2RS32

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3200
4IV1B 1VBC1 2HWD2 1AYM2 1WCDJ 1TME3 1OOPC 1VBC3 4Y4YA 5CFDA 4YVWC 1ND3B 1BBT1 4QPIC 5BNNA 4CEWB 2HWD1 2WZR1 4JGYC 1AUYA 1FPN1 1RUC2 4FSJA 3ZFEA 3VBRB 1X36A 2HWD3 2WZR3 5K0UA 1AR91 1FPN3 2RS32 1K5MC 1NCRC 2R041 4CDQC 5ACA2 1AR93 2ZZQA 1OOPB 5AC92 2R043 3JBG2 3ZFFA 1CJDA 1RUC1 4YVSC 4RR3A 1PIV2 1QQP2 4N53B 5L7OB 2RS31 4JGYB 5D8AA 2QQPA 3VBUC 5ACA1 4PDWC 2BUKA 1NA1C 4RQPB 2RS33 1MQTA 1RUF1 5AC91 3DPRA 5JZGA 3JBG1 5ACA3 1EV11 1CD3G 1AR72 5C9AB 5AC93 1RUF3 5CFCA 3JBG3 1E57A 1EV13 2RS53 1IHMA 1ZBA1 1AL22 2HWF2 4RS5A 1A6CA 4N43A 1QJU2 2ZAHA 3FBMA 4WM8A 1MEC1 1ZBA3 1C8M3 5ABJB 1MEC3 1BEV2 4CEYB 3VBUB 1AL21 2HWF1 2XBO2 1VB4A 3J8F2 1QJU1 1VAKA 1RVF3 1QJU3 3IDEA 2MEV2 5C4WA 1ND3A 1AR62 3VBOC 5LK7B 3VDDB 1R082 4Q4Y2 4Q4V2 1QJY1 4JGZA 1W39A 4RFT0 2HWC1 1QJY3 2MEV1 1RUD3 1AR61 1OOPA 2HWC3 2ZTNA 2X5IC 1R081 4CDXC 1NCQC 1POV0 1FMD1 1RUI3 4YVWA 4QPGB 1ASJ2 1ZBE3 1R083 4IV1C 4QPIA 3VBOB 4JGYA 1FMD3 2Y26A 4NWVA 2R063 1HX6A 1K5MA 1NCRA 1VBA3 4Q4X2 4CDQA 1V9U3 3JD71 1B35B 4CEWC 3JD73 4YVSA 3VBRC 1NG0A 2HWE2 1VB2A 2RM23 1H8TB 3LOBA 2RS12 4Q4X1 2RMU2 3VBUA 4PDWA 5GKAC 1NA1A 4Q4X3 2WWSA 5A32B 2GSYA 4N53C 2BFUL 1BMV2 5L7OC 1AYM1 1BBT3 2RMU1 2R072 3CJIB 4RQPC 1AYM3 2HWB2 1RHI2 2RMU3 4AEDB 1F8VA 5C9AC 1AR82 1AYN2 3VBSB 1VBB2 1RUE2 1BMV1 1SMVA 1D4M2 1ND2B 5BNOC 1RHI1 1RUC3 3NAPB 4FTEA 1AR81 1AYN1 5ABJC 1VBB1 4CEYC 3JB4C 1RUE1 1RHI3 2WFF2 1AYN3 1AR83 3VBOA 1VBB3 1RUE3 1COV2 1D4M1 4NWWA 1PIV1 4GH4C 1QQP1 1RMU2 4LLFA 1D4M3 1PVC2 1PIV3 1TMF2 1QQP3 3VBFC 2WFF1 5BNOB 1COV1 3VDDC 1AR71 2X5IA 4CDXA 1NCQA 3ZFGB 2PLV2 1RMU1 1COV3 1AR73 4IV1A 1PVC1 1X33A 1TMF1 1RMU3 1HRI2 2HWF3 1AL23 4GH4B 4CDWB 1PVC3 3M8LA 1M06G 1BEV1 1R092 1RUH2 2FZ1A 3VBFB 4Z92B 4FTSA 4QPGC 2PLV1 1QJX2 1VRH2 4CEWA 2XBO1 1BEV3 1VBD2 3J8F1 2PLV3 2DF7A 1F2NA 3VBRA 2XBO3 3J8F3 2BBVA 1R1A2 1PGW2 5CFDB 1RUH1 5BNNB 1QJX1 1B35C 1VRH1 1RUH3 1VBD1 2MEV3 4Q4Y1 4Q4V1 3ZFEB 1AR63 1QJX3 4BCUA 1VRH3 1FOD2 1VBE2 1VBD3 4Q4Y3 4Q4V3 1H8TC 4N53A 5DDJ2 4GMP1 5L7OA 3TN92 4GMP3 4RQPA 4Y5Z0 1EAH2 4RR3B 5C9AA 1PO22 1VBE1 1ASJ1 4CDUC 4EJRA 3JB8A 5D8AB 1VBE3 3TN91 2IZWA 1ASJ3 1RUJ2 1MQTB 3CJIC 3DPRB 5JZGB 1EAH1 5FOJB 3TN93 5BNOA 4AEDC 3VBSC 5CFCB 1PO21 5ABJA 4CEYA 1HXS2 1TME2 1VBC2 4RS5B 1PO23 5BNPC 1POV1 1ND2C 1RUJ1 5C8CC 1RB8G 2HWE1 5A33B 4GH4A 3S6PA 1POV3 3NAPC 4CDUB 1PO12 4RHV2 2VQ0A 2RS11 2HWE3 1HXS1 2XPJA 1NY72 1TME1 3VBFA 4SBVA 2RS13 2WZR2 1FPN2 1HXS3 3VDDA 2GH8A 4FTBA 1AR92 3VBHC 1PO11 4RHV1 3ZXAC 2R042 5C4WB 5BNPB 2R071 1NY71 5C8CB 1PO13 4RHV3 2HWB1 2R073 4JGZB 3ZFGC 2HWB3 4QPGA 4IV3C 2WS92 1Z7S2 1RUF2 4CDWC 3VBHB 4WM7C 1EV12 2RS52 4YVWB 4QPIB 1B35A 1ZBA2 2WS91 1Z7S1 1C8M2 2WFF3 1MEC2 2WS93 1Z7S3 2RS51 5FMOS 1K5MB 1H8TA 1NCRB 4IV3B 5CFDC 4CDQB 5BNNC 5J96B 1PGL2 1RVF2 4WM7B 1TMF3 4YVSB 3ZFEC 1C8M1 5K0UC 1OHFA 1NOVA 2RR12 5A33A 5A32A 4CDUA 4PDWB 2WLPA 1NA1B 1HRI1 1RUG2 3CJIA 1PGL1 3ZFFC 1RVF1 4GMP0 4AEDA 1R091 1HRI3 4RR3C 1QJY2 1DDLA 3VBSA 1OPOA 1RUD2 2RR11 2FZ2A 1R093 2HWC2 5D8AC 5BNPA 1ND2A 1MQTC 1C8NA 2RR13 1RUG1 3DPRC 5FMOL 5JZGC 5K0UB 5C8CA 1RUI2 1R1A1 1PGW1 1ZBE2 2BPA2 3NAPA 1RUG3 5CFCC 1FMD2 2TBVA 1RUD1 1R1A3 1GFF2 1HRV2 1QJZA 4RS5C 3ZFFB 4N43C 1HQNA 2R062 4WM8C 4GB32 4Q4W2 1FOD1 1VBA2 1RUI1 1V9U2 5DDJ1 1ZBE1 3VBHA 1FOD3 3JD72 5DDJ3 1HRV1 2RM22 2R061 2BFUS 4GB31 4Q4W1 1HRV3 1VBA1 1EAH3 3ZFGA 3HAGA 1V9U1 4GB33 4Q4W3 4N43B 1AL0G 5C4WC 4IV3A 4WM8B 1ND3C 5J98B 2RM21 4CDWA 2X5IB 4CDXB 1NCQB 1RUJ3 4WM7A 4JGZC 1BBT2
chains in the Genus database with same CATH superfamily
5DXDA 1VBC1 4LK7A 5GLVA 1OC1A 2KXLA 2HWD2 3CDZB 3MUZ1 5FZ4A 2ZGQA 4RGGA 5IW0A 1FYUA 3EJKA 1TME3 4QQPA 1VBC3 4UBGA 2GNTA 3GF6A 5T5OA 4EN7B 3I3MA 1YCIA 4FFHA 3HOBA 4YW5A 5KC6A 4Y4YA 1N1YA 4YW4A 1SG3A 4Y5TA 4QPIC 3ZN6B 2E6VA 3GYDA 5BNNA 2BERA 2VULA 2LW8A 1AUYA 3TEXA 4A3XA 4TLFA 4CSWA 3WF2A 2HJIA 3ZFEA 3OGJA 5CB7A 5K0UA 1BLZA 5EJ3A 4M3CA 4E9KA 5JXHA 2WUHA 1A3KA 2VNOA 2R041 4YGEA 2VVEA 4AI0A 2ZGRA 5ACA2 5LW9A 4ET7A 3MUY1 2XKOA 2R043 4LHKA 4XF1A 4JZRA 3ZFFA 4LBQD 2VCBA 3H9AA 2UWAA 2BNMA 4AVBA 1DBNA 3RNSA 1PIV2 2GP5A 3ES1A 4M3CF 5L7OB 3ZO0B 4PHZA 3RYPA 5BV6A 4R4ZA 3N7LA 1Q8SA 1HW5A 3PVEA 4RQPB 1MQTA 1RUF1 2VMDA 3ROUA 5AC91 2XR4A 2WQ8A 2Y6GA 3OBAA 4GIQA 1VIWB 4LOSA 1CD3G 