2RS32

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3200
4CDXA 4LLFA 2RMU3 3J8F3 1BBT2 4YVWB 2WS91 1HXS3 3CJIC 2PLV1 1Z7S2 1BMV2 1RMU1 4FTSA 2WLPA 1NCQA 1TME3 1FMD3 1R1A3 1AYN1 4CDXB 2BPA2 1A6CA 2X5IC 5C4WA 2HWD1 3CJIB 2BFUS 2RMU2 4CDWB 4GH4B 1ZBE3 4CDQC 1Z7S3 1R092 3FBMA 3IDEA 1C8M3 4QPGA 2RS32 4RQPC 4CDWC 1EAH3 1TME1 2HWC1 1RUH2 2WFF1 4QPGB 5ABJA 1ZBE1 3VBUC 1AR82 2R062 1RUI2 3NAPC 4PDWC 4RR3C 1RVF2 5DDJ1 1MEC2 5L7OB 5D8AA 2WZR3 1RUG1 5FMOS 4RHV1 2RM22 4GB31 2TBVA 4CDUA 2RR13 2HWF3 1POV1 1QJX3 5D8AB 5BNPA 1QQP2 2RR12 2GSYA 1NG0A 1VBD1 4N43B 2HWF2 4Q4X1 2RM23 1RUH3 4CEYA 4CEWA 3VBFA 5BNPB 4YVWC 4AEDB 2GH8A 1NCRC 5K0UB 2MEV2 2HWE3 1AL21 2RMU1 5CFDB 5C9AC 4CDXC 1VRH1 5BNPC 1ZBA3 1AR92 1F8VA 4AEDA 1AR73 2HWC2 1NCRB 1ASJ1 1VBE3 1VBD3 1FMD1 5K0UA 2RM21 1COV3 2XPJA 5CFDC 2XBO3 2HWE2 2WS92 2WZR2 1K5MB 1TMF2 1NCQB 4JGZC 3VDDB 2HWE1 5C4WB 1ZBA2 1H8TC 3VBRA 1R083 3VBOC 4CDQA 2HWD2 1VBD2 1QJX2 1B35A 4GH4A 1BEV3 1RUF2 4JGZB 3VDDA 1TMF3 1MQTC 1ND2A 1R082 3VBOB 3VBRB 2XBO1 1BEV2 1FPN1 2HWB1 5C8CA 4JGZA 1PGW2 3J8F2 5ABJC 1PO11 1PO21 1VBC3 1CD3G 1ND2B 1R1A2 1VB2A 4JGYC 2RS31 3TN91 4WM8B 2X5IB 5LK7B 1RUJ3 1VBC2 4Q4X2 2WWSA 1TMF1 5A33B 4Q4W1 5DDJ3 3ZFFC 1R093 1MQTA 1AYN2 1ND2C 5ACA3 4JGYB 3ZFEA 5BNOB 1C8M2 2X5IA 2R041 5D8AC 1AR63 1RHI1 1D4M1 1NA1C 1WCDJ 5A33A 5BNNA 4N43C 4Q4Y1 4JGYA 3ZFEB 1F2NA 2FZ2A 5JZGC 3CJIA 1OOPA 1QJU2 3ZFGB 1HRV1 1ZBE2 2RS13 2RS51 4PDWB 4CEYB 1MEC3 4RR3B 2WFF2 3VBFB 5AC93 5BNNC 1VBA1 5L7OC 5J98B 1BBT1 2RS33 3ZFGA 1EV11 1BMV1 4IV3C 1PGL1 1AUYA 4CEYC 1RVF1 3HAGA 1AYM1 3JBG3 1X36A 1ASJ3 1VBE1 2R073 3VBSC 3VBFC 1QJZA 1FOD1 1R091 1H8TB 4RHV3 5ACA2 4Q4V3 3J8F1 1HXS1 4IV1C 5GKAC 2RS11 4IV3B 1D4M3 2R063 1AR83 2R072 3JBG2 4Q4V2 2RS52 1RUG3 2HWB3 4GMP0 4IV3A 4QPIA 2ZAHA 1NY72 3TN93 4YVSC 1POV3 1AR93 1AR71 1EAH1 3VBHC 2R061 1B35C 1PGL2 4RFT0 5AC91 5C8CB 1RUI1 1RUC3 4QPGC 1PIV1 1FPN2 4CDWA 3JBG1 2R071 1VB4A 1RUE3 1HRV2 1AR91 4RHV2 2ZTNA 1VBB2 1RUF3 3JD72 5JZGB 1ZBA1 4RS5C 3VBRC 1NCRA 1RUC1 1COV1 1HRV3 3LOBA 4GB33 1FOD2 5ABJB 1K5MA 4RS5B 4CEWC 1RHI2 4N53C 4NWVA 1DDLA 1R081 4SBVA 2WS93 2XBO2 1C8NA 2BUKA 1AYM3 4RS5A 1VRH2 3VBSB 1ND3C 5C9AA 1QJU1 4N53B 1HXS2 3DPRA 4CDUC 5BNOC 1PVC2 1RUH1 3NAPA 1AYN3 2HWD3 1RHI3 3VBUA 3VBOA 4IV1B 1AR62 1ND3B 4CDUB 1AL23 2HWF1 4Z92B 1EV12 1RB8G 1QJU3 1ND3A 1VAKA 4FSJA 4YVSB 2RS12 1QJY2 1NCQC 1MEC1 1RUJ2 2MEV1 3JB4C 5C4WC 1TME2 1AL0G 3VBHB 1RUD3 1EV13 2IZWA 1RMU3 1ASJ2 1QJY3 1W39A 1RUI3 1QQP1 1OOPB 1RUD2 2PLV2 1M06G 1RUF1 1D4M2 4Q4W2 1RUD1 1PO13 1PO23 1RMU2 1C8M1 1CJDA 4Q4X3 1RUE1 1NOVA 4RR3A 5DDJ2 4WM8C 1OOPC 1RUG2 1BBT3 5AC92 4Q4W3 1GFF2 2RS53 1PGW1 4EJRA 1QJY1 2WFF3 5CFCC 3TN92 1FMD2 5J96B 1OHFA 1R1A1 4WM7A 1V9U2 4AEDC 1H8TA 2R043 2QQPA 4GH4C 1NA1B 1SMVA 5CFCB 4CDQB 3ZFEC 2R042 4WM7B 2BBVA 1V9U3 4YVWA 1EAH2 2VQ0A 1NA1A 1OPOA 1FPN3 4QPIB 1QQP3 1RUE2 1PIV3 1IHMA 2PLV3 2HWB2 3DPRB 1HX6A 2BFUL 4GMP3 1PO12 1PO22 3VBUB 1E57A 1PVC1 5BNNB 1HRI1 4IV1A 1VBB1 3JD71 3S6PA 1BEV1 1PIV2 1HQNA 1RVF3 4N43A 1POV0 1V9U1 1MQTB 2MEV3 2FZ1A 1VBC1 4GB32 1VBA3 4CEWB 4Q4V1 1Z7S1 3JB8A 1RUC2 1QJX1 4RQPA 4NWWA 3ZFFA 1VBE2 1X33A 1COV2 5JZGA 2HWC3 1PVC3 1VBB3 1AR81 3JD73 5ACA1 4FTBA 1HRI3 1VRH3 4BCUA 3VBHA 4RQPB 1RUJ1 3ZFFB 5A32A 1AL22 3M8LA 2Y26A 4PDWA 1HRI2 5L7OA 5FMOL 1AR61 2ZZQA 5A32B 5K0UC 1B35B 4GMP1 2DF7A 2WZR1 4Q4Y3 3VBSA 5C8CC 5C9AB 4FTEA 4N53A 1NY71 3NAPB 1AR72 2RR11 1AYM2 1VBA2 3ZFGC 4Q4Y2 1K5MC 4Y4YA 4WM7C 5FOJB 3VDDC 4WM8A 1FOD3 4QPIC 5CFCA 3ZXAC 5CFDA 4YVSA 3DPRC 5BNOA 4Y5Z0
chains in the Genus database with same CATH superfamily
4CDXA 4LLFA 4HVRA 4XETA 2RMU3 4CU9A 3GZEA 5DQ0A 2VUAA 2WS91 4V2WA 2VZUA 2E9QA 4TXWA 4CXXA 1SLBA 3DV8A 2ZGRA 1NCQA 1WUVA 1TME3 4GIQA 1R1A3 4CDXB 1AX0A 2JXAA 1LESA 2X5IC 5C4WA 3UKNA 2HWD1 4MVTA 1BKZA 3L2YA 4O65A 2BFUS 4BLIA 2XOMA 5CKQA 5GLVA 1ZBE3 5CG8A 2PELA 1Z7S3 2R30A 4UF0A 2G9FA 3HN1A 5L19A 4ZONA 5JSOA 4JVAA 4NHXA 2VZSA 2Q8CA 1YIPA 1GQHA 2OPWA 5ANQA 4RQPC 5FP7A 3KHCA 5IVCA 2YBKA 5KHJA 3QBQA 3LF7A 2HWC1 1L7RA 2WNUA 2XLFA 3DCQA 4HG6B 4R52A 3RJRA 3IMMA 2ARCA 5T3NA 5ABJA 3W58A 5IK7A 1W8HA 4UFIA 1SLLA 4ZU4A 5LW9A 1G8WA 3A4UA 2RG4A 3JQXA 5F5CA 5L9BA 2VULA 1EYBA 3VD9A 2R062 5FZOB 4PIZA 1R64A 1WLTA 3POSA 1XJAA 2NQYA 1IKPA 2VZVA 2P3YA 3WP4A 5FWJA 1CAUA 2XVKA 1DGWA 2CHHA 1JH5A 1OMIA 3LGRA 1SLIA 4QX3A 4DXRA 1W8OA 5F5AA 1DGRN 1EPWA 4OFGA 5L7OB 4W65A 2XGXA 3K4AA 4RHV1 4MXWB 3M7AA 2BGOA 3JQWA 1J84A 2OQ6A 1WMDA 5F5QA 4KI5M 2WSUA 1W99A 4I2OA 3LCPA 3HQRA 1V00A 2TNFA 3R05A 1IQAA 4HMZA 1W9SA 4HKWA 4AHZA 4H55A 3BUCA 4LBLA 3T2PA 4YW1A 1AJKA 2DUQA 5FY0A 4QB6A 1XC6A 4LKFA 3LIGA 4XJZA 2A6XA 1UPSA 2J22A 3HT2A 4GKXA 4O61A 3BIEA 2WRAA 4D0QA 5IT6A 3GYDA 2YGLA 4ARXA 4QGLA 1A8MA 4CEYA 3VBFA 1X9TA 4BQXA 2E51A 4YVWC 4HN0A 2FDJA 4KH9A 2A5ZA 4IDZA 1DFQA 4B1MA 2HWE3 3I3MA 5GLZA 2FMDA 3VKNA 3MYXA 4IESA 3O1SA 2A70A 3ON7A 2P6CA 1AR92 3W5NA 1F9KA 4AEDA 1RYYA 4QX1A 2GMPA 3BALA 5K0UA 2C4XA 5HCBA 1CN1A 1COV3 2XPJA 4AFDA 3PUQA 2DCKA 4YZ1A 3OCPA 2J1VA 1WA4A 2HWE2 2WS92 2WZR2 