2RS12

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs1200
5AC92 1QJZA 4RR3B 3VBHC 2GH8A 5LK7B 1NCRB 5C8CC 1BEV1 2HWC2 2BFUL 4Q4V1 4QPGA 1HRI1 2Y26A 4GMP1 1R1A3 2WLPA 3HAGA 4CDQA 1RUD1 1RB8G 1RHI2 1EAH3 2WFF3 1NCQB 4QPIB 3VDDA 1RMU3 1TME3 1VRH2 1VB4A 2MEV3 1RUG3 1POV0 4RFT0 4JGYC 4CEYB 4AEDB 3TN93 5C9AB 4N53B 1RUH1 1AR63 1FOD3 3CJIB 3VBFA 1VBA2 5ACA2 1QJU2 1AL0G 1PO23 4LLFA 2WS93 1AR71 5L7OC 1BEV3 4GH4A 5BNPC 1FMD2 3NAPC 4PDWA 1X36A 2XBO1 3VBSB 3JBG1 1B35A 4WM7A 2R062 4RS5B 3ZXAC 3J8F1 1VBB3 5K0UA 1EAH1 1H8TC 5BNNB 1PVC1 1F2NA 1FOD2 4CDWA 1AR62 4GB32 5C4WC 2MEV1 5A32A 4Y4YA 2WS92 1QJX3 3DPRA 1RVF3 1RUH3 3VBSC 1PGW2 1CJDA 1QQP2 2ZZQA 1QQP1 4CDQB 3ZFFA 1AYN1 1MQTC 1PGW1 1RUJ1 1PIV3 1RUC1 3JB8A 5BNPB 1AR81 2X5IB 2FZ1A 1VBD3 4N43A 1DDLA 1HXS3 2R042 1QQP3 1NY72 3ZFGB 5JZGA 1PO13 1R081 4CDWC 1PVC2 1M06G 5CFDC 3J8F3 1TMF3 1FPN1 1QJX2 3J8F2 4AEDC 1RVF2 1RUE1 5C4WB 4Q4Y2 4WM7B 1PO12 3S6PA 3VBOA 1NCQC 4QPIC 1BEV2 1VRH3 1AR72 1NOVA 1MQTA 1V9U3 2PLV2 2RS13 1HRI3 3JD73 4GMP3 1ZBA2 1RUH2 5D8AC 1HX6A 4GH4C 5BNPA 2RR12 2HWF1 1W39A 1PIV1 1C8NA 1VBD1 5A33A 1ASJ2 1PO22 3CJIC 4BCUA 2WFF1 1RMU2 1TME2 4CEWC 4YVSA 3ZFFC 2WZR3 1B35C 1NA1B 5FOJB 4FTBA 3ZFEC 1Z7S3 2RR11 4Q4W3 2ZAHA 3JB4C 3VDDC 5D8AA 3VBFB 1VBD2 1R1A1 3VBHA 2HWB2 3FBMA 2HWF2 1ND3A 4EJRA 4AEDA 3JD71 2RS31 4CDXC 2XPJA 1K5MB 3DPRB 1RUD3 2HWD1 2RM23 2TBVA 3VBHB 4N43B 2PLV1 1D4M1 2HWE3 1HXS2 5CFCB 3TN92 1RUE2 3VBOC 1FPN2 4CDXA 2WFF2 3ZFEA 4Q4X1 1RUF1 5BNOC 1OOPC 2PLV3 2QQPA 4GB31 2R063 1EV13 4YVWB 1NCQA 4Q4W1 4QPIA 1BBT1 1RUI3 3M8LA 1ZBA1 2RR13 1ND2C 2R041 4CDUC 3IDEA 5GKAC 3VBUA 4CDUB 1AL22 5CFCA 1RUC3 1AR82 1H8TA 2RS33 1RUC2 1AL21 1X33A 2R072 1R083 1HRV3 2WWSA 4PDWB 3VBUC 1V9U2 4NWVA 1OHFA 4JGZB 4Q4W2 3VBOB 1QJX1 1IHMA 1COV2 2MEV2 4WM8B 5C4WA 1NY71 1WCDJ 4GB33 1RUF2 1SMVA 3VBUB 4Q4X2 1GFF2 1RUF3 4SBVA 3DPRC 1RHI1 1AR83 2R061 1VAKA 3JBG2 3TN91 2XBO2 5L7OA 1VBC2 1V9U1 5ABJC 2R043 1HQNA 2BBVA 4IV1C 1AR92 1ZBE1 2R071 1POV1 2HWD2 3VBFC 1ND3B 1RHI3 1PGL2 4YVWC 2WS91 5BNNA 1NG0A 1COV3 4WM8A 1QJU1 1QJY1 1R1A2 1VBA1 1B35B 1POV3 3VBSA 1OOPB 1CD3G 4QPGC 1EAH2 5DDJ1 1HRV2 3VBRB 1RUI2 4RQPB 1AYM2 4YVSB 1VBA3 2RMU3 1VRH1 4CEWA 5K0UB 5CFDA 1K5MC 2ZTNA 5D8AB 4CDXB 5DDJ3 2RS11 3CJIA 5JZGC 1AYM3 2HWB3 4CEYA 4IV3B 3ZFGA 5JZGB 3JD72 2BFUS 5K0UC 2RM22 4WM7C 2WZR2 2HWB1 1QJY3 5BNOA 1D4M3 1QJY2 2WZR1 3ZFFB 4Q4X3 1ASJ3 1R091 1TMF2 5C9AA 1MEC3 4RHV3 5CFDB 1PGL1 1PO11 4QPGB 2HWC3 1Z7S1 1AYN3 1RUJ3 1VBC3 1AUYA 4NWWA 1EV12 2RMU1 1ZBA3 4Z92B 4IV3A 4GH4B 1OPOA 1MEC1 4Q4V2 5FMOL 2HWC1 1ND3C 4Q4V3 1PO21 4CDQC 4IV3C 4JGYA 5ABJB 2RS52 1AL23 4CDUA 1AYM1 1RUE3 1HRV1 5DDJ2 4JGZA 4N53A 2HWE1 1BMV2 3VBRA 3JBG3 1C8M2 2DF7A 1VBE1 4FTSA 4YVSC 4WM8C 4RQPC 1OOPA 3VBRC 1RUG1 5A32B 1H8TB 1VBB1 5BNNC 1VBB2 2X5IA 4RHV1 4RS5C 1BBT3 5C8CA 2VQ0A 5J98B 4Q4Y1 4CDWB 1VBE3 3ZFGC 3LOBA 1AR91 1ZBE2 1VBE2 4Y5Z0 1C8M1 1AR61 1FOD1 2IZWA 3NAPA 1RVF1 4PDWC 5ABJA 1VBC1 2RS53 4YVWA 2X5IC 5L7OB 1R082 1K5MA 1MQTB 4RQPA 4IV1B 1C8M3 1ZBE3 1FMD1 1COV1 4RHV2 4N53C 2XBO3 1AYN2 1RUJ2 1RUG2 4JGYB 1VB2A 4CEYC 5ACA3 2FZ2A 1HXS1 5BNOB 1PVC3 1F8VA 1TMF1 1FPN3 4FSJA 4JGZC 1AR93 4N43C 5A33B 4Q4Y3 3NAPB 2HWD3 2RM21 2HWE2 5FMOS 1BBT2 2R073 1MEC2 5C8CB 1NCRC 1RUD2 2RS51 4RR3C 2BUKA 2RMU2 1QJU3 5AC93 2BPA2 1ND2B 1HRI2 1NCRA 2RS12 1ND2A 2HWF3 2GSYA 1E57A 3VDDB 1RMU1 1TME1 5C9AC 1FMD3 3ZFEB 1EV11 5J96B 5AC91 1ASJ1 5ACA1 1D4M2 1NA1C 1Z7S2 1RUI1 1PIV2 4GMP0 1R093 4RS5A 4CEWB 4FTEA 1BMV1 1R092 2RS32 1A6CA 5CFCC 1AR73 1NA1A 4RR3A 4IV1A
chains in the Genus database with same CATH superfamily
1WBFA 3AL6A 4RR3B 2HYKA 3POYA 3R4SA 1QH6A 4IEUA 5JPMB 5FYIA 3W59A 5A7PA 1SCRA 5IK4A 1BEV1 1I9RA 1IG3A 3SISA 3UGFA 3VKMA 1LOGA 1ZRDA 3NKTA 2WLPA 4BIOA 1X82A 3CEWA 4CUAA 2ZEYA 1RUD1 4CU8A 2BTVC 1OI6A 2DUOA 3ETQA 3BB6A 4LORA 1K45A 1B09A 3SQOA 1NCQB 2VG9A 2R7EB 3H3UA 2JG9C 3I7DA 4LO8A 1BLZA 1OA4A 1VB4A 2MEV3 5FMCA 1UPIA 1RUG3 2JB4A 2JECA 4PJYA 4RFT0 3N36A 2OZ6A 4MGIE 1XYOA 2VVFA 2WZEA 2NYYA 3TN93 2VZ1A 2ZBJA 2XOMA 3UL2A 3Q8CA 5HPOA 4IL7A 2R1BA 5IT6A 3IDCB 2G9GA 5FV3A 3M3CA 1WWYA 2ZX2A 3AB0A 1ONAA 1PMIA 3PNAA 5FYYA 3H8XA 3D5OA 1OURA 2BGCA 2N7GA 3AXEA 4XYXA 3RRDA 1S1AA 3M3QA 2Q8EA 1DBNA 2DURA 5L7OC 3HWJA 1BK1A 3U11A 2K0GA 3SXWA 1BEV3 1GP4A 2IXHA 4GA9A 2DCZA 2JDKA 2ZEZA 4PDWA 2E7AA 1X36A 3TEXA 5I0RA 1N1YA 1GP6A 1SLAA 1XU1A 3JQWA 5FP4A 3VBSB 5FAXA 3CO2A 2D98A 5FFOC 5K0UA 1VBB3 3J7NA 4UW6A 2KA3A 2ILMA 1H8TC 2WA4A 4XACA 3USUA 2ZMNA 1JHJA 3LA7A 1PVC1 1F2NA 1FOD2 4Y1ZA 1MS3A 4GB32 1OLME 4ASMB 1RUNA 5C4WC 2UYAA 5A32A 3OBZA 1RITA 4AVCA 1HJGA 2QDNA 4GULA 5FUPA 4YFZA 1QJX3 3I49A 3O0XA 5IATA 1IZ3A 5KXDA 3NVCA 4V1PA 1DYPA 1O6UA 2UY8A 2WRAA 3K46A 3IWZA 5GZDA 3RGBA 2VXRA 3SEPA 1LECA 1CJDA 2JDMA 4NAOA 4FI9A 1QQP1 4XTMA 3EJKA 2YFZA 3PDQA 5EYYA 1MQTC 2NN8A 2OX0A 4OUSA 4ET7A 2PHDA 4R9DA 4BQYA 2BGPA 3B00A 5J7MA 1HV1A 1FNZA 3WW1A 2X5IB 2JE7A 3HNYM 3THTA 1JZ5A 4ZU5A 3ZYJB 5LA9A 1VBD3 4INDA 4YWAA 2WL1A 4COYA 4XTPA 1GNZA 1OMIA 1CAVA 4GWJA 4O65A 4QX5A 3VL8A 4LO7A 