2RS14

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rs1400
1RHI4 4RHV4 1VBB4 1D4M4 2HWC4 1RUJ4 1RUE4 2R074 3JD74 1PO14 2RR14 4Q4Y4 1H8TD 1RUF4 2PLV4 4GB34 1HRV4 1RUC4 4PDWD 1RUG4 1VBC4 2X5ID 1NCQD 1VBA4 1RVF4 2HWB4 1PO24 1VBE4 4Q4X4 3JBG4 1AR84 1R084 1K5MD 1OOPD 1Z7S4 4Q4W4 1RUD4 2R064 1RUH4 2RMU4 2RS34 1POV0 1AR74 1RMU4 1AR64 2RS54 1NA1D 1HXS4 1PVC4 1COV4 1ASJ4 1EAH4 2RS14 2R044 4Q4V4 2RM24 1VRH4 1EV14 1VBD4 1PIV4 1RUI4 1AL24 1MQTD 1HRI4 1R094 1AR94 1BEV4 3J8F4
chains in the Genus database with same CATH superfamily
2WU5A 3AEFA 2H89A 2HWC4 1RUJ4 1RUE4 3AE9A 1PO14 5C3JA 4GB34 4PDWD 3AE4A 4YTNA 4Q4X4 1NENA 2PY5A 2WDVA 1OOPD 3VR8A 1RUD4 1XI1A 1RUH4 3AE8A 1KFYA 1HXS4 3FI7A 2B76A 3AE1A 2R044 2WU2A 2FBWA 3AEBA 4KX6A 1RUF4 1RHI4 1KF6A 2R074 1D4M4 1NEKA 1XHXA 1H8TD 1RUC4 1RUG4 1VBA4 3AE6A 1RVF4 2HWB4 3JBG4 1Z7S4 3ABVA 1YQ4A 3P4PA 1RMU4 1PVC4 3VRBA 2WQYA 1VRH4 1EV14 4YSYA 4YSXA 1RUI4 3SUCA 1VBD4 2EX3A 1MQTD 3AEGA 3P4RA 1AR94 3J8F4 1L0VA 4YTPA 1VBB4 3VR9A 3GQHA 3AE5A 1HRV4 2PYJA 2WDRA 2X5ID 1VBE4 4YT0A 1AR84 1R084 2R7FA 3CIRA 3AEAA 2WP9A 2RMU4 2ACZA 3VRAA 1AR74 1XHZA 2WS3A 1COV4 1ASJ4 1EAH4 4YXDA 1ZP0A 3GQKA 2PZSA 2RS14 4Q4V4 1PIV4 1HRI4 2RS34 1R094 3AECA 4YTMA 4YSZA 4RHV4 2H88A 2PYLA 3AEEA 4Q4Y4 2PW9A 3JD74 2RR14 2WDQA 2PLV4 3AE2A 1NCQD 3AE7A 1PO24 3SFEA 1ZOYA 4Q4W4 1K5MD 3AEDA 2R064 3AE3A 1YQ3A 3P4QA 1POV0 1AR64 2RS54 1NA1D 3SFDA 5C2TA 1AL24 1VBC4 2RM24 3P4SA 1BEV4
chains in the Genus database with same CATH topology
1RHI4 4RHV4 1VBB4 1D4M4 2HWC4 1RUJ4 1RUE4 2R074 3JD74 1PO14 2RR14 4Q4Y4 1H8TD 1RUF4 2PLV4 4GB34 1HRV4 1RUC4 4PDWD 1RUG4 1VBC4 2X5ID 1NCQD 1VBA4 1RVF4 2HWB4 1PO24 1VBE4 4Q4X4 3JBG4 1AR84 1R084 1K5MD 1OOPD 1Z7S4 4Q4W4 1RUD4 2R064 1RUH4 2RMU4 2RS34 1POV0 1AR74 1RMU4 1AR64 2RS54 1NA1D 1HXS4 1PVC4 1COV4 1ASJ4 1EAH4 2RS14 2R044 4Q4V4 2RM24 1VRH4 1EV14 1VBD4 1PIV4 1RUI4 1AL24 1MQTD 1HRI4 1R094 1AR94 1BEV4 3J8F4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHI 4;  4RHV 4;  1VBB 4;  1D4M 4;  2HWC 4;  1RUJ 4;  1RUE 4;  2R07 4;  3JD7 4;  1PO1 4;  2RR1 4;  4Q4Y 4;  1H8T D;  1RUF 4;  2PLV 4;  4GB3 4;  1HRV 4;  1RUC 4;  4PDW D;  1RUG 4;  1VBC 4;  2X5I D;  1NCQ D;  1VBA 4;  1RVF 4;  2HWB 4;  1PO2 4;  1VBE 4;  4Q4X 4;  3JBG 4;  1AR8 4;  1R08 4;  1K5M D;  1OOP D;  1Z7S 4;  4Q4W 4;  1RUD 4;  2R06 4;  1RUH 4;  2RMU 4;  2RS3 4;  1POV 0;  1AR7 4;  1RMU 4;  1AR6 4;  2RS5 4;  1NA1 D;  1HXS 4;  1PVC 4;  1COV 4;  1ASJ 4;  1EAH 4;  2RS1 4;  2R04 4;  4Q4V 4;  2RM2 4;  1VRH 4;  1EV1 4;  1VBD 4;  1PIV 4;  1RUI 4;  1AL2 4;  1MQT D;  1HRI 4;  1R09 4;  1AR9 4;  1BEV 4;  3J8F 4; 