3OBTA 4UT5A 2AR6A 3ALQA 3THCA 4AG4A 4ASLA 1W9TA 3ILRA 1WW6A 5FBJA 1FV3A 4PLNA 3SC7X 5LBEA 4DINB 4LIUA 3DECA 2ZCWA 2PHDA 3VBOC 4MGYE 3VBRA 3TEYA 4NHLA 3JU9A 4YLZA 1CX4A 1RGSA 1QXPA 1QJX2 3USUB 2ZBJA 1RUF2 1F4HA 2A75A 1JZ7A 5JXGA 3QD6A 3VD3A 4HK8A 4P9YA 3IZOA 4Q8LA 1GZTA 2DCJA 1R082 1W03A 3O1TA 4YPJA 1RUNA 1YLLA 1LRHA 4OUSA 1VMJA 2XBO1 3AVRA 3NVCA 4Q27A 4QQOA 4Y4RA 3UGGA 3M3EA 1KITA 4JGZA 4AW7A 2PHWA 2A6VA 1PO11 1JZ8A 1VBC3 1CD3G 5DUWA 1S0JA 3H8RA 3ACIA 3VD4A 1R1A2 4JKKA 5FCCA 4OZXA 3TN91 1ULPA 4MYEA 4DS0A 1DQ5A 1FAYA 5CAZA 1RUJ3 5A70A 2SBAA 1XB9A 5C8WA 5HV4A 2YPDA 4ASMB 4Q4X2 4DO0A 5A33B 4G4FA 5BYNA 1W6MB 1R093 1URXA 1MQTA 1UPIA 2JG8C 2XG3A 4LO7A 5H9SA 2VPVA 5BNOB 4Z07A 3T2TA 1C8M2 1O6UA 3N7LA 5FLJA 3HN3A 4HANA 2ES3A 5FZLA 5D8AC 4UW6A 3RDIA 5JLVA 4XBLA 2CU5A 5FZCA 3RPQA 4DRVA 4LE3A 3KV5A 1YC61 3OGVA 5BNNA 2YPJA 4U36A 3DF0A 1NAEA 2YFUA 4GD4A 4EN7B 5FOBB 1F2NA 3RWNA 3MF6A 3AKPA 4KWLA 3PVNA 1E5RA 2QFEA 5IHRA 3WINE 5FYSA 5JXIA 2XQXA 3HWJA 4P5HA 3IMNA 4BMBA 1J83A 3N35A 4M3CF 1YYNA 4UF0B 3WEZA 1ZBE2 4B7KA 1UAIA 5BY5A 3HQXA 3Q9OA 3CO2A 4PDWB 5F6LB 4CEYB 4AHWA 3IT8A 3U37A 2VMCA 5JSRA 2ZX4A 1VBA1 2ZMKA 4QB1A 4FPFA 3WCRA 5J98B 4AI1A 3NNGA 1BBT1 1W04A 1EV11 4BMEA 4F8AA 1BMV1 4KGQA 2XKPA 1PGL1 4D7TA 4CEYC 1X36A 4XABA 2R073 1VBE1 3IAPA 3NNJA 5EP9A 1QJZA 5IK5A 1FOD1 1V6NA 2GMEA 2C9KA 2YUEA 3ME2A 4Q4V3 2F4PA 3DXTA 4J6GA 2WNUC 1LCLA 1HXS1 3MW4A 3DYPA 2RS11 1HN1A 2AGSA 4IV1C 5LZ6A 2P5BA 4TYSA 1D4M3 3IKWA 1CZVA 1O59A 5LBFA 3SNMA 3RZMA 2R063 4LOSA 2DCTA 1QKQA 1ULGA 3G6JB 2R072 2QDRA 2YXSA 2VXJA 3KT7A 5FYCA 4LBKA 2GNBA 2BWCA 2CGNA 1KFUL 5E88A 4IV3A 3VZJA 3VHNA 3ACLA 1XSQA 1SHWB 2WN3A 3EHKA 3A0NA 4L92A 3ZXKA 2E63A 3O1RA 1POV3 4DQAA 1AR93 4QX7A 5K7PA 1RITA 1U12A 4Q1RA 1UL9A 2JDAA 1BJQA 3T0DA 3HNMA 3K46A 1HB2A 1YCIA 4AR2A 4TZDA 1RUC3 1W8TA 2QQIA 1T6BX 2G4IA 2NMOA 2YC0A 4QT6A 2V73A 4EQVA 4MZUA 1YJKA 2ET7A 3ZDSA 2YU2A 4QPGC 5L36A 1PIV1 2D3SA 4GJZA 1TVGA 1BHGA 1XU2A 2JENA 3JBG1 4S2DA 4XJ9A 3ZSJA 4AL9A 3WVJA 1JZ5A 4XBNA 2ZTNA 4R9CA 4V2VA 1RUF3 1N3QA 5JZGB 1XE8A 1ZBA1 4YW6A 2RJLA 3MICA 5L73A 2K2SA 4RS5C 3KV9A 1MZFA 4CP0A 5IVEA 1ZZCA 3SXWA 3VBRC 3I2OA 2IXIA 2WZ8A 4LLOA 4I0BA 1GICA 2B8MA 1US3A 3FZ3A 3AMQA 1ULCA 4GB33 5HCHA 3AKRA 1FOD2 4XEZA 1QMJA 3U75A 4LK6A 4IE4A 4XF0A 1VMFA 4B4RA 2ARXA 4NN0A 4CA9A 1U0AA 2XUMA 3ROUA 4TTGA 2DTWA 2XDVA 3I2JA 4MV2A 3TNQA 5A3TA 5ISLA 2BUKA 1OUXA 5IVVA 5JMOA 1ULFA 4Q2FA 1VRH2 3VBSB 3V56A 1QJU1 4LEJA 1HXS2 1UYYA 1YQ2A 3DPRA 4AHXA 5DXDA 4CDUC 3NAPA 2WO7A 2GC3A 2HWD3 2JDZA 2W95A 2XONA 3VBOA 4UBHA 2JDYA 3FHQA 3TB0A 5HV0A 3H1WA 1ZA7A 3TRSB 3T2OA 4A7ZA 3PHMA 2I07B 2RV9A 3B3QE 4XJ8A 2ET1A 3N9NA 2PN5A 4TLGA 3AJZA 4YZ3A 4A6SA 1WCUA 1AL23 1XXNA 3ZXLA 1O5UA 2DU0A 2HWF1 3C7EA 4YG0A 2JDMA 2JE8A 3THPA 2PQQA 3ZIXA 1SBDA 4UFLA 5CIRA 4LBQB 4LITA 4COWA 2DVAA 1BVP1 2HJIA 1OKOA 5C7GA 1I9RA 2JE9A 3FWEA 5FYIA 5KHGA 3OG2A 1XRUA 4OQ8A 2RS12 2VTXJ 5JI9A 4OI1A 4AGGA 1MEC1 5A3LA 5JDBA 4E2GA 3FLPA 5C4WC 1TME2 3VBHB 4AFCA 2L9LA 3NKGA 2D3PA 1DU3D 5C5TA 5L9VA 4E4DX 3UJOA 3KSCA 1YO8A 2IZWA 3WNKA 1A78A 3BODA 5BXXA 1H4GA 2VTFA 2A6WA 5I8TA 3IPVB 3UV9A 1QJY3 2QZ3A 3FMGA 1PX4A 1RUI3 4B29A 3GBWA 2GNMA 4MHUA 3ZR6A 2Z42A 1LULA 1Y9MA 4G3YC 5FZEA 5K4LA 1IGOA 1D4M2 3OD0A 5EYXA 1N1YA 5H9QA 4BYYA 3T4HB 4FI9A 3RYRA 1ZVFA 1NQJA 1CJDA 1SPPA 1RL3A 4BQWA 4RR3A 3V0BA 1W6QA 3NV4A 3AP6A 2JDUA 1QOOA 1RUG2 1BBT3 3CMGA 4FFFA 2ZXQA 4MGSA 4P9XA 5FV3A 4AGVA 3MW3A 1TG7A 5C3RA 2RS53 1LU2A 2Z5WA 2VOWA 5CFCC 4WVMB 3ZSEA 4EZHA 5A1AA 4QGMA 4QAWA 1V9U2 3JXSA 1HV0A 4QHBA 4LO8A 3ZR5A 5DAPA 2QQPA 3LZZA 5T5LA 1SMVA 1KXGA 5CFCB 1HQWA 3S7IA 4NVPA 4A42A 3I97A 4OUMA 5EIYB 5CEHA 1X9PA 3GJBA 2BBVA 5HPOA 5CB7A 1BLZA 1V9U3 3OBAA 4KU8A 1LB2A 4JQTA 1NLSA 4XMAA 1NA1A 4XIOA 3O12A 3LEMA 2BP6A 2JIJA 1UY4A 3W59A 3AB0A 5FZ1A 4I0WB 1J59A 4JTNA 4FOWA 1QQP3 3HEIA 4Y1UA 1PIV3 2YFZA 3GZTB 2A3WA 4QMAA 5FYVA 4XUNA 1OF3A 1U5XA 1X7NA 4YG6A 2F17A 3ES1A 1PO22 3SH4A 3VBUB 1NT0A 2D6PA 1PVC1 3E6BA 3N9QA 5BNNB 5JOYA 1HRI1 1XNTA 3MIBA 4K3UA 1OUSA 1HQNA 5FP8A 4JTOA 2V09A 4BIFA 4X6QB 5JXJA 3WY6A 4A44A 3I3BA 2MEV3 4K8RB 4UW5A 4UXAA 4Q4V1 1PNFA 1LHWA 2PAKA 3OPTA 3OUJA 5I91A 2B7YA 1CR7A 3I2HA 1TQ5A 2WNUB 3C8XA 3J7NA 4M0HA 4AZZA 4E2QA 2XH6A 5CNAA 5A7NA 3ZFFA 3CEWA 1OQDA 4XDOA 5EV7A 5EQUA 2VNOA 1UOFA 5C6CA 1AR81 2UWAA 3ZYRA 5ACA1 4IEVA 5EZWA 1HB3A 1O4TA 5EFUA 1SQ4A 4L9BA 3DL3A 3N3HA 4AF9A 3VBHA 4BCUA 4RQPB 3SLIA 3ZYHA 1LOAA 2QTWB 3SEPA 4B3NA 4DXTA 4DY3A 3ETQA 4HZFA 2BTVC 3ZFFB 1LHUA 2GC1A 3M8LA 1KGYA 3UKVA 5LA0A 2XHNA 5FY7A 2BJSA 3TEWA 5K9YA 1Q8QA 3H7JA 2TEPA 4Y26A 1LOFC 2VCMA 5BPXA 4PDWA 1HRI2 1SFNA 1REDA 4B8EA 1AR61 3RMXA 2QQMA 2YBSA 2JECA 5F5IA 1J1TA 5JPMB 5A1LA 4XE9A 2VNGA 4PIXA 1VJ2A 1LOEA 4KNCA 3RYKA 3NAPB 4BXSV 1V6KA 1GANA 3KWVA 2EXJA 4HBNA 3RQ0A 1FX5A 1S55A 2RR11 4JCKA 4YM0A 3W20A 1GOHA 4BQ4A 3ZFGC 4Q4Y2 1U5YA 1OLME 1MZEA 3ZMNA 4AEMA 4XQWA 1ENQA 4IXLA 2E32A 4PQQA 5APAA 2OYZA 4WM8A 2OVUA 3KF3A 1UZZA 4LBQA 2RDNA 2J7MA 2PHTA 1Y7BA 3MIDA 3H9AA 4QPIC 3IDAA 4JC1A 4Q1PA 4YW4A 5CFCA 