3LSEA 5FZAA 2OPKA 4DO0A 4YM1A 2RDNA 1JZ8A 5AC93 1RUF3 1J84A 2C26A 4YZ5A 2B9VA 2XKPA 2RS53 5FLHA 2OZ6A 5C3RA 1AL22 4LT5A 1A6CA 1WW4A 2Y64A 4NAMA 1W6NB 1YQ2A 3J9SA 4WM8A 1C4RA 5A3LA 2DFBA 3HT1A 1MEC1 3LSDA 4RFRB 5L73A 1RJ8A 3B7MA 4L92A 4LBJA 4IE4A 4NO4A 4YZ3A 1HLCA 5IT6A 5LEJA 4NHXA 2A6XA 3ECQA 1MEC3 4CEYB 3AKQA 4XIKA 2JICA 1G9BA 3MPPG 3KM5A 3AMQA 5JR7B 2HWF1 1Q8QA 2XBO2 3ST7A 3WW4A 3ZXFA 3J8F2 1QDCA 2W92A 4GQ7A 1KJLA 1QJU1 4QX8A 4DXZA 4YWAA 2YC2A 3KS7A 4XUOA 2X8KA 1MVEA 2W47A 3TEYA 4LBOA 4NPLA 4KG8A 4P00B 1QJU3 1JU3A 2ORZA 5TSWA 4KGGA 4I09A 1IQDC 1LCLA 3D5OA 1O59A 4M4RA 5LB6A 1EP0A 4XC9A 3BTAA 2YPJA 3RZHA 3H3UA 5FYYA 1R082 2IWGB 3L9JT 1ZRRA 4XJ9A 1BK1A 4AHYA 1TNRA 2ARXA 3WNKA 4DEVA 1NLRA 4P9WA 1W39A 2Q8DA 4JTOA 3U78A 4DPNA 2WO3A 2HWC1 2WNOA 1G9AA 5FYUA 3UKNA 2MEV1 1KEXA 1AR61 4COVA 2JECA 1GOGA 3ON7A 4Q8LA 2HWC3 2VW1A 3RS6A 5A1FA 2ZTNA 2E7AA 4CP9A 3ZN5A 1FMD1 4D69A 3EXUA 2G19A 3IKWA 3FN9A 4IV1C 4YW3A 5GLWA 4QDSA 3HQUA 1FMD3 3H7YA 4MV2A 1AXYA 4LO7A 3DKQA 4MXVA 4JQRA 2Y26A 3WP5A 3I54A 1K45A 2VCAA 2R063 2CDPA 2YROA 2WNEA 3AXDA 3SQOA 3QACA 5JOYA 4Y4RA 1V6KA 1NCRA 1CJPA 4M3CE 4C0HA 4UFKA 3N7KA 1F5JA 4Q4X2 4QQ2A 5I0TA 2WZPP 4B1MA 3ASIA 5J36A 5DN2A 4L2NA 1B35B 1OD5A 4CEWC 1SACA 2W9XA 4LKSA 3ZPYA 1H2NA 1W9SA 2ZA9A 2BJSA 2HYXA 4BQ1A 5A6XA 3ILRA 4UFJA 1VB2A 3KHCA 1DF0A 4XJ8A 4Z2AA 5HI0A 1URXA 2WIIB 4C90A 4XFBA 3MFCA 5I8YA 3W5MA 3FLTA 1ZZ6A 5E16A 1D7PM 4FBFA 2B42B 3GCWA 4CUGA 5A3TA 2QQKA 5FJKA 2GDFA 4ASKA 4EQVA 5FPUA 4XXAA 3TEWA 3AMNA 1CZVA 4MGSA 2A75A 3POIA 5LZ6A 5IHRA 1AYM1 1ZNPA 1BBT3 4BB3A 1W3XA 1YWKA 1QOSA 3ALQA 4NHMA 1AYM3 4WVMB 3HR9A 1VMHA 1F8VA 1OD3A 4NR1A 3WW3A 4A42A 5C9AC 1YLLA 1HB3A 2A6YA 3H1YA 4DRRA 3N9QA 1SMVA 4W4ZA 4JVAA 3BUCA 3L2HA 3JQWA 1SZBA 5DAPA 1D4M2 5C6CA 3WQ7A 2YGLA 5C8WA 2HYKA 4L99A 3R4UA 4BIOA 1J83A 4BH9A 5FYMA 1AR81 3O1VA 4QT6A 2ZGUA 2W2IA 1QMJA 3MV01 3R05A 1CPNA 4IE5A 1AR83 3VBOA 3I3QA 4CDUC 5FDBA 5FREA 3H8OA 4XACA 1W8HA 1LAJA 3LKJA 2QDNA 4RGAA 1BYHA 1DZQA 3KSCA 3GZUC 4GH4C 1OKOA 3LA7A 4D3WA 3U0ZA 1RMU2 2CNAA 2DVGA 4C91A 5FBZA 1UY4A 4URAA 4IEVA 5GALA 4UF0A 3SH3A 4XFIA 4OQ8A 2J42A 2PHFA 1J3PA 3KQRA 4UXAA 3VDAA 3WF1A 5IYYA 4Q2FA 3D82A 5JLVA 2D93A 1DGRA 1K3IA 3MLLA 4PLMA 2X5IA 3E5QA 1NCQA 4HN1A 1UZ0A 3KHBA 4HKWA 3ZFGB 3NNGA 2DV9A 4EE2A 4K8FA 2WYFA 4AVTA 4AW7A 3WSOA 2QE3A 1C28A 4CP2A 4HN0A 1NZIA 1HRI2 2VE1A 5FY0A 3UKTA 1U0AA 2Z79A 2PAKA 3LIHA 4GH4B 4DQAA 5A6ZA 2WQ4A 5JMCA 4XBQA 4GWNA 1BEV1 1OA3A 4JDNA 2FMYA 4FTSA 2XG3A 1QJX2 4OVEA 1MS0A 1VRH2 2NPIA 1BEV3 4CP0A 3THDA 1XYOA 4DUXA 1SPPA 4GA9A 1ZX5A 3A7QA 4MSVA 2BBVA 4RN5A 2W68A 3D3AA 2R0HA 1DQ1A 3VHNA 3ACGA 1VBD1 3E5XA 4QX0A 3J7HA 1UO9A 1H30A 5CYYA 1VBE2 1VBD3 2ZEWA 2VMCA 1VALA 5FY4A 5LA2A 4B4RA 4N53A 5A1AA 3WZ1A 1WMXA 1G7YA 4BLIA 1OT5A 2K0GA 1SHWB 3WHUA 4XCAA 4UW6A 5GZCA 2PAEA 2TUNA 1S4CA 4GJZA 4KMQA 1GMMA 4LEJA 2F6BA 3KZ4C 4AAPA 4SLIA 3WF3A 1G8WA 2CWSA 4XUTA 4DINB 3ACLA 3WDUA 2ZEZA 1V00A 4EJRA 3PU8A 1UZZA 4XW3A 3URFA 2EICA 3B5LB 3LPGA 3NNFA 4Y1YA 3ZVXA 5GJ6A 2IZWA 3I2IA 3VDDB 1RUJ2 3PVNA 5GLTA 5JZGB 2P3KA 2HEWF 2D44A 2LTNA 4HPKA 4META 1JN2P 4AEDC 4NIDA 3ZYGA 3VBSC 2ZMLA 3ENRA 3E5UA 5CFCB 1IPSA 2R1BA 4FAGA 4LJHA 1E5HA 1OA4A 3VHRA 5FO7B 1NQJA 4KG0A 4RS5B 1ODMA 3KQ4B 4COUA 1POV1 5KWRA 4Q27A 4FQZA 3IBMA 4H3WA 1CAWB 3ZYFA 1RB8G 2HWE1 3C7GA 5JOWA 2BU9A 1S2EA 1AZDA 3POBA 1POV3 3NAPC 4PQ9A 3S6PA 4RHV2 1LKNA 1I3HA 5FLIA 5H9QA 3GHMA 5IFPA 2HWE3 3RSJA 4COWA 2XPJA 4BMEA 4BQ4A 4ZU5A 2PYTA 2VZQA 3ZYHA 4SBVA 3VKMA 4IEOA 2CDOA 2CHHA 4XJWA 1WCKA 3VDDA 4AQ2A 2I45A 4UW3A 1JZ3A 2GH8A 5IVEA 5I91A 3DYOA 3RVHA 1YFWA 2MPFA 3VBHC 2ZHMA 1W6MA 5A7WB 5G04L 5F5CA 2V73A 2SLIA 2VTFA 4QWNA 4QDQA 2R071 5JMOA 2VBBA 4FFIA 3N3HA 2XVGA 2RE9A 2HWB1 5LBEA 3LEKA 2R073 3MO4A 4CA9A 1NE6A 1LOFA 2HWB3 3VHOA 5IVVA 2A6VA 4QPGA 1GP6A 3VZMA 5EYXA 5T54A 3KWVA 2ETEA 3Q8BA 3A4UA 1J1TA 1YEWA 3FHIB 5ANNA 3UGHA 3NWKA 3AFKA 3O1UA 4XFGA 4OQ9A 3LFIA 1I6XA 1W05A 1N47A 2ZGLA 3VBHB 5DG2A 2P3IA 5F8PA 3I3BA 4IGQA 1TEIA 2VZOA 1E5RA 4W6XA 1BZWA 2EIDA 3OEBA 1JOJA 2RJ2A 4Q0PA 3T0BA 1LESA 2GMMA 4LKEA 4Z2WA 2ZGKA 1W8UA 1Z7S1 2ZCWA 4XFCA 4LO8A 3RDIA 1C8M2 2WFF3 3WUCA 1PMIA 4LBLA 5FUNA 5JI7A 1S2KA 1Z7S3 2TNFA 3W58A 1K5MB 4KL1A 5CFDC 1ACCA 3SCFA 5IUQA 1UF2C 1CR7A 2XJVA 3T4VA 1CGPA 4IEQA 4CP1A 5KHHA 3WDTA 1Y9MA 4DXRA 