGYC 1LOFC 1AR63 1RVF2 3UESA 4OQ8A 2Q4SA 3SQOA 2CGOA 4NUBA 4RHV2 3W5NA 5D21A 5FZOB 3GJAA 1KDKA 2KXLA 3KB5A 3A23A 1R1ZA 1WCQA 2ZEWA 2ZGNA 3VBUC 3ZR5A 2ADDA 1BHGA 3L9JT 1H8TA 2BWAA 2GC3A 3WF3A 2FD8A 5FJKA 3ZFGA 1KFUL 4HG6B 4QXKA 1W8HA 1ZA7A 1GP5A 1RUE1 2XJUA 1VRBA 5F1RA 4EQVA 4LIVA 2LS6A 2C26A 5FPBA 1IG0A 3WDYA 1ENRA 4ISRA 3JZVA 2DF7A 3ZSEA 4ORFA 5FK8A 4MXWB 1DQ1A 1IKPA 4QHOA 5LA9A 3RWKX 3ZXEA 2CWSA 3EQEA 4N7UA 4XOGA 1I5PA 3SC7X 4CCNA 1SZBA 3TEYA 4I3GA 4BQ5A 5LW9A 2D5HA 4ZHNA 3E97A 3GZUC 1UMZA 4NE9A 1CAVA 5CFDB 4WVMB 1GOFA 2ZX0A 3GNEA 5C8CC 1N47A 2VMFA 3PUIA 3POGA 2GC1A 4TZDA 2WZEA 2I07B 3UGFA 3O1OA 2C1FA 1VBA1 1L7RA 2W0XA 5FREA 1PMHX 3ETPA 4CCJA 2VZ1A 2HYXA 4JHTA 3NNMA 4RL7A 5F5AA 3PURA 2DBIA 1VAKA 1L7LA 4B7EA 2ILMA 4CEYA 5GM0A 3AP6A 5EXOA 5LATA 4AEJA 4CCEA 1RUD2 4FFIA 1E5IA 2GNMA 3LEIA 4PF5A 3OBAA 3UETA 5IFPA 4C91A 5C3RA 4C0BA 2XJVA 4Y4YA 1QQP2 5EFUA 4XFAA 5CZKA 2Z5WA 3ZFEA 5FPAA 2ZGRA 1GQHA 1GZWB 2XBO2 1H8TC 3H42B 1IS4A 3HT2A 4YZ1A 4LBQA 1OVPA 2JDZA 2JE7A 3ZFGC 5A6XA 2KR2A 1WLWA 4B4PA 2DVFA 1Y7BA 4O61A 2HWD2 1YFUA 1CONA 5DG1A 4NIAA 3N9MA 3AYCA 2QDNA 1Y9MA 3TN91 5FZKA 1K5MB 1OOPA 4ISQA 2EXHA 2RR13 4TLFA 4DXZA 1PX4A 2W1SA 4HVRA 2ZGQA 1I3HA 2OUJA 1KITA 2R061 3I4IA 4OZOA 1G9CA 5FYVA 3J7LA 2CGNA 3A22A 3FFQA 5FZ1A 3A0NA 2HLEA 3B02A 1F5FA 3QH6A 4QU1A 4BCUA 5A1FA 3LQCA 1AYM3 4YSFA 1FPN2 3N7MA 5I0UA 3VKMA 3RVHA 4AGVA 5J36A 2JKBA 3OSDA 2P3JA 2VNGA 3O12A 1OT5A 2R32A 3AZYA 1HQNA 1RGSA 5H9PA 4DY3A 3HAGA 3BUCA 1LJ7A 2P4EA 1RHI1 4AI0A 3ZDVA 3WW4A 1SG3A 1MR5A 3DEMA 1DU3D 1W8WA 3AL5A 5CA6A 1OMIA 1UU5A 2OA2A 1YFXA 3USUB 3LDRA 2VBBA 4KGGA 5LA1A 1IG3A 4UXAA 4NIGA 1LOGA 1AYM1 4CEYC 4CDXB 3SKJE 1BEV3 4AI3A 1V6MA 1Q8PA 4P14A 1OHFA 4UYBA 4YGDA 2PTMA 2WZPP 1XE0A 1O7FA 5K9YA 2VUAA 1LESA 5K0UB 5F3EA 4FOWA 3DF0A 3KHCA 5KWRA 4LO6B 2VY0A 1UIJA 3ZFEC 1VBC2 3LA7A 2A3WA 3HMYA 4AOCA 1V6JA 1OQEA 1BEV1 1O4TA 1SEFA 2BERA 4XFGA 5F9TA 2BFUS 4CVUA 1QWRA 1BBT3 1QY4A 1AYN2 2HEVF 1DF0A 3WLUA 2G9FA 3CEWA 4QB6A 2TBVA 3AZWA 5JMOA 1YJKA 3H1MA 4FVVA 4M0HA 3LWCA 5HV0A 1EV13 1W6MA 1OOPC 3WF1A 2J1AA 3GGLA 3K4DA 2PHWA 3V64A 1H0BA 2C0ZA 4MOAA 4NWVA 1F15A 2FMYA 2VZOA 3K48A 2VZ3A 5EZWA 2C5DA 1S0CA 5FLJA 4BQYA 1EV11 3JUUA 3W5MA 4ARXA 1ONAA 1VBE3 2D40A 1W6PA 2ZGSA 1KXGA 4IEQA 2QNKA 3AKSA 5C3OA 2LUWA 1PK6B 2RG4A 4XQWA 3WQ7A 1W03A 3NQHA 4IEWA 1UQXA 5JSOA 3BU0A 2DU0A 2MPFA 2XJTA 3QLQA 5I8YA 4XJUA 1KD7A 1YQ6A 4FFGA 4LHKA 3ZPYA 1UD1A 3WCSA 1OLMA 3BTYA 2OX0A 2PLV1 1IKQA 2UWAA 5H9QA 3THTA 4CYDA 4DXTA 3VDCA 1WW5A 4Q0QA 1PM4A 5EQUA 4C1WA 