5IVBA 4DRRA 5BNOA 1RIRA 1SLTA 2YY1A 4OYUA 3FX3A 1ACCA 4PLOA 3VDAA 5C3PA 1UX6A 1H1IA 5A6YA 5JUVA 1UO9A 2Q0AA 3J8F3 4CE8A 1BBT2 2B39A 2QCSB 3CJIC 1AHSA 4LUKA 2PLV1 3POYA 3ZSKA 5E89A 2IFRA 1IG3A 2WINB 3J7LA 3GBFA 4K7JA 1HKDA 4OHXA 4UAPA 1ZZBA 4FTSA 1DLLA 3F2ZA 4P9IA 3WOGA 1ZREA 2BPA2 4MO3M 2YU1A 2YDEA 2IXCA 2RVAA 5FUNA 3WNOA 1JZ4A 3LDBA 4CDWB 2OUHA 1M4WA 1UXXX 3WDYA 4CDQC 1WWYA 3FBMA 1N3OA 1DGLA 3CIHA 2UY9A 4FPCA 4XF3A 1FNZA 3FC0A 3U10A 5A6XA 2H0VA 2QKDA 4BISA 1QNWA 4IEYA 4CDWC 1OFNA 5JIUA 3CHXA 2XR4A 1TME1 2JDKA 3APBA 3MI8A 4O9GA 3RWKX 5I0DA 1SFPA 1S0EA 1XNBA 5JR7B 4LBQD 1NKGA 2VOKA 4LOTA 3U4XA 1JYXA 4N7IA 3FUQA 1ZBE1 3M3QA 2O14A 3AMNA 1RXGA 4CXYA 1W2TA 4HPKA 3VB9A 2JKXA 4C0BA 4XFHA 5FR3A 3NJYA 4LUMA 2EIBA 3MEPA 5C3QA 2K0GA 1JHJA 1KJRA 3OBRA 2ZGQA 2B46X 1S0FA 2FDFA 1NUKA 2ADEA 1PX3A 5CA6A 1C4RA 1RUI2 2WJSA 4BE3A 1GP5A 2DVDA 2XL7A 4RR3C 1RVF2 4N90A 4AOCA 1MEC2 3I59A 2XMLA 3LSEA 4ISQA 4QXCA 1W8WA 3BTZA 5T5JA 4AEKA 1HLCA 3VKFC 3QLQA 1C28A 5JOWA 2OPKA 2C26A 3ZXFA 1Q3EA 2DUOA 4TSVA 3C2UA 1Z0HA 2TBVA 1Y9GA 4DZGA 3AZZA 3PMEA 1H9PA 3I59B 1UU6A 2HWF3 1POV1 4G9SB 3M1HA 4L0PA 2OXBA 4BLJA 2WFPA 3NJVA 3ZYIB 1NE4A 5BNPA 2BBAA 4XXPA 1LECA 2WBKA 1JXNA 1WLDA 4U2AA 5FPVA 2RR12 4PBPA 3U4SA 5A6QA 1NG0A 1VBD1 3FL7A 5GALA 2NZ9A 5FUPA 4CEWA 2ZPXA 2E33A 1JI6A 1MS0A 2D44A 1W3VA 2CWMA 2FHRA 3ACFA 3S7EA 2W91A 3SCFA 3ZN4A 5FPXA 4QHOA 1C3HA 2ZOEB 2N7GA 1OSGA 3GBGA 4BHPA 5LY1A 3LEIA 3ZN5A 4AGRA 1H9WA 3AP7A 4S2HA 5CFDB 5FY4A 3RGBA 2VZRA 2PFWA 1LAJA 4OI2A 1WZXA 1ZBA3 1SCSA 5FK7A 1UMZA 1PMHX 1AR73 5C71A 4XURA 1NCRB 1QY4A 2D98A 1ZZ6A 1ASJ1 3ZYGA 5F37A 1FMD1 3ATGA 4MGKE 4RGGA 4CUGA 1GWKA 1GYKA 4JV4A 1K5MB 3FE5A 5FZ9A 1AX2A 2FDIA 3OY8A 3LPGA 2JDPA 3B7MA 2HWE1 3OPWA 5JSPA 1ZBA2 1WD4A 1ZM1A 3BYWA 1LR5A 3I3DA 2JKBA 2W5FA 2GALA 5LASA 1VBD2 3EYPA 2ETEA 2VOXA 4XHXA 1BEV3 2FCVA 3MLJA 2YGMA 1SLCA 3HIFA 4MGIE 5FREA 4R4ZA 5E8AA 2JICA 3TNPB 1IQDC 3WP3A 4CCLA 3BGAA 5GZEA 1ND2A 4GAZA 5JR2A 3I2DA 1DF0A 4RA0A 5DPNA 5LA1A 3THDA 1A8DA 3H3UA 2G9ZA 1FPN1 4HLTA 4UFKA 2YV8A 3UNPA 4Y20A 5ANNA 2ZGOA 3K48A 4ASKA 1PO21 2LS6A 4PIYA 1MACA 3MIGA 2C24A 4I01A 4COVA 4WM8B 2YYOA 4BQ3A 1H4HA 2UWBA 2LALA 4HPKB 5LK5A 5F1RA 3AKSA 3AZYA 1IPKA 2P6HA 3WDXA 4GKYA 2J1RA 1ONAA 1TMF1 1YQCA 3FHAA 2FBEA 4Q4W1 1VR3A 4Y3OA 4OQ9A 4ZKTB 5ACA3 3POIA 4PI0A 3WNMA 2X5IA 4NIGA 2BOIA 1GQGA 2GP3A 1W8UA 1D4M1 4YGBA 5IWFA 1GOGA 2DUPA 1WCDJ 3BU7A 5LRRA 1I1EA 1E5HA 2CY6A 5A7OA 4XC9A 2HEWF 2D5FA 2VL4A 4FFGA 2OZ6A 5KWRA 2FZ2A 1FI2A 4XCAA 3VDCA 3LIHA 2VZTA 3WG4A 2WO1A 4DIQA 2P37A 2ZGLA 4O9EA 3CJIA 3ECQA 5EXOA 4BDVB 1UZ0A 1CWPA 3T08A 3WNPA 2UURA 2VW0A 3K2OA 5LRSA 3U14A 1XYOA 4ARYA 4UWDA 4ONUA 1DQ2A 3U07A 5FQ0B 3NNFA 4ZHNA 3QOPA 4XUPA 4QX0A 3WQ7A 2E7QA 3O1MA 2O8OA 4AVVA 2JDHA 1T2XA 2RS33 1N47A 3CZJA 3FJSA 4Q0QA 2W94A 4FPGA 2QVSB 3HNBM 4F3JA 4YM2A 1RVF1 3HAGA 1BYHA 3JBG3 4LHKA 3VBSC 5A1FA 1UYZA 5EJZB 3DKQA 2Q30A 1ZNPA 1YFUA 1V6MA 1O3RA 1H2LA 1S0GA 1DQ1A 3IAQA 4J25A 5G04L 3ZX7A 4YM3A 5IAVA 4LBJA 4FAGA 5GKAC 3LDRA 1O3TA 1LOGA 3M70A 2OKXA 1UMHA 4CP9B 1IZ3A 4XHBA 3AK0A 4A3ZA 5J37A 1HN0A 4XPVA 3ES4A 1KD7A 2I2SA 2DURA 3OY8B 4LR4A 1CONA 3CJXA 3KVAA 2Y33A 1YRZA 1H8VA 3HBZA 2VMHA 3WF4A 2HWB3 1OD5A 3FFZA 1MVQA 5FPZA 3H7YA 5FO9B 2BU9A 1RXFA 2Y6GA 4LO4B 5B2GB 2E7TA 1VAMA 1J1LA 2WAAA 1WA6X 3UGHA 3VZOA 5D1IA 3FFQA 4LIVA 4FQZA 5FPUA 2RDRA 4LKDA 1VIWB 2DTYA 2C5DA 1WW7A 1EAH1 4E9KA 4E8CA 2Y34A 3SITA 1QXJA 2Q5TA 5IW0A 5C8CB 3NJZA 5CADA 5FZ6A 2W0XA 1UW8A 2WZEA 3GM8A 3HVDA 2LW8A 3IIAA 1ZRIA 1Y43B 3H50A 2LRPA 3I3QA 1FPN2 1YXWA 1OLRA 1JTZX 3ZXJA 1VB4A 1AR91 3RJ2X 1IS4A 3AZVA 3AFGA 4GWJA 3ZM8A 1LJ7A 3H42B 3VD5A 4BH9A 2Y0OA 1L3JA 2MHFA 5D21A 3NMBA 1OA4A 2B42B 2VQAA 4FOVA 2CDPA 3PTRB 1V6JA 3T0AA 4QXKA 1LOFA 4XF1A 1NZCA 1BK0A 1W9FA 4NUBA 1LTEA 3E6DA 3ENRA 3LA3A 4BU2A 5C5UA 1HRV3 3AMMA 4QU2A 1V6LA 3KM5A 4PHZA 1K5MA 2VMFA 3OB8A 3DYMA 1EP0A 5A3OA 4CEWC 1D2QA 1OBNA 2VBPA 4NWVA 1R081 1N1SA 3BI3A 3O0WA 4SBVA 4XJUA 4IGOA 4LNVA 1ZA4A 2E31A 2WS93 3V0AB 1CGPA 4YZ2A 2ZGNA 3Q8BA 1UOJA 3AC0A 1AYM3 5FP4A 4M3CA 4QX5A 4RS5A 3PURA 2VVEA 3KT4A 4D69A 1OFSA 2GN7A 4IETA 4N53B 4UFJA 1PVC2 4OULA 4XW3A 3RSJA 2D6NA 1CPMA 3WUCA 1QJEA 1AYN3 1RHI3 3B5LB 1HV1A 1G86A 3AKTA 4Y1XA 2Q8EA 4YGDA 4IV1B 4C91A 5I8YA 3EB7A 4QQLA 3WF1A 3FLRA 1FXZA 1ALYA 1AR62 4ZPIA 3POJA 3RRDA 4B4PA 4EWEA 1DCSA 4Y22B 1F5FA 5FMCA 4AAPA 2RE9A 4GALA 4EROA 5LA2A 1EV12 1KQRA 3E6CC 3I3EA 2IUWA 1UOBA 2P2KA 3O14A 4CUAA 4LO6B 4MXWA 4BQ2A 3KCCA 4WV8A 4Y22A 4P00B 5FY1A 4UW3A 4YVSB 2WZPP 3I8TA 1Z78A 2JD9A 3BU0A 1IPJA 1H0BA 4CXWA 3GF6A 1RUJ2 5GLUA 3QH6A 2XKOA 4CU7A 3AKQA 2MEV1 1XBFA 2V4AA 3PVBB 5IVYA 3VZKA 3WHTA 1AL0G 2BZDA 4MH0E 5F3GA 1RUD3 4L2NA 3RZGA 2VM9A 1GZCA 1EV13 2WYSA 1Y9QA 2Y64A 4KU7A 1RMU3 1LOCA 3AVSA 5E16A 1ASJ2 2PHUA 3WG3A 3W9AA 1GZWA 4KGGA 1ULDA 2Z79A 4AI3A 1JW6A 1W39A 3OPZA 4XVHA 2OQ7A 4AHYA 4FFHA 3TEZA 4QX2A 1QQP1 3R0RA 3PMSA 5FYYA 4A7KA 1M06G 2C1FA 1KS5A 3TOJA 1G9FA 2PYTA 3B69A 2JD4A 3UGFA 1PO13 1CVNA 2KR2A 2DCYA 3POBA 1C8M1 1QJFA 2FQPA 4GJYA 4WM8C 4YRDA 