2J1AA 4H7MA 3VZNA 1RVF2 5A7OA 2XQXA 4Y22B 2J1VA 5FKCA 1GSLA 1UYYA 5CZKA 1GICA 4FSJA 1DP0A 1QXJA 1GZWB 2E51A 2HH9A 2YU2A 3N9OA 4LITA 5H9RA 4N9HA 1ENSA 4FFFA 2EXJA 4I30A 1X82A 2WJSA 4IE7A 3QH7A 4CDUA 1FNZA 4PDWB 1H8VA 4H14A 1NA1B 1JU4A 3CJIA 1HJFA 4QGLA 5JDBA 3WW2A 4GMP0 1Y9QA 3O7OA 5FZCA 1R091 4E4DX 1H4GA 1QJY2 1W6QB 4RR3C 4LO5B 1IG3A 3PUHA 1YIPA 3BTZA 2FZ2A 1W2NA 1R093 2UWBA 4FO9A 5D8AC 4ZY9A 3H50A 1WBFA 2ARAA 3UJQA 1SLIA 5FMOL 3MHZA 1S0GA 2V5DA 1XNBA 3FE5A 3DXTA 4QXCA 5FWEA 1R1A1 5C8CA 3H3LA 3M3EA 2WZEA 1ZBE2 4ATFA 4KWJA 1PK6B 4KQ7A 2VC9A 1MS3A 2QZ2A 1R1A3 1GFF2 3NJZA 3EMRA 4DB5A 5DAVA 4MGKE 1O7FA 1FOD1 1VBA2 1O3QA 1RUI1 3K3NA 4YW1A 1V9U2 3H7JA 3C8XA 3Q9OA 1RJ7A 1A8MA 1FOD3 3HPNA 4NRQA 4KWUA 3SC7X 4EZHA 1CZTA 3Q8AA 2DU1A 5FZDA 1EUTA 3I8TA 1F4HA 2BDRA 4IEUA 2W46A 1QJEA 2EIEA 2VZUA 4Q4W1 3U11A 4TSVA 1ZZ8A 5E8AA 4AWDA 1EAH3 1W9TA 5IK8A 3HAGA 1TZOA 5IAVA 1XQNA 1DG6A 3WF0A 4CCMA 3VD5A 5FWJA 4Q4W3 3C7HA 3V0AB 1DIWA 3O0VA 4BXFA 4NIGA 1SBDA 2VOKA 1QH7A 2QJVA 1N1VA 3OY8A 5FZ9A 4AAXA 4CTEA 1DGWA 4IGPA 2RG4A 3PVBB 3PL0A 3MLKA 2BGPA 2RM21 3E97A 3QD6A 3NW4A 3OSDA 1LOGA 2ZX4A 2KD7A 1Z0HA 3AZVA 1O91A 2DCZA 1DZRA 5ERLA 1JW6A 1DHKB 2CTVA 2DFCA 2WNUB 4JKKA 3LPFA 2XJPA 3NV2A 4EWDA 3BOPA 1UYZA 3KV5A 3P5BA 3KB5A 1QDOA 4FPGA 1MPXA 3DL3A 5KHIA 3N9LA 4FPKA 1ZZ7A 4HT1T 3P6BA 4HVQA 1JYXA 3ZMOA 1US3A 3LOIA 4YVWC 5F6LB 1QXPA 4QGMA 3OGSA 1OURA 3OYWB 2XHKA 2HWD1 4JGYC 1QKQA 1PHMA 3I3DA 3LEMA 1MS8A 1FPN1 1S0EA 4L9BA 2TEPA 4LPLA 1RUC2 5IATA 5KXCA 3SISA 5DZEA 2O8OA 2Y38A 1NKGA 2JDZA 4L97A 4Y5SA 2HWD3 3VBRB 2BNNA 5FP4A 1AR91 4OI1A 1FPN3 2P4EA 5DMYA 2P6CA 2VVFA 2NLRA 3WV6A 4YM0A 4CDQC 1KRIA 1AR93 2PQSA 3LE0A 5BNQA 2E7TA 2P34A 2E33A 4K8RB 4KU8A 5F7UA 2VOXA 1KFXL 4YGDA 4AR2A 4XZPA 3JBG2 5F5IA 1CJDA 4D7YA 5HXMA 3MDPA 4AEKA 2WC2A 3K3OA 4FP2A 1OPMA 4YVSC 4A41A 5IFTA 1W03A 5L9VA 4DXTA 1JTZX 3ZSJA 4FP3A 2DVDA 2QZ3A 4JGYB 4ZS2A 2WKKA 1D4VB 1Y4WA 2JB4A 2ZKLA 1APNA 1NT0A 3VBUC 2GC3A 5ACA1 2BUKA 4LHLA 3PMSA 1IS5A 3DPRA 4JRLA 4YPJA 1H1IA 3OG2A 4AYUA 4EWEA 5ACA3 1EV11 3SXWA 1PMHX 2DBNA 5EHDA 2D5HA 4JV4A 2SBAA 1EV13 2DU0A 2W3JA 1W06A 1OH3A 3WNXA 1JZ6A 2Z5WA 5A3WA 2H0VA 3AZZA 3DYMA 3USUB 1CAVA 4AI9A 4BZ4A 1YQCA 1P8JA 1JXNA 1X8EA 1LHWA 2ET7A 5ABJB 1QF3A 1YNAA 3VBUB 1DCSA 2V4AA 1Q8VA 3DECA 1AL21 2PHRA 4OHXA 1VB4A 1W90A 4IEWA 5K7PA 3APBA 5GLZA 5IWFA 4NJ4A 2XJRA 3ITQA 5HXVA 3VHPA 4D7TA 3NV4A 5FOBB 1YFYA 4WZCA 3IDEA 3MICA 3SITA 4UW5A 5C4WA 2R1DA 1I5ZA 2P3YA 1VAVA 1F5FA 1ULOA 5GZEA 1VR3A 4QU2A 5FYIA 1RYYA 1I5PA 4Q4Y2 2D3SA 5FJHA 3THPA 4DUVA 2ZGMA 3ZXJA 2D97A 4JGZA 1WUVA 5F3IA 2A71A 3R4DB 4RFT0 1A8DA 2E26A 4Y20A 1RUD3 5CADA 3UESA 2OYZA 1SFPA 4AQ6A 4CCEA 4AEJA 4YW6A 3CQOA 1OH4A 5DABA 3ZDVA 4AF9A 1R081 1XPWA 5FCCA 4CDXC 5BXXA 1QNWA 1POV0 2JG9C 4COZA 1I1EA 2LM3A 5LA9A 2GU9A 2G9ZA 2I2SA 2YMZA 5JXJA 1ASJ2 4QPIA 1R083 3WQ0A 3RZGA 1UOJA 2ADDA 1NX9A 4YZ4A 4Q0UA 2B9UA 2BOJA 2DUOA 3NSTA 1G86A 1WD3A 3U14A 3VB9A 4FQ4A 3THCA 4G4FA 4KWLA 3ZSLA 4FOVA 4F8AA 3H3ZA 2CGNA 5KHJA 3ZXKA 4OHYA 1NQDA 1LOCA 3IIAA 5C3SA 5FKBA 3V0BB 1W2TA 4U36A 3PIJA 1YI7A 5ANQA 5JUVA 1I9RA 1UYPA 2EXHA 3N7JA 3MW4A 3J26N 1UXXX 4K21A 4I3GA 3UYJA 1UY3A 3V65A 2PELA 4HSLA 3I2FA 3GBFA 2VZTA 3WQ1A 1GWMA 1N1SA 4BYYA 4QKFA 2WNVB 5CG8A 4QKDA 2A3WA 4Y1ZA 5BUVA 1A34A 4AK3A 1H8TB 3O1OA 4JCKA 5J48A 4NPMA 4Q4X1 2KR2A 1S0BA 3FWEA 1KS4A 5CKMA 3WCSA 4CCJA 2FMDA 4AEMA 2NYYA 4FPCA 4Q4X3 1W6OB 4FPLA 4HOOA 2X10A 2PHDA 2ZGNA 5FY8A 1HKDA 2ZMNA 3AFGA 5CU1A 2JDYA 2PAMA 2PHXA 5A32B 1CAXA 1BMV2 5L7OC 4DOUA 1DQ0A 2C6SA 1GLHA 5K4LA 1NXD1 1NLSA 4AZZA 3CBNA 3QH6A 1UWWA 1SQ4A 2FCVA 4RQPC 3WDYA 4FPFA 4FI9A 2D6MA 2VU9A 1WCUA 3SLIA 4B8EA 1JZ5A 5AFEA 1RHI2 3HNBM 5LY2A 1AYN2 3HN1A 3SNMA 2IFRA 5FYVA 3SCHA 3BKZA 3HJRA 2Q8EA 1TQ5A 3S7EA 1PNFA 2CWMA 4A3ZA 5JCTA 1ND2B 3IDBB 3KV4A 4Z07A 3ZKUA 1CZSA 2QQNA 2VZRA 1JZ7A 2PTMA 3POEA 3I59B 5I8TA 5FZMA 1AXZA 2Y6KA 1UY1A 3M3CA 1YFUA 2Y6LA 5FPVA 5FZEA 3UGGA 4HMZA 2JENA 4CEYC 2ZHKA 3JB4C 2VOVA 3NKTA 5FO8B 2AEZA 1LECA 1UPSA 2VVDA 1XNCA 2ZX0A 2FBEA 4MXWA 1C5IA 4KBBA 2BGCA 3ZMNA 3X29B 1AJOA 4CCLA 1D4M1 3H1MA 3S5AA 2XXZA 4D94A 2IXJA 4S2HA 2PHUA 2VCCA 1DFQA 3IWZA 4XABA 2X09A 1QQP1 2UWCA 1D4M3 5LRRA 2XUMA 1W8WA 4J25A 1REDA 1TG7A 4UT5A 5B4XA 2WN2A 4BISA 1TMF2 4HVOA 3VN4A 1QQP3 3VBFC 5DAQA 3GBWA 3VD9A 4FPHA 1CX1A 3N36A 