3RQ0A 4UAPA 2XHNA 2RV9A 5KXDA 2C9KA 2ZX2A 2ZS6B 5CU1A 4FPGA 4IETA 4YM1A 3W58A 1HLCA 1O4YA 3IKWA 4XETA 2W46A 2GP3A 4NOTA 5APAA 2FBEA 3OUIA 1NA1A 3T0DA 2D44A 3I8TA 3OPZA 4WM8B 1OF3A 1W8UA 1XJAA 4RS5A 1Z7S3 4QXCA 2WT1A 1ZYBA 1SFPA 5HCHA 4YYOA 1OXCA 1XU2A 1UMHA 1YIPA 2H0VA 3HBKA 3PL0A 1WBLA 5L9BA 3WDVA 5KC6A 1KJLA 3OY8A 4YW4A 1SLAA 2VZRA 2ID4A 5C4WA 3PIJA 2QCSB 3OUJA 4N9HA 4R4ZA 3KVBA 4YW5A 1Z7S1 5FV3A 2ES3A 2BFUL 3ATGA 4MUVA 4XPVA 5FUIA 5C9AB 5DUWA 4P9XA 5FPZA 5BNOA 2EXIA 2VUDA 1A34A 4BQ4A 2TUNA 3S0MA 3PMEA 5LK5A 4IV3A 1L3JA 5EHDA 1JUHA 2VXJA 4GJZA 2ARCA 4AR2A 1S0EA 4QMAA 4X8NA 2H6BA 2WT0A 4DO0A 5JR7B 2WZR2 5DABA 4N53B 2UYAA 3RJ2X 5CAZA 5FZ0A 2HKXA 2SLIA 5KHGA 3KV9A 5C5TA 4LK6A 1E57A 5A3LA 1JZ3A 5ACA3 4E4DX 1LU2A 3WP3A 2BOIA 3KM5A 1L7QA 4YRDA 5K8SA 3ZXFA 4LBLA 3BI3A 2VQUA 5FZCA 3T2TA 1J59A 3AC0A 3MF6A 4AFDA 5C9AC 4PI2A 1X7NA 2O0OA 3ZN6A 5IVJA 1AR73 1BMV1 1U0AA 1QIQA 3QD6A 1AXYA 1NA1C 1UYYA 3ACHA 2XKOA 4KBZA 1RUNA 1W3XA 4OUMA 1POV0 4IGQA 4COZA 1DIWA 4NPLA 2D97A 3BPSA 3VGIA 5DUXA 3ZM8A 1XQNA 4IE0A 4QX8A 4LBQD 1D2QA 1MZEA 2OZJA 2HYKA 3D3AA 3NV2A 1OQ1A 2NN8A 5D8AA 3THDA 4Z07A 4CU7A 1XNTA 4URAA 5C4WC 1H6YA 4IEVA 4X8PA 4EWDA 5T50A 3DN7A 4H7LA 4Q4W2 4IESA 4HLTA 2RM23 5FUPA 2JEMA 3R05A 4Q8KA 4MV2A 3LDKA 3WDXA 2ENRA 2VVEA 3C7EA 5BNOC 4YVWB 2YC4A 3OD0A 4IV3C 3QOPA 3VBOA 1JW6A 3LD8A 2D6OX 4PLOA 1AL0G 1ODNA 1R1A2 1V6IA 4GD4A 4LUKA 4QGLA 5FUNA 3SKVA 4CDQA 4FAHA 2RM21 4JTOA 3MV01 4A7KA 3M3IA 4XF0A 5HI0A 2XPJA 2FCTA 1O8SA 4XJWA 1VBD1 4IL7A 3U4XA 2HEYF 2HWB3 2Q8OA 2YFZA 4DB5A 5FY0A 4FTSA 4B1MA 4RYDA 4Q27A 3HR9A 1ULCA 1GOGA 1FATA 2PMWB 3LFMA 4K21A 4O9GA 3VB9A 2D43A 3VZLA 3WEZA 4AG4A 3R6SA 2QQLA 2WYSA 5BNPB 1MQTB 4HKOA 4LO4B 4XJAA 1J84A 1QJU2 2OKXA 1DFQA 1AL23 4AVCA 3N3HA 4XIKA 3NMBA 2QQOA 5DAQA 4QPIB 2WFPA 1ALYA 3J8F3 4OHWA 1XC6A 1NUKA 3WSOA 1VP6A 4E4SA 3P6BA 3PMSA 2Y6FA 2JB4A 4OUSA 2D3RA 3M7AA 2K2SA 2PHDA 3E5XA 2WKKA 1F2NA 5A3OA 2OT7A 3O0XA 1SLTA 2PFWA 3LZZA 3VZKA 3DXTA 5L73A 2FHRA 1QEXA 1MEC3 3RZJA 3LOBA 2VMCA 4RFRB 4D69A 5D8AC 2WO1A 2XLAA 4MGKE 3ZXDA 4AE2A 3UYJA 2VQ0A 3B9IA 4LORA 1VRH2 3MIEA 1XSQA 2J1SA 3U10A 2ZX3A 3ME2A 5J3UA 3AKRA 3VN4A 4UT5A 3VLBB 4GULA 1V70A 2OUHA 2YBKA 3ETQA 2RMU1 2Z42A 1POV3 1A78A 5JPNB 2A6YA 3RYPA 1PO22 2YC0A 2AC1A 3KVAA 4QPGA 2OS2A 1PHMA 3AVSA 4I3PA 4XHBA 3VBOC 4CP1A 4CDQC 1X8EA 3SLIA 1W6OA 5A7SA 3LE0A 1CX1A 5IWFA 1FOD1 5CKMA 3VHOA 5B4NA 2WS92 5CBLA 2DURA 4P00B 1IQAA 4HKWA 5GALA 1X50A 1DG6A 2BDRA 1IGOA 3PJYA 5IK4A 5AC93 1S2EA 1QXJA 4Q1RA 4AHYA 1ND3B 4XTPA 3VZJA 2CTVA 