3WX5A 4DPNA 3TEXA 3T2QA 1CZTA 4DUXA 1DYOA 4OHVA 3USUA 5AC92 4META 5IVJA 2IXHA 5FZMA 1GFF2 1UMIA 5F9TA 4N8MA 4BK4A 1D7PM 3URFA 4EJRA 3C7HA 5DG2A 4D8MA 1V6OA 3TN92 5FPLA 3T4VA 1AXKA 4D7YA 5J96B 1HQLA 1R1A1 4NIDA 3ZN6A 4AEDC 5KR7A 2R043 3HNYM 1PVXA 3O1UA 2Z69A 4OHWA 3WHUA 4QM8A 1XE7A 1Y3TA 5F2SA 5JPNB 4CDQB 1DQ0A 5C70A 4DMIA 1O3SA 1ENRA 3GGLA 1KDMA 2ATFA 3D0SA 4WM7B 3O1VA 3PNAA 3ZYPA 4UBGA 1VAVA 3KCYA 3KB5A 1XNKA 3LA2A 1EAH2 1NLQA 2JJ6A 5FMBA 2JDNA 3CBNA 4M0NA 3PJYA 1UQXA 1OPOA 4OHZA 4PLMA 3Q8AA 2VMDA 4QPIB 1QDOA 2O0OA 4R9DA 5FMDA 4HVOA 4I3GA 1V70A 3B93A 3EXUA 4CCCA 1F31A 4GMP3 3H3LA 1PO12 5GZFA 1WBLA 4IV1A 1QWRA 2VUCA 1VBB1 3JD71 3K4DA 3K75B 4GWNA 4ITCA 3LB9A 1RVF3 2VCAA 4GWMA 4N43A 1XSRA 1C1LA 2FZ1A 2VTXA 4GB32 1VBA3 2ZHNA 4LQRA 2A1XA 4D6QA 1Z7S1 5J36A 3P1IA 2SLIA 3JB8A 4D6RA 3BKZA 1RUC2 3ZSLA 1LGBA 1QJX1 2Q8OA 4RQPA 1S4CA 2IC1A 4MADA 4Q0UA 1PZ8A 4NWWA 1PHMA 3U11A 1HJFA 1JZ3A 3IB3A 4NIAA 5TSWA 4QX8A 1K42A 1UYXA 1XE0A 4TWTA 4C8DA 1S0DA 2W3JA 1WMFA 1VBB3 3JD73 3PUAA 5DZEA 3K3OA 1YFYA 4QXHA 4XILA 2C6SA 1W0PA 3HR9A 5JOZA 1RUJ1 2V5DA 2EA7A 2AENA 2VVFA 2J1EA 1HIXA 3WV6A 5BNQA 2QQVA 5BUVA 2VXRA 4FFIA 3WQBA 1O7FA 2W1UA 3VUOA 1LHOA 4MX3A 1XYPA 3AXDA 4MUVA 1QOSA 2QUOA 1JYTA 2DYCA 2ZZQA 5A32B 3OSDA 4AQ2A 4FO9A 1OKQA 2CTVA 4XUOA 1UY0A 2PMWB 2DF7A 2WZR1 1OURA 4Q4Y3 4HONA 5C8CC 1NY71 1X82A 3IN9A 5CU1A 5CISA 2J42A 2AACA 2WIIB 1S2EA 4CU8A 4TN7A 1UOGA 1L7QA 1IPSA 4XFBA 4JDNA 1OA2A 3NWKA 3ABZA 4LHNA 3H1MA 2ZGPA 5F6KA 2WDBA 1K5MC 2DVFA 4QB2A 4HN1A 3ZO0B 5FOJB 4KBBA 3VDDC 3ZKUA 3VN4A 2Q4SA 3OBZA 5FY9A 2LTNA 4IE0A 2D93A 5KXEA 5F3CA 4QPYA 4CCJA 1VP6A 2W87A 4IE5A 1G9AA 1VPHA 2B5HA 2HEYF 5IVFA 3I2IA 3M4FA 3POEA 3DPRC 2WT0A 2ZX3A 2ORXA 2XJVA 3SHRA 1DLCA 1GV9A 2XJSA 4Y5Z0 2G9GA 1SFYA 3ZIWA 3J4UH 2QNKA 1STMA 1EPZA 5FZ4A 2UYAA 3A21A 4KL1A 1Z7S2 3AYCA 3NW4A 5AVPA 4H3WA 1BMV2 1RMU1 2OA2A 4MGTA 1A3KA 3MLLA 4PI2A 3LD8A 1AYN1 3I7DA 1A6CA 1Q5OA 4HOOA 4DEVA 4QKNA 5A7WA 3OJBA 4PF1A 3C7GA 2AYHA 4HT1T 2RMU2 4NAMA 2R0HA 4D94A 1GMMA 3MIFA 2VZ1A 4GXLA 4LT5A 2HKXA 3AMPA 4NJ4A 4HK9A 1R092 1JYIA 1WBFA 2AEZA 1C8M3 1DYKA 1F5JA 3ETPA 2BGCA 4Q0SA 4Q26A 2AC1A 1JUHA 4FPHA 1Q56A 2W9XA 3KCXA 1AF9A 2R0FA 3V0AA 1EAH3 2WN2A 2QQKA 1RUH2 3HJRA 3PTYA 4IE7A 2WFF1 2BW8A 1QU0A 3WXPA 1SEFA 3JUUA 3M2MA 4YW3A 1ZX5A 3SH3A 1H1AA 4QPGB 4CP1A 3H3ZA 4DEQA 4FPOB 3D4KA 3QACA 2F6BA 1H6XA 4XFCA 1YI7A 3VBUC 4R4XA 4JHZA 3VHPA 3WF2A 1OVSA 4IL7A 4BQ1A 3LA7A 1W6MA 2FCTA 4P9WA 1VLNA 3FN9A 1TNRA 1JN2P 2RJ2A 3NAPC 2NLRA 4CCDA 5DDJ1 2BWAA 1BQPA 1SDWA 2XJPA 3OD4A 3ZLIA 4YYOA 4PT6A 2QQJA 3GDBA 4INDA 5D8AA 1W06A 2WZR3 5FLHA 2PXJA 2IXJA 3Q8CA 4BOWA 1UIKA 1SBFA 1HJGA 4FQ4A 2VNRA 4ATEA 1EUUA 3DKWA 1IG0A 1SZBA 2RR13 4CDUA 1BXHA 2WNOA 1K3IA 3WW1A 4AEJA 4JDOA 1QJX3 1OQEA 1JODA 2WR9A 1WD3A 1LGCA 3EMRA 1QQP2 4GWIA 4L8QA 1BK1A 1W0OA 4UOJA 1ULEA 1P8JA 3AYEA 4WBBA 5CBLA 4XTMA 2GSYA 2HWF2 1DP0A 3VZMA 4LJHA 1W9YA 1RUH3 3LFMA 4MLOA 3ZPOA 5I0TA 1GUIA 5BNPB 1BVVA 2H0BA 4AEDB 4BIOA 1ZYBA 2HBTA 1MS3A 2PA7A 2HBUA 3GJAA 4E4ZA 5IFTA 2EAAA 1V0AA 2MNGA 1W0NA 2ORZA 2MEV2 3UKTA 1AL21 1UD1A 2RMU1 1IS5A 2ZABA 3D0JA 4GULA 5CKNA 4I02A 1VRH1 3PVOA 4X8NA 1DQ6A 1W6QB 4ZY9A 5BNPC 4I0AA 3ST7A 4Q8KA 2PHFA 2E26A 4JAAA 2QZ2A 4HVQA 4ES9A 4BA6A 1VBE3 3E5XA 2RM21 3KD4A 2HLEA 3N9PA 2XBO3 1FATA 1TMF2 3C7FA 4C90A 4EN6B 4H7MA 4Y24A 1L7LA 2VOTA 2WO3A 2ZX2A 5C4WB 5E6HA 3TAYA 1H8TC 3SKJE 1XNDA 2X10A 1JU4A 4H2AA 2Y6KA 3NQHA 1B35A 2W92A 4GH4A 4IEXA 4PF5A 4XTPA 1GP4A 1T6GC 4YWAA 3THTA 2R32A 4AI8A 4CVUA 1TMF3 4XFGA 5T50A 2JG8A 1MQTC 1MS4A 1OF4A 4QQ2A 4RSUA 4UW4A 3I49A 5FAXA 3VBOB 1H2NA 2RDSA 3E5QA 4XFFA 3ZN6B 4RD7A 1BEV2 3SQOA 4N9IA 4BQYA 2B4KA 2HWB1 5I0UA 4XOGA 5C8CA 3SCHA 1PGW2 3J8F2 4YM1A 5ABJC 4K21A 2WABA 4DUVA 1U5IA 2GC0A 2JG8B 3AM2A 1HW5A 1WCSA 2VQUA 4JGYC 2RS31 4QHZA 2D43A 5L9RA 4PJYA 3WP5A 5LK7B 5HI0A 2NN8A 2AZ5A 3PIJA 4CSWA 4KMQA 2WWSA 5IYYA 4UFMA 4COZA 4ZU7A 3EQEA 5JCTA 1ZRFA 1AYN2 2Y38A 5FZGA 4JGYB 3ZFEA 4YW7A 2WT2A 2YHJA 3IDCB 4BM8A 2ZGKA 1I5ZA 4X8PA 1DIWA 2D6KA 1AR63 4DFSA 2A3YA 1JZ2A 1EUTA 2JEMA 1LOBA 5JIAA 3BCWA 3S0MA 3NJXA 3AMHA 4N43C 4LBMA 5ERLA 2DCZA 5AVAA 2VH9A 2R6QA 5IFPA 2WA3A 4OZOA 4W6XA 5KXDA 5A7WB 3T1MA 4FPKA 3WDTA 1UY3A 1YUDA 5FYTA 5JMCA 4MSVA 1C5HA 3UK9A 3UYJA 4CUBA 3CL1A 3VLBB 1MPXA 1CPNA 2JG9C 1LNSA 3LQCA 2YG0A 1IKQA 4LTAA 1JYCA 1G7YA 1JOJA 1YQ6A 5FZKA 2RS13 4W4ZA 2RS51 2H6CA 5IK4A 2WUHA 5FTTC 2VECA 1UZVA 4RR3B 4NIIA 1JYNA 5BNNC 1OLMA 3OF1A 4DXZA 1C57A 1UKRA 5DAVA 1JMUB 3ZFGA 1HB1A 1U5ZA 2EXKA 5CZKA 1JBCA 2I74A 5GZCA 3KVBA 3T1LA 4IV3C 4LHSA 1AUYA 4KQ7A 3O0VA 4AQSA 1AYM1 3WNNA 5GM0A 3WDUA 1GBGA 3VD7A 3LFIA 1GU3A 3WR0A 2ZA9A 5C3OA 4MGZE 4YFZA 2VZQA 3IM0A 4ZXKA 3OOXA 3AP4A 3O1OA 3EJKA 3J8F1 2NP0A 3OUHA 4V1PA 4IV3B 1WCQA 1NZIA 5LBCA 2VCCA 1X50A 5DZFA 3ZYFA 1LHNA 4O7XA 5KHKA 2VW2A 1OD3A 1S0BA 3IDBB 4HSJA 4IE6A 5LWBA 1AR83 5FXVA 3HPNA 4XAAA 1S2BA 2VD7A 1RUG3 4OMDA 4EN0A 3GXUA 3CDZB 5JXHA 4DNYA 4PCRA 2FDGA 2AEYA 2RJKA 4URAA 3VGIA 1O5LA 3RZZA 5DN2A 4W6WA 4XIKA 3X29B 1W6PA 1DQ4A 2UYBA 1VRBA 