4Z2WA 4HK9A 3VV1A 1LGCA 2WT1A 1GZ9A 5A7SA 4AEMA 2YC0A 3LPFA 3J8F2 3ELNA 4CPBA 1X9PA 2ZJCA 3ZDSA 1N3QA 5FPLA 2BYVE 5GLTA 3I3BA 3RMXA 5C4WB 2YY1A 1G9BA 1GSLA 5CYYA 4HOOA 1IS4A 4N7UA 3R4DB 1UZWA 2W68A 3ZXEA 3ZYIB 3DN7A 3ON7A 3T0BA 3VBOA 5HBAA 3DKQA 4QPIC 1E5SA 3DKWA 4YZ3A 3FC0A 1BEV2 2EAAA 3WP4A 1W2NA 2ZHMA 1VRH3 1AR72 1OUSA 2PLV2 4MGKE 3KSCA 1KS5A 2BEOA 4A6SA 5LK5A 1GICA 4HKOA 1HRI3 5DUVA 2P6HA 2VMDA 3JD73 5CB7A 4GMP3 4OCTA 4H55A 1RUH2 1FX5A 2JENA 2W1SA 1PX3A 1Y9QA 2RR12 3FLPA 2HWF1 1W39A 4XVHA 1PIV1 2ZX0A 5FY1A 1D7PM 5IVYA 1TZOA 5A7WA 1DP0A 1C8NA 1XPWA 2IVJA 2D97A 2GP5A 2NMNA 3A22A 2ENRA 4I0BA 4Z07A 5FK7A 2EVXA 4ARXA 1W9FA 1U12A 2QQMA 2A7AA 2BBAA 2HBTA 2V72A 3ILFA 4E4ZA 1SHWB 1GQGA 1YQ8A 2TUNA 3B93A 3I54A 1LHVA 2C9KA 4P9YA 4CEWC 4YVSA 1FATA 2BNMA 3EBRA 2H6BA 3J9SA 5LB6A 3RDIA 4BOWA 1GU3A 1YNAA 1ZYBA 2UYBA 1V00A 5FOJB 1MPXA 4FTBA 3ZFEC 3WCSA 2B42B 3DCQA 1JOPA 1X8MA 2C1FA 3KF3A 1DQ1A 4LBNA 3ZN5A 3J7MA 3AYAA 3PUSA 2RDRA 1XNBA 1DQ4A 3UKTA 3WQ1A 5IK7A 4DEQA 1R1A1 3C7HA 4QXCA 5JIAA 3VBHA 3RZKA 1Q56A 2HWB2 4QHBA 4G3YC 2EALA 4N90A 3F2ZA 3V0BB 2GALA 1OH4A 2HWF2 3PU8A 4YW1A 1ND3A 4EWDA 1UIJA 5LA0A 3B01A 4AEDA 3RWKX 1CPMA 4PLMA 1ZZ9A 3JD71 5HXVA 2SBAA 1EPWA 4YNIA 3I2KA 4HKWA 4V2WA 1W05A 3THCA 2HWD1 1XXNA 3AKTA 4A7KA 4COUA 4N43B 2PA7A 5GLZA 4S2HA 4YZ4A 4QU1A 2W08A 3NJXA 5CFCB 4YYOA 1AJKA 4PCRA 3UGHA 3WW2A 4JQTA 3ZXKA 2XONA 1FPN2 1KDMA 3QCWA 3AL5A 3HEIA 4AI0A 1RL3A 4AK3A 1OOPC 4MHUA 3TB0A 4AFAA 2R063 2P6CA 2YPJA 3OB8A 3ZIXA 1W90A 5T54A 2VL4A 1ULDA 2VZVA 2ZHNA 4IETA 4CCNA 4XAEA 2A1XA 4PQ9A 4Y22B 3RQ0A 5A3MA 5JAXA 1TEIA 4L2NA 1NQJA 3NWKA 2YMZA 3LSEA 5C6CA 3DL3A 2CAUA 3QACA 4X8PA 5JPNB 1MS0A 5F3GA 1S0EA 1JZ4A 2V5DA 4WVVA 4NHYA 3OG2A 3ZVXA 4E9KA 1RUC2 4XE9A 5DUWA 1GWLA 4M3CE 1C5HA 1R083 3HD8B 3LF7A 2WWSA 4B4QA 4OLLA 4PDWB 1F9KA 3B9IA 3VBUC 2BWCA 4H2AA 1JMUB 4E4SA 5HV0A 1KS4A 3K2OA 3CZUA 4AL9A 4YW7A 4CU9A 1UX7A 5FYCA 3FL7A 4HG6B 5LEJA 3H8RA 1OF3A 1QMJA 1WMXA 3H8OA 1IHMA 3GJAA 4GQ7A 3NO8A 1GLHA 1LHWA 3AK0A 3SKJE 2YFUA 4PIYA 2YC2A 3VDAA 4ARYA 4CEYC 1L7LA 3D8CA 4HL0A 4I01A 5A3PA 4XUTA 4KL1A 2CDOA 4LK6A 3RMYA 5FYUA 5IVJA 2O14A 5FZ9A 4DRRA 1UYZA 1YRZA 2D5HA 2Z2SB 1AR83 3ZSLA 3U75A 1YJLA 4XCAA 2TNFA 3JBG2 2XBO2 1WCQA 5ABJC 1UOBA 3BI3A 2P17A 5IAXA 4IV1C 4JC1A 3AZZA 4M4RA 4XMIA 1QGLA 3VD5A 3KV6A 2FBEA 4FPCA 1W6OA 5FYZA 4AFBA 1W6QB 2B45X 4Q0PA 2J1UA 1PGL2 2LM3A 1LTEA 5CZKA 2WS91 4CUCA 5BNNA 4O61A 1NG0A 5FK8A 4YPJA 2Q1FA 2GNBA 1UZ0A 4QQLA 1NX9A 1SEFA 5A3OA 4XFFA 2QVSB 4YM1A 1PNGA 1OQEA 3SKVA 1VMFA 5IK5A 2XGXA 1RGSA 5A6YA 4AW7A 3BOWA 3D4KA 3PTYA 5DDJ1 3VBRB 5JLVA 4XAAA 4FPLA 5FZ8A 4BZ4A 2YZ4A 4F83A 3G6JB 1UKGA 2Y6FA 4XQDA 2JKBA 4LO5B 2J7MA 3WDYA 4EWAA 1UWWA 2HBUA 5K0UB 4BK4A 1YIPA 2UWBA 2ZTNA 3ZKYA 3K75B 1BXHA 1ULFA 1AX1A 2D6PA 3OUIA 3Q8FA 1SDDB 3EXUA 4NMIA 1AYM3 3AC0A 4IQPA 4P9GA 1DG6A 2ET7A 4OULA 1WGPA 4E27A 4XJ8A 4MGZE 5IJRA 3VHPA 4AHZA 1XE8A 1GUIA 5K0UC 2IFRA 1GOFA 4XOGA 2ZHLA 5FPVA 4Q29A 4KG0A 2NMOA 3IMNA 1CAUA 2HWB1 2FMDA 3K77A 2JDAA 3S0MA 1YWKA 1UL9A 1QJY2 2IXLA 2WYFA 2XUEA 2WZR1 4JZRA 3PHMA 1F5FA 3J7LA 1SCSA 3ZFFB 1ASJ3 2EICA 4UW4A 5C9AA 3I2FA 3LE0A 1OA2A 1REDA 2HWC3 4CP2A 2GNDA 1Z7S1 1PK6A 1VBC3 3CLPA 4NN0A 2W9XA 5I8SA 4AFCA 2BNOA 4DO0A 3WUDA 2BV4A 4NWWA 3POEA 4D94A 4XBLA 4Y5TA 5F8PA 4Z92B 4GKYA 4P9WA 4GH4B 4CCMA 2VQAA 2BJSA 1MEC1 4OZXA 4Q4V2 3Q8AA 1S0IA 5KHIA 4LOSA 2XQXA 3HT1A 1NE6A 2ZZJA 2DTWA 1PX4A 4TYSA 5JI9A 1JU3A 3T3YA 3E6BA 4KQ7A 1WW4A 4WVWA 4ITCA 3U4XA 5ABJB 4JHTA 1AL23 3UKNA 4DEVA 4BQ2A 4XILA 1IGOA 2HWE1 3FHAA 2VVDA 3FE5A 3HBKA 4BA6A 5J36A 1HIXA 2RHPA 1TNFA 3H1WA 2RJLA 1VBE1 5LBEA 4BM8A 3VDCA 5J3UA 2CSGA 1Y9MA 2I07B 5FXXA 2UURA 1IPJA 3UJQA 5JWPA 4RQPC 4AI1A 1LOCA 1UU4A 3MO4A 3E5UA 2HKXA 1H8TB 1VBB1 2ET1A 1LULA 5CIRA 5BY5A 1US2A 2LALA 4MGSA 5FZIA 4Y3OA 2YBPA 1IKQA 5ANQA 5FPZA 3ZSEA 1CAWB 1AR91 1NZIA 1VBE2 1WW7A 1WW5A 2PTMA 2IZWA 1AR61 2XJSA 4LBMA 4PDWC 3AZWA 1TVGA 4O7XA 3RG0A 1BHGA 4R4XA 5F5CA 5LBBA 4R8HA 3FHQA 4AFMA 4HN1A 1FYUA 3VZLA 3PUIA 5F5QA 3VKNA 2QKDA 5L7OB 1NYWA 1X50A 4FBFA 2ZABA 1LGNA 1MACA 1NLSA 3B94A 3DYOA 3AMQA 4IGPA 2G1MA 3ZO0B 2VPVA 5E6HA 1FMD1 5LBCA 1QOSA 4UF0B 5HV4A 3O14A 3LA3A 4CXYA 1G7YA 2VCCA 1AXKA 3M3OA 1JW6A 4EV0A 1V6LA 1RUG2 1JZ3A 2NP0A 4DOUA 5LY1A 2PHRA 4FP2A 4RGGA 1ENRA 4QB1A 1MZEA 2IXCA 2JG9B 2Q0AA 3N9MA 2LROA 2WN2A 4JGZC 4B8EA 1CN1A 3ILNA 1FI2A 2XUMA 1UZYA 4PIZA 3HNBM 4UW3A 4YW2A 1BVP1 4ISQA 1AR93 2VNVA 4X6QB 4N43C 2BRTA 3GGLA 1MS8A 4BWOA 1REFA 4Q4Y3 3NAPB 2ZMKA 1CVNA 2HWD3 3C7FA 2HWE2 4HN0A 5AFBA 1ULCA 2ZGRA 1BBT2 2RJ2A 4I30A 2R073 3WQBA 4UFLA 4DNYA 3OGSA 3FN9A 5FMBA 1XNAA 2AREA 4ES9A 3H1MA 4RR3C 4Y26A 5HI0A 1CWPA 4P5YA 3KMHA 1ENQA 2JICA 1LKNA 2W3JA 1ZRCA 2D3PA 2RS12 5D21A 3OGVA 2CDPA 3LZZA 5A6QA 1VJ2A 2JJ6A 2ZKNA 1RMU1 4PIXA 4OI0A 4Q27A 3PTRB 3ZFEB 1L3JA 4E2QA 1Q43A 1A8MA 2YROA 5AC91 2GC2A 4GXLA 4H3WA 1D4M2 4LO6B 1N47A 1NXD1 5DG2A 2WA3A 1Z7S2 1W6MB 2QFEA 3KHCA 4Q5OA 1DYOA 1YFYA 2PHXA 4CEWB 1ZZ6A 1XYPA 3LFMA 3M70A 4O9GA 1R092 1YHFA 3LKJA 3POIA 5JMCA 5LA1A 4AI3A 