1YFWA 5LBBA 3AKQA 4QX5A 4ZY9A 2XJRA 4BZ4A 2JB8A 1G9AA 2JKXA 5A33A 3OGVA 1JODA 4JGZA 1KEXA 3K2OA 2P5BA 1F4AA 2ZX1A 4OI4A 1SBFA 4XMAA 4BMBA 4DZGA 3ZXLA 1ZRCA 4I0BA 4A2UA 1UPIA 2FMDA 2YU2A 3C8XA 5AC91 2RS12 3C7FA 3A21A 2YB7A 4HVOA 2YDEA 4YPJA 2WFF3 5LBFA 4MHUA 4DINB 1NLQA 1RUJ2 2A75A 2HWC2 4LBKA 2R1DA 5FBZA 3NKGA 3W59A 3DPRA 1EPZA 1GR3A 1QKQA 3INAA 3E5QA 5CIRA 1QJX3 2VXRA 2ZGUA 4ATFA 2UWCA 3ZKUA 2EXKA 5DG2A 2JD4A 3R4SA 1H4HA 2F6BA 1WKYA 2B46X 3A0KA 4BQ2A 1ZBE3 2GU9A 4ZS2A 2XQXA 3JBG3 4QPGC 4KBBA 2EIBA 2VZSA 1PIV2 3ORJA 4CDUA 3TB0A 3J7MA 4NR1A 4QHBA 2D6PA 4CXWA 2JXAA 4IUGA 1VBB1 5IYYA 4URTA 5I0TA 1ZZCA 1M4WA 3USSA 3Q8EA 2Y60A 1W9SA 4LPLA 3JBG1 4K1ZA 5FZ4A 4YFWA 3AB0A 4Q0PA 2WDBA 5A3WA 2V09A 3VD3A 5A7WA 2GC2A 1FMD3 2GZWA 1ZVFA 4JGZC 4BIOA 3S6PA 5IVVA 1VR3A 1G9FA 4PBOA 1QF3A 1GP6A 1HXS3 1LULA 2GDFA 2ZPXA 4UI9L 3SISA 5L7OB 4GH4A 5LCWL 2E51A 4Y20A 4Z2WA 2PHLA 1YYNA 1V9U2 3I2FA 2Y34A 5H9RA 5T5JA 4AEDB 2X05A 1RUI2 1CAUA 4OCTA 1W28A 3VBSB 2VOTA 3D8CA 2DVDA 1NCQB 3CNAA 1QOTA 2WZ8A 3DPRC 2ZGTA 4WZCA 5JXIA 4NJ4A 3WCRA 5T5PA 4C90A 1CESA 2X29A 3GZAA 1S2BA 2E7TA 2XKPA 1SFNA 4XF3A 4BJ0A 4N9IA 5LZ6A 1O3SA 3V0BB 3AP5A 2E32A 3IPVA 2G9ZA 1NY72 3I3BA 1W99A 1D0GA 3O14A 3H7JA 4HBNA 1S2KA 1URXA 3NV3A 1JTZX 1NYWA 4CDUC 3WUDA 3BN6A 3WXPA 4HK8A 5FJHA 2PQQA 2XLGA 1F35A 2ZTNA 1WGPA 3K46A 3WF2A 1JU4A 4QXHA 3F2ZA 2R0HA 2R041 1TME2 2VGDA 4JKMA 3NW4A 5E6HA 5C5UA 3RZHA 5DAVA 1D4M1 3ZXJA 1R091 1NCQC 1HX6A 1AX2A 5E88A 1H2KA 4CPBD 5J09A 1I6XA 4EN6B 5BPXA 3BKZA 4FP3A 1X9PA 1OD3A 4LKEA 5C71A 2B39A 1OA2A 5FYCA 1DQ2A 1HV0A 5FXWA 3RWNA 4PCRA 3AP7A 3PLQA 2LTNA 3HN3A 3HPNA 2RS52 2XUEA 4UW5A 1RJ7A 3Q8CA 4GH4C 1J58A 2Y6KA 2WABA 3NO8A 5JDBA 3GF6A 4MG2A 4YG6A 2A71A 1DQ0A 1T6GC 2NZ9A 4GIQA 2DVGA 2J1EA 4WVZA 4GMP1 2W1QA 4LHNA 2DV9A 3IBMA 2A6WA 4NHYA 4E8CA 1COV2 5C3QA 5CFCA 3I2OA 1LENA 2WC2A 5GZGA 4K9SA 2OPKA 1XNBA 2QVSB 3WQBA 1NCRA 1K42A 1J1LA 3GALA 3UNPA 2VOXA 1Y4WA 2FDGA 5FYUA 5FZ8A 3VD7A 2PHRA 3ZPOA 3OYWB 3OG2A 3LFIA 1J3PA 1DYKA 1XU1A 3RNSA 3S5AA 3VDAA 2A70A 2MEV1 2VMIA 4HPKB 2HWE2 4G9SB 2VL4A 3VD5A 5FP9A 1GBGA 4UF0B 5IVCA 3ZXAC 2DUPA 3FZ3A 1KQRA 4MVTA 1AR83 4ASKA 3BTXA 4Q2FA 4BK5A 1RMU2 5JCTA 4Q4Y1 4Y1YA 3N7JA 5GZDA 3WG2A 1HRV3 4Z2AA 3WINE 1IS3A 3RMXA 2QQIA 4AQ2A 3APBA 3HEIA 3ZVXA 4R4XA 4CU9A 3MFAA 1N3OA 1XYNA 2LALA 1JH5A 2J1TA 1DZQA 3QCWA 1STMA 4UWDA 5F3GA 1OFSA 3K51A 1WCKA 2VUCA 3NNJA 4F83A 4AGRA 1HRV1 1PM7A 2B9VA 4XF4A 1BVP1 1ZA4A 4XDQA 4XIOA 2R0FA 5EV7A 3RPQA 3FLPA 4O9EA 2YHJA 4CUBA 4F7ZA 1GU3A 3B00A 2E6VA 2ATFA 5CFCC 