3ACGA 4YVSC 4PBOA 3VL8A 1JOPA 1D0GA 2R16A 3OYWB 1DZQA 1X8MA 5FYBA 5LY2A 2H6BA 5FZ3A 2J1SA 4AVCA 2XWBB 5T5OA 1B35C 3POWA 1UZYA 3RNSA 1PGL2 4RFT0 3WNXA 4KWJA 5AC91 5FYMA 3K77A 3GCXA 2Q8DA 4C1WA 3P6BA 2BQPA 4AFAA 5LA9A 2NM1A 1R1ZA 1EY2A 5A7QA 1Y4WA 3RI8A 1IS6A 3N9LA 2A7AA 1QF3A 2XQRA 4RN5A 4FT8A 3B9CA 4BZ4A 1W6OA 4N7UA 1S1AA 2QDNA 4CCKA 5F2WA 5FIXA 3HT1A 4WVWA 2VCBA 2D7FA 4A6OA 1MS9A 2QQOA 4QWNA 1WMXA 1AZDA 5FZIA 4LBNA 5LBBA 4NIHA 4XZPA 1S2KA 3GALA 1I5PA 4XYXA 2FMYA 3WQ0A 3KQ4B 3WT3A 4Y5SA 1FV2A 2EALA 3LDKA 4QU1A 3AZWA 4IUGA 1ZZ9A 4K1YA 4XJWA 3H8XA 1ENSA 4W6YA 2VE1A 3RS6A 3L9JT 1V6IA 3MDPA 3N7JA 2ZACA 4IGPA 2D6OX 4JQRA 1UYPA 4M3CB 4RS5B 5A3NA 1DDLA 1ZRRA 4IGQA 5DUXA 4CUCA 4XUTA 4EZ4A 5J3UA 2DFBA 4AI9A 2GP5A 2FD8A 4JRAA 5FZDA 4FPLA 5KXBA 1C8NA 1VMHA 1GP6A 2KD7A 1ODNA 2BNOA 3M3IA 5EJ1B 4WZCA 4ZZ8A 4HKOA 1MR5A 4Z1VA 1ND3C 2YROA 4IEWA 4FOYA 1PM4A 1NLRA 4P9LA 5F32A 1CIYA 1B09A 2WYFA 1F15A 2E53A 3J26N 2PHLA 1GNHA 2VMIA 3KZ4C 3WF3A 4NAOA 2ZEYA 1FYUA 2JG9A 2YBPA 3BVCA 4K1ZA 3TBDA 3BTXA 5F3EA 3BB6A 3PUSA 1ND3B 4CDUB 2ZS6B 1BZWA 5FZHA 1S0IA 3IIIA 3VL9A 2W46A 3BIWE 5FJKA 5DAXA 1PK6A 2VVDA 1CAWA 2EVXA 4M3CE 4CU6A 3MBWA 4B1LA 1YQ8A 4OUEA 1OXCA 1VAKA 5DZGA 4E27A 5JAXA 3GCWA 3N9MA 4FSJA 4X6RB 5FDBA 3NV1A 3RZLA 2OT7A 3FBYA 1QJY2 4P08A 5FP3A 3MZHA 2Y8KA 1CAWB 3JB4C 2UU8A 2XJUA 2DFCA 2JIGA 5JOXA 1FNYA 1W9WA 3R4UA 4LHLA 5GLTA 3CLPA 4XXAA 5FO8B 2W1WA 4MGQA 2BV4A 3OEAA 4E4SA 3RZJA 1YFWA 2XLGA 2ZEZA 4A4AA 4XQDA 5K8SA 4KG8A 4AYUA 1SPPB 5FLIA 2LM3A 1KJLA 2PTMA 3MUY1 1QEXA 4NHKA 3AL6A 1JHNA 1OOPB 2GNTA 3PLQA 1QDCA 3RG0A 1OC1A 4D3WA 4JDMA 1JYVA 1O3QA 3S5QA 2VQTA 5I0SA 1RUD1 1GZWB 1PO23 2DVBA 3IPVA 5HCAA 3KV6A 4K8FA 5CVRA 4Q4X3 2ZMLA 1OOPC 1RJ7A 4AK3A 2WQZC 3VKLA 1GOFA 4Q4W3 2QJVA 3LPFA 3O1PA 3I2FA 2DDUA 3A0KA 1PGW1 3OGSA 1QJY1 2WFF3 5GJ6A 2QQUA 1FMD2 1BCXA 3C7OA 3AYDA 5J09A 2YB7A 1KRIA 5EPAA 5FZ7A 4AWDA 1J3QA 2P3IA 5GZDA 4H14A 3WDVA 3KV4A 4QDSA 2C0ZA 2CGOA 2VUJA 5FZ8A 2Z4FA 4FP3A 2R042 1J58A 5FKCA 1CAUB 4COYA 4ET7A 2XUEA 4XQ4A 4I3PA 2WNEA 2ZKNA 2EIEA 4NE9A 5I93A 2VQ0A 2CAUA 3AJYA 4NR1A 4XFIA 4ZZ5A 4WVZA 1HDKA 4Y1YA 2VBDA 2JWPA 2WWJA 4TLFA 3VHRA 1FPN3 5J1XA 5FPAA 1ZRDA 1W6PB 3ITQA 1RUE2 1MVEA 1IHMA 2HWB2 3AP5A 3DPRB 4QDRA 1HX6A 3N9OA 4BB3A 3MW2A 3AZXA 4LA3A 4Y1VA 1E57A 1CESA 1AVBA 2W68A 1POQA 4K40A 1PZ7A 3MV01 3OUIA 5T5PA 4P9JA 1KFXL 3S6PA 3SEEA 2KA3A 3LOIA 4FAHA 3AFKA 3ZXEA 4QKFA 2A6ZA 4NPMA 1POV0 1V9U1 4M00A 1OVPA 5EJ3A 5FBZA 2X05A 3ZYBA 1VBC1 2ERFA 5F39A 5HXMA 4CEWB 4D7SA 5JVVA 4HXCA 2P17A 3PU3A 4BJ0A 1XPWA 2C9AA 1DHKB 4YGEA 1DGRA 2PHXA 4XFAA 2V72A 3WQ1A 5A7PA 2HYXA 3WUDA 2CWSA 1VBE2 2D97A 1X33A 1COV2 5FO7B 2HWC3 3ZMOA 3ZYJB 5FFOC 4FTBA 1HRI3 1MS1A 4AI2A 2ZX0A 2W52A 2JB4A 1CAXB 1LEMA 2CAVA 2WAOA 3WW2A 1NXD1 2ZHMA 2J1UA 2WKKA 2E6VA 4Z2WA 1AL22 1REEA 2K46A 2AUYA 3GNEA 4E2SA 3LKJA 2PAMA 1G9CA 2Y26A 4JKLA 4LA2A 3E97A 5IATA 4AVAA 2A71A 5FMOL 5G05L 2AREA 1UZWA 1O8PA 3DYOA 4XF4A 5FZ0A 1B35B 1S0CA 4LO5B 3ZXGA 3N7KA 2CYFA 3VBSA 1QOTA 2JX9A 4FTEA 4N53A 4YSFA 4KWKA 3KGZA 1SLAA 2CSGA 1PK6C 4NOTA 1TEIA 4OHYA 1AR72 1D2SA 2Y6LA 4M4PA 5JWPA 2VMEA 1G9BA 1AYM2 2Y60A 3KHBA 4FPJA 4QXBA 3SKVA 1UIJA 3MIHA 4XDQA 4KWUA 3UJQA 4Y4YA 4WM7C 5DAWA 4OI0A 1DBNA 1KS4A 2BNNA 3D8CA 2GU9A 1PMJX 4XDPA 4ATFA 2ZGMA 3R4SA 2B9UA 1DZTA 1W90A 4CCMA 1FOD3 4EE2A 3ZOIA 3MLKA 5LEJA 3G7DA 4DB5A 2A3XA 2P1BA 1QNYA 2W1SA 1W3XA 3DN7A 3PL0A 4RYDA 3ZXAC 5CFDA 2ADDA 1TE1B 5HCFA 2ARBA 4YVSA 1OH3A 3WP6A 2HH9A 4R9BA 1N1VA 3E1F1 4F7ZA 3CNAA 4YNIA 3NKTA 3OGRA 4OI4A 2ARAA 2D3RA 4YVWB 4GA9A 1HXS3 3NNLA 4YFWA 1VALA 4FOQA 1Q8PA 1YI9A 3I2GA 2IXLA 2WLPA 1MZ5A 3B02A 2Y6HA 1FMD3 3VV1A 4HSLA 1QH6A 4CCNA 2OUJA 4ES8A 3UL2A 1D4VB 1E5IA 1GNZA 2GZWA 2PHRA 4NMIA 4RGAA 2WC2A 3CJIB 4XMIA 5H9RA 4LMFA 1GR3A 5D2AA 2BOJA 4FVVA 4GH4B 4EWDA 4A3XA 1APNA 4HFSA 4RL7A 5T52A 3IDEA 3A22A 3VDBA 5FWEA 3INAA 1SDDB 2VNVA 4BK5A 4AAXA 3MFCA 3F95A 4QPGA 5FYHA 3V0BB 3UETA 4NHMA 2RS32 4OLLA 2EIGA 3MFAA 4XF9A 4XJAA 4A2UA 2VGDA 1PNGA 4NRPA 2QQNA 2BVVA 5AFEA 3DUIA 1GQPA 5FYZA 3LSDA 4L97A 2XXZA 5DUVA 5FY5A 4CP2A 2K9ZA 4QGNA 3W5MA 2P4EA 3BTAA 1WKYA 2R49A 1UY2A 2R1DA 4L99A 4LXLA 2ZMNA 4W50A 1AR82 2I45A 5FKBA 3WG1A 2EAKA 4K9SA 4MHRA 5AFBA 5FJHA 3DGTA 3MIEA 3B00A 4C0HA 5A6ZA 1A34A 3ELNA 3MPBA 3P5BA 3SMHA 4ZXEA 1UU5A 2E7AA 2ZKLA 4PDWC 1G6NA 1UN1A 1QXRA 1OH4A 4AI0A 2ZEXA 2X29A 1OA3A 5IAXA 2ILMA 1GWLA 3SISA 4XAEA 1RUG1 5FMOS 4CYDA 2CGPA 1NXMA 4IERA 4QKDA 2KXLA 2VG9A 2RM22 3NNMA 2VZPA 1J3RA 4GB31 1UCXA 3DEMA 2VUDA 3CU7A 2W47A 4LK7A 2XL9A 3S5AA 2ZHKA 2WL1A 5D8AB 1CIWA 2NPIA 2F4LA 3AL5A 2A73B 2OIIA 4MOAA 1WMEA 3CQOA 4PQ9A 1YFXA 4N43B 2XVLA 4Q4X1 1D0HA 2RM23 5HXVA 3WCSA 5LB6A 2TUNA 2D40A 1W6NB 2CDOA 1MZ6A 4RGKA 1H2MA 4K20A 2GH8A 2W39A 1NCRC 2QE3A 5K0UB 3BTYA 3D82A 4BPZA 3PU8A 5FZBA 5B4XA 1PM7A 1UKGA 3PDQA 4A7YA 5C9AC 2W2IA 4UYBA 4CDXC 4AE2A 4UI9L 4F83A 1XQNA 2XB6C 5I0RA 1F8VA 3HD8B 1AX1A 2HWC2 3WSOA 4NROA 1K45A 2IXKA 1VBD3 2WNVA 2W08A 1WLCA 3J7HA 2PAEA 1XNAA 4HKLA 4OCTA 1LHVA 2WLQA 3AXEA 5CFDC 2VAUA 3PJQA 1NCQB 