2BOIA 2JD4A 3A7QA 4IV1A 5IAVA 1OVSA 2CWSA 2RJKA 2OS2A 4HVOA 5FZKA 5AC92 4HETA 2D40A 3AP4A 4IE4A 2BDRA 5LK7B 1NCRB 1QF3A 3VKOA 4XIOA 5CG9A 5K4LA 5FREA 4E8CA 3ZLIA 5EYXA 4YZ5A 1K42A 2O1QA 4QDSA 3HR9A 3VUOA 3FMGA 1R1A3 2FHRA 2ZGMA 3ZSJA 2WNEA 5I0DA 3RSJA 1OD3A 1LEDA 4CDQA 1OFSA 1RB8G 2ERFA 1LODA 1TE1B 2VULA 3TEWA 1CZVA 2F4PA 4CP9B 1DQ0A 4Z82A 1EAH3 3GALA 4QPIB 1RMU3 1UY1A 2ARAA 3WD5A 4QQHA 4XJAA 3O1PA 4HMZA 2FCVA 3BKZA 3VDBA 5E1RA 4JGYC 4CE8A 1ZVFA 3GZEA 2WYSA 5C9AB 2W1WA 4FP3A 4R9AA 3OTFA 4M3CB 2XJUA 3T2TA 1CIWA 1KITA 3SCHA 3W5NA 3CJIB 4FAHA 2GMEA 5FY4A 3PIGA 3ZYHA 3VBFA 4YG3A 1CAUB 3GCXA 2X10A 2VJXA 1QJU2 3ZXFA 3VD9A 4ZONA 4P9XA 3RI8A 1PO23 1IS6A 1YQCA 1KQRA 2WS93 2BOJA 2ZEWA 4FQ4A 5K9YA 4LKFA 2ZGPA 3MUY1 5L9VA 4FPJA 4GH4A 3APBA 5EZWA 1W2TA 4FOVA 1W04A 4M0NA 4BMEA 4OHXA 2DDUA 2YBSA 3O7OA 4EZHA 3V0BA 3WCRA 4BLJA 2XBO1 2FCUA 3JBG1 5FJHA 5KHJA 5EP9A 2R062 1UO9A 1EAH1 3Q9OA 2QCSB 4L99A 4OFGA 4XBQA 4JQRA 4K20A 4D8MA 1AR62 3ZXLA 4D6QA 2XJVA 2C5DA 3PUAA 3GM8A 4Y4YA 1WA6X 3RZMA 3OY8A 2XKOA 1QJEA 5FZFA 3IIIA 1UX6A 5FY8A 2WQZC 3DPRA 3BU0A 5HCHA 2VW2A 1BCXA 3AZVA 5DQ0A 5H9PA 3MIHA 5FZ6A 3S5QA 3VBSC 3OEAA 4QX1A 1ZA4A 2A6YA 4DFSA 1R64A 5JXJA 1HN0A 2ZZQA 1CAWA 3ZFFA 1RTVA 5L9BA 1ULEA 1MZFA 4F7ZA 1PIV3 2R16A 1JH5A 1RUC1 3H0OA 2CY6A 1AR81 1U5XA 5IW0A 4KWLA 2QJVA 3O1TA 4B4PA 3QLQA 3LDRA 5JSPA 4TLFA 3T2PA 1DZQA 1N3OA 3KS7A 4P9JA 3TWIA 1HXS3 1GZWB 2R042 5BUVA 1QQP3 3WDTA 4NIGA 1POQA 3ZSMA 4LJHA 5JZGA 5K7PA 4DXSA 5KWRA 3EQEA 1AX0A 1YI7A 4CDWC 4BQ5A 1NUKA 1M06G 4R9BA 1NAEA 2RV9A 2CNAA 4LHSA 5CFDC 4R9CA 1SFYA 5FZ4A 4E4HA 3KGLA 1RVF2 1QJFA 1LCLA 5FP3A 2ES3A 2YC4A 4U36A 3VD3A 4K40A 1YUDA 3B5LB 3N4MA 4CRQA 5J1XA 1NCQC 1F31A 3H3LA 3LEMA 1C4RA 1XOYA 1OC1A 5C3PA 2PHTA 3N7LA 4KBBA 1NOVA 4L92A 4TN7A 3WDUA 1MQTA 2A3WA 2DVGA 3VHOA 5CA6A 1SQ4A 1UMZA 5EJZB 1V6MA 2VMEA 1D0HA 2JDUA 3I2OA 3N9NA 4J1WA 3RZJA 1ZBA2 1VRBA 3NRUA 5DZEA 1MS4A 3M7AA 1ZZBA 2A73B 2QQKA 1NLQA 2C6SA 3RYPA 2DWRA 3BIEA 3P3PA 3IAPA 2AEZA 3LWCA 5F39A 1ASJ2 5DAWA 1OF4A 2ARXA 4BCUA 2J42A 4LA2A 2CL2A 4DQAA 2GH2A 3PIJA 2QDRA 1TME2 1JYCA 2WN3A 4P02B 5A3WA 2ARBA 2P2KA 2VMFA 1APNA 4NIAA 3H1YA 3RJRA 5CKNA 2MNGA 2ZACA 4JCKA 3M2MA 2Q8OA 3MPBA 3IDBB 2V5YA 4HZFA 1QXJA 3I3QA 3DUIA 3P5BA 4AQTA 4AVVA 5D8AA 1LNSA 1RYYA 1W9SA 5EFUA 5FYTA 4BH9A 1HW5A 2VE1A 4YW6A 4Q1PA 1SBDA 3PMSA 2C9AA 3FBMA 3OJBA 5LASA 3O1UA 1IPSA 4DXZA 1W03A 4EN7B 4YW3A 1DZTA 2AC1A 2RS31 3AM2A 4D6RA 3POBA 3HMYA 4ZXEA 2V4AA 2VUAA 1OKQA 3I3DA 4A3XA 4ZZ5A 1YQ6A 2TBVA 1FV3A 2WAAA 3AVSA 3CIHA 3LOIA 2PLV1 3AP6A 1GMMA 1I5ZA 1Q8OA 3PU3A 4I0AA 4Y20A 1H4GA 4YW4A 1ACCA 1D4M1 2I74A 1YXWA 2TEPA 2WO2A 2OA2A 4KWKA 4BB3A 1CX4A 1W8WA 2DCTA 1RUE2 3IM0A 3IT8A 5FY5A 3T09A 3ES4A 3UKVA 2XJRA 4FOYA 3ZOIA 4CXXA 5C71A 2QQIA 3VBOC 2ZCWA 2WFF2 5C3SA 3OEBA 3THDA 4CCKA 4AQSA 5JVVA 2DCKA 4LUMA 4GB31 1DFQA 3OPTA 1EY2A 1W6PB 1MS5A 4A3ZA 1EV13 1YQ5A 1JYXA 3HN3A 1J83A 2ZGQA 3QBQA 2J22A 5DZGA 3ZKUA 1QH7A 4AF9A 3EMRA 1NCQA 2YB7A 3K4ZA 1RUI3 5A7QA 3N7KA 2QE3A 4E4DX 2E63A 4MG2A 2W94A 3IDEA 1WCSA 3VBUA 1I6XA 2GC1A 4KH9A 3TOJA 4CDUB 1MZ5A 4FQZA 2OQ6A 3EB7A 1N1VA 5FO8B 4BQWA 5CFCA 1UD1A 2ZGNA 1RUC3 2RS33 4LOTA 2VD7A 4LUKA 2LRPA 4AR2A 1V6JA 1EYBA 3BU7A 1C57A 4ZZ8A 5HXMA 3IIAA 1ZA7A 1H4HA 4I2OA 4GZ9A 2WFPA 4YZ1A 3WLUA 4JKKA 1O8SA 1AZDA 3ZYBA 4LBOA 4LE4A 4BU2A 3H8UA 5FZMA 3MLJA 4OMDA 2JKXA 1VPHA 3AFGA 2XHNA 2MEV2 2Z79A 2DBIA 4NRMA 1W3VA 3A23A 4WM8B 5C4WA 4I0WB 1EUUA 1KRIA 1HQLA 3SLIA 2PAEA 1WCDJ 4GB33 4W6YA 1UZZA 5E8AA 1GFF2 3E5QA 3T1MA 3WDWA 3PMEA 3DPRC 4L11A 5FKBA 5FY7A 2FDKA 4DB5A 4AVSA 1VAKA 4XBNA 3ROUA 4XDOA 2O8QA 1QNYA 3RPQA 3N7JA 1ZRRA 3WG3A 4LKEA 2I2SA 3V56A 5C3QA 1ZBE1 3LGRA 4J1XA 3AKPA 4YSFA 4IEWA 5AFEA 2XXZA 4WVZA 4YVWC 3HPNA 4Q26A 4BQXA 2D3RA 2XHKA 5IVBA 1DQ2A 5A3TA 4EWEA 5KXEA 2DTYA 1NE4A 2JEMA 4BK5A 4QKDA 4WVMB 4Z2AA 3VHNA 2VOTA 3HJRA 2A6VA 3POGA 4XQWA 4ZXKA 2E7TA 3P3NA 4EQVA 1KD7A 4YVSB 3MIGA 3VZOA 4IESA 5C3RA 1BKZA 3ECQA 2K9ZA 1KFXL 2WKKA 3GHNA 1ODMA 3RJ2X 4CEWA 1K5MC 3LEGA 3NV3A 5JIUA 3AFKA 1QDOA 4YG0A 5DDJ3 4CDXB 2RS11 5F2SA 5LA2A 2QQWA 1OBNA 2BP6A 4Y24A 5FTTC 5FZGA 4KMQA 1JYNA 5I8YA 3O1MA 4XMAA 4IV3B 4DUVA 3TNQA 1NZCA 3I2GA 4XW3A 4QXBA 2YDEA 3T0DA 3JD72 3TRSB 1S55A 3C7EA 1JXNA 4AI2A 4RD7A 2D6KA 3AJYA 1YC61 2W0XA 3O1RA 1D4M3 1SBFA 2VZ3A 2RDSA 4QDRA 4XFIA 5FO7B 3KD4A 1YIFA 2WNUB 4LBQB 3ZXJA 4BQ1A 1DZRA 2ZXQA 5L36A 1UY3A 1G86A 4RHV3 4YZ2A 3LDKA 1O3SA 1W3XA 4QPGB 3TNPB 2FD8A 1LU2A 4LLOA 3AZXA 3HIFA 2X29A 4V2VA 3IBMA 3WT3A 3KZ4C 4LHNA 4AI8A 1ZZ7A 4IEVA 1SFNA 1RJ7A 2GMMA 1BZWA 3W58A 1GKBA 5FPAA 3LSDA 4YM3A 1UOGA 5FMOL 4QPWA 2E31A 3SEEA 3W5MA 1A3KA 1DGWA 2HWC1 4Q4V3 2DYCA 1P8JA 2V09A 5F6KA 1VMHA 4LHLA 2VGDA 5AVPA 4FPEA 2B39A 3T2QA 3I8TA 4NROA 4HONA 5B4XA 3BTYA 5DAQA 1GQPA 4UFMA 4NE9A 2WBKA 1OH3A 3VBRA 4I3PA 5T3NA 2DF7A 1R1ZA 3BODA 1W2AX 1JHNA 1GR3A 3BCWA 5FIXA 4FTSA 1WZXA 2ZGUA 1OOPA 1W2OA 4BYYA 1H2NA 3DF0A 1VBB2 5KC6A 1W9WA 4KBZA 4Q0SA 5F32A 4RHV1 4RS5C 4UFKA 1BBT3 3WHTA 4K1ZA 2ZMLA 2VQ0A 2IUWA 2QQJA 4N7IA 4Q4Y1 4CSWA 1VBE3 