5FLIA 2CSGA 3HNBM 4UFLA 1B35B 2IXJA 1PZ7A 2FDJA 2Z2SB 4GKXA 2FDIA 4PIYA 2VD7A 4P9LA 1O5UA 1ZBA3 3DL3A 2R072 1U5IA 4YZ2A 3NJZA 2P6HA 3MPBA 2RDRA 2I2SA 1NCRC 1AR62 3RGBA 1WA4A 4UW3A 1FXZA 1I5ZA 2Q8CA 4CSWA 4D3WA 3MO4A 3MV11 2XB6C 4OMCA 4ZU7A 2X10A 4F3JA 4D6QA 2ZMKA 3TEXA 2WSUA 2YPDA 3GBWA 2YYOA 1YCIA 3CJIA 3TWIA 4BLIA 2R30A 4ATEA 3I59A 5I93A 1R081 2BNNA 1G9BA 4FPFA 1Y9GA 4ZU5A 5FZLA 1O3TA 3PIGA 1ACCA 2ARXA 2WNOA 3GZTB 4JGYB 4Y1ZA 2NQYA 5JLVA 3O5SA 4QX3A 4G4FA 1NG0A 2WO2A 3ZXKA 2O1QA 3FBMA 1Z0HA 2OVUA 1V0AA 2VOKA 5KHIA 5L19A 4A6SA 1AR93 1MZ6A 2ERFA 4IV1A 2XGXA 5L9RA 2RHPA 1LHUA 3VBUB 4A3ZA 3U4SA 2BEOA 2B7YA 5IAXA 4DUWA 1WD3A 1FNZA 1LGCA 4OZXA 4UOJA 2GSYA 4K7JA 3MHZA 1W04A 4YGBA 1WW6A 2XWBB 4XFFA 1IPSA 1BYHA 4CEWB 4AAPA 5IK8A 4HSLA 3PTRB 4KG0A 4F8AA 5JXJA 4NHMA 1ENXA 3TOJA 3ZFFA 4P9JA 5HCAA 1AR91 4FOYA 4CCLA 5D1IA 1V00A 3UK9A 5KHHA 4CP0A 1YRZA 5AVAA 4XCAA 4LO7A 2RJ2A 1RXGA 1C5IA 5BNNA 4IEYA 3IMNA 2F17A 1RUE3 2UYBA 3OEBA 4AHZA 4C0HA 4QQ2A 1W6QA 2JD9A 4OI2A 5C8CB 3LCPA 4LNVA 4ZONA 3RS6A 3WT3A 3ACIA 4YM2A 1YQ5A 3IIIA 3BB6A 4K8RB 2E31A 2AEYA 2BWCA 2W9XA 3THCA 1CJDA 3BGAA 2WA3A 4LBNA 1IOAA 3CJIC 3KCCA 2R6QA 4JRLA 1GP4A 3E1F1 5A32B 4CEWC 1LCLA 1XSRA 4CZSA 4AHWA 1ODMA 3T0BA 3IDEA 1PZ9A 1YQCA 5G04L 5FTTC 3MIBA 1H8VA 1LR5A 2WBKA 1ENQA 2Y8KA 2RR12 2EAKA 3EHKA 1US2A 4MO3M 1VBA3 5F5IA 3WD5A 1VJ2A 4H55A 4S2GA 4CUCA 4OLLA 1F8VA 3FC0A 2VMEA 5CB7A 3AMNA 4IV1C 4E4ZA 3MDPA 2ZGLA 3NV4A 1H8TB 1HDKA 2WWSA 3S7IA 3UGGA 4CCDA 1GV9A 3WVJA 4MGTA 3ZFGB 5KHKA 1AYM2 1W0PA 3ZIWA 1TMF3 2W68A 4K20A 5FY1A 2WAAA 4RN5A 2E63A 1TZOA 5J48A 4Y26A 1PO11 2DUQA 1C8M3 2WN3A 5C3PA 1UOBA 4Y5TA 3WG1A 4HXCA 2WNEA 4N7IA 5FOJB 4JHZA 5BNNC 3FLTA 1OA4A 1LTEA 1TMF1 4KQ7A 3WP6A 1JYTA 2VQAA 5F37A 3ZMNA 3M1HA 2GALA 2C9AA 1FV3A 3EBRA 1CAVB 1C8M1 2B9UA 3KT1A 1SPPA 3SCGA 3TN93 1XB9A 3HNYM 4FO9A 5LWBA 5JI9A 2AREA 3MIFA 3POEA 1RC6A 2BGOA 2R063 5C3SA 5FZHA 3ES1A 4L2NA 4AYUA 1SLIA 2BRTA 4FPJA 1KJRA 2ZGMA 2YBPA 1BBT2 2VZQA 4A41A 1N1VA 1CWPA 1RVF3 2FCVA 5GLTA 2QQNA 2R49A 4CEYB 4FBFA 2JDYA 4RHV3 1GZ9A 3FX3A 1RUC1 3RSJA 1EV12 3GXUA 2ZMLA 3KF5A 3VBRA 4AFCA 4H2AA 4A3XA 1F5JA 4XUTA 3E5UA 1PZ8A 2BVVA 1RHI3 4I09A 4QPWA 3FFZA 2UY8A 1ULDA 2W87A 1RUOA 1DZTA 1YEWA 3SEPA 4XXAA 4AXOA 3ZFEB 3K75B 1RVF1 3GBGA 4CP9A 4IE4A 4RHV1 4LBQB 5I0SA
chains in the Genus database with same CATH topology