4JGZC 3VDDB 5A80A 3QH7A 5T55A 3K4ZA 3OGGA 3H1YA 2EICA 4KG0A 3WD5A 5KXCA 1R083 3UESA 4CDQA 1OT5A 4P14A 2HWD2 3GHMA 4Y1ZA 4AVSA 4LKEA 4P02B 1K5JA 4CZSA 3ZPYA 3PUIA 3B94A 1YJLA 4JGZB 3SH5A 4AFMA 1I3HA 1LEDA 3PVEA 3P3NA 3VDDA 4N9HA 4WVMA 4QQPA 2ID4A 3OYWA 4URTA 4LPLA 3M3OA 1SBEA 4K6BA 3VBRB 3W21A 3S30A 3LEKA 3JZVA 2G1MA 4AQ6A 1W2OA 4IEUA 2EXHA 3I2KA 2ZGSA 2OS2A 1ND2B 3MO4A 5IJRA 1VB2A 5FY8A 3WLUA 4B4QA 2GH2A 3D5OA 2X5IB 1QGLA 3DXUA 4UFHA 2P3JA 3WG2A 1G9DA 1AXYA 2GMMA 1W6OB 2RHPA 4YW2A 1VBC2 1KDKA 4JKMA 5FZOA 2XWJB 5DDJ3 3ZFFC 1ND2C 3LAGA 4Q0PA 1LGNA 3NRUA 3WDWA 4YARA 2R041 3RYPA 1XU1A 2JB8A 1RHI1 3BOWA 4WZFA 2DU1A 1NA1C 3NV2A 5A33A 3KLSA 3OTFA 4IEPA 4Q4Y1 3OGJA 3H8UA 4JGYA 3ZFEB 3R4DB 3JCIA 4FP2A 4L11A 4CPBA 4Z2AA 2BDRA 1ZRCA 5JZGC 3N4MA 1H1MA 2ZZJA 1WCKA 4COUA 3BOPA 4MXVA 4EWAA 1JU3A 1N1TA 5HBAA 3NL1A 1OOPA 2DVGA 1QJU2 3POGA 1H2KA 3ZFGB 3D6EA 2ZX1A 4XBQA 1HRV1 4E8DA 3FHIB 4NHYA 1MEC3 3I54A 4IQPA 2WFF2 3T3YA 3TWIA 3VBFB 4E4HA 5AC93 1GWMA 3ACHA 4Y33A 5B4NA 5L7OC 5LEKA 3HBKA 3NO8A 3HMYA 4H7LA 4BXFA 2QQLA 3AX4A 1VE0A 1Q8SA 4EN8B 2XJQA 2HEVF 2DWRA 3NV3A 5FQ0A 1RJ8A 1ASJ3 2IFWA 1ZZ8A 1GZ9A 5FXZA 3VBFC 1ODMA 1F35A 1NE6A 1R091 1H8TB 4RHV3 5ACA2 5SV8A 2DV9A 1NYWA 4J1WA 3LWCA 1AXZA 4DY5A 1RUOA 5FUIA 4NPRA 3WW4A 5FRAA 3FUOA 4HL0A 5I8SA 2FCUA 2VJXA 3JBG2 1Q8VA 4Q4V2 2VOVA 5FPBA 4J1XA 2NYYA 2RS52 1GNYA 4GMP0 3HQUA 5DABA 2B9VA 2R1BA 2X53S 4C1XA 4CP9A 4ORFA 3CZUA 1YHFA 4QPIA 2NMNA 2ZAHA 5T54A 1NY72 4W8JA 3TN93 1OI6A 4NRQA 1ZZ7A 1UF2C 1AR71 1WLWA 1UX7A 1ULOA 1FT9A 3ZXDA 4FXKB 3VBHC 4NRMA 2R061 3K51A 4JZRA 1H30A 1LODA 1RUI1 2FDHA 2YMZA 3KGLA 1W8FA 3RVHA 4B7EA 1CQ9A 4I30A 2B45X 1PZ9A 1REFA 2XLAA 2X8KA 2EIDA 2GAUA 1UXZA 4FPEA 1PMIA 1RC6A 2R071 4LKSA 1KEXA 4XCBA 4CDWA 2VC9A 2FDKA 1UY1A 1RINA 1RUE3 1HRV2 5FYUA 1N3PA 4RHV2 1W2UA 3ZVXA 2WQ8A 5KC6A 1VBB2 3A23A 2CNAA 3JD72 4P5YA 2A6YA 3RFRA 2Z2SB 3MF9A 1W8ZA 4XZUG 5BV6A 2QQWA 2BVBA 1JZ6A 1CAXA 1NCRA 5J48A 1RUC1 2WNVB 1COV1 1YIFA 2Y6FA 3LOBA 3M3CA 4ISRA 5ABJB 2EXIA 5FP9A 4CRQA 5A3MA 3U78A 5FXXA 1JUIA 3V65A 2Q1ZB 1RHI2 4N53C 4CCOA 1O91A 2WNVC 3R6SA 2VMGA 2VZ3A 1E5SA 2ZGTA 2XBO2 3H8OA 5GLWA 2WQ4A 5LATA 3E5UA 5FZAA 4A45A 4YW5A 2VU9A 4WVVA 5C9AA 1MS8A 4QKBA 1XNCA 3N36A 5BNOC 4AFBA 1RUH1 4BQ5A 3IWZA 4QPWA 5FK8A 2ZHLA 4EYUA 5F3IA 3VBUA 5DG1A 2ZEWA 2GN3A 1MS5A 3D3AA 4EN9B 4DOUA 2O1QA 2BEOA 4I09A 4Y20B 4RFRB 5A3WA 3RI9A 2G19A 2WSVA 3GZUC 4XACA 4CPBD 4IEQA 4Z92B 2GDFA 1NX9A 4R8HA 5CKMA 1QHDA 4EV0A 3ORJA 3HOBA 1LKNA 3VZLA 1DYPA 5IUQA 1RB8G 1QJU3 1ND3A 4D6SA 3O5SA 1C5IA 3B01A 5A7SA 3ILFA 1DZRA 4IEOA 2D6MA 2VO5A 1CAVB 3T30A 2YZ4A 3ILNA 1PK6B 2WA4A 4OVEA 5J7MA 1NCQC 4SLIA 2P3KA 2YC4A 4YGCA 3EO6A 2LUWA 3ZSMA 2HYKA 1XYNA 2GNDA 3POFA 1W28A 1QH7A 4XUQA 2DBIA 4Q29A 1LU1A 4IEZA 2BERA 4QDQA 2VBBA 2MPFA 1SG3A 5FXWA 3B9IA 3KMHA 3MGUA 4JHTA 4GQ7A 2R7EB 3J9SA 3VKOA 2D6LX 2UWCA 1W2NA 2W1QA 3CKHA 1W6NA 4AVTA 1OLQA 3EBRA 3BN6A 4Y5TA 1K12A 1RUD2 3LE0A 5H9PA 3OEBA 2PLV2 5M0TA 1RUF1 4OMCA 2CL2A 3ASIA 1OPMA 2VR4A 1TNFA 2EF6A 2ZAAA 4Q4W2 4LBOA 4FXGB 3T0BA 1RMU2 2OW4A 5DUUA 3O7OA 1RUE1 1NOVA 1AJOA 5DDJ2 2PQSA 1WW4A 3CF6E 4IW3A 4P9GA 2IWGB 3O0XA 2BNMA 3PUHA 3KS7A 3UT0A 1I6XA 3WW3A 3WNLA 2O8QA 5KHHA 3V64A 5LCWL 1XOYA 1OHFA 5EYYA 4WM7A 4ZS3A 1IOAA 1H8TA 2BYVE 2XJRA 1CJPA 3WF0A 2J1AA 3QCWA 4S2FA 3H0OA 1CZSA 4GH4C 5DMYA 4KBZA 1NA1B 4R9AA 4Z8BA 1UWWA 3Q8EA 4M4RA 5EHDA 1UU4A 3ZFEC 2WT1A 3MPPG 3BPZA 5KHIA 4Z82A 5JI7A 1X8EA 1US2A 4M01A 3VKMA 5C33A 2XJTA 1DG6A 4BWOA 3FLTA 1F4AA 4YVWA 3RZKA 3U1XA 1GKBA 1O4YA 1O8SA 3J7MA 1GSLA 1SCRA 4A41A 3GZAA 1GLHA 3KF5A 1ST8A 3VZNA 3S57A 2PLV3 3SCGA 1H6YA 3Q8FA 2P34A 1UNBA 2ZGUA 2BFUL 2UY8A 2JE7A 4GZ9A 3TYJA 3USSA 1JS9A 1LENA 1NQDA 5E1RA 1BEV1 1PIV2 1Q8OA 4S2GA 4AQTA 3VHOA 1IS3A 3P3PA 4QQHA 1MQTB 5SV5A 3ZKYA 3I4IA 3NSTA 4FPYA 3GHNA 4CCEA 1O4ZA 2WWUA 3MUZ1 2BGPA 1W05A 4MG2A 2V4VA 5CYYA 4QM9A 3RMYA 4LULA 1PGSA 2ENRA 1YWKA 1CAVA 1YQ5A 1ENXA 1W8NA 1W2AX 5JZGA 1PVC3 2AH2A 2IVJA 4ZS2A 3C3VA 5DAQA 1J3PA 2VY0A 1VRH3 2IVIB 2QBXA 1JYWA 1RTVA 4NPLA 5KBFA 1TZOA 3LEGA 4AVBA 2VZOA 4ZU5A 1WW5A 5F8PA 5A32A 1QIQA 2CV6A 3U0ZA 2LROA 3PIGA 3A7QA 2XVGA 5A3PA 2ZJCA 5L7OA 1SACA 2Q1MA 1Q43A 5K0UC 2OZJA 5CG9A 3KT1A 2Y0IA 5FZFA 4GMP1 5EWSA 4CTEA 5C9AB 5F7UA 4NO4A 2RDQA 4HETA 4JRLA 4DXSA 2D5HA 4YZ4A 3KQRA 5GZGA 2BRTA 2YC2A 3WZ1A 4QD2A 2JG9B 5IK8A 4JX0A 1VBA2 4DUWA 2VW1A 5A3UA 3L2HA 2KM2A 1C1FA 3BPSA 1HB4A 3RZHA 3IBMA 2OX0A 2GC2A 5C3SA 3MHZA 5KC5A 4AXOA 3K3NA 4LORA 1OQ1A 1WGPA 3AP9A 2WO2A 2DBNA 2Y6JA 4Q0VA 3ZDVA 4LE4A 1CX1A 3T09A 3MV11 4YG3A 2Q1FA 4YZ5A 1YEWA 4FBFA 2J1TA 2V5YA 3AYAA 1JOBA 2X09A 4Q5OA 3N7MA 1DGWX 2XHKA 1YNAA 4FCAA
chains in the Genus database with same CATH topology