3ZFGC 3BTAA 1JODA 3SITA 4LMFA 1ZBE2 4Y5Z0 1MS1A 2E51A 4NHMA 4XUPA 1FOD1 3NAPA 1KEXA 3N3HA 4C90A 1N3PA 1HB1A 1ZM1A 3AMMA 3Q8BA 3KCXA 5GZEA 4IEYA 1OXCA 1PGSA 3U37A 3T1LA 3RYRA 1JS9A 3PVNA 4XIKA 4EYUA 5IFTA 3S5AA 4QU2A 4FPKA 3WQ0A 1SFPA 1OLQA 2WNVB 1U5IA 4RQPA 2XH6A 3WF0A 3E6CC 1H6XA 4QHOA 1ZBE3 4KU8A 2CGNA 2L9LA 4YW5A 3U78A 1F4HA 1GOGA 2D44A 3I3EA 1IS3A 1K3IA 3OUJA 4MOAA 2GNMA 4RHV2 1OKOA 1YFUA 1DHKB 1I3HA 2ZOEB 3LIGA 5EQUA 2A75A 3GZAA 1AYN2 1RUJ2 5LBFA 1YO8A 4XF3A 3M3EA 4ASKA 5CAZA 4GJYA 4N8MA 2UWAA 1Z78A 1DLLA 2PN5A 3IPVA 1HXS1 4NPMA 4Q1RA 4KWJA 5I93A 1VE0A 4XCBA 4N9HA 1G8WA 1T6GC 1E5HA 5B4NA 5BNOB 3LD8A 1F8VA 2J1AA 3WP6A 3ST7A 1MVEA 3KF5A 4C1WA 4TZDA 5C5TA 4LXLA 1XNDA 2GC3A 2E7QA 1ALYA 2Y8KA 4CCDA 4FPYA 2IXKA 4OHZA 3FLTA 2XVLA 1OA3A 2J1EA 5A33B 1L7QA 2FDIA 4P9LA 3PUHA 5FDBA 2JE9A 2JWPA 1GQHA 2B5HA 4BJ0A 3WV6A 2JXAA 3POSA 3USUB 2LTNA 5FCCA 1K12A 4CP0A 2DVAA 2W95A 2Y6JA 2RS51 4XJWA 2IFWA 1Y9GA 2BUKA 2RMU2 3ES1A 4QPYA 4KGQA 2BPA2 1ND2B 3QH6A 1H2MA 4LR4A 5C8WA 3OF1A 1ND2A 4YLZA 2HWF3 4OQ8A 2GSYA 4HVRA 1TME1 3MIDA 5LCWL 1IS5A 1EV11 1JUHA 3ME2A 4YFWA 4ZU4A 1SPPB 4CUGA 1T6BX 4LEJA 1ASJ1 1NA1C 2JX9A 4E8DA 4K9SA 4EE2A 2AGSA 1CZSA 1RUI1 3BPSA 1ENSA 4GMP0 4RS5A 3O1SA 5LEKA 2VCMA 1STMA 1T2XA 2VMHA 2CWMA 2ZAAA 4IGOA 4PLOA 1QKQA 2RS32 4KWUA 1A6CA 4FFGA 1Y43B 5FZ3A 1O3RA 4Q2FA 3O0WA 4OHWA 1QOOA 3OD0A 4AYUA 1S0FA 2VNOA 1QJZA 1C28A 2B9VA 4XURA 5LY2A 2GH8A 2YV8A 2IC1A 2OYZA 2GDFA 2BZDA 5C8CC 2C24A 3MZHA 2HWC2 3J7HA 3WW3A 4Q4V1 2VMIA 2W5FA 2W39A 2Y26A 1OFNA 1DGLA 4IEZA 3OBTA 2RDNA 4XZUG 3UYJA 5GALA 3VZMA 4AE2A 1EUTA 2JDPA 4ZS2A 5CNAA 5FWJA 4GAZA 1MVQA 1KXGA 2YBKA 1UYYA 4MHRA 2WFF3 1W0OA 2Y0OA 5DAPA 2ZKLA 2WZPP 1TME3 3SCGA 2OVUA 2ZX1A 3ACGA 1VRH2 1A78A 3VDDA 4A4AA 2FDGA 4NPLA 1POV0 4RA0A 4I09A 5JCTA 2EXKA 1JZ7A 1QDCA 5KBFA 3ZYPA 2FCTA 1XBFA 4XPVA 2EAKA 3PUQA 4CP9A 5A1FA 4ZKTB 3NJYA 4AWDA 2DBNA 4N53B 4MGYE 4LBQA 3ZMNA 2CGPA 1CGPA 5FXZA 1AR63 4MADA 3I59A 2P5BA 4P08A 5J48A 1O5LA 5CG8A 4URAA 2R1DA 1AL0G 3NQHA 2YYOA 3UJOA 1F4AA 3RI9A 3CKHA 1AR71 1O91A 2HEYF 4ZY9A 1JTZX 2GZWA 1AX2A 4X6RB 5BNPC 1OLRA 1Q8QA 1FMD2 2UU8A 1YQ2A 5JR7B 1A8DA 5T5JA 2OXBA 1U5ZA 2RDQA 3AZYA 4A41A 4QB2A 1XJAA 1RXGA 3T2OA 3ZXDA 1RC6A 2KM2A 4Y1XA 2CTVA 1HB3A 5KXCA 3D0JA 4WM7A 1LOBA 3ZXAC 1X7NA 2RE9A 3WF4A 2BVBA 1DGRN 4C91A 3PVOA 4XDQA 5BNNB 5IWFA 5FBJA 2PQSA 3V0AB 4CDWA 4C0BA 5CEHA 3Q8EA 2BQPA 3M4FA 1I1EA 2BNNA 4UWDA 5H9SA 5FXWA 3JXSA 1DGRA 4EROA 1J1LA 3AJZA 5CISA 3MIBA 4OYUA 3N9OA 2WS92 4IW3A 2MPFA 3QOPA 2HLEA 4WZCA 4OQ9A 1RVF3 1GZCA 3QD6A 1OPMA 1S2KA 2ZPXA 3ALQA 4XABA 4XFBA 4AAXA 2DFBA 2DU0A 1IG0A 1LU1A 3AVRA 4RN5A 4C8DA 4CDQB 2WNVC 3DECA 3JQXA 4MV2A 3KWVA 4XXPA 4QKBA 3ZMOA 1F15A 1NT0A 1WUVA 1YFWA 5I0TA 5FZOB 1LGBA 2JG8B 2QBXA 1HDKA 1O7FA 3S7EA 4O9EA 4E2SA 5IVCA 5BPXA 4Y1VA 4N43A 1CX1A 1ZRIA 1DU3D 5F9TA 1GYKA 4UXAA 2XMLA 5FZBA 2E53A 2W91A 3ZFGB 1PZ9A 3JUUA 4CCEA 4QQPA 2WT0A 5HCAA 1UOFA 2EIBA 1TMF3 5JXHA 3UV9A 4OHYA 1UU5A 1J59A 3BN6A 1W8ZA 2VW0A 2VU9A 3I2DA 1XE7A 2JD9A 3IPVB 4AEDC 3TBDA 1W8FA 4NR1A 5FQ0B 5BXXA 1ZNPA 4B1MA 4DXRA 4WM7B 3WG1A 3FUOA 4Q0UA 1O4ZA 4QD2A 3INAA 1CAXA 4META 2QUOA 3ZN6B 2X8KA 3WF1A 2HEVF 2J1SA 2VH9A 4BE3A 5H9QA 2WINB 2Y33A 5LW9A 3LEKA 4XFAA 5T52A 2ZX4A 1V9U3 3K4DA 2OKXA 1LHOA 1S0JA 5FZ7A 2ETEA 2WQ4A 5JMOA 3VD7A 3IB3A 1PZ8A 1O3TA 5DXDA 3FFQA 3GF6A 4AVTA 3LAGA 5J37A 3FZ3A 2XDVA 4B7EA 5JXIA 5D8AC 3SMHA 1FNYA 3VLBB 3W21A 5BNPA 5IVFA 4XETA 3MHZA 5FZ0A 4YGBA 2VMCA 3LIHA 5B2GB 2J1VA 1URXA 1SLIA 3MW3A 3GBGA 4PI0A 3A4UA 2VZQA 4JDMA 1PMHX 3EYPA 1U5YA 1GP5A 3ILRA 4HXCA 2QQVA 2WFF1 3OUHA 2P1BA 4Q0QA 1BVVA 1RMU2 3VL9A 1V6KA 4K21A 1TQ5A 4M0HA 4RSUA 5FYBA 2WZR3 3U10A 1B35C 1U0AA 2VUCA 4FFHA 3CDZB 5JXGA 2Y60A 3T08A 1OQ1A 4XFCA 3OPWA 4B3NA 4JDOA 3DXUA 1Z7S3 4Z8BA 1PVXA 3WEZA 1GOHA 2ZAHA 3J26N 2BW8A 2WR9A 4S2GA 2PFWA 1VP6A 3VDDC 2Q30A 1DGWX 2JG8A 3VBFB 1V0AA 1Q8PA 3IZOA 1VBD2 2VQTA 4XZPA 4AHXA 1EP0A 1LOFA 2OPKA 4EJRA 4C1XA 1Y4WA 3K51A 1M4WA 2ARCA 4L97A 4CDXC 3E6DA 3JCIA 5G04L 3AMPA 2XPJA 1K5MB 2WWUA 3MLLA 1RUD3 4QB6A 1ENXA 5LATA 2W87A 3RFRA 4RGAA 3I2JA 1DQ5A 2VQUA 4YRDA 4F8AA 1ULGA 5A1LA 1PK6C 3CQOA 1WKYA 4HSLA 2HWE3 1HXS2 5F3EA 3TN92 5F37A 3LPGA 4QMAA 3AP9A 4UFHA 1S0CA 2EIGA 1AJOA 1LOAA 2Q1MA 4LE3A 4CDXA 3VN4A 3RZGA 4Q4X1 5FP8A 3SNMA 5A6ZA 4DZGA 2ZGLA 1UMHA 2PLV3 4AGVA 1H9WA 5JOYA 5JI7A 2DV9A 2DVDA 4Q8LA 3CBNA 2VOWA 4NPRA 1Q5OA 1UPSA 3OY8B 3BOPA 4IERA 4DY5A 4YVWB 4JVAA 5F3IA 4QPIA 1SZBA 4LQRA 1JBCA 3KGZA 1BBT1 3M8LA 1ZBA1 1SLLA 2W92A 4JTNA 2P3IA 2RR13 4LNVA 1FAYA 1ND2C 1Q8SA 4BQ4A 3FX3A 5H9RA 4UFJA 3PVEA 2PHLA 3H9AA 3NNGA 3FJSA 4GIQA 4XF9A 2XWJB 2Q8DA 3NSTA 1H9PA 4GWIA 1ZX5A 4M3CF 4YGCA 1YYNA 1H8TA 2HEWF 2YGLA 1BYHA 3ZDVA 4DXTA 5LZ6A 1SACA 4GWNA 1UW8A 5E88A 1SPPA 4D3WA 2R072 3MUZ1 3V65A 1HRV3 4D6SA 2FDHA 5DMYA 3HN1A 3H42B 2R32A 5T5LA 1V9U2 1ST8A 1J3RA 4HANA 1OHFA 2VAUA 3U07A 1CESA 3MEPA 5TSWA 1ZZ8A 4WVMA 4AOCA 3B9CA 4QXHA 3WF3A 2XWBB 4AHWA 4IGQA 2O8OA 2VCAA 4WZFA 2ZGTA 3NJZA 3G7DA 3KCYA 1I5PA 2NM1A 1SMVA 3I3MA 1CIYA 1YJKA 