4JDOA 1AR71 5F39A 5KXDA 4ATEA 3IT8A 3LEIA 2XQRA 4JHTA 1IKQA 5A7PA 2AH2A 2Q30A 4OLLA 1ZRDA 2XL9A 1RMU1 1YUDA 1AR73 4IV1A 3WNLA 2P1BA 3OBTA 1UPIA 2YPDA 2AZ5A 1NZCA 1RMU3 3MIFA 1YJLA 5IJRA 2BWCA 1GBGA 2HWF3 2QNKA 4CDWB 2AENA 2Y0OA 1OLME 2J7MA 4QHBA 1FI2A 1ZRIA 3MIBA 2O14A 3TNQA 3A0KA 3VBFB 2GNMA 3RPQA 1OKQA 3GGLA 5DZGA 5IK4A 3SCGA 1OI6A 1QU0A 1F15A 4CEWA 2PA7A 3RFRA 1UOBA 2Y8KA 3SEPA 4D7SA 1DQ2A 2ORXA 4OCTA 2Z4FA 1F2NA 2QDRA 1XB9A 3PLQA 4QPWA 4XPVA 3HNYM 1B09A 4QM8A 4WVMA 4INDA 5JIAA 2Z69A 3WHTA 1J3QA 5AFBA 2FDIA 2WAOA 1KDMA 3VZOA 4WVVA 5BNNB 1QJX1 1B35C 1VRH1 5HPOA 3AMMA 4XUPA 5JSRA 2YB7A 4YZ2A 2MEV3 4XF0A 4Q4V1 3OGGA 3ZFEB 1AR63 1UX7A 1O8SA 4B7KA 1QJX3 4BCUA 1XE7A 3WP6A 3I2OA 1VRH3 1Q56A 1STMA 4IW3A 5ISLA 2CAUA 1F35A 3FJSA 5KXBA 4TLGA 4Q4V3 5DDJ2 4K7JA 1OSGA 2YGMA 3ETPA 4GMP1 5FZ8A 4AL9A 3ACIA 5FYBA 1ULFA 2ET1A 4O61A 3NL1A 4MYEA 5FYHA 5JXIA 4NUBA 1V6JA 2RDQA 4GMP3 4Y5Z0 4LBNA 3ZYPA 2VY0A 3LZZA 2J1SA 3T09A 2B7YA 5C9AA 1V6LA 5F3GA 5CKNA 1PO22 5CEHA 2D40A 1VBE1 2YFUA 1PX4A 2WO7A 3GJAA 4HL0A 4IETA 3VDBA 2X05A 1JYTA 4P9IA 3D0SA 2BP6A 3BGAA 1VBE3 4M0HA 4NE9A 4LBQB 1MQTB 1PGSA 4JKMA 3AM2A 2K9ZA 3UETA 3NRUA 3PUAA 1PVXA 3RG0A 2V5YA 1SEFA 1HN1A 1IPKA 2YV8A 5DPNA 3WG2A 1LGNA 4B4QA 5LA0A 2W5FA 2XOMA 2CY6A 2BYVE 1TME2 1VBC2 4R52A 4XTPA 4UFLA 4NRMA 2E9QA 3I4IA 4C0BA 3RJ2X 4DXSA 5BNPC 2R49A 4XQDA 1RUJ1 3WXPA 2PN5A 2I07B 4ZU4A 1U5ZA 3WDVA 4MUVA 2XWBB 4GH4A 4B4PA 2WO1A 2A3XA 1UIKA 2RS11 5BPXA 4CU9A 1RITA 4F83A 2VNVA 1W8OA 3K2OA 5FZ6A 1NY72 1PNGA 1MVQA 2D5FA 2AYHA 2AACA 2VBDA 3LDBA 3U75A 2RS13 4B29A 1UKRA 2D6OX 4ZPIA 2VZSA 2W95A 2WBKA 4XFFA 1MR5A 2VUCA 2VQTA 3TBDA 1WCSA 2PXJA 1UN1A 1W0NA 2WN3A 4XBLA 2WDBA 4RHV1 5FXWA 3RJRA 1ONAA 2R042 3KV9A 4IQPA 3O14A 4LE3A 4XILA 4AVAA 5BNPB 3VUOA 1LHUA 4RHV3 2UY8A 2Y6FA 1GWLA 3INAA 2OT7A 5CBLA 3OUHA 1IGOA 4HANA 5C7GA 1QH6A 1XNTA 3ZFGC 4E27A 1SBEA 4L8QA 4UFMA 1GR3A 4YG3A 3CLPA 2OQ7A 4FT8A 1LOAA 4XYXA 3P1IA 4Z82A 3N9MA 1UOGA 3IDCB 2XL7A 1AX0A 1RUF2 2DCTA 3T0AA 2DCKA 4FPEA 4CP9B 2UYAA 4XDQA 2DYCA 2RS52 1VE0A 3LGRA 3ZKYA 4YZ1A 2KM2A 1AXKA 1AJKA 2PHWA 3SKVA 2EALA 3UGFA 5FR3A 3EB7A 4UAPA 4K20A 3TWIA 4QDRA 4XZUG 1MEC2 1VMFA 5F37A 1WD4A 4JRAA 2WWJA 1XSQA 1NCRB 1QEXA 2GP3A 5KC5A 3JCIA 3MF9A 1DLCA 1C3HA 4XURA 4OZOA 5D2AA 5FMDA 5I8SA 5J96B 3WVJA 1UQXA 3KGZA 3WP3A 3S0MA 2NZ9A 2JJ6A 4ZXKA 1BK0A 3WW1A 3OUJA 3DEMA 2OQ6A 1C8M1 2XLGA 1H2MA 1ZZ9A 3BALA 4KI5M 1SLBA 2XLFA 5EPAA 2GC0A 4MGZE 4NRPA 4NHLA 2RR12 3VDCA 4YLZA 1O3RA 2X29A 4V1PA 1LR5A 1O4ZA 4YARA 3NJXA 5EXOA 2WLPA 1IQAA 2Y6JA 3O1MA 1KD7A 1UIJA 4XQWA 1QOOA 1X9TA 4AGGA 1RVF1 3D6EA 3MGUA 3ILNA 1W6PA 2GNDA 3I7DA 4AEDA 4M01A 1ULDA 1XBFA 3WNPA 1XE0A 2JE8A 3F95A 3VBSA 1JYVA 4P14A 4E8CA 3NJYA 2WSVA 3AK0A 1GUIA 2OA2A 2HWC2 3T2PA 4OUSA 1ZRCA 2GC2A 4PI0A 3TAYA 5JZGC 3POJA 3DF0A 1RXFA 4BQ3A 1PGW1 4BM8A 1AX2A 1X8MA 3LF7A 3NAPA 4J6GA 1H9PA 4GULA 4HKOA 1CIWA 1XNAA 2NMOA 5CFCC 1FMD2 5CVRA 4NVPA 3C7FA 3M70A 3MZHA 1HQWA 1HRV2 1MZEA 3QOPA 4RS5C 4N43C 3HIFA 3ZR6A 1HQNA 4ARXA 1JYWA 2R062 4C1XA 1W8NA 3HBKA 4GB32 4NAOA 3TRSB 1C57A 1OA2A 3WD5A 2VECA 2W0XA 5DUXA 4Q0SA 1ZBE1 3UNPA 1LEDA 4A2UA 3VBHA 5EJ1B 4IE0A 2OZJA 5F1RA 2EIGA 4PI2A 1JH5A 2FCTA 1FT9A 3IN9A 1N3QA 2VXRA 1WKYA 4PF1A 1YI9A 1W04A 2BTVC 3NNMA 5FXXA 2D6LX 1VBA1 1WA6X 3BB6A 1V9U1 2ATFA 4QX1A 4LORA 4UF0B 4N43B 3T2QA 3IMMA 3C2UA 1ND3C 1MS1A 1JMUB 2DDUA 4KGQA 4K9SA 2VMFA 2QCSB 1O4TA 4IEZA 1UY0A 1OQDA 4ISQA 3NKGA 1NXMA 3OOXA 2X5IB 1FAYA 1BHGA 1NCQB 1POQA 1Q3EA 3IMNA 4YYOA 4CCNA 4XAAA 2D3RA 2GALA 1BBT2 1OXCA 3KVAA 4UWDA 3U4SA 2ZXQA 1GZWA 5FZ3A 5IK7A 1IS6A 2XWJB 4P08A 3ZN4A 2VUJA 3AZWA 1AYM2 1WCDJ 5EP9A 4E2QA 1OOPC 3OCPA 4XHXA 3ZYBA 4CE8A 1WWYA 1FV3A 1LB2A 2VZ1A 3FUQA 2Q8CA 2VPVA 5KR7A 2XJUA 3B00A 5CFDA 1FX5A 1SLTA 1ND3B 1QGLA 1W6QA 5FQ0A 1MS4A 4IEYA 2PFWA 2WZR1 4IESA 4ASMB 1SPPB 1O4YA 2OPWA 2BRTA 2ZJCA 2RJKA 1HJGA 3GALA 3JZVA 3QBQA 4R9CA 4RL7A 2LRPA 2WZR3 1K42A 3RZZA 5JXGA 2RS32 2VM9A 2E7QA 1K5MC 1IKPA 4AG4A 2QQMA 4OUMA 3AXEA 4P9JA 4B7EA 4DRVA 1AX1A 2ZZQA 1OOPB 4BIFA 1N3OA 3VKOA 1BKZA 1RUC1 1QHDA 4LE4A 1W3VA 5FXZA 2JKXA 3O0WA 3WY6A 2JG8C 4RR3A 2JE7A 1CX4A 4N53B 3PJYA 4TZDA 1Y7BA 2XGXA 4Q1PA 4EV0A 3RI8A 5D8AA 2QQPA 2WT1A 2ARBA 4PDWC 3AP9A 3ES4A 1HB2A 1NA1C 2LS6A 1BVVA 3HWJA 3C7EA 4HBNA 4LULA 1LHVA 2D7FA 5FP7A 2G9GA 5FZBA 