4CDXA 4LLFA 4HVRA 4XETA 2RMU3 2VUAA 2WS91 2E9QA 1SLBA 3DV8A 2ZGRA 1NCQA 1WUVA 1TME3 4GIQA 1R1A3 4CDXB 1AX0A 2JXAA 1LESA 2X5IC 5C4WA 3UKNA 2HWD1 4MVTA 1BKZA 3L2YA 2BFUS 4BLIA 5GLVA 1ZBE3 5CG8A 2PELA 1Z7S3 2R30A 2G9FA 3HN1A 5L19A 5JSOA 4JVAA 1YIPA 1GQHA 4RQPC 5KHJA 3QBQA 2HWC1 2WNUA 2XLFA 4R52A 3RJRA 5T3NA 5ABJA 3W58A 5IK7A 1SLLA 4ZU4A 1G8WA 3A4UA 3JQXA 2VULA 1EYBA 2R062 4PIZA 1WLTA 3POSA 2NQYA 1IKPA 3WP4A 1CAUA 2XVKA 1DGWA 1JH5A 1OMIA 3LGRA 1SLIA 5L7OB 1DGRN 1EPWA 4OFGA 4W65A 2XGXA 4RHV1 4MXWB 3M7AA 3JQWA 1WMDA 5F5QA 2WSUA 4I2OA 3LCPA 1V00A 2TNFA 3R05A 1IQAA 4HMZA 4HKWA 4AHZA 4H55A 4LBLA 4YW1A 1AJKA 2DUQA 4XJZA 2A6XA 1UPSA 3HT2A 4GKXA 5IT6A 3GYDA 2YGLA 4QGLA 1A8MA 4CEYA 3VBFA 2E51A 4YVWC 4HN0A 4KH9A 2A5ZA 1DFQA 2HWE3 5GLZA 2FMDA 3VKNA 3MYXA 4IESA 2A70A 1AR92 1F9KA 4AEDA 2GMPA 3BALA 5K0UA 5HCBA 1CN1A 1COV3 2XPJA 4AFDA 2DCKA 4YZ1A 3OCPA 1WA4A 2HWE2 2WS92 2WZR2 3OBTA 4AG4A 2AR6A 3ALQA 4ASLA 3ILRA 1WW6A 1FV3A 4PLNA 4DINB 2ZCWA 2PHDA 3VBOC 4MGYE 3VBRA 4NHLA 3JU9A 4YLZA 1CX4A 1RGSA 1QXPA 1QJX2 3USUB 2ZBJA 1RUF2 2A75A 3QD6A 4HK8A 4P9YA 4Q8LA 2DCJA 1R082 1RUNA 1YLLA 1LRHA 4OUSA 3NVCA 2XBO1 4Q27A 4QQOA 3M3EA 1KITA 4JGZA 4AW7A 2PHWA 2A6VA 1PO11 1VBC3 1CD3G 5DUWA 1S0JA 1R1A2 5FCCA 4OZXA 3TN91 4MYEA 4DS0A 1DQ5A 1FAYA 5CAZA 1RUJ3 2SBAA 5C8WA 4ASMB 4Q4X2 5A33B 4G4FA 5BYNA 1W6MB 1R093 1URXA 1MQTA 1UPIA 2JG8C 2XG3A 4LO7A 5H9SA 2VPVA 5BNOB 4Z07A 3T2TA 1C8M2 5FLJA 3N7LA 4HANA 2ES3A 5D8AC 4UW6A 3RDIA 5JLVA 4XBLA 4DRVA 3RPQA 4LE3A 5BNNA 2YPJA 4U36A 3DF0A 4EN7B 5FOBB 1F2NA 3RWNA 3MF6A 3AKPA 4KWLA 3PVNA 2QFEA 3WINE 3HWJA 4P5HA 3IMNA 4BMBA 3N35A 4M3CF 1YYNA 1ZBE2 4B7KA 1UAIA 5BY5A 3HQXA 3Q9OA 3CO2A 4PDWB 5F6LB 4CEYB 4AHWA 3IT8A 5JSRA 2ZX4A 1VBA1 2ZMKA 3WCRA 4FPFA 5J98B 4AI1A 1BBT1 1EV11 4BMEA 4F8AA 1BMV1 4KGQA 2XKPA 1PGL1 4D7TA 4CEYC 1X36A 2R073 1VBE1 1QJZA 5IK5A 1FOD1 1V6NA 2GMEA 2YUEA 3ME2A 4Q4V3 2F4PA 4J6GA 2WNUC 1LCLA 1HXS1 3MW4A 4IV1C 2RS11 2AGSA 4TYSA 1D4M3 3IKWA 3SNMA 2R063 2DCTA 1QKQA 1ULGA 3G6JB 2R072 2QDRA 2YXSA 3KT7A 4LBKA 2GNBA 2BWCA 2CGNA 1KFUL 5E88A 4IV3A 3VZJA 3VHNA 3ACLA 3EHKA 3A0NA 4L92A 3ZXKA 2E63A 1POV3 4DQAA 1AR93 5K7PA 1RITA 1U12A 4Q1RA 1UL9A 1BJQA 1YCIA 4TZDA 1RUC3 2G4IA 2NMOA 2YC0A 4QT6A 2V73A 4MZUA 1YJKA 2ET7A 3ZDSA 4QPGC 5L36A 1PIV1 2D3SA 1XU2A 2JENA 3JBG1 4S2DA 4XJ9A 3ZSJA 3WVJA 4XBNA 2ZTNA 4R9CA 1RUF3 1N3QA 5JZGB 1XE8A 1ZBA1 5L73A 2RJLA 3MICA 2K2SA 4RS5C 4CP0A 1MZFA 1ZZCA 3SXWA 3VBRC 2IXIA 4LLOA 4I0BA 1GICA 2B8MA 3FZ3A 3AMQA 1ULCA 4GB33 3AKRA 1FOD2 4XEZA 1QMJA 4XF0A 4B4RA 2ARXA 4NN0A 1U0AA 2XUMA 3ROUA 2DTWA 4MV2A 3TNQA 2BUKA 1ULFA 4Q2FA 1VRH2 3VBSB 3V56A 1QJU1 4LEJA 1HXS2 3DPRA 4CDUC 4AHXA 5DXDA 3NAPA 2GC3A 2HWD3 2JDZA 3VBOA 4UBHA 3TB0A 3H1WA 3TRSB 4A7ZA 3PHMA 2I07B 3B3QE 4XJ8A 2ET1A 4YZ3A 2PN5A 3AJZA 1AL23 1XXNA 3ZXLA 1O5UA 2DU0A 2HWF1 4YG0A 3THPA 2PQQA 3ZIXA 1SBDA 5CIRA 4LBQB 4COWA 2DVAA 1BVP1 2HJIA 1I9RA 2JE9A 3FWEA 5KHGA 1XRUA 2RS12 5JI9A 4OI1A 4AGGA 1MEC1 5A3LA 5JDBA 4E2GA 3FLPA 5C4WC 1TME2 3VBHB 4AFCA 3NKGA 2D3PA 1DU3D 4E4DX 3UJOA 3KSCA 1YO8A 2IZWA 1A78A 3BODA 5BXXA 1H4GA 2A6WA 5I8TA 3IPVB 3UV9A 1QJY3 2QZ3A 3FMGA 1RUI3 4B29A 3GBWA 2GNMA 2Z42A 1LULA 4G3YC 1IGOA 1D4M2 3OD0A 5EYXA 1N1YA 5H9QA 4BYYA 3RYRA 1ZVFA 1NQJA 1CJDA 1RL3A 4RR3A 3V0BA 1W6QA 3NV4A 3AP6A 1QOOA 1RUG2 1BBT3 4P9XA 4AGVA 3MW3A 2RS53 1LU2A 2Z5WA 2VOWA 5CFCC 4WVMB 3ZSEA 4QGMA 1V9U2 1HV0A 4QHBA 4LO8A 2QQPA 3LZZA 5T5LA 1SMVA 1KXGA 5CFCB 1HQWA 3S7IA 4NVPA 4OUMA 2BBVA 5CB7A 1V9U3 4KU8A 1LB2A 4XMAA 1NLSA 1NA1A 4XIOA 3O12A 3W59A 3AB0A 4I0WB 1J59A 4JTNA 4FOWA 1QQP3 4Y1UA 1PIV3 3GZTB 2A3WA 4QMAA 1U5XA 1X7NA 4YG6A 3SH4A 3ES1A 1PO22 3VBUB 2D6PA 1PVC1 3E6BA 5JOYA 5BNNB 1HRI1 3MIBA 4K3UA 1HQNA 4JTOA 2V09A 4BIFA 4X6QB 3WY6A 2MEV3 4UW5A 4UXAA 4Q4V1 1PNFA 1LHWA 2PAKA 5I91A 2B7YA 1CR7A 1TQ5A 2WNUB 4M0HA 4E2QA 2XH6A 5CNAA 3ZFFA 3CEWA 1OQDA 5EV7A 2VNOA 5C6CA 1AR81 2UWAA 3ZYRA 5ACA1 4IEVA 5EZWA 1O4TA 5EFUA 1SQ4A 4L9BA 3DL3A 3N3HA 4AF9A 3VBHA 4BCUA 4RQPB 3SLIA 1LOAA 4B3NA 4DY3A 3ETQA 4HZFA 2BTVC 3ZFFB 1LHUA 2GC1A 3M8LA 3UKVA 5K9YA 1Q8QA 3H7JA 2TEPA 4Y26A 1LOFC 5BPXA 4PDWA 1HRI2 1SFNA 1REDA 4B8EA 1AR61 3RMXA 2JECA 1J1TA 5JPMB 4XE9A 2VNGA 4PIXA 1VJ2A 1LOEA 4KNCA 3RYKA 3NAPB 1V6KA 1GANA 2EXJA 4HBNA 3RQ0A 1FX5A 1S55A 2RR11 4JCKA 4YM0A 3ZFGC 4Q4Y2 1U5YA 1MZEA 3ZMNA 4AEMA 4XQWA 1ENQA 4IXLA 2OYZA 4WM8A 2OVUA 1UZZA 4LBQA 2PHTA 1Y7BA 3MIDA 3H9AA 4QPIC 4JC1A 4YW4A 4Q1PA 5CFCA 4DRRA 5BNOA 1RIRA 1SLTA 2YY1A 3FX3A 4PLOA 1UX6A 1H1IA 2Q0AA 3J8F3 1BBT2 2B39A 2QCSB 3CJIC 1AHSA 4LUKA 2PLV1 3POYA 3ZSKA 5E89A 2IFRA 2WINB 4OHXA 5I8YA 3GBFA 4K7JA 1HKDA 4FTSA 1ZZBA 1DLLA 1ZREA 4P9IA 3WOGA 2BPA2 2YDEA 2IXCA 4CDWB 2OUHA 1M4WA 3WDYA 4CDQC 3FBMA 1N3OA 1DGLA 2UY9A 4FPCA 4XF3A 1FNZA 3FC0A 3U10A 2H0VA 2QKDA 1QNWA 4IEYA 4CDWC 1OFNA 5JIUA 1TME1 3APBA 3MI8A 4O9GA 1S0EA 1XNBA 5JR7B 4LBQD 2VOKA 3U4XA 4N7IA 3FUQA 1ZBE1 3M3QA 3AMNA 4HPKA 4C0BA 4XFHA 4LUMA 3MEPA 2K0GA 1KJRA 3OBRA 2ZGQA 2B46X 1S0FA 5CA6A 1C4RA 1RUI2 2WJSA 4BE3A 2DVDA 2XL7A 4RR3C 1RVF2 4N90A 1MEC2 3I59A 3LSEA 4ISQA 5T5JA 4AEKA 1HLCA 3VKFC 3QLQA 1C28A 5JOWA 2OPKA 3ZXFA 1Q3EA 2DUOA 4TSVA 3C2UA 1Z0HA 2TBVA 4DZGA 3AZZA 3PMEA 1H9PA 3I59B 1UU6A 2HWF3 1POV1 4G9SB 3M1HA 4BLJA 2WFPA 3ZYIB 1NE4A 5BNPA 4XXPA 1LECA 1JXNA 1WLDA 4U2AA 2RR12 4PBPA 1NG0A 1VBD1 5GALA 2NZ9A 4CEWA 2ZPXA 1MS0A 2D44A 2FHRA 2CWMA 3S7EA 3ZN4A 3SCFA 