4HMZA 1BK1A 3MPPG 1VBE2 1F31A 2XH6A 2IXCA 3RRDA 3WW2A 1C1FA 1OOPB 2ZHNA 3T1LA 1YWKA 4GB32 4QPYA 4RD7A 3C2UA 2HEWF 3C3VA 1AJOA 3AKTA 2GMPA 3FUQA 1IS5A 3NKTA 1EAH3 1XRUA 3OD4A 1QHDA 4R9CA 4WM7A 4B8EA 1GZCA 4OHXA 5L36A 1AXKA 1LOEA 1Z7S2 4M3CE 4DOUA 4HZFA 3JQWA 1RUD3 3PVOA 1EAH1 3DKWA 3EO6A 1LOBA 4IXLA 4FPEA 4ZU4A 3VBRC 4HVQA 2A3YA 3WR0A 1BXHA 2YGLA 2WIIB 2IFRA 4BYYA 1CAXA 5IUQA 1RUD1 4ASLA 2PLV3 2ZHKA 4AWDA 1W6NA 4LO8A 3WQ0A 3AZVA 4Y1XA 4H14A 2D93A 1QQP1 2XVLA 2ZZJA 2XJQA 3LGRA 3AMMA 3O0VA 2VW1A 2DU1A 3AMPA 2BUKA 4YM0A 1W6MB 2DFCA 3SHRA 4RGAA 5LK7B 3D0JA 2HWD1 3ES4A 3TBDA 4P9GA 5ACA2 3AJYA 4Y1UA 4NVPA 3WZ1A 1PNFA 1FPN3 2OYZA 3VZMA 4FOVA 1SBDA 1WMFA 2ZGOA 1N1SA 2UY9A 1DBNA 4WM7C 1AR72 5J37A 1W6PB 5GLZA 3V56A 3AFGA 4L97A 2D3SA 1FPN1 4L99A 4L92A 3B69A 2AENA 1DGWX 1OD5A 1S0JA 3M3OA 3WHUA 2UU8A 4D94A 5DZEA 4Q4V2 3AMHA 4FPLA 2VPVA 3IDBB 2RM22 3D82A 5FFOC 3CJXA 3LAGA 1MZFA 2AUYA 3KT4A 4XBNA 1NA1B 1ZNPA 3KCYA 4RS5B 5LRRA 4RA0A 1JYCA 3HQXA 2D6KA 1CVNA 1UZZA 4HN1A 5FO8B 2WNVA 4ITCA 4R9BA 1VBC1 2VECA 1BVVA 5EWSA 3OY8B 3VHRA 3FWEA 5C4WB 2HWB2 1AHSA 3UKTA 4QQOA 1TEIA 2BGCA 1AYN1 1I1EA 2GAUA 5JOZA 2ZAHA 1F9KA 3QBQA 1RUH2 4CRQA 5BNOB 2K0GA 3J4UH 4JV4A 5JPMB 4K6BA 1AL22 4P9IA 4IV3B 3MFCA 3MI8A 3FUOA 3VKFC 2GH2A 2G4IA 1X36A 1VAVA 3DGTA 3J8F2 4RS5C 2IXIA 4J1WA 4BH9A 4XQDA 1GICA 2YROA 1JUIA 1NLSA 1U5YA 4META 3VKLA 1MEC2 1C8NA 3KQRA 2JG9A 1LKNA 3V0AA 3TAYA 4MH0E 5E1RA 4AQ6A 3I7DA 1PVC3 1WCDJ 3M3QA 1VBD3 5FAXA 4LT5A 4Q4X3 3ZN6B 2FZ2A 3LA3A 4YZ4A 5JZGA 1DQ5A 1JYIA 1DLLA 2EF6A 3KZ4C 4BIFA 4NO4A 1PVC1 1RUG3 1UAIA 1X33A 2WNVC 2ZABA 2D5FA 1M06G 4Q4X1 2B45X 5D8AB 2GC0A 2A7AA 2JE9A 2X5IA 3B5LB 4YW3A 1GLHA 1NLRA 5CG8A 2P34A 1HV1A 3KD4A 4FTEA 1U5XA 1RUG1 1DGRA 1ASJ2 4DY5A 1MACA 4Q1PA 4XQ4A 4RSUA 4XJ8A 3P3PA 2JECA 1PGW1 3VBOB 1HQWA 1OI6A 4YGCA 4CDQB 3ILRA 1LEDA 5FCCA 4QQHA 2UWBA 2NMOA 2RMU3 1OLRA 2ZACA 1A8DA 1HRI2 2JG8A 2WFF2 2JG9C 1EYBA 2YY1A 4FPCA 1WMDA 1FOD3 4OHVA 1UL9A 4N43A 5HXVA 1QJX2 2Z69A 4K40A 5JZGC 3PNAA 4KNCA 2IXKA 2WL1A 4RQPA 3SXWA 3VKNA 1SLBA 1ZBE2 4XFBA 1AZDA 3JBG2 3OBTA 5J7MA 2XLFA 3WNXA 2NM1A 4JVAA 2PN5A 3URFA 2X5IC 2VOWA 1LECA 3DV8A 2GNBA 3WQ1A 5AFBA 4BMEA 5KXCA 3R4DB 4E2GA 3MIGA 1IHMA 4EROA 1KRIA 1C3HA 2DUOA 4W6YA 4Y24A 3SMHA 4D7TA 3MLJA 4W6WA 3PVNA 1TE1B 4QPGB 4E2SA 1FMD2 2ET7A 1D2SA 3ZN4A 1W6OB 4D7YA 3N36A 1HXS2 1LGBA 2VG9A 4MYEA 1R1A1 3D6EA 4MGIE 1KDMA 2JG8C 1NQJA 3MZHA 1UU4A 1RUF3 3H7YA 2ETEA 2P3KA 3WDUA 1QGLA 1AUYA 3ZYGA 3PVEA 4YM3A 5FQ0A 5A33B 1VBB3 1QMJA 4N43C 1O3QA 4JGZB 3D0SA 5GKAC 5H9SA 4FPKA 5BUVA 4GMP0 4FP2A 1RUF1 1MVQA 2A6VA 2ZBJA 3VV1A 4JDMA 2WNUA 3X29B 4E2QA 1AF9A 1EPWA 1WBFA 3MIDA 3ENRA 3EXUA 4AVBA 1AX1A 5ABJA 2MHFA 3ZYJB 5C6CA 5F6KA 1Q8VA 