2C9AA 3JBG1 5A6YA 2JD4A 3OEAA 5C3OA 3O1TA 5JSPA 1LTEA 1CESA 3JBG3 3MW3A 1DYKA 4XF3A 1ZBA1 3VZLA 3H8UA 1OUXA 5J37A 1GP5A 3FUOA 4JTNA 4M4PA 4NPRA 2FDHA 2ZAHA 5E1RA 4HZFA 4Y24A 5HBAA 4AVVA 2JG8B 2OS2A 1ZBA3 3P3NA 4HPKB 4IGOA 3U37A 4ZHNA 1Y3TA 1ZM1A 3MV11 3WINE 1Z78A 3BPZA 4K3UA 4BWOA 4DS0A 5IVCA 4D6RA 1MS9A 1BEV2 1PK6C 3K75B 2DURA 5LK5A 5FAXA 4CXWA 5C71A 1GQHA 3BTXA 4QD2A 3WEZA 4IUGA 1CWPA 2B4KA 3N7MA 4TXWA 4JHZA 3TB0A 5FK7A 1WZXA 2A7AA 4XQ4A 4W8JA 3B01A 5FPBA 1S0CA 2Y60A 3KV6A 1UU5A 1VAKA 3ORJA 3FZ3A 1GQPA 2ZGSA 4XE9A 2R7EB 4F3JA 4WVWA 4CXXA 2A3YA 2VUDA 5FYTA 2A6WA 4QX7A 4CU7A 2IC1A 1WMDA 4QGNA 1XXNA 3MI8A 3BYWA 3EYPA 1U5YA 2IFWA 2HLEA 2BW8A 2ERFA 4RYDA 1OFNA 2Z2SB 3AKSA 3AB0A 5I0UA 1PZ9A 1WLDA 3ACHA 3HD8B 2FDGA 2QQLA 4HETA 2W1UA 1W6MB 4JDMA 2DUQA 3BU7A 4HLTA 2QQIA 5H9PA 1JUIA 2VMGA 1GNYA 4MOAA 3WG1A 3U07A 2UU8A 4K6BA 3N4MA 3MPBA 1J3RA 1KDKA 2G1MA 4YGCA 1YO8A 4QX5A 4YM3A 5LCWL 2D6KA 2GN3A 2VQUA 5F32A 3T2TA 5F5AA 3MW2A 1RUI3 4Y33A 4YVWA 4DUWA 4IXLA 2LUWA 4QPGB 4XCBA 1QJFA 2B8MA 4X6RB 5SV8A 2WNUC 4JGYA 2A1XA 3A0NA 3UKVA 5AVAA 2Y33A 3NJVA 3FMGA 5FY1A 1AHSA 1W0PA 1UZVA 4MZUA 5F5QA 1FXZA 4RGKA 4PCRA 1GU3A 4S2DA 1VMJA 3PVOA 3RYRA 4OZXA 2WQZC 2FDFA 2HEVF 4CDQA 3JD71 4XOGA 3BU0A 4H55A 3DCQA 5GZDA 3RI9A 1OF3A 4E4HA 1X7NA 4YRDA 2W1QA 3JD73 2VJXA 2OX0A 4YVSA 4NOTA 1H0BA 1GYKA 1LHNA 3VBRC 3ZPOA 2HWE2 2ILMA 2RM23 4JKLA 3GXUA 4LO6B 5FZOA 5A7NA 3USUA 2B5HA 2GN7A 2RDRA 3DV8A 1W8FA 3OTFA 2OIIA 1NYWA 3POYA 4IE6A 5JPMB 2YHJA 2RMU2 3H1WA 3VBUA 3AP5A 5GKAC 5DUUA 3KT1A 3E6BA 4LKFA 4I0BA 2WA3A 2BVVA 3FLRA 1O3TA 3IM0A 3MYXA 5LRSA 3KMHA 3WNNA 2BFUL 3KT4A 1UU4A 1MZ5A 3AC0A 4PLOA 5I0DA 2W52A 3AKTA 2R072 3W59A 3CJIB 2AC1A 4NROA 4HSJA 1PM4A 1ENXA 2HWB2 3IAPA 1CAUA 3B02A 1V6MA 2ZX2A 2F4PA 3CO2A 2DVBA 1VBB2 4ITCA 2C5DA 1D0GA 1EYBA 1RUE2 4XBNA 2Q8OA 3A22A 4Z1VA 1BMV1 2Q5TA 3HNMA 3FFZA 1UOFA 4C1WA 2XONA 3IPVA 4YFWA 2XB6C 3Q8CA 1WLCA 1JHNA 4MGQA 1E5SA 2DCYA 5BNOC 1RHI1 4FTEA 1AYN1 1Y43B 2EXIA 3K51A 2ZOEB 5ABJC 4FPJA 4GKYA 3B9CA 4FXKB 2QKDA 2WSUA 4XIOA 4XVHA 1RHI3 4O65A 2WFF2 2VOTA 1AYN3 3NNLA 4AQTA 4F7ZA 1COV2 1U5XA 2Y6HA 1PIV1 1XNDA 2Q1ZB 5A3NA 2D43A 4LUMA 4LLFA 1C1LA 1OF4A 5GZGA 1PVC2 1PIV3 1HQLA 2B46X 2E32A 2F17A 3OJBA 3GCXA 4XDPA 2BOIA 4Q8KA 4EROA 5EJZB 4R8HA 5BNOB 1LODA 4ZU7A 2FQPA 4CDXA 3HQRA 4FPOB 1X50A 2JG9A 2WFPA 2ES3A 3A23A 3KF5A 3LEGA 3JXSA 2PLV2 4N7UA 1KQRA 5FLJA 4CZSA 5FY7A 4PT6A 3M2MA 1BCXA 2QQOA 1TMF1 3ZSEA 2NQYA 1JS9A 2IXKA 1V6OA 4HXCA 2VUAA 3BVCA 4LUKA 2A6ZA 4ES8A 1AL23 3W5NA 3KCCA 3M4FA 4KU7A 5FIXA 1H9WA 2XVKA 4QXKA 5L9RA 3DYPA 4Q1RA 5A3UA 3NVCA 5A7QA 4AGVA 1M06G 2JEMA 1R092 2QUOA 1RUH2 2CV6A 2VTXJ 2XJTA 5FZIA 1Y9GA 2A5ZA 5L9BA 3SKJE 3T2OA 4BDVB 4CU8A 4AI2A 3ZN6A 1T6GC 2XBO1 3LWCA 2O8QA 4LTAA 1SLLA 3J8F1 4FCAA 1LHOA 1VPHA 2DF7A 2UURA 4XMAA 3ZYRA 1O8PA 2XBO3 1GOFA 4ZXEA 3J8F3 1R1A2 5HV0A 4GXLA 3NNJA 1YQ6A 4TTGA 3ZSKA 2ZX1A 1IZ3A 5FK8A 3GZTB 1TVGA 5FMCA 3B9IA 5C3PA 3N9NA 3ZIXA 3C3VA 1JYNA 4CPBA 3OB8A 1W28A 2WNVC 1FOD2 3M3QA 4DFSA 1RL3A 4EN9B 1ALYA 3ZXLA 1H8TC 3A21A 4IL7A 4KBZA 5L7OA 5CKQA 3BIEA 3ABZA 1EPZA 4XAEA 2A70A 3TN92 4LNVA 4UBHA 1JZ2A 1OLMA 4N7IA 4RQPA 1EAH2 1UKGA 4AHWA 4N8MA 1REFA 1RC6A 2ZEXA 2W08A 2VTXA 2JD9A 4LA2A 3K48A 5JOZA 4HG6B 4BA6A 3JB8A 2ZHLA 4P9XA 2VXJA 1W6NA 3R0RA 3DPRB 1XU2A 2WYSA 3SH5A 1M4WA 4GAZA 5I93A 2ZABA 1GQGA 5FOJB 2QVSB 5J09A 3G7DA 2E63A 3CU7A 5FPAA 4V2WA 1PO21 4DEQA 4CEYA 1HXS2 4URTA 4LHSA 4QKNA 1PO23 3AYEA 1YQ8A 3H0OA 3MBWA 4KH9A 5T5PA 4E2SA 1ND2C 2EIBA 2J1RA 5BY5A 5IVBA 5J3UA 2E31A 4G9SB 1CAVB 2R0FA 2G9FA 4NN0A 3WDWA 2E53A 5A33B 3CEWA 1PZ8A 3M3IA 2JDHA 1N1TA 1PO12 1G9DA 3O1PA 3RYKA 2EVXA 2HBTA 1TME1 4NIAA 3VBFA 1WCQA 3BIWE 3OPWA 3MIEA 4UOJA 3AZYA 1FPN2 4W6WA 3VKFC 1OVSA 1VRBA 2PQQA 1GANA 4FTBA 3U1XA 1AR92 3OUIA 3FL7A 5LASA 4LR4A 4S2FA 4E8DA 5T50A 3WNMA 1GZ9A 5C4WB 5C70A 5LY1A 4JAAA 5I0SA 1NY71 4XFAA 1PMJX 3K4ZA 3E1F1 4XJUA 2XJQA 2P17A 1CQ9A 1JUHA 3LDRA 2MHFA 4JGZB 5HCAA 3PURA 1SCSA 1ULPA 5APAA 2DUPA 2FDKA 2W87A 1W8ZA 2H6CA 4IV3C 2WS92 4Y20B 1W9YA 1SBFA 1AF9A 5A3PA 1BJQA 1V6NA 1L3JA 4K40A 2BBAA 3T08A 3GZAA 4BMBA 4YFZA 1QXRA 2VGDA 5GZFA 3WLUA 2QQVA 4CDWC 5IVFA 3GNEA 4IEPA 4WM7C 1EV12 2AUYA 4PBPA 3EHKA 4PJYA 4MG2A 4YSFA 4AHZA 1RGSA 2C1FA 1US2A 3CL1A 4QPIB 1U12A 3M7AA 3OD4A 4A45A 4YG6A 3CF6E 1B35A 