5FPXA 1C3HA 2ZOEB 2N7GA 1OSGA 3GBGA 4BHPA 3ZN5A 4AGRA 1H9WA 3AP7A 4S2HA 5CFDB 2PFWA 4OI2A 1ZBA3 1SCSA 1UMZA 1AR73 1NCRB 1QY4A 2D98A 1ZZ6A 1ASJ1 3ZYGA 1FMD1 3ATGA 4MGKE 4RGGA 4JV4A 1GYKA 1K5MB 3FE5A 1AX2A 3OY8A 3B7MA 2HWE1 5JSPA 1ZBA2 1WD4A 1ZM1A 1LR5A 2JKBA 2GALA 1VBD2 2ETEA 2VOXA 4XHXA 1BEV3 4MGIE 3MLJA 2YGMA 1SLCA 3HIFA 5FREA 3TNPB 4R4ZA 5E8AA 2JICA 3WP3A 5GZEA 1ND2A 3I2DA 1DF0A 4RA0A 1A8DA 3H3UA 1FPN1 4HLTA 2YV8A 4Y20A 2ZGOA 3K48A 1PO21 4PIYA 1MACA 3MIGA 4I01A 4COVA 4WM8B 2YYOA 1H4HA 2UWBA 2LALA 4HPKB 5LK5A 5F1RA 3AKSA 3AZYA 1IPKA 3WDXA 4GKYA 1ONAA 1TMF1 2FBEA 4Q4W1 1VR3A 4ZKTB 5ACA3 2X5IA 1GQGA 1D4M1 4YGBA 2DUPA 1WCDJ 3BU7A 5LRRA 1I1EA 2CY6A 2HEWF 2D5FA 2OZ6A 5KWRA 2FZ2A 1FI2A 3WG4A 2P37A 2ZGLA 4O9EA 3CJIA 3ECQA 5EXOA 2UURA 2VW0A 5LRSA 1XYOA 4ONUA 1DQ2A 3U07A 5FQ0B 3QOPA 3WQ7A 2E7QA 2O8OA 4AVVA 2RS33 1N47A 3FJSA 4Q0QA 4FPGA 2QVSB 4F3JA 4YM2A 1RVF1 3HAGA 1BYHA 3JBG3 4LHKA 3VBSC 2Q30A 1ZNPA 1YFUA 1V6MA 1O3RA 1H2LA 1S0GA 1DQ1A 3ZX7A 4YM3A 4LBJA 4FAGA 5GKAC 1O3TA 1LOGA 3M70A 1IZ3A 4XHBA 3AK0A 5J37A 4XPVA 3ES4A 1KD7A 2I2SA 2DURA 3OY8B 4LR4A 1CONA 3CJXA 1YRZA 1H8VA 3HBZA 2VMHA 2HWB3 1OD5A 3FFZA 1MVQA 5FPZA 3H7YA 5FO9B 4LO4B 5B2GB 2E7TA 1VAMA 1J1LA 3VZOA 5D1IA 3FFQA 4FQZA 1VIWB 2DTYA 2C5DA 1WW7A 1EAH1 4E9KA 3SITA 1QXJA 2Q5TA 5C8CB 3NJZA 5CADA 2W0XA 1UW8A 3IIAA 1Y43B 3H50A 1FPN2 1YXWA 1OLRA 1JTZX 3ZXJA 1VB4A 1AR91 3RJ2X 1IS4A 3AZVA 3AFGA 1LJ7A 4BH9A 2Y0OA 1L3JA 2MHFA 1OA4A 2B42B 2VQAA 4FOVA 1V6JA 4QXKA 1LOFA 4XF1A 1NZCA 1LTEA 3E6DA 3ENRA 3LA3A 1HRV3 3AMMA 4QU2A 1V6LA 3KM5A 1K5MA 1EP0A 4CEWC 1D2QA 4NWVA 1R081 1N1SA 3O0WA 4SBVA 4XJUA 4LNVA 1ZA4A 2WS93 3V0AB 1CGPA 4YZ2A 2ZGNA 1AYM3 4D69A 4M3CA 4QX5A 4RS5A 4ES8A 2VVEA 3KT4A 1OFSA 2GN7A 4IETA 4N53B 1PVC2 4OULA 4XW3A 3RSJA 2D6NA 1CPMA 3WUCA 1AYN3 1RHI3 3B5LB 1HV1A 1G86A 3AKTA 4Y1XA 4YGDA 4IV1B 4C91A 4QQLA 3FLRA 1FXZA 1ALYA 1AR62 3RRDA 4B4PA 4EWEA 4Y22B 1F5FA 2RE9A 4GALA 4EROA 1EV12 1KQRA 3E6CC 2P2KA 3O14A 4LO6B 4MXWA 3KCCA 4WV8A 4Y22A 2WZPP 4UW3A 4YVSB 3I8TA 1Z78A 1IPJA 1H0BA 3GF6A 1RUJ2 5GLUA 3QH6A 2XKOA 3AKQA 2MEV1 3PVBB 3VZKA 3WHTA 1AL0G 4MH0E 1RUD3 4L2NA 1GZCA 1EV13 1Y9QA 4KU7A 1RMU3 1LOCA 5E16A 1ASJ2 2PHUA 3WG3A 3W9AA 1GZWA 4KGGA 1ULDA 2Z79A 4AI3A 1JW6A 1W39A 3OPZA 4AHYA 1QQP1 3R0RA 3PMSA 4A7KA 1M06G 2C1FA 1KS5A 3TOJA 1G9FA 2PYTA 3B69A 2JD4A 1PO13 1CVNA 2DCYA 1C8M1 2FQPA 4WM8C 4YRDA 3WX5A 4DPNA 4OHVA 3USUA 5AC92 4META 2IXHA 1GFF2 5F9TA 4EJRA 3URFA 5DG2A 1V6OA 3TN92 1AXKA 4D7YA 5J96B 1HQLA 1R1A1 3ZN6A 4AEDC 2R043 1PVXA 2Z69A 4OHWA 3WHUA 4QM8A 1XE7A 1Y3TA 5JPNB 4CDQB 1DQ0A 4DMIA 1O3SA 1ENRA 1KDMA 2ATFA 3D0SA 4WM7B 3PNAA 3ZYPA 4UBGA 1VAVA 3KCYA 3KB5A 1XNKA 3LA2A 1EAH2 2JJ6A 4M0NA 3PJYA 4OHZA 1OPOA 4PLMA 4QPIB 1QDOA 2O0OA 4R9DA 4HVOA 4I3GA 1V70A 3B93A 3EXUA 1F31A 4GMP3 5GZFA 1PO12 1WBLA 4IV1A 1QWRA 1VBB1 3JD71 4GWNA 4ITCA 3LB9A 1RVF3 4GWMA 4N43A 1C1LA 2FZ1A 4GB32 1VBA3 2ZHNA 1Z7S1 5J36A 2SLIA 3JB8A 1RUC2 3ZSLA 1LGBA 1QJX1 2Q8OA 4RQPA 2IC1A 4Q0UA 1PZ8A 4NWWA 1PHMA 3U11A 5TSWA 4TWTA 1S0DA 1WMFA 1VBB3 3JD73 5DZEA 1YFYA 4XILA 3HR9A 1W0PA 5JOZA 1RUJ1 2EA7A 2AENA 2VVFA 3WV6A 1HIXA 5BNQA 5BUVA 2VXRA 1O7FA 3VUOA 1LHOA 4MX3A 1XYPA 3AXDA 4MUVA 1QOSA 2QUOA 2DYCA 2ZZQA 5A32B 4AQ2A 4FO9A 1OKQA 2CTVA 2DF7A 2WZR1 4Q4Y3 5C8CC 1NY71 1X82A 3IN9A 5CU1A 2WIIB 4XFBA 4JDNA 1OA2A 3NWKA 4LHNA 5F6KA 3H1MA 2ZGPA 1K5MC 2DVFA 4HN1A 3ZO0B 5FOJB 4KBBA 3VDDC 3VN4A 2Q4SA 2LTNA 2D93A 5KXEA 4QPYA 1VP6A 1G9AA 2B5HA 2HEYF 3M4FA 3DPRC 2WT0A 2ZX3A 2XJVA 3SHRA 1GV9A 4Y5Z0 2XJSA 2G9GA 1SFYA 3ZIWA 3J4UH 2QNKA 1EPZA 2UYAA 4KL1A 1Z7S2 3AYCA 3NW4A 5AVPA 4H3WA 1BMV2 1RMU1 2OA2A 1A3KA 3MLLA 1AYN1 3I7DA 1A6CA 1Q5OA 3OJBA 2AYHA 4HT1T 2RMU2 4D94A 2R0HA 3MIFA 4GXLA 4LT5A 2HKXA 3AMPA 4HK9A 1R092 1JYIA 1WBFA 1C8M3 1DYKA 1F5JA 4Q0SA 2BGCA 4Q26A 1JUHA 4FPHA 1Q56A 3KCXA 1AF9A 2R0FA 3V0AA 1EAH3 1RUH2 3PTYA 2WFF1 2BW8A 1QU0A 3WXPA 1SEFA 3JUUA 3M2MA 4YW3A 1ZX5A 3SH3A 1H1AA 4QPGB 4CP1A 3H3ZA 4FPOB 3D4KA 3QACA 2F6BA 4XFCA 1YI7A 3VBUC 4R4XA 3VHPA 4BQ1A 4IL7A 3LA7A 1W6MA 4P9WA 1VLNA 3NAPC 1TNRA 1JN2P 2NLRA 5DDJ1 2BWAA 1BQPA 1SDWA 2XJPA 3OD4A 4YYOA 4INDA 5D8AA 2WZR3 5FLHA 2IXJA 4BOWA 1UIKA 1SBFA 4FQ4A 2VNRA 4ATEA 3DKWA 4CDUA 2RR13 1BXHA 3WW1A 4AEJA 4JDOA 1QJX3 1OQEA 1WD3A 1LGCA 1QQP2 4L8QA 1BK1A 1W0OA 5CBLA 1ULEA 3AYEA 4WBBA 4XTMA 2GSYA 2HWF2 3VZMA 1RUH3 4MLOA 5I0TA 5BNPB 1BVVA 2H0BA 4AEDB 4BIOA 1ZYBA 1MS3A 2PA7A 4E4ZA 2EAAA 2MNGA 2MEV2 3UKTA 1AL21 1UD1A 2RMU1 1IS5A 2ZABA 3D0JA 4GULA 4I02A 1VRH1 3PVOA 4X8NA 1DQ6A 1W6QB 5BNPC 4I0AA 3ST7A 4Q8KA 2PHFA 4JAAA 2QZ2A 4HVQA 4ES9A 4BA6A 1VBE3 3E5XA 2RM21 3KD4A 2XBO3 1FATA 1TMF2 4C90A 4EN6B 4H7MA 4Y24A 2ZX2A 5C4WB 3TAYA 1H8TC 1XNDA 1B35A 4GH4A 4IEXA 4PF5A 4XTPA 1T6GC 3THTA 2R32A 4AI8A 1TMF3 4XFGA 5T50A 1MQTC 1MS4A 2JG8A 4QQ2A 4RSUA 4UW4A 5FAXA 3VBOB 1H2NA 4XFFA 3E5QA 3ZN6B 4RD7A 1BEV2 4N9IA 2HWB1 5I0UA 4XOGA 5C8CA 3SCHA 1PGW2 3J8F2 4YM1A 5ABJC 4K21A 1U5IA 2GC0A 3AM2A 2JG8B 1HW5A 1WCSA 4JGYC 2RS31 2D43A 4PJYA 3WP5A 5LK7B 5HI0A 2NN8A 2AZ5A 2WWSA 4COZA 4ZU7A