4QM9A 1CJPA 5CG9A 3DPRB 5AVPA 3LSEA 3OGGA 5FOBB 4YVSA 1OSGA 3ILFA 4BM8A 2I74A 3WDWA 1LGNA 1VRH1 4H3WA 1H9WA 1H2NA 4LTAA 1ZRRA 4R52A 4CDUB 4RR3A 3LOIA 4M3CA 4QD2A 4CDWA 1CD3G 1NE4A 4PQ9A 3NSTA 2AH2A 1PO21 4BHPA 1SQ4A 4I02A 2ZHMA 1SDWA 4XEZA 3TYJA 2G9GA 2OW4A 2DCKA 3POYA 4FAGA 1O4ZA 2D7FA 3PTYA 5T55A 2JENA 3MGUA 4IQPA 3BCWA 4K3UA 1WD4A 4JRAA 4J1XA 4FPOB 2R043 3B9CA 2FZ1A 3U0ZA 4XFHA 1W0OA 1ZZ6A 4XW3A 2IWGB 1D4M3 3ZSMA 5IT6A 1R093 3WP5A 4GH4B 4Y20B 4COWA 2WNUC 1A8MA 4PJYA 3UKVA 1S55A 1MS0A 1CAUB 2NP0A 3WY6A 5ABJC 1ULEA 4PLMA 2PAKA 4RFT0 2PHXA 1QJY3 2P17A 4EN9B 4ES8A 3RYKA 1AR82 2VMGA 4UW4A 4YVSC 3ZX7A 3CU7A 1VAMA 5SV5A 2NMNA 1VALA 1HRV2 1PIV3 3FMGA 1MVEA 3IPVB 3M4FA 3MF9A 4D69A 4GMP3 1AVBA 4GWNA 5T5OA 4XF9A 2CAUA 5FLHA 3WP4A 4RR3C 1QJY1 5E8AA 2XL9A 1YHFA 1ZZ7A 4CDWC 2Y0IA 4KWLA 4HKLA 2E7QA 5EYYA 3KS7A 2HWF2 3AFKA 1XNDA 2QE3A 1PIV1 2NLRA 2A6XA 4DPNA 4BOWA 2GMMA 4Z1VA 5JI7A 2VULA 2A5ZA 4MSVA 1S0BA 2MEV3 4I01A 3VUOA 3A4UA 1ZBA2 3O0WA 3AJZA 1NXMA 3AK0A 4EWAA 1JOJA 2I45A 4AHXA 4KWJA 4EN7B 1Y3TA 1H9PA 1V9U3 4XJ9A 4Y1VA 3NAPA 4Q4Y3 1PGL2 3FBYA 1C1LA 1CAWA 4DQAA 3UL2A 3GYDA 1YI9A 5CFCB 1FNYA 4COYA 3TRSB 2LM3A 4FTBA 5GZCA 1AX0A 1V9U1 3NV1A 4X6QB 4L9BA 2XG3A 3BOWA 2OIIA 1NCRB 1HQLA 3H3UA 1QDOA 4JAAA 4PDWA 3KLSA 3VBFA 1WLDA 1LHNA 4Q0UA 4PIZA 1YJLA 5AFEA 2A73B 2QUOA 3B7MA 1QH7A 5CVRA 4J6GA 5JIUA 1W2UA 2WJSA 1MS1A 1NY71 2DVAA 5DDJ3 4QGNA 5FO9B 2RJKA 3ZYPA 4LR4A 3MEPA 1SACA 1QJZA 2WLPA 2XUMA 4MLOA 3KGZA 4B7KA 3H50A 4HN0A 2DCTA 2YUEA 2D6MA 1EY2A 2PAEA 4DS0A 5JVVA 5DDJ1 1RUE2 1ZX5A 1H1MA 1R083 3VBHA 2PHTA 4COVA 1MZ5A 3NAPC 4QT6A 5GLVA 2ET1A 5JSRA 1KS4A 4BWOA 4MZUA 3WHTA 4SBVA 2Q30A 5FDBA 3ZN5A 5A3MA 1BZWA 1ND2A 4IEOA 3IIAA 4LEJA 3N4MA 4FPYA 5FO7B 1ZZBA 3S7EA 1COV1 5FPXA 4PDWC 3VBFC 1VBA2 2E53A 4FQZA 2PHUA 1SMVA 4YZ5A 4FQ4A 3JU9A 4LHLA 4IEUA 3POWA 4GA9A 2DCZA 3BIWE 1V6NA 3GHMA 3CJIB 3B93A 3I59B 1TMF2 3O7OA 1RMU3 3JD73 4G3YC 1N3QA 2IFWA 3H9AA 3R4UA 5GZEA 5T52A 1RJ8A 1LHWA 3VDDA 2IZWA 2HWE1 4Y22A 3UV9A 4YARA 3BU7A 3FLRA 1RB8G 4X6RB 3ZSJA 2XJSA 3B01A 2RS33 1VB2A 3ZIXA 1OQDA 2GH8A 1RMU1 1DGWA 3JD71 3OGJA 4IV1B 4DRVA 2KM2A 4MX3A 3VBHC 3TN92 2NPIA 5CADA 3L2HA 1NXD1 4IEXA 2R062 3MICA 1SCRA 2RS31 3M2MA 4H7MA 3ZFFB 1Z78A 4Y5Z0 5FMOS 1ND2C 2R073 4HFSA 2N7GA 2YGMA 1XXNA 3IDCB 4AGGA 4NN0A 4AVSA 5BNNB 4MXWA 4AVAA 5DUVA 4EWEA 1BCXA 3L2YA 2XHKA 2EIGA 4NWWA 4Z82A 1W6QB 1PO13 3ZSLA 1RHI2 3ROUA 3ZYRA 5CFDA 2R071 4WVMA 4I2OA 3J9SA 4LULA 3LB9A 1AR61 2A3XA 3I54A 4BQ1A 4HL0A 4D7SA 4N90A 1TQ5A 3T1MA 3ACLA 1S0DA 1MS5A 