3N9PA 2Y64A 1RUF3 2EIDA 3WINE 3OPZA 2AYHA 3M1HA 4SBVA 4NAMA 2VR4A 3GCWA 1RHI1 1LHNA 2HYXA 2W1QA 1W6NB 1GNHA 1LOFC 4IEPA 2Q4SA 1VBC2 1V9U1 4CVUA 3VKFC 3NNLA 1HQNA 4MSVA 4F3JA 1XU2A 3VD4A 1ZREA 1KGYA 2BBVA 1AR92 2XJPA 2R071 1POV1 2VXJA 2HWD2 2W1UA 2YHJA 3CMGA 2C26A 5FZHA 1GV9A 2IVIB 3VBFC 5FZOA 1ND3B 2PYTA 4H7MA 4MUVA 1ULPA 5FZEA 4Q8KA 2A3YA 1PZ7A 1JZ6A 1SDWA 3WVJA 5LRSA 3GZUC 3HOBA 2ADEA 2Y34A 2JDNA 3ACLA 4NOTA 4OMCA 5D2AA 1COV3 2PAMA 3N7MA 4QX3A 2WUHA 5BV6A 1R1A2 1VBA1 1FT9A 4LULA 4QM8A 1B35B 3LEIA 3VBSA 2QZ2A 3O0VA 5LRRA 1IQAA 1F5JA 4CCJA 4DUWA 5F6LB 2C4XA 4XF0A 1EAH2 5FY0A 3KM5A 4DRVA 3V64A 4BIFA 1WMDA 1KFUL 1AYM2 2JDZA 3OD4A 3CJXA 5FUIA 4A42A 2D93A 2KR2A 5KC5A 2QQLA 1W2UA 1EPZA 2RMU3 4UBGA 4XFGA 3CL1A 1VRH1 5DAXA 1A34A 4NHLA 1SG3A 2WT2A 5JSOA 5CFDA 2LW8A 4A7ZA 5D8AB 3MW4A 4C0HA 4K3UA 4FAGA 4UOJA 3CJIA 3D0SA 3UNPA 5JZGC 3AXDA 4PF5A 4QWNA 4QGNA 1OLMA 3EO6A 1CPNA 1XB9A 2AZ5A 2BERA 1C1LA 2VTXJ 3AKSA 3JU9A 5FP9A 1KJRA 1PM4A 3CU7A 5F1RA 4CEYA 3U14A 3MDPA 1JOBA 1LESA 1QEXA 2WSUA 4PBPA 1ZZCA 5DPNA 2VW1A 3TAYA 4QX8A 5JZGB 1J84A 3ACHA 5FYSA 2RM22 1XE0A 4AI9A 4COZA 1SLCA 4UW5A 4WM7C 3IN9A 2WZR2 4HFSA 5JR2A 2AUYA 1DIWA 5FZDA 1WBLA 5CBLA 1SLBA 2Q8CA 3SC7X 1QY4A 2XJTA 3I97A 4LTAA 1CR7A 2G19A 1PO11 3MFAA 4JKLA 2CYFA 2WNUC 2P3YA 4OI4A 5IFPA 5G05L 1HJFA 1AUYA 4UT5A 4YGEA 5EJ3A 2OQ7A 3N9QA 4FCAA 4LBQD 4LHKA 1EV12 3DYPA 2RMU1 5I0SA 1DCSA 1Q8VA 4IV3A 3HQUA 2QQNA 2W47A 4NJ4A 3E5XA 2ZA9A 4IEQA 1W99A 1W9YA 2PHWA 1ND3C 1PO21 5CU1A 3RNSA 5T5PA 2VY0A 1O4YA 2YU1A 3BVCA 3IKWA 4FPFA 4IV3C 4CDQC 2K2SA 1LJ7A 1X9TA 3KT7A 4IEXA 4YM2A 5C5UA 3OGRA 5FYVA 1W6MA 3LDBA 4CDUA 5BNQA 5KHKA 4BQ3A 1CONA 2GAUA 4CCCA 5DDJ2 3EHKA 4JGZA 3ZYRA 4MXVA 1W6QA 3H7JA 2NZ9A 1BMV2 4NIDA 3JBG3 1C8M2 4BPZA 4D7YA 2G9FA 2YPDA 4L8QA 3NV4A 5E16A 3GHMA 2WJSA 3B7MA 2O0OA 4YVSC 2B9UA 3NV2A 1V6OA 1HKDA 5F3CA 4AAPA 1RUG1 5BNNC 3MPPG 5IK8A 1JZ8A 3KLSA 2X5IA 1BJQA 2HJIA 3ZN6A 5C8CA 3S30A 4BXSV 4COWA 4CDWB 5F7UA 2YG0A 4MH0E 5APAA 1F35A 4ZPIA 3LOBA 2B4KA 3OYWB 1C8M1 4XJZA 3KQ4B 4NRQA 3PVBB 3UT0A 2R0FA 3SCFA 1JN2P 3DGTA 4EN9B 2ZS6B 2RS53 1QOTA 2D7FA 4FOWA 1UY2A 4YVWA 2Q1ZB 1R082 4W8JA 5FWEA 1RJ8A 2A70A 2P37A 1D2SA 3ZIWA 5DN2A 1YEWA 3POJA 3CNAA 4JHZA 2JIGA 3P6BA 4FPGA 4B29A 2Y6LA 2YU2A 4R4ZA 1UNBA 2FDFA 4LKDA 5C33A 3THPA 3K48A 3BPZA 4DINB 1REEA 1OD5A 2VOVA 4IEOA 4AGRA 4N53C 2CV6A 2PXJA 2R30A 2VBBA 1H2LA 4PQQA 2I45A 2WO7A 2XLAA 5ACA3 1MZ6A 3HBZA 3KV5A 4CU7A 4DY3A 1E5IA 5FUNA 1PMJX 2J1RA 1PVC3 1W6OB 2B7YA 4CCLA 4ZU7A 2VTFA 4HLTA 4Y5SA 1TMF1 4QXKA 4LK7A 4FSJA 5LWBA 2WIIB 5CKMA 4EN6B 1DQ6A 1O59A 5K8SA 1PK6B 1S0DA 4XQ4A 2GN7A 4A45A 5I0UA 1SBEA 1AXZA 2E6VA 3C7GA 5FMOS 5I91A 3GJBA 4UF0A 3GXUA 4MXWA 3T4VA 5C8CB 2E32A 2F4LA 2QTWB 2OT7A 1RUD2 3GBWA 5GZGA 3B69A 3HT2A 3GBFA 3OGJA 2OZJA 1QJU3 1WCKA 3H3ZA 3ENRA 3MGUA 4MX3A 2A6WA 3RZLA 3CHXA 4D7TA 3OBAA 3ZXGA 4AEKA 3I4IA 1GZTA 4NHXA 3VDDB 4QKFA 5DG1A 3AP7A 1S2EA 4PHZA 3U1XA 1IKPA 5C9AC 5J96B 1IQDC 3VZKA 5ANNA 1WLCA 4OI1A 5ACA1 1WLTA 4KG8A 1CQ9A 4L9BA 5FKCA 2Y6HA 2DVBA 1PIV2 2VNGA 4DMIA 4U2AA 4COVA 1O5UA 3MBWA 4MVTA 4LA3A 1VLNA 3WF2A 3D6EA 4ZHNA 1UKRA 2JDHA 2E26A 4XXAA 4BMBA 1AR73 3MIEA 3WNLA 2XL7A 2X05A 1UIKA 1W06A 4GWMA 3URFA 3VBHC 1H1AA 4P14A 2YUEA 1RUOA 3WQ7A 2QQOA 1ZRFA 1DF0A 4HPKB 5EHDA 3AYCA 1BQPA 2BFUL 2W46A 5GLVA 4QPGA 4S2DA 1HRI1 1LAJA 2VZTA 1H0BA 2VZPA 4GMP1 3ORJA 1W8OA 5FZ1A 4JTOA 5FRAA 2ZGSA 3HAGA 4LO4B 5ISLA 1W8TA 1XQNA 4CYDA 3IMMA 2QZ3A 3X29B 4P5HA 4TTGA 2D3SA 4A2UA 1RHI2 1W0NA 4BLIA 4CZSA 3SHRA 3VBHB 2VZSA 3NNFA 4XF1A 2IXIA 5DUUA 3ZN4A 1UYPA 2A5ZA 2VCBA 3ATGA 2H0BA 4QGLA 3ZR5A 1RINA 1CAVB 2NLRA 4FVVA 4MGQA 4PI2A 2W2IA 3ACIA 3RWNA 1LB2A 1OVPA 3VZNA 4CEYB 4AEDB 5SV8A 3LFIA 5CADA 2FDJA 4NUBA 3I2HA 3MI8A 4RYDA 2FQPA 3AYDA 3U4SA 1RUH1 4MXWB 1FOD3 1JOJA 1Z0HA 3S7IA 3KCCA 1VBA2 5ACA2 2VM9A 5E89A 3WXPA 2D6MA 1YLLA 2WAOA 4LLFA 4YG6A 1G6NA 3ITQA 4MLOA 3OCPA 1G9AA 2VECA 4MYEA 2JG8C 4CXWA 5FJKA 3BUCA 2BGOA 4XC9A 1XSQA 3OSDA 3BIWE 3NAPC 4JRLA 1V70A 4PLNA 3I2IA 2VZOA 5J09A 1AVBA 2ORZA 3KT4A 3AKQA 1W6PA 1UU6A 4M00A 1B35A 5JDBA 3DV8A 4RS5B 1QIQA 3J8F1 4HVQA 4GKXA 3C8XA 3KQRA 1UOJA 4FOQA 4IE0A 3UETA 1JYWA 4AQ2A 2EA7A 3HQRA 1VAMA 4B4RA 3S57A 5ERLA 2E9QA 3VB9A 2MEV1 5ABJA 3WHUA 1JYIA 4KI5M 3WNOA 3NMBA 4XUNA 3GYDA 3MIFA 1RUH3 4IE6A 5FPUA 2V73A 1PGW2 1C5IA 1QQP2 2CGOA 4HK8A 2EF6A 3OYWA 4M01A 1DLCA 1UZVA 2AR6A 1AYN1 1PGW1 1RUJ1 2CAVA 4GALA 4UAPA 5CKQA 5FYHA 3ZSKA 4EN0A 2QQUA 3JB8A 1XRUA 3WUCA 1H6YA 1KJLA 4QX0A 4XF4A 5BNPB 2G9ZA 3GDBA 2FZ1A 3R4UA 5JSRA 3SH5A 1LEMA 3C2UA 3HVDA 3NJVA 1PM7A 1DDLA 1UCXA 3CZJA 2OIIA 2GMPA 1LOEA 4Y4RA 1NY72 4QKNA 3WP3A 1PO13 1R081 5FLJA 3WG4A 1PVC2 4AEJA 2D6OX 2ATFA 5FY9A 3J8F3 4SLIA 1FPN1 2R0HA 3GNEA 4A6OA 1QJX2 2VOXA 4BISA 4E2GA 2BVVA 1G9FA 2E33A 2UY9A 4A7YA 1RUE1 3UGGA 5DUXA 4D0QA 2VNRA 4Q4Y2 1J3PA 4LT5A 2WNUA 1PO12 3S6PA 1LRHA 1OT5A 3ZYGA 1UYXA 4HPKA 4LBKA 4FT8A 3BYWA 5T50A 2LS6A 4M3CA 5T55A 3WNPA 3FBYA 3FLRA 3LA2A 4AVAA 4J25A 3TEZA 3W20A 1LR5A 2WNVA 1LHUA 2DUQA 1GBGA 2P3JA 2VZRA 4I3GA 