#chains in the Genus database with same CATH topology
 2WU5 A;  3AEF A;  2H89 A;  2HWC 4;  1RUJ 4;  1RUE 4;  3AE9 A;  1PO1 4;  5C3J A;  4GB3 4;  4PDW D;  3AE4 A;  4YTN A;  4Q4X 4;  1NEN A;  2PY5 A;  2WDV A;  1OOP D;  3VR8 A;  1RUD 4;  1XI1 A;  1RUH 4;  3AE8 A;  1KFY A;  1HXS 4;  3FI7 A;  2B76 A;  3AE1 A;  2R04 4;  2WU2 A;  2FBW A;  3AEB A;  4KX6 A;  1RUF 4;  1RHI 4;  1KF6 A;  2R07 4;  1D4M 4;  1NEK A;  1XHX A;  1H8T D;  1RUC 4;  1RUG 4;  1VBA 4;  3AE6 A;  1RVF 4;  2HWB 4;  3JBG 4;  1Z7S 4;  3ABV A;  1YQ4 A;  3P4P A;  1RMU 4;  1PVC 4;  3VRB A;  2WQY A;  1VRH 4;  1EV1 4;  4YSY A;  4YSX A;  1RUI 4;  3SUC A;  1VBD 4;  2EX3 A;  1MQT D;  3AEG A;  3P4R A;  1AR9 4;  3J8F 4;  1L0V A;  4YTP A;  1VBB 4;  3VR9 A;  3GQH A;  3AE5 A;  1HRV 4;  2PYJ A;  2WDR A;  2X5I D;  1VBE 4;  4YT0 A;  1AR8 4;  1R08 4;  2R7F A;  3CIR A;  3AEA A;  2WP9 A;  2RMU 4;  2ACZ A;  3VRA A;  1AR7 4;  1XHZ A;  2WS3 A;  1COV 4;  1ASJ 4;  1EAH 4;  4YXD A;  1ZP0 A;  3GQK A;  2PZS A;  2RS1 4;  4Q4V 4;  1PIV 4;  1HRI 4;  2RS3 4;  1R09 4;  3AEC A;  4YTM A;  4YSZ A;  4RHV 4;  2H88 A;  2PYL A;  3AEE A;  4Q4Y 4;  2PW9 A;  3JD7 4;  2RR1 4;  2WDQ A;  2PLV 4;  3AE2 A;  1NCQ D;  3AE7 A;  1PO2 4;  3SFE A;  1ZOY A;  4Q4W 4;  1K5M D;  3AED A;  2R06 4;  3AE3 A;  1YQ3 A;  3P4Q A;  1POV 0;  1AR6 4;  2RS5 4;  1NA1 D;  3SFD A;  5C2T A;  1AL2 4;  1VBC 4;  2RM2 4;  3P4S A;  1BEV 4; 
#chains in the Genus database with same CATH homology
 1RHI 4;  4RHV 4;  1VBB 4;  1D4M 4;  2HWC 4;  1RUJ 4;  1RUE 4;  2R07 4;  3JD7 4;  1PO1 4;  2RR1 4;  4Q4Y 4;  1H8T D;  1RUF 4;  2PLV 4;  4GB3 4;  1HRV 4;  1RUC 4;  4PDW D;  1RUG 4;  1VBC 4;  2X5I D;  1NCQ D;  1VBA 4;  1RVF 4;  2HWB 4;  1PO2 4;  1VBE 4;  4Q4X 4;  3JBG 4;  1AR8 4;  1R08 4;  1K5M D;  1OOP D;  1Z7S 4;  4Q4W 4;  1RUD 4;  2R06 4;  1RUH 4;  2RMU 4;  2RS3 4;  1POV 0;  1AR7 4;  1RMU 4;  1AR6 4;  2RS5 4;  1NA1 D;  1HXS 4;  1PVC 4;  1COV 4;  1ASJ 4;  1EAH 4;  2RS1 4;  2R04 4;  4Q4V 4;  2RM2 4;  1VRH 4;  1EV1 4;  1VBD 4;  1PIV 4;  1RUI 4;  1AL2 4;  1MQT D;  1HRI 4;  1R09 4;  1AR9 4;  1BEV 4;  3J8F 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...