4OI1A 2PELA 5HBAA 4M3CF 3MIHA 3ZFFC 4LE3A 2CGPA 3VDDC 2Y38A 4AFAA 5LRSA 1HKDA 1XYPA 1RL3A 4U2AA 3QACA 2VNRA 3AYDA 1BEV2 5JIAA 3RDIA 1H4GA 1ULFA 3ZMOA 2GN3A 1S0GA 4QGMA 3WDTA 1YI7A 3NVCA 4Q26A 4BPZA 1GZWA 2B42B 1RUC3 1EAH2 3WX5A 2R16A 1PNGA 4IEZA 2XJPA 1J3QA 2VH9A 3GBFA 4AVTA 5KBFA 1WLCA 3VHNA 4EN8B 1ENSA 2QFEA 2YPJA 3SH3A 3WG3A 1VB4A 2CY6A 3B94A 4LO5B 3IM0A 1K5MA 2A6ZA 3M3EA 4E27A 4IEPA 2ZZQA 2ZJCA 5KHJA 1MS4A 4UW6A 1YFYA 4GKYA 1LB2A 5FMOL 5CFDC 4R9AA 3VL9A 3IT8A 3H3ZA 3MW2A 2PLV2 3N7LA 5DZGA 3VHPA 2VVDA 1VLNA 4KU7A 1EP0A 4LA2A 4QQPA 1WMEA 2D3PA 2ZAAA 3USUA 2WQ4A 5IK5A 1D0HA 4E9KA 4COUA 4MGYE 4YLZA 4SLIA 2H6CA 4CDXA 3TNPB 3VBRB 5IK7A 1A6CA 1YNAA 1LHOA 3E6CC 4LBOA 3BODA 1RINA 5K0UA 1SLLA 2VUJA 2RR11 3VL8A 3HD8B 1H1AA 1IS6A 3KCXA 4FCAA 4Z8BA 1YUDA 2X53S 1LEMA 1QXPA 4P5HA 4NPRA 1V6KA 2EAAA 1K5MC 3BTAA 1N3PA 4M0NA 2MNGA 1MS8A 1LHVA 1QQP3 4Q29A 4B4RA 2CNAA 2XBO3 3KGLA 2K9ZA 4B3NA 3ZO0B 4C1XA 4WM7B 4XHXA 3JB4C 1UF2C 4AI8A 1KS5A 2HWD3 3RMYA 1PK6A 4WV8A 4S2DA 3I2DA 3SCHA 4LE4A 1FYUA 1J1TA 2XBO1 1GKBA 5E16A 3E6BA 3WW3A 4FSJA 2BTVC 1BMV2 4CDXC 4BLJA 3AX4A 1BBT1 1JN2P 4QM8A 1CAXB 4JQRA 4ONUA 2TEPA 3SCFA 4YW1A 5K0UC 3RI8A 3ECQA 2EALA 2ARBA 4OHYA 1FI2A 1VIWB 4OULA 1IPJA 2ZKLA 4WM8A 1W6NB 1AXZA 1B09A 2WSVA 1D4VB 2ZMNA 1YO8A 1O3RA 1LRHA 4I0AA 4GB33 1AJKA 3MW4A 4YG0A 1NOVA 4L11A 1PMIA 1VBE1 1XNKA 3JB8A 1C28A 5BXXA 3WUCA 1ZRFA 1Q43A 5C9AA 3AXDA 3BALA 5JOYA 1PVC2 1I9RA 2PA7A 2ZGPA 1VBC3 2E9QA 2GNDA 3S30A 1VBD2 3FJSA 4GB31 4AI1A 4Q4X2 2Q1ZB 1NZCA 4A7ZA 1ZM1A 5BV6A 2VW0A 2PAMA 1XYOA 4INDA 3AP9A 1AYN3 1PK6C 1Q56A 2EVXA 1OFNA 1FX5A 4N53A 4XF1A 2JICA 1WW4A 3IWZA 1RUG2 5JOXA 2VOVA 2XVGA 5EYXA 2WA4A 1NE6A 2YZ4A 1PGW2 4YGEA 3PHMA 1Y9QA 1NQDA 2AGSA 2YXSA 4XZPA 3LA2A 1QNYA 2BPA2 2BNOA 4KGQA 2BW8A 4DFSA 4HANA 1QOSA 3AKPA 3MW3A 3H1WA 4WM8C 4OHZA 5GJ6A 4KG8A 2WNVB 3NL1A 4FXGB 1UU6A 5JWPA 3OCPA 4Z92B 3D4KA 3QH7A 3HBZA 2VW2A 4XFIA 4K8FA 1BKZA 2TNFA 3OTFA 4YNIA 2RMU2 4R9DA 2O8QA 4GXLA 3VZOA 4AFMA 1UIKA 3U07A 1CGPA 3N7KA 3CF6E 4M01A 2XL7A 4YVWA 1N1YA 1FOD2 5I91A 3ALQA 2SBAA 1UCXA 2PHFA 5ACA1 2UURA 1BQPA 4ZXKA 1V6LA 5I8TA 5I0RA 5JMCA 4MXVA 3HN1A 1GNZA 4N53C 3CLPA 2DCYA 1AR71 1IPKA 2W08A 4KU8A 2IXHA 3ZXGA 1JBCA 4Q4V3 4WVVA 1Q8OA 1DZRA 2JG9B 3V0AB 4JDNA 5BNPA 2AZ5A 1MQTA 4IERA 4A7YA 1H1IA 2V73A 3AYEA 4B29A 1O5LA 5AC92 1S1AA 5JZGB 1ULGA 2H0BA 4QPIA 5DZFA 4Q4V1 4FXKB 3M3CA 4I0WB 2ZA9A 4XFCA 2BBVA 3G7DA 2WZR3 3POSA 2KA3A 3AM2A 4XTMA 3VZNA 1S0IA 4FOQA 5JOWA 1DQ6A 3Q9OA 4WVWA 3G6JB 4MGZE 2X5IB 2CWMA 1G9DA 1RUH3 1H2LA 