1GZWA 2D43A 2W52A 5KXBA 4Z1VA 2P3KA 2RS13 2PMWB 2VOKA 4ES8A 1WMFA 3FUQA 5F2WA 2ZX3A 5IVEA 1HX6A 3KVAA 4GH4C 1H2KA 4CPBD 4XEZA 1YCIA 2A6XA 3V0AA 3K4AA 4LKSA 1WD4A 2EXJA 3AP5A 2VZUA 3DEMA 1JU4A 1H1IA 2Y6GA 1VBD1 4Y33A 5A33A 5FQ0A 1PO22 5CVRA 1UY4A 1W0PA 1W8NA 4DIQA 3CJIC 1W28A 1RIRA 1WA4A 3POFA 2WC2A 3WR0A 4RFRB 2YXSA 4CCOA 4W6XA 3ZFFC 2HH9A 4XUOA 3WNXA 2FMYA 3MLKA 2DU1A 1NA1B 3WY6A 1OSGA 4IUGA 5FYMA 5JOWA 3H7YA 2RR11 3F95A 1VIWB 3ACFA 3D82A 1Q3EA 4Q4W3 1L7RA 3JB4C 4QGMA 2UWCA 3ZM8A 3FHIB 2WZ8A 5KHHA 1O4TA 3E1F1 4MGTA 2GN3A 3VZJA 2PAKA 2XG3A 4ORFA 2PQQA 1FXZA 3ASIA 3O5SA 3OOXA 4QT6A 4YGDA 4P9IA 2ZGKA 4CA9A 4QX7A 3R6SA 3DPRB 1VALA 3USSA 2RM23 4GD4A 4A44A 4KGGA 1CZTA 1HLCA 1WW6A 1JUIA 2MHFA 3H50A 5A3NA 4ZS3A 4JAAA 4FO9A 1US3A 4W50A 3L2HA 1H8VA 2DCYA 1W8HA 3NL1A 4CU6A 3WDVA 3DXTA 5HCFA 2H6CA 2XJQA 3O1VA 1HV0A 5D1IA 2V4VA 2WQ8A 2X53S 3B02A 3ZFEA 1QXRA 1RUF1 1OQDA 1S0BA 5BNOC 4GJZA 4BDVB 5GZCA 2QQPA 2BU9A 4PBOA 3GZTB 3LQCA 4D7SA 4HKLA 1D0GA 1XC6A 3LCPA 4W4ZA 1J58A 3NKGA 4TSVA 4QX2A 3RZZA 1OUXA 1UQXA 4Q4W1 1N1TA 1S0GA 1WLDA 2AEYA 2EXIA 3SH3A 2KD7A 3MW2A 4LIUA 5F5IA 2PHUA 2EXHA 2R041 4CDUC 4AXOA 4K8FA 5GKAC 5FOBB 1ULOA 1XYNA 2PELA 4NRPA 5KR7A 1AL22 1VAVA 4AQ6A 3T0AA 1AR82 3MICA 2XVKA 5M0TA 1ODNA 3WNKA 4AGGA 2XLGA 1AL21 1X33A 2D6NA 2Z42A 3WNMA 5L9RA 4RL7A 4CTEA 4XJ9A 2D5FA 4JRAA 3BTXA 3AX4A 1S4CA 4HBNA 4K1YA 2Y6KA 2LUWA 1C1FA 2VMGA 4NWVA 4YM0A 4JGZB 1SLTA 4N9IA 4Q4W2 3VBOB 1QJX1 5DABA 1COV2 3KB5A 4NIHA 4ASLA 1WMEA 4XFHA 3K3NA 1TG7A 4H7LA 3I59B 5FZAA 5A7WB 1HN1A 1NY71 2NQYA 1K5JA 4KU7A 2AH2A 5FXVA 1RUF2 5A7NA 5EWSA 3VBUB 3WP5A 3WZ1A 4Q4X2 3A0NA 2VVEA 4Y1UA 2IXJA 2GNTA 4UFIA 1O8PA 1UXZA 1H30A 3TYJA 4OUMA 2R061 4I02A 3PJQA 4KNCA 4LPLA 3TN91 1IPKA 1DYKA 4FPHA 4OZOA 2GP3A 3KV4A 1LENA 1PHMA 3LB9A 5L7OA 2Y0IA 2R043 4LITA 4JV4A 4MZUA 3A0KA 2CHHA 4G9SB 5EIYB 1RHI3 1V6IA 1CAXB 4NHKA 3WG2A 2WDBA 3U0ZA 2WLQA 5IYYA 4QQOA 3C7OA 2XQRA 5C3OA 4ONUA 1UN1A 2WWJA 3N35A 3W9AA 4WM8A 1QJU1 3AMNA 4W6WA 1QJY1 1H1MA 3WSOA 5KHGA 3ABZA 4M4PA 1POV3 3MF9A 3MFCA 1OOPB 4FXKB 4L0PA 5JOXA 3KV9A 1CD3G 4QPGC 4K8RB 3HQXA 3POWA 2OUJA 2AENA 2K46A 1HRV2 1RUI2 4RQPB 4FFIA 4CUBA 1VBA3 2B8MA 5JOZA 2OUHA 5FP7A 1G9CA 3KVBA 1HB2A 1N1SA 1W9TA 4PF1A 3VHRA 1D2QA 3ZPYA 4LBLA 3R05A 1VR3A 2KXLA 2ZGOA 4W65A 5F5AA 1JZ2A 1MR5A 1FV2A 3WOGA 5FMDA 4ATFA 1XNTA 5FZLA 4B7KA 2HWB3 1GWKA 1UMIA 4FPOB 1QWRA 5GLWA 1YI9A 2XVGA 2GU9A 2ID4A 3ZFGA 1CJPA 2Z5WA 3L2YA 2WO1A 4ISRA 2J1TA 3T30A 3CF6E 2BFUS 1NXMA 3M3IA 5GLUA 1WLWA 3HNMA 4OI2A 1D4VB 5EXOA 2X09A 5EV7A 4LBJA 1QJY3 5BNOA 2A6ZA 3L9JT 3SH4A 4Q4X3 5FLIA 2Q5TA 1R091 3UESA 2NPIA 1S2BA 1TMF2 1UAIA 3BALA 2RG4A 3VKLA 1MEC3 3ZX7A 5CFDB 1PGL1 2Y38A 5L73A 1AYN3 1RUJ3 3QH7A 4AG4A 1PNFA 2ZHKA 3BGAA 4OUEA 5JUVA 2Z4FA 4B1LA 4QDQA 5IUQA 5FR3A 4QAWA 2VTXA 2VC9A 1ZBA3 1UF2C 2CU5A 2JG9A 5FPBA 4DS0A 3ZR6A 2DVFA 1OPOA 4R52A 3WX5A 1JYVA 1XSRA 2VBDA 4TLGA 3UK9A 2H0VA 3IDAA 2B46X 2ZEXA 5T5OA 2AACA 1QNWA 1XNCA 4JGYA 2VO5A 5IHRA 3C3VA 2A3XA 3AYEA 4EZ4A 2RS52 4WV8A 1JI6A 5FO9B 3PLQA 1AYM1 2OPWA 1RUE3 3JZVA 1E5RA 1HRV1 5A1AA 4N53A 2WNOA 1VMJA 4X8NA 4XHBA 5EPAA 4D69A 1X8EA 1NKGA 4XJUA 1AF9A 1Y3TA 2WABA 4UYBA 4BHPA 1AXYA 4OVEA 3TEYA 1HQWA 2G4IA 3R0RA 3NNMA 1YFXA 1WD3A 4WM8C 3AKRA 4XUQA 4EN8B 2XR4A 3VBRC 4K6BA 5A32B 5BYNA 5DZFA 2JB8A 5C7GA 3OBRA 4HSJA 3FFZA 2Z69A 3K3OA 5J98B 3MF6A 3B3QE 4FFFA 1J1TA 1TNRA 2R6QA 4JKMA 3RZHA 2D6LX 2SLIA 2P34A 5DAVA 4DUXA 2DCJA 1RVF1 4XHXA 3PJYA 1WCUA 1VBC1 4Y1YA 4XDPA 4S2FA 5GJ6A 4UI9L 2X5IC 3E97A 4IE5A 4OHVA 2XKPA 4AZZA 5EJ1B 1C3HA 3WW4A 2WSVA 1W8UA 1K5MA 3O12A 1MQTB 1W6NA 3A21A 2YGMA 4NIIA 4CP1A 5A6XA 3J4UH 4IV1B 2EIEA 1C8M3 1GNYA 1UY0A 3D3AA 4PT6A 4IE7A 3O1OA 1HB4A 3N9LA 1RXFA 5A3LA 2IWGB 1COV1 2VUDA 5L19A 2XL9A 2XBO3 4JDNA 1GWMA 5IVVA 4JGYB 1VB2A 4Y20B 2FZ2A 3MV11 2WO3A 3FWEA 2ORXA 3ZYFA 1O3QA 4Q0VA 3IAQA 4P00B 1BK0A 3NV1A 2R49A 3BTZA 3OGGA 1J3QA 4DPNA 1FPN3 2VUJA 1QHDA 2XLFA 5GZFA 5FBZA 3PURA 5FZCA 1AHSA 1IOAA 2BWAA 2PHFA 3WNNA 4JX0A 2C0ZA 4URTA 3RS6A 2QNKA 4AHYA 5GM0A 4BXFA 5A70A 1KDKA 2RM21 3KHBA 5A80A 3KT1A 3WDXA 1UXXX 1XNKA 4IXLA 4QM9A 4UBHA 1MEC2 1NCRC 5SV5A 1QU0A 1Y7BA 2P4EA 4G4FA 4H14A 3MV01 4Y22A 4AFDA 3AMHA 4MO3M 5AC93 2RVAA 1JYTA 1NQDA 4QQ2A 4NVPA 3NW4A 2OW4A 4ATEA 3P1IA 5A3UA 3T4HB 1HRI2 1NCRA 4TWTA 5HCBA 5FLHA 1QXPA 2VBPA 1GANA 1E57A 1MS9A 1V6NA 2DUPA 3RYKA 5C70A 2ADDA 2DFCA 4WBBA 4LIVA 1G9DA 3VGIA 1FMD3 4AVBA 3MYXA 5A7OA 2F6BA 4QHZA 2GC0A 1NLRA 4NO4A 4YARA 1R093 4FTEA 4TXWA 2F17A 4J6GA 3RVHA 5FPXA 1BMV1 3ZPOA 3PL0A 4IDZA 4K7JA 3ETPA 4HT1T 2JDYA 4RGKA 5AVAA 2XB6C 3NNJA 4FXGB 2JE8A 5CFCC 5I8TA 3DYMA 2JIJA 1NA1A 4RR3A 2A71A
chains in the Genus database with same CATH topology