3ZSMA 1DGRN 4MVTA 5IK5A 5IVYA 1LU1A 1SDDB 2ZGOA 4BPZA 4LBQA 1UW8A 3TOJA 4AXOA 2ZKNA 1J59A 1ZZBA 5EZWA 1OVPA 2D98A 2NMNA 2RS51 1JBCA 4IV3B 3E6DA 1DU3D 3OPZA 2GZWA 4FPYA 1F31A 3BOWA 4ZKTB 2WAAA 5BNNC 2VO5A 5JIUA 2JE9A 2IXIA 3PTYA 1PGL2 2VMEA 4HK9A 1D0HA 4WM7B 4XF9A 3RWNA 3ZFEC 5FYSA 3OGVA 3FLPA 4HVRA 4TYSA 3VD7A 4EN0A 5K0UC 1OHFA 1UY2A 3CMGA 4OHZA 2A73B 1NOVA 5EWSA 3S7IA 3GJBA 4Y1UA 5FRAA 1JOPA 2C0ZA 3VV1A 1CPMA 2ZAAA 2YBKA 2YZ4A 4LK6A 1JODA 3JUUA 4BLJA 4MGIE 2ZEYA 3O1SA 4E4ZA 1HRI1 1ZZCA 1RUG2 1NUKA 3ZFFC 4DMIA 3K4AA 1GP4A 5FZGA 1KS5A 3E6CC 2NP0A 1HRI3 3POGA 1DDLA 2XMLA 1WLWA 3MEPA 1RUD2 1ZYBA 1CAXB 5CG9A 2RR11 2BVBA 2VZPA 2HBUA 2AGSA 5BNPA 2RR13 1MQTC 4D6SA 5K0UB 2IVIB 1PZ7A 4M3CB 3PUIA 2Q4SA 2VMHA 1XE8A 4JX0A 3PIGA 1IS3A 5LEKA 2VW0A 4TWTA 2UYBA 2TBVA 4AI8A 4W6YA 3LD8A 3V64A 2YUEA 1CVNA 5LWBA 1QJZA 4LHNA 3W9AA 3ZFFB 5IAXA 1ZA4A 5LA1A 1T2XA 4WM8C 3LOBA 1IOAA 1W9WA 4A6OA 5JAXA 3RGBA 3I2GA 5E89A 5CAZA 4YNIA 4D0QA 4CCOA 2R30A 1W2OA 3OBRA 5FXVA 4DZGA 2PHTA 4QXHA 5KBFA 2LALA 1HRV1 2ZGPA 1WW5A 4MXWB 3VLBB 5CA6A 4PIYA 2V72A 4R9AA 2JDNA 2FHRA 2R061 2WO2A 4A4AA 4GB31 3NV3A 2D6PA 3WUDA 3POWA 1HRV3 4XF4A 2V09A 1BQPA 3ZFGA 2IUWA 5T52A 5I0RA 3BI3A 3ZXDA 4GB33 2J1UA 1G6NA 3IZOA 1H2KA 4AGRA 4WM8B 1GNZA 1IPJA 1O5UA 2VZ3A 2R16A 2YC4A 4LIVA 1DQ4A 4LMFA 2JIJA 1HB4A 1RUJ3 1T6BX 2O0OA 4P9LA 1JHJA 4GALA 5F3CA 4GWIA 4OYUA 5BYNA 4Y1VA 5B2GB 2XLAA 4IV1B 2Q0AA 4Q5OA 4A44A 2WR9A 4CUBA 1REEA 3N9PA 5L36A 5EYYA 1C1FA 1H6YA 3GDBA 3O0XA 1LGCA 2B39A 3AX4A 4Y1XA 4MADA 2J1EA 1MS5A 1GZCA 2IXLA 1JOBA 3AYCA 3T1LA 3PDQA 4GZ9A 4R9DA 3GHNA 3T4HB 1BBT1 2XDVA 2GMEA 3I2DA 3DKWA 3U10A 1UD1A 3EBRA 4CEWB 3WX5A 3ZXEA 5F9TA 4ZZ8A 4GD4A 2W94A 1MACA 2JXAA 3FHQA 5EFUA 1SLCA 5FTTC 3SMHA 1UX6A 4AFBA 1X36A 2PMWB 1JYIA 1KXGA 1HIXA 4OHVA 1K12A 2ZS6B 3ZOIA 3JU9A 4BE3A 5C3QA 1NCRC 4A6SA 4QAWA 4UFIA 4X8PA 4LKDA 1D2QA 2RVAA 5AC92 3FX3A 3MIDA 4AFDA 3GBGA 4FXGB 2OKXA 4QHOA 4QHZA 5KHGA 1XNKA 5G05L 1WBLA 3MIGA 1OQEA 2VG9A 4ISRA 4BQ5A 4G3YC 2WT2A 1U5IA 3BODA 4EWAA 4M00A 5CISA 1QQP2 4PF5A 2RS31 2RDSA 1O5LA 5GM0A 2F4LA 2YBSA 2Y34A 3M1HA 1QIQA 4X8NA 3OF1A 4AOCA 2RS33 2ZX3A 1O6UA 2VNGA 4L0PA 5JZGA 5T5JA 5FFOC 4FOYA 3AKPA 3VD4A 3J7LA 1AR72 4GJYA 2JKBA 5C9AB 3PU3A 1G9CA 5CFCA 4YG0A 1OLRA 3PNAA 1AVBA 3I2HA 5B4NA 1E57A 3UJOA 3DXUA 1IHMA 4LQRA 3VGIA 5KXEA 2HWF2 4RS5A 3J7NA 4N43A 4J1XA 3JQXA 1QJU2 1QNYA 3FBMA 4AHXA 4QB2A 4O9EA 1CN1A 1PX3A 1CAWA 2DWRA 4MGYE 3ZLIA 3F2ZA 3KVBA 3OBZA 3PHMA 3ATGA 5DAWA 5FPLA 1BXHA 1UYXA 4HKLA 5FUIA 2YBPA 1C8M3 5JI9A 4NHYA 4U2AA 5GLUA 3AYDA 4MHRA 3J4UH 5JOXA 1YIFA 2EAKA 4QMAA 1HN0A 4WVZA 1S0IA 3ILFA 2YDEA 2PHLA 1J1LA 4NIIA 2ENRA 3HT2A 3VZKA 1S2BA 1E5IA 2Z42A 3NO8A 1YQ5A 2JB8A 2WA4A 5FPZA 1RVF3 4Y3OA 2Q1MA 4K1ZA 4AVSA 3I3EA 2BQPA 2IVJA 1CONA 5A7WA 2CGPA 2MEV2 4RSUA 3GZEA 1ND3A 1AR62 2OUJA 3KCXA 3AP4A 3VBOC 3T30A 3W21A 5AVPA 5LK7B 2C24A 4Q4V2 2QBXA 1QJY1 1GV9A 5FP8A 2YXSA 1GZTA 3B94A 3C7OA 4XUNA 2XH6A 1Q8OA 1Q43A 1WLTA 3ZXGA 1NLQA 5LBFA 2MNGA 1QJY3 5E88A 2QFEA 4ASLA 1ODNA 1W9FA 3VL9A 3WOGA 5HCFA 1A78A 1OOPA 3QLQA 4FOQA 5D1IA 1UMIA 4P9YA 1DQ5A 3LFMA 2X5IC 4ZONA 1NCQC 3I2KA 4OMDA 1FATA 1YFXA 4KWKA 4QPYA 5FZFA 2H0BA 1UCXA 1W2AX 1DZTA 2DVAA 1DQ6A 4QU1A 3LAGA 3RRDA 1ZBE3 3VBOB 4GWMA 3OGRA 4BQWA 2VOWA 4H7LA 2ARCA 3Q8EA 4IEXA 1S0FA 2O1QA 5A1LA 5FZHA 3ME2A 3WQBA 5F2SA 4NWVA 4ZZ5A 2KA3A 2W39A 3ZDSA 2ID4A 1HX6A 2CU5A 5IVJA 1HDKA 3HQXA 1K5MA 1VBA3 4XUQA 1VAMA 2NM1A 4CCCA 1V9U3 4CUCA 3BCWA 3O12A 4I3PA 3HEIA 4R4XA 1G9FA 1V0AA 3LA3A 5JWPA 4R9BA 4JQTA 2CSGA 1HB1A 2D3PA 3P3PA 4PIZA 5C5TA 2EAAA 5FPXA 4Y22A 1IG0A 5JSOA 1NG0A 4Z8BA 2JG8A 1KFUL 3UV9A 2VQAA 4UW4A 3O5SA 4QXBA 3AL6A 2RS12 3FHAA 1XU1A 1OUSA 1EY2A 1WGPA 2C4XA 4PDWA 4UFHA 4OMCA 1RINA 4BJ0A 1NA1A 3AMHA 2ZHNA 2C9KA 3HBZA 1SFNA 3MLJA 5FYCA 2EF6A 3KLSA 1Q5OA 5EQUA 4AQSA 1ZRFA 3V56A 3KCYA 2WWSA 4FOWA 1WMFA 4Q0QA 1UL9A 4BU2A 2GSYA 3OD0A 1L7QA 4N53C 4XTMA 4CU6A 4Q29A 5C5UA 1EPWA 5FY9A 2IXCA 5FZKA 5SV5A 3W20A 1GOHA 4NMIA 3NV1A 1TE1B 2DTWA 2RMU1 2DBIA 5M0TA 2YG0A 4E2GA 4GKXA 3M3OA 4W50A 1S0DA 2BV4A 5F2WA 3I97A 2OVUA 1W6PB 2CL2A 1H6XA 1LNSA 2RMU3 3LQCA 4ORFA 4AEDB 1AR82 3VBSB 2BWAA 4GWJA 5J7MA 1PK6A 1DGLA 1YXWA 3AP7A 3CZUA 1HV0A 4I2OA 4D8MA 2J1TA 2FD8A 4CCDA 2J22A 2OUHA 4HK8A 4QQLA 4I02A 1YRZA 3PTRB 3MIHA 4Q26A 1H4HA 1QY4A 5DUVA 