2X8KA 1OLQA 2WZR1 2VNOA 4OI0A 2B8MA 1RUF2 2HWB1 1GFF2 1UKGA 3LKJA 2QZ2A 4YVWC 5HCBA 5JAXA 1VBB2 4AW7A 5KXBA 1QXRA 1RUH1 4XYXA 2GMEA 1YXWA 4GQ7A 1YIFA 2P3IA 4WBBA 1AL21 2Q0AA 4LLOA 3M70A 1PGSA 2WLQA 4DRRA 1BJQA 4Q4W3 4XE9A 3RG0A 3J8F1 3DUIA 2JG8B 2ZX4A 1X82A 4JTNA 4HETA 5BNPC 5GLUA 1MQTC 2PYTA 5E89A 2B5HA 1ND3A 1MEC1 4N43B 4ASMB 1U12A 1G8WA 1WCSA 5KXEA 1R1A3 2AYHA 2D6LX 4Q4W1 4QPIC 5HCFA 2QQPA 1N1TA 2CV6A 4RQPB 4QU2A 5J98B 1WW7A 2D98A 4XMIA 1OPMA 2WQZC 3CO2A 5KC5A 2RE9A 1CPNA 2WINB 1SBEA 3MLKA 4XBLA 1POV1 1HW5A 4YZ3A 2IC1A 2AR6A 1C4RA 1QJU3 3V65A 2WT2A 1GQGA 2DVBA 1XNCA 2GNTA 1ASJ3 1SLCA 5BY5A 1Q5OA 2FQPA 5T3NA 3CL1A 4LBMA 2P37A 3RYRA 4YG3A 1TNRA 2ZHLA 3KMHA 1CIWA 2R042 1QJU1 4RQPC 1DGLA 3ASIA 2IXLA 3BOPA 4CP2A 1ASJ1 4UBHA 1JHNA 1D4M2 1OKQA 4OFGA 1R092 1HRI3 5K7PA 1VRH3 2VMHA 4AEMA 1C5HA 1DDLA 3J26N 1LOCA 1O91A 3H1YA 3PJQA 1UX6A 3KSCA 1RTVA 1GSLA 1Q8QA 1GANA 1QJY2 1ND3C 1CN1A 5FQ0B 1V6OA 2E7AA 4EN0A 1HRI1 2WFF1 1PO23 4JC1A 4NHLA 1ZZ8A 3H0OA 4NHKA 2DTWA 4PIXA 2WS93 1LU1A 3VKOA 5L7OA 1QJX1 2DTYA 2Y0OA 2WNUB 4HSJA 3MLLA 5SV8A 2W39A 1G86A 1GNHA 4AEDA 5ABJB 4CTEA 1ZBE1 1APNA 4L8QA 2W52A 3VBSA 2QZ3A 3WV6A 2P2KA 1NCQA 5B2GB 1YLLA 2WS91 4YVSB 2ZCWA 1QOOA 1X8MA 4Q0SA 1QU0A 1DYPA 1QNWA 3EJKA 4W6XA 1HIXA 2MEV2 3V0BA 1CX4A 4LLFA 4DMIA 2RS13 4RR3B 3AYAA 4M3CB 4S2HA 3SH5A 4XILA 4CDWB 1RUJ3 4K1YA 4Q4Y2 2HWC3 1FMD1 4XXPA 1UN1A 1U5ZA 1UZYA 5FRAA 1G6NA 3ST7A 1HXS1 4HT1T 2RS11 1TNFA 1J3RA 4TWTA 2R1BA 4LBJA 2Q1MA 1C57A 1G7YA 3N35A 4EV0A 2DYCA 1RUJ1 4BE3A 2HWC1 1REFA 4KL1A 5EJ3A 1MS3A 2BVBA 3SH4A 5L7OC 4HK9A 4AVVA 3HWJA 2JX9A 1REEA 4LUMA 1RITA 1DQ4A 2Y26A 1RIRA 3W9AA 4AEDC 1QDCA 2YMZA 4TSVA 3UJOA 5DDJ2 3AXEA 3VBSC 3OBRA 3IN9A 1Q3EA 4DNYA 4P9YA 4AQSA 3JCIA 5BNQA 4PBPA 4AK3A 3SNMA 2ZKNA 3ZDSA 4AQTA 4XBQA 4JCKA 5J96B 3P3NA 3OYWA 1LOAA 3AP4A 3OF1A 1R082 2BNMA 2O8OA 5F5QA 1RUI3 2CYFA 1Y43B 3HT1A 3ZYIB 1CQ9A 4HPKA 5GLWA 4TYSA 1WUVA 4V1PA 1GYKA 5I8SA 1UPSA 4B4QA 2XVKA 3M8LA 4GWMA 3E6DA 1REDA 1OPOA 3AZXA 3KT7A 4LA3A 2XWJB 2Q5TA 1RUI1 5T54A 3SITA 3H8UA 3MYXA 3FHIB 5DUUA 3TNQA 3UJQA 4AFBA 3NAPB 2DFBA 1AR92 4Q0VA 5C33A 3ZSKA 1QH6A 1JXNA 2OZ6A 3RJRA 1CAWB 2ZOEB 1TME3 5F6LB 3ILNA 2BYVE 1SCSA 3D5OA 2CL2A 4BA6A 4I30A 5LEJA 3JD72 2QJVA 2CAVA 2VVFA 1B35A 4AF9A 3WG4A 4GALA 3PVBB 1TME1 4PDWB 1SFYA 3VBFB 1UKRA 5CNAA 2RS53 2RS32 4JDOA 4FT8A 1ZREA 1AR81 4EJRA 2JJ6A 4AI2A 5C8WA 3JQXA 3U11A 4OVEA 2HWF3 3B3QE 3R0RA 2VU9A 3RZZA 2QDRA 1COV3 1FAYA 4YFZA 1DHKB 4KH9A 2RS51 1DGRN 2F4PA 1KFXL 4RGGA 4M00A 4ES9A 4ZKTB 5JSPA 3UKNA