1WBFA 4RR3B 2HYKA 3POYA 3R4SA 1QH6A 4IEUA 5JPMB 3W59A 1SCRA 5IK4A 1BEV1 1I9RA 3SISA 3VKMA 1LOGA 1ZRDA 3NKTA 2WLPA 4BIOA 1X82A 3CEWA 1RUD1 2BTVC 1OI6A 2DUOA 3ETQA 3BB6A 1B09A 1NCQB 2VG9A 3H3UA 2JG9C 3I7DA 4LO8A 1OA4A 1VB4A 2MEV3 1UPIA 1RUG3 2JECA 4PJYA 4RFT0 3N36A 2OZ6A 4MGIE 1XYOA 2VVFA 2NYYA 3TN93 2ZBJA 3UL2A 4IL7A 2R1BA 5IT6A 3IDCB 2G9GA 3M3CA 2ZX2A 3AB0A 1ONAA 1PMIA 3PNAA 3D5OA 2BGCA 2N7GA 3AXEA 4XYXA 3RRDA 1S1AA 3M3QA 1DBNA 2DURA 5L7OC 3HWJA 1BK1A 3U11A 2K0GA 3SXWA 1BEV3 2IXHA 4GA9A 2DCZA 4PDWA 2E7AA 1X36A 5I0RA 1N1YA 1SLAA 1XU1A 3JQWA 3VBSB 5FAXA 3CO2A 2D98A 5FFOC 5K0UA 1VBB3 4UW6A 2KA3A 2ILMA 1H8TC 2WA4A 3USUA 2ZMNA 3LA7A 1PVC1 1F2NA 1FOD2 4Y1ZA 1MS3A 4GB32 4ASMB 1RUNA 5C4WC 2UYAA 5A32A 1RITA 4AVCA 2QDNA 4GULA 4YFZA 1QJX3 3O0XA 1IZ3A 5KXDA 3NVCA 4V1PA 1DYPA 5GZDA 2UY8A 3IWZA 2VXRA 1LECA 1CJDA 1QQP1 4XTMA 3EJKA 5EYYA 1MQTC 2NN8A 4OUSA 2PHDA 4R9DA 3B00A 5J7MA 1HV1A 1FNZA 3WW1A 2X5IB 2JE7A 3THTA 4ZU5A 3ZYJB 1VBD3 4INDA 2WL1A 4COYA 4XTPA 1GNZA 1OMIA 1CAVA 4QX5A 3VL8A 4Z2WA 4LO7A 4HK9A 3VV1A 1LGCA 2WT1A 1GZ9A 4AEMA 2YC0A 3J8F2 3ELNA 2ZJCA 3ZDSA 1N3QA 5GLTA 2BYVE 3RMXA 5C4WB 2YY1A 1G9BA 1GSLA 4N7UA 1IS4A 3ZYIB 3R4DB 2W68A 3ZXEA 3DN7A 5HBAA 3VBOA 4QPIC 3DKWA 4YZ3A 3FC0A 1BEV2 2EAAA 3WP4A 2ZHMA 1VRH3 1AR72 2PLV2 4MGKE 3KSCA 1KS5A 2BEOA 5LK5A 1GICA 4HKOA 1HRI3 5DUVA 5CB7A 3JD73 4GMP3 4H55A 1RUH2 1FX5A 2JENA 1Y9QA 2RR12 3FLPA 2HWF1 1W39A 1PIV1 2ZX0A 1C8NA 2D97A 2NMNA 2ENRA 4I0BA 4Z07A 2EVXA 1U12A 3ILFA 2A7AA 4E4ZA 1GQGA 2TUNA 3I54A 3B93A 4P9YA 1LHVA 4CEWC 4YVSA 1FATA 2BNMA 3EBRA 2H6BA 3J9SA 3RDIA 4BOWA 1YNAA 1ZYBA 2UYBA 1V00A 5FOJB 4FTBA 3ZFEC 3WCSA 2B42B 1X8MA 2C1FA 1DQ1A 4LBNA 3ZN5A 3AYAA 1XNBA 1DQ4A 3UKTA 3WQ1A 5IK7A 1R1A1 3VBHA 5JIAA 1Q56A 2HWB2 4QHBA 4G3YC 2EALA 4N90A 3V0BB 2GALA 2HWF2 4EWDA 4YW1A 1ND3A 1UIJA 3B01A 4AEDA 1CPMA 4PLMA 1ZZ9A 3JD71 5HXVA 2SBAA 1EPWA 4YNIA 4HKWA 2HWD1 1XXNA 3AKTA 4A7KA 4COUA 4N43B 2PA7A 5GLZA 4S2HA 4YZ4A 2W08A 5CFCB 4YYOA 1AJKA 4PCRA 3WW2A 3ZXKA 1FPN2 1KDMA 3QCWA 4AI0A 1RL3A 4AK3A 1OOPC 3TB0A 4AFAA 2R063 2YPJA 3ZIXA 5T54A 1ULDA 2ZHNA 4IETA 4PQ9A 4Y22B 3RQ0A 5A3MA 5JAXA 1TEIA 4L2NA 1NQJA 3NWKA 2YMZA 3LSEA 5C6CA 3DL3A 2CAUA 3QACA 4X8PA 5JPNB 1MS0A 1S0EA 4WVVA 3ZVXA 4E9KA 1RUC2 4XE9A 5DUWA 4M3CE 1C5HA 1R083 3HD8B 2WWSA 4B4QA 4OLLA 4PDWB 1F9KA 3B9IA 3VBUC 2BWCA 4E4SA 1KS4A 5LEJA 1QMJA 1IHMA 4GQ7A 3NO8A 1GLHA 1LHWA 3AK0A 4PIYA 4I01A 3D8CA 4HL0A 4KL1A 3RMYA 4DRRA 2Z2SB 1YRZA 2D5HA 1AR83 3ZSLA 1YJLA 2TNFA 3JBG2 2XBO2 5ABJC 2P17A 4IV1C 4JC1A 3AZZA 4XMIA 1QGLA 2FBEA 4FPCA 1W6OA 4AFBA 1W6QB 2B45X 4Q0PA 1PGL2 2LM3A 1LTEA 2WS91 5BNNA 1NG0A 2GNBA 4QQLA 1SEFA 4XFFA 2QVSB 4YM1A 1PNGA 1OQEA 5IK5A 2XGXA 1RGSA 4AW7A 3BOWA 3D4KA 3PTYA 5DDJ1 3VBRB 5JLVA 4FPLA 4BZ4A 2YZ4A 4F83A 3G6JB 1UKGA 4XQDA 2JKBA 4LO5B 3WDYA 4EWAA 5K0UB 1YIPA 2UWBA 2ZTNA 1BXHA 1ULFA 1AX1A 2D6PA 3EXUA 1AYM3 4IQPA 4P9GA 1DG6A 2ET7A 4OULA 1WGPA 4E27A 4XJ8A 4MGZE 3VHPA 4AHZA 1XE8A 5K0UC 2IFRA 4XOGA 2ZHLA 4Q29A 4KG0A 2NMOA 3IMNA 1CAUA 2HWB1 2FMDA 3S0MA 1YWKA 1UL9A 1QJY2 2IXLA 2WZR1 3ZFFB 3PHMA 1F5FA 1SCSA 1ASJ3 4UW4A 5C9AA 1OA2A 1REDA 2HWC3 4CP2A 2GNDA 1Z7S1 1PK6A 1VBC3 3CLPA 4NN0A 5I8SA 4AFCA 2BNOA 3WUDA 4NWWA 4D94A 4XBLA 4Z92B 4GKYA 4P9WA 4GH4B 2VQAA 4OZXA 1MEC1 4Q4V2 1S0IA 5KHIA 3HT1A 1NE6A 2ZZJA 2DTWA 4TYSA 5JI9A 3E6BA 4KQ7A 1WW4A 4WVWA 4ITCA 3U4XA 5ABJB 1AL23 3UKNA 4XILA 1IGOA 2HWE1 2VVDA 3FE5A 4BA6A 5J36A 1HIXA 2RHPA 1TNFA 3H1WA 2RJLA 1VBE1 4BM8A 5J3UA 2I07B 2UURA 1IPJA 3UJQA 5JWPA 4RQPC 4AI1A 1LOCA 1UU4A 3E5UA 2HKXA 1H8TB 1VBB1 2ET1A 1LULA 5CIRA 5BY5A 2LALA 5FPZA 1IKQA 3ZSEA 1CAWB 1AR91 1WW7A 1VBE2 2XJSA 1WW5A 2PTMA 2IZWA 1AR61 4LBMA 4PDWC 3AZWA 3RG0A 4R4XA 4AFMA 4R8HA 4HN1A 1FYUA 3VZLA 5F5QA 3VKNA 2QKDA 5L7OB 1NYWA 1X50A 4FBFA 2ZABA 1LGNA 1MACA 1NLSA 3B94A 3AMQA 3ZO0B 2VPVA 1FMD1 1QOSA 3O14A 3LA3A 1G7YA 1AXKA 3M3OA 1JW6A 4EV0A 1V6LA 1RUG2 2NP0A 4DOUA 2PHRA 4FP2A 4RGGA 1ENRA 1MZEA 2IXCA 2JG9B 2Q0AA 4JGZC 4B8EA 1CN1A 3ILNA 1FI2A 2XUMA 1UZYA 4PIZA 4UW3A 4YW2A 1BVP1 4ISQA 1AR93 4X6QB 4N43C 4BWOA 1MS8A 1REFA 4Q4Y3 3NAPB 2ZMKA 1CVNA 2HWD3 2HWE2 4HN0A 5AFBA 1ULCA 2ZGRA 1BBT2 4I30A 2R073 4DNYA 2AREA 5HI0A 3H1MA 4RR3C 4Y26A 3KMHA 1ENQA 2JICA 1LKNA 1ZRCA 2D3PA 2RS12 3LZZA 1VJ2A 2JJ6A 2ZKNA 1RMU1 4PIXA 4OI0A 4Q27A 3ZFEB 1L3JA 4E2QA 1Q43A 1A8MA 2YROA 5AC91 2GC2A 4GXLA 4H3WA 1D4M2 4LO6B 1N47A 1NXD1 5DG2A 2WA3A 1Z7S2 1W6MB 2QFEA 1YFYA 2PHXA 4CEWB 1ZZ6A 1XYPA 3M70A 4O9GA 1R092 1YHFA 3LKJA 5JMCA 4AI3A 2JD4A 4IV1A 2CWSA 2RJKA 4HVOA 5AC92 4HETA 2D40A 3AP4A 5LK7B 1NCRB 1QF3A 3VKOA 4XIOA 5CG9A 5FREA 5EYXA 4YZ5A 2O1QA 3VUOA 3HR9A 3FMGA 1R1A3 2FHRA 2ZGMA 3ZSJA 2WNEA 3RSJA 1LEDA 4CDQA 1OFSA 1RB8G 2ERFA 1LODA 1TE1B 2VULA 2F4PA 1DQ0A 4Z82A 1EAH3 3GALA 4QPIB 1RMU3 3WD5A 4QQHA 4XJAA 4HMZA 5E1RA 4JGYC 1ZVFA 5C9AB 4FP3A 4R9AA 3OTFA 4M3CB 2XJUA 3T2TA 1CIWA 1KITA 3SCHA 3CJIB 4FAHA 2GMEA 3VBFA 4YG3A 1CAUB 1QJU2 3ZXFA 4P9XA 3RI8A 1PO23 1IS6A 1KQRA 2WS93 4FQ4A 5K9YA 2ZGPA 4FPJA 4GH4A 3APBA 5EZWA 4FOVA 4BMEA 4M0NA 3V0BA 4OHXA 3O7OA 3WCRA 4BLJA 2XBO1 3JBG1 5KHJA 2R062 1EAH1 3Q9OA 2QCSB 4L99A 4OFGA 4XBQA 4JQRA 4K20A 1AR62 3ZXLA 2XJVA 2C5DA 4Y4YA 3OY8A 2XKOA 1UX6A 2WQZC 3DPRA 2VW2A 1BCXA 3AZVA 5H9PA 3MIHA 3VBSC 1ZA4A 2A6YA 4DFSA 2ZZQA 1CAWA 3ZFFA 1RTVA 1ULEA 1MZFA 4F7ZA 1PIV3 2R16A 1JH5A 1RUC1 3H0OA 2CY6A 1AR81 1U5XA 4KWLA 2QJVA 4B4PA 3QLQA 5JSPA 4TLFA 1DZQA 1N3OA 3KS7A 4P9JA 3TWIA 1HXS3 1GZWB 2R042 5BUVA 1QQP3 3WDTA 5K7PA 3ZSMA 5JZGA 5KWRA 3EQEA 1AX0A 1YI7A 4CDWC 1M06G 4R9BA 2CNAA 5CFDC 4R9CA 1SFYA 3KGLA 1RVF2 1LCLA 2ES3A 4U36A 4K40A 1YUDA 3B5LB 3N4MA 4CRQA 1NCQC 1F31A 1C4RA 2PHTA 3N7LA 4KBBA 1NOVA 4L92A 3WDUA 1MQTA 2A3WA 2DVGA 3VHOA 5CA6A 1SQ4A 1UMZA 1V6MA 1D0HA 4J1WA 1ZBA2 5DZEA 1MS4A 3M7AA 1ZZBA 2A73B 3RYPA 2DWRA 3P3PA 3LWCA 1ASJ2 2ARXA 4BCUA 4LA2A 2CL2A 4DQAA 2GH2A 2QDRA 1TME2 1JYCA 2ARBA 2P2KA 1APNA 3H1YA 3RJRA 2MNGA 2ZACA 4JCKA 3M2MA 2Q8OA 3MPBA 3IDBB 2V5YA 4HZFA 1QXJA 3DUIA 4AQTA 4AVVA 5D8AA 5EFUA 4BH9A 1HW5A 4Q1PA 1SBDA 3PMSA 2C9AA 3FBMA 3OJBA 4DXZA 4EN7B 4YW3A 1DZTA 2RS31 3AM2A 3HMYA 2VUAA 1OKQA 4A3XA 2TBVA 1FV3A 3VBHB 3LOIA 4I0AA 2PLV1 3AP6A 4Y20A 1I5ZA 1Q8OA 4YW4A 1H4GA 1D4M1 2I74A 1YXWA 2TEPA 4KWKA 2OA2A 1CX4A 2DCTA 3IM0A 1RUE2 3IT8A 3UKVA 3ES4A 2XJRA 4FOYA 3VBOC 2ZCWA 2WFF2 4AQSA 5JVVA 2DCKA 4LUMA 4GB31 1DFQA 1EY2A 1W6PB 1MS5A 1EV13 2ZGQA 3QBQA 5DZGA 1QH7A 4AF9A 1NCQA 1RUI3 3N7KA 2QE3A 4E4DX 2E63A 3IDEA 1WCSA 3VBUA 1I6XA 2GC1A 4KH9A 3TOJA 4CDUB 1MZ5A 4FQZA 1N1VA 5FO8B 5CFCA 1UD1A 2ZGNA 1RUC3 2RS33 4LUKA 1V6JA 1EYBA 3BU7A 1C57A 3IIAA 1H4HA 4I2OA 2WFPA 4YZ1A 3WLUA 1AZDA 4LBOA 4LE4A 3H8UA 3MLJA 3AFGA 2MEV2 2Z79A 4WM8B 5C4WA 4I0WB 1KRIA 1HQLA 3SLIA 2PAEA 1WCDJ 4GB33 4W6YA 1UZZA 5E8AA 1GFF2 3E5QA 3T1MA 3WDWA 3PMEA 3DPRC 4L11A 4DB5A 4AVSA 1VAKA 4XBNA 3ROUA 2O8QA 1QNYA 3RPQA 3N7JA 1ZRRA 3WG3A 2I2SA 3V56A 1ZBE1 3LGRA 4J1XA 3AKPA 4YSFA 4IEWA 5AFEA 4WVZA 4YVWC 4Q26A 2D3RA 2XHKA 1DQ2A 4EWEA 5KXEA 2DTYA 1NE4A 2JEMA 4WVMB 3VHNA 4ZXKA 2A6VA 4XQWA 2E7TA 3P3NA 1KD7A 4YVSB 3MIGA 3VZOA 4IESA 1BKZA 3ECQA 2K9ZA 1KFXL 2WKKA 3GHNA 4CEWA 3RJ2X 1K5MC 3NV3A 5JIUA 3AFKA 1QDOA 4YG0A 5DDJ3 4CDXB 2RS11 4Y24A 5FTTC 5I8YA 4XMAA 4IV3B 3TNQA 1NZCA 4XW3A 2YDEA 3JD72 3TRSB 1S55A 4AI2A 1JXNA 4RD7A 2D6KA 3AJYA 2W0XA 1D4M3 1SBFA 4XFIA 3ZXJA 5FO7B 3KD4A 1YIFA 2WNUB 4LBQB 4BQ1A 1DZRA 5L36A 1G86A 4RHV3 4YZ2A 1O3SA 4QPGB 3TNPB 1LU2A 4LLOA 3AZXA 3HIFA 2X29A 3WT3A 3IBMA 4AI8A 3KZ4C 4LHNA 1ZZ7A 4IEVA 1SFNA 1RJ7A 2GMMA 1BZWA 3W58A 1GKBA 4YM3A 3LSDA 5FMOL 1A3KA 1DGWA 2HWC1 4Q4V3 2DYCA 2V09A 5F6KA 4LHLA 2VGDA 5AVPA 4FPEA 2B39A 3I8TA 3VBRA 4I3PA 5T3NA 2DF7A 1R1ZA 3BODA 1JHNA 1GR3A 3BCWA 4FTSA 2ZGUA 1OOPA 4BYYA 1H2NA 3DF0A 1VBB2 5KC6A 4Q0SA 4RHV1 4RS5C 1BBT3 3WHTA 4K1ZA 2ZMLA 2VQ0A 4N7IA 4Q4Y1 1VBE3 3ZFGC 3BTAA 3SITA 1ZBE2 4Y5Z0 1MS1A 2E51A 4NHMA 1FOD1 3NAPA 3N3HA 4C90A 1N3PA 3AMMA 1ZM1A 3KCXA 5GZEA 4IEYA 1PGSA 3T1LA 3RYRA 3PVNA 4XIKA 4QU2A 4FPKA 3WQ0A 1OLQA 2WNVB 1U5IA 4RQPA 2XH6A 3E6CC 1ZBE3 4KU8A 2CGNA 4YW5A 2D44A 1IS3A 2GNMA 4RHV2 1YFUA 2ZOEB 1DHKB 1I3HA 2A75A 3GZAA 1AYN2 1RUJ2 1YO8A 4XF3A 3M3EA 5CAZA 4CEYC 2UWAA 1Z78A 1DLLA 2PN5A 3IPVA 1HXS1 4Q1RA 4KWJA 5I93A 4N9HA 1G8WA 1T6GC 5BNOB 1F8VA 3WP6A 3ST7A 1MVEA 4TZDA 4C1WA 1XNDA 2GC3A 2E7QA 1ALYA 4FPYA 2IXKA 4OHZA 3FLTA 2XVLA 1OA3A 5A33B 4P9LA 5FDBA 2JE9A 1GQHA 2B5HA 3WV6A 2JXAA 3POSA 3USUB 2LTNA 5FCCA 4CP0A 2DVAA 4XJWA 2RS51 2IFWA 2BUKA 2RMU2 3ES1A 4QPYA 4KGQA 2BPA2 1ND2B 3QH6A 1H2MA 4LR4A 5C8WA 3OF1A 1ND2A 4YLZA 2HWF3 2GSYA 4HVRA 1TME1 3MIDA 1IS5A 1EV11 1JUHA 3ME2A 4YFWA 4ZU4A 4LEJA 1ASJ1 1NA1C 2JX9A 4K9SA 2AGSA 1RUI1 1ENSA 4GMP0 4RS5A 5LEKA 2VMHA 2CWMA 2ZAAA 4PLOA 1QKQA 2RS32 1A6CA 1Y43B 1O3RA 4Q2FA 3O0WA 4OHWA 1QOOA 3OD0A 4AYUA 1S0FA 2VNOA 1QJZA 1C28A 2GH8A 2YV8A 2IC1A 2OYZA 2GDFA 5C8CC 3MZHA 2HWC2 3WW3A 4Q4V1 2VMIA 2W39A 2Y26A 1OFNA 1DGLA 4IEZA 3OBTA 3VZMA 5GALA 4AE2A 5CNAA 1MVQA 1KXGA 2WFF3 1W0OA 2Y0OA 2ZKLA 2WZPP 1TME3 3SCGA 2OVUA 2ZX1A 3VDDA 1VRH2 1A78A 4ES9A 1POV0 4RA0A 4I09A 5JCTA 2EXKA 1QDCA 5KBFA 3ZYPA 4XPVA 2EAKA 4ZKTB 4AWDA 4N53B 4MGYE 4LBQA 3ZMNA 2CGPA 1CGPA 1AR63 3I59A 5J48A 1O5LA 5CG8A 2R1DA 1AL0G 2YYOA 3UJOA 3RI9A 1AR71 1O91A 2HEYF 1JTZX 2GZWA 1AX2A 4X6RB 5BNPC 1OLRA 1Q8QA 1FMD2 2UU8A 5JR7B 1A8DA 5T5JA 1U5ZA 3AZYA 3ZXDA 1RC6A 2KM2A 4Y1XA 2CTVA 5KXCA 3D0JA 4WM7A 1LOBA 3ZXAC 1X7NA 2RE9A 2BVBA 1DGRN 4C91A 3PVOA 4XDQA 5BNNB 3V0AB 4CDWA 4C0BA 2BQPA 3M4FA 1I1EA 2BNNA 5H9SA 4EROA 1DGRA 1J1LA 3AJZA 3MIBA 2WS92 2MPFA 3QOPA 4WZCA 1RVF3 1GZCA 3QD6A 1OPMA 1S2KA 2ZPXA 3ALQA 4XFBA 2DFBA 2DU0A 1LU1A 4CDQB 2WNVC 3JQXA 4MV2A 4XXPA 3ZMOA 1WUVA 1YFWA 5I0TA 1LGBA 2JG8B 1HDKA 1O7FA 3S7EA 4O9EA 4E2SA 5BPXA 4Y1VA 4N43A 1DU3D 5F9TA 1GYKA 4UXAA 2E53A 3ZFGB 1PZ9A 3JUUA 4QQPA 2WT0A 5HCAA 1TMF3 3UV9A 4OHYA 1UU5A 1J59A 2VW0A 3I2DA 2VU9A 4AEDC 1XE7A 3IPVB 3TBDA 4NR1A 5FQ0B 5BXXA 1ZNPA 4WM7B 3WG1A 3FUOA 4Q0UA 1O4ZA 4QD2A 3INAA 1CAXA 4META 2QUOA 3ZN6B 2X8KA 2HEVF 2VH9A 4BE3A 5H9QA 2WINB 4XFAA 5T52A 2ZX4A 1V9U3 1LHOA 1S0JA 2ETEA 2WQ4A 1PZ8A 1O3TA 5DXDA 3FFQA 3GF6A 4AVTA 3LAGA 5J37A 3FZ3A 4B7EA 5D8AC 3SMHA 1FNYA 3VLBB 5BNPA 4XETA 4YGBA 5B2GB 1URXA 1SLIA 3MW3A 3GBGA 3A4UA 4JDMA 1U5YA 3ILRA 4Q0QA 2WFF1 1BVVA 1RMU2 3VL9A 1V6KA 4K21A 1TQ5A 4M0HA 4RSUA 2WZR3 3U10A 1B35C 1U0AA 1OQ1A 4XFCA 4B3NA 4JDOA 1Z7S3 4Z8BA 1PVXA 3J26N 2ZAHA 2BW8A 4S2GA 3VDDC 2PFWA 1VP6A 2Q30A 1DGWX 2JG8A 3VBFB 1Q8PA 1VBD2 4XZPA 4AHXA 1EP0A 1LOFA</