1DYPA 1MZ6A 1RUC3 2V4VA 3NAPB 3LIGA 5FP3A 4BK4A 1VBB1 4LXLA 1RUE1 1S55A 1WW6A 2HEYF 2NN8A 4FAHA 5D21A 2H6BA 3B3QE 3RWKX 4YM2A 2YFZA 1VBB3 2K46A 2VW2A 1RUE3 5FZ0A 1SCRA 4Y26A 1WMEA 1H1AA 5FYZA 4NWWA 4P5YA 3H8RA 4BK5A 5F3EA 2VD7A 3HN3A 5T5LA 3FFQA 3V0AA 2XVLA 5E6HA 4YW7A 4C8DA 4AVCA 1W99A 2WT0A 3PUSA 5FY5A 1F9KA 2RJLA 2WFF1 4NIHA 1XJAA 2IXHA 2YU1A 2JDMA 4ARYA 1COV1 1XRUA 2GMPA 5A7SA 3VDDC 1ENQA 2VL4A 3SEEA 3AKRA 4AFAA 4P02B 1COV3 1JYCA 1R1ZA 3K77A 4HFSA 5LBBA 1GWKA 5A3OA 1PVC1 2WNUA 4H2AA 2FCUA 3KF3A 3AYAA 1X33A 4LIUA 4XJAA 4XXPA 5F6KA 3SHRA 2VNRA 3I2JA 2JX9A 3IB3A 1ENRA 1YC61 1PVC3 4P9GA 3M8LA 1KJRA 2ZGTA 1XSRA 2K2SA 2FZ1A 1LOFC 5L19A 2GC1A 4Z92B 4N90A 2PLV1 4QPGC 5JVVA 3OYWA 3FBYA 1VBD2 4YGBA 3H8XA 4PBOA 2BEOA 2R32A 2PLV3 3WG3A 2CGOA 2DVFA 3VBRA 2L9LA 4K1YA 4I0AA 3N35A 5K9YA 3G6JB 5EV7A 2WL1A 1PGW2 5FP9A 3VL8A 2YYOA 5CFDB 3ZYJB 3H42B 1RUH1 3IIIA 4FVVA 3ZYIB 2P3JA 5K8SA 1ULEA 5FQ0B 4BQXA 1LENA 3AZXA 5KHKA 1RUH3 3WG4A 1EUUA 4Q4Y1 1FV2A 4M0NA 1KGYA 1GNHA 1J58A 1DGWX 5A3MA 4X6QB 4Q4Y3 4WBBA 5FZLA 2VAUA 2JIGA 4J1WA 1UMZA 3LB9A 4I0WB 4KNCA 4WZFA 3S5QA 2R6QA 1YHFA 1OMIA 5C33A 4AI3A 3DUIA 1BVP1 4PQQA 3RZLA 1CIYA 2I74A 4LBKA 4LBMA 1ZREA 3GM8A 1S0JA 4RR3B 5HCBA 3T0DA 1ASJ1 4UI9L 3VKNA 3THTA 1UXZA 2ZACA 2QQJA 2ZBJA 1ULGA 1H1MA 1XC6A 2ZMKA 3PUQA 4PIXA 3D8CA 5D8AB 5T3NA 3I49A 1C5HA 3TN91 3R4SA 1ASJ3 5FUPA 3U4XA 4OI4A 3CJIC 2DTYA 4NHKA 1XOYA 1EAH1 1GKBA 3OPTA 3O1RA 3TN93 3LA2A 3LCPA 5BNOA 5HV4A 1UMHA 2JWPA 4QX2A 5ABJA 2B45X 5LBCA 2OW4A 5DZFA 3FC0A 2JDKA 1ZVFA 3HVDA 3KGLA 3AVRA 2WINB 4XJZA 3VZJA 2JDAA 4E4SA 2W1WA 2P37A 4ONUA 5J1XA 4AI1A 1H2LA 4EYUA 3J7MA 2P2KA 4D6QA 5C8CC 3VKLA 4BXSV 5A6QA 3PJQA 1N3PA 2AR6A 3SH4A 4CDUB 4ES9A 1V70A 2VQ0A 4DNYA 1L7RA 1HXS1 3T3YA 1JI6A 4OUEA 3S30A 1OFSA 3WF4A 4B1LA 1UU6A 2P6HA 2QTWB 1VP6A 1YJKA 3UT0A 3TNPB 2WZR2 5FBJA 1HXS3 1X9PA 1W0OA 4JC1A 1UZYA 1NE4A 4OHWA 4I01A 3ZR5A 3AMPA 5JR2A 1OLQA 2EA7A 2YC0A 4P5HA 5A70A 1PO11 3BPSA 4OULA 3ZXAC 1VJ2A 2GH2A 4QB1A 3D4KA 4MO3M 1ULCA 5C8CB 1PO13 4OI0A 3ZIWA 2JDUA 1K5JA 3RZMA 3BN6A 1SDWA 1RXGA 4CUAA 3AVSA 1FNYA 5CIRA 1SLAA 2W91A 3WR0A 1V6IA 2VCMA 3RQ0A 4QQHA 1UZWA 3WT3A 4L11A 3PMEA 1Z7S2 1W2UA 3IAQA 4A7ZA 3EO6A 2VBPA 2WWUA 4COYA 2VZVA 1LGBA 3USSA 1RTVA 2JDPA 4CRQA 2CYFA 4QX3A 3T1MA 4AFCA 4BQ2A 4Q0VA 4CYDA 3V0BA 3VD3A 4AE2A 4RD7A 4YVWB 2FDJA 5FZ1A 3NMBA 1F4AA 1ZBA2 2WLQA 3KT7A 4YW2A 2WS91 4QB6A 5FMBA 4IERA 3RMXA 3CKHA 4WV8A 1RUNA 5FZ7A 2N7GA 2ZPXA 2GAUA 1WA4A 2WNVA 4QKBA 2WS93 1MZFA 2GNBA 3CZJA 3IDAA 4MGTA 3CJXA 4LOTA 5FMOS 1H8TA 3R6SA 4EN8B 3ZM8A 1OBNA 1WW7A 1IS4A 2BGOA 2D6NA 3OY8B 3UL2A 4CDQB 1RUOA 4XEZA 1KITA 3AJZA 1YYNA 5FV3A 2VMIA 3DN7A 4MHUA 5DUWA 1JZ4A 3ZX7A 4PLNA 3EQEA 3WCRA 4CCKA 1TMF3 2LROA 4OFGA 4YVSB 1W6OA 2ADEA 4BQYA 2G4IA 5JPNB 5FZOB 3LDKA 1DYOA 4CVUA 5HCHA 5A32A 5A33A 2XHNA 3RMYA 1O3SA 2EXKA 4V2VA 3BTYA 2X53S 2WABA 2Y0IA 1LU2A 1SFYA 4CPBD 1PGL1 3Q8FA 2RV9A 3ETQA 5EIYB 1LRHA 2OXBA 4EZ4A 3DGTA 2XUEA 4XFHA 1OPOA 2Q1FA 4AFMA 4XETA 2HKXA 2VH9A 4QQOA 3HMYA 2WZ8A 4MX3A 4MLOA 3WDXA 3RZJA 3UK9A 2ZZJA 4DY5A 1ND2A 1XYNA 1C8NA 1RUG1 3DPRC 1XYPA 1RIRA 1PM7A 1RUI2 3I59A 1CAUB 1LOEA 2BPA2 4CXYA 1RUG3 3L2YA 4BHPA 3AL5A 5H9SA 1RUD1 2VR4A 3K46A 1ST8A 3TEZA 1Q8PA 1ZA7A 2DCJA 3WP4A 3CHXA 3WNOA 4TN7A 1DLLA 1OQ1A 4Q4W2 3IPVB 3CNAA 3B93A 4QM9A 3ACFA 3AP6A 4FFGA 1LEMA 2AEYA 2YY1A 3ELNA 4LA3A 1LJ7A 5DQ0A 2RHPA 1HV1A 3CIHA 3D0JA 5DDJ1 2WRAA 4B3NA 3POSA 3TYJA 1D2SA 5LATA 4A7KA 1TNFA 4RA0A 3POFA 4BOWA 3JD72 5DDJ3 1W8TA 3QCWA 2AREA 2QQUA 1QWRA 2BNOA 2RM22 3MFAA 4LO4B 4N9IA 3S57A 2XJSA 5DAXA 2BFUS 4HONA 3B69A 4O9GA 4A7YA 5FO9B 5DG1A 2QQWA 4DY3A 4S2GA 3NQHA 4O7XA 2P5BA 3AJYA 4XHBA 1QOTA 1LOBA 1R64A 1AL0G 3KD4A 4IV3A 4OI2A 5CNAA 5C4WC 1UNBA 4ZS3A 5J98B 1VLNA 2BZDA 2W1SA 4UYBA 1UAIA 5A80A 4XDOA 1L7LA 4LLOA 3K4DA 4CDWA 1NAEA 4W65A 4XMIA 4EN6B 2UY9A 4CDXB 2CAVA 4WM7A 4DIQA 4JGZC 2JG9B 5T55A 1LULA 3RZKA 4IDZA 4MH0E 3MF6A 1S1AA
chains in the Genus database with same CATH topology
5DXDA 1VBC1 5GLVA 2KXLA 2HWD2 2ZGQA 4RGGA 1FYUA 3EJKA 1TME3 4QQPA 1VBC3 4UBGA 2GNTA 3GF6A 5T5OA 4EN7B 1YCIA 4YW5A 5KC6A 4Y4YA 1N1YA 4YW4A 4QPIC 3ZN6B 2E6VA 3GYDA 5BNNA 2VULA 1AUYA 4A3XA 4TLFA 2HJIA 3ZFEA 3OGJA 5CB7A 5K0UA 5EJ3A 4M3CA 4E9KA 1A3KA 2VNOA 2R041 4YGEA 2VVEA 4AI0A 2ZGRA 5ACA2 2XKOA 2R043 4LHKA 4XF1A 3ZFFA 4LBQD 3H9AA 2UWAA 2BNMA 4AVBA 1DBNA 3RNSA 1PIV2 3ES1A 4M3CF 5L7OB 3ZO0B 3RYPA 5BV6A 4R4ZA 3N7LA 1Q8SA 1HW5A 3PVEA 4RQPB 1MQTA 1RUF1 3ROUA 5AC91 4GIQA 1VIWB 1CD3G 3LSEA 2OPKA 4YM1A 5AC93 1RUF3 4YZ5A 2XKPA 2RS53 5FLHA 2OZ6A 4LT5A 1AL22 1A6CA 1WW4A 1W6NB 3J9SA 4WM8A 1C4RA 5A3LA 2DFBA 3HT1A 1MEC1 3LSDA 5L73A 1RJ8A 3B7MA 4L92A 4LBJA 4YZ3A 4NO4A 5IT6A 1HLCA 5LEJA 2A6XA 3ECQA 1MEC3 4CEYB 3AKQA 4XIKA 2JICA 1G9BA 3MPPG 3KM5A 3AMQA 5JR7B 2HWF1 1Q8QA 2XBO2 3ST7A 3WW4A 3ZXFA 3J8F2 1QDCA 4GQ7A 4DXZA 1KJLA 1QJU1 3KS7A 2X8KA 1MVEA 4LBOA 4KG8A 1QJU3 5TSWA 4KGGA 4I09A 1LCLA 3D5OA 1EP0A 3BTAA 2YPJA 3H3UA 1R082 2IWGB 3L9JT 1ZRRA 4XJ9A 1BK1A 4AHYA 1TNRA 2ARXA 1NLRA 4P9WA 1W39A 4DPNA 4JTOA 2HWC1 1G9AA 3UKNA 2MEV1 1AR61 4COVA 2JECA 4Q8LA 2HWC3 2VW1A 3RS6A 2ZTNA 2E7AA 3ZN5A 1FMD1 4D69A 3EXUA 3IKWA 4IV1C 4YW3A 5GLWA 1FMD3 3H7YA 4MV2A 1AXYA 4LO7A 4MXVA 4JQRA 2Y26A 3WP5A 3I54A 2R063 2YROA 2WNEA 3AXDA 3QACA 5JOYA 1V6KA 1NCRA 1CJPA 4M3CE 4C0HA 5I0TA 3N7KA 1F5JA 4Q4X2 4QQ2A 5J36A 2WZPP 3ASIA 4L2NA 1B35B 1OD5A 4CEWC 1SACA 3ZPYA 1H2NA 2ZA9A 4BQ1A 3ILRA 1VB2A 1DF0A 4XJ8A 5HI0A 1URXA 2WIIB 4C90A 4XFBA 3MFCA 5I8YA 3FLTA 1ZZ6A 5E16A 4FBFA 2B42B 2GDFA 4XXAA 3AMNA 2A75A 1AYM1 1ZNPA 1BBT3 1YWKA 1QOSA 3ALQA 4NHMA 1AYM3 4WVMB 3HR9A 1F8VA 4NR1A 3WW3A 5C9AC 1YLLA 2A6YA 3H1YA 4DRRA 1SMVA 4JVAA 3L2HA 3JQWA 1D4M2 5C6CA 3WQ7A 2YGLA 5C8WA 2HYKA 4L99A 3R4UA 4BIOA 4BH9A 1AR81 4QT6A 2ZGUA 1QMJA 3R05A 1CPNA 1AR83 3VBOA 5FDBA 5FREA 3LKJA 2QDNA 4RGAA 1BYHA 1DZQA 3KSCA 3GZUC 4GH4C 4D3WA 3LA7A 3U0ZA 1RMU2 2CNAA 2DVGA 4C91A 5FBZA 4IEVA 5GALA 3SH3A 4XFIA 2PHFA 3KQRA 1J3PA 4UXAA 4Q2FA 3D82A 5JLVA 2D93A 1DGRA 3MLLA 4PLMA 2X5IA 3E5QA 1NCQA 4HN1A 4HKWA 3ZFGB 2DV9A 4K8FA 4AVTA 4AW7A 2QE3A 1C28A 4CP2A 4HN0A 1HRI2 4DQAA 3UKTA 1U0AA 2Z79A 2PAKA 4GH4B 2WQ4A 5JMCA 4XBQA 4GWNA 1BEV1 1OA3A 4JDNA 2FMYA 4FTSA 2XG3A 1QJX2 4OVEA 1MS0A 1VRH2 2NPIA 1BEV3 4CP0A 1XYOA 4GA9A 1ZX5A 4MSVA 2BBVA 2W68A 2R0HA 1DQ1A 3VHNA 1VBD1 3E5XA 1H30A 1VBE2 1VBD3 4B4RA 1VALA 4N53A 3WZ1A 4BLIA 1G7YA 2K0GA 3WHUA 4UW6A 5GZCA 2PAEA 2TUNA 4LEJA 2F6BA 3KZ4C 4SLIA 1G8WA 2CWSA 4DINB 3ACLA 3WDUA 4EJRA 1V00A 4XW3A 1UZZA 3URFA 3B5LB 4Y1YA 3ZVXA 5GJ6A 2IZWA 1RUJ2 3PVNA 5GLTA 5JZGB 2P3KA 2HEWF 2D44A 2LTNA 4HPKA 4META 1JN2P 4AEDC 3ZYGA 3VBSC 2ZMLA 3ENRA 3E5UA 5CFCB 2R1BA 4FAGA 1OA4A 3VHRA 5FO7B 1NQJA 4KG0A 4RS5B 4COUA 1POV1 4Q27A 4FQZA 3IBMA 4H3WA 1CAWB 1RB8G 2HWE1 5JOWA 1AZDA 4PQ9A 1POV3 3NAPC 3S6PA 4RHV2 1LKNA 1I3HA 5FLIA 5H9QA 3GHMA 2HWE3 3RSJA 4COWA 2XPJA 4BMEA 4ZU5A 2PYTA 4SBVA 3VKMA 4IEOA 4XJWA 1WCKA 3VDDA 4AQ2A 2I45A 4UW3A 2GH8A 5I91A 1YFWA 2MPFA 3VBHC 2ZHMA 1W6MA 2V73A 2SLIA 2R071 3N3HA 2XVGA 2RE9A 2HWB1 2R073 1NE6A 1LOFA 2HWB3 3VHOA 2A6VA 4QPGA 3VZMA 5EYXA 5T54A 2ETEA 3A4UA 1J1TA 3FHIB 3NWKA 3AFKA 4XFGA 1I6XA 1N47A 2ZGLA 3VBHB 5DG2A 2P3IA 1TEIA 4W6XA 1BZWA 1JOJA 4Q0PA 1LESA 2GMMA 4Z2WA 2ZGKA 1Z7S1 2ZCWA 4XFCA 4LO8A 3RDIA 1C8M2 2WFF3 3WUCA 1PMIA 4LBLA 5JI7A 1S2KA 1Z7S3 2TNFA 3W58A 1K5MB 4KL1A 5CFDC 3SCFA 5IUQA 1UF2C 1CR7A 2XJVA 1CGPA 4IEQA 4CP1A 5KHHA 3WDTA 4H7MA 3VZNA 1RVF2 4Y22B 1GSLA 1GICA 3S0MA 1QXJA 1GZWB 2E51A 3WUDA 5H9RA 4N9HA 1ENSA 4I30A 2EXJA 4CDUA 1X82A 2WJSA 3QH7A 1FNZA 4PDWB 1H8VA 4H14A 1NA1B 3CJIA 4QGLA 5JDBA 3WW2A 4GMP0 1Y9QA 3O7OA 4E4DX 1R091 1H4GA 1QJY2 1W6QB 4RR3C 4LO5B 1YIPA 2FZ2A 1R093 2UWBA 4FO9A 5D8AC 3H50A 1WBFA 3UJQA 1SLIA 5FMOL 1S0GA 5C8CA 1XNBA 3FE5A 1R1A1 3M3EA 1ZBE2 4ATFA 4KWJA 1PK6B 4KQ7A 1MS3A 2QZ2A 1R1A3 1GFF2 3NJZA 4DB5A 4MGKE 1O7FA 1FOD1 1VBA2 1O3QA 1RUI1 4YW1A 1V9U2 3H7JA 3Q9OA 1RJ7A 1A8MA 1FOD3 2DU1A 3I8TA 4IEUA 4Q4W1 3U11A 4TSVA 1ZZ8A 5E8AA 4AWDA 1EAH3 5IK8A 3HAGA 1XQNA 1DG6A 3V0AB 4Q4W3 1DIWA 3O0VA 1SBDA 2VOKA 1QH7A 2QJVA 1N1VA 3OY8A 4CTEA 1DGWA 3PVBB 3MLKA 2RM21 3QD6A 3E97A 3NW4A 1LOGA 2ZX4A 1Z0HA 3AZVA 1O91A 2DCZA 1DZRA 1JW6A 1DHKB 2CTVA 2DFCA 2WNUB 2XJPA 3NV2A 4EWDA 3BOPA 3KB5A 1QDOA 4FPGA 3DL3A 5KHIA 4FPKA 1ZZ7A 4HT1T 4HVQA 3ZMOA 3LOIA 4YVWC 5F6LB 1QXPA 4QGMA 3OYWB 2XHKA 2HWD1 4JGYC 1QKQA 1PHMA 1MS8A 1FPN1 1S0EA 4L9BA 2TEPA 1RUC2 5KXCA 3SISA 5DZEA 2O8OA 2Y38A 3VBRB 2JDZA 4L97A 2HWD3 2BNNA 1AR91 4OI1A 1FPN3 2VVFA 2NLRA 3WV6A 4YM0A 4CDQC 1KRIA 1AR93 5BNQA 2E7TA 2P34A 4KU8A 5KWRA 2VOXA 1KFXL 4YGDA 4XZPA 3JBG2 4D7YA 1CJDA 3MDPA 4AEKA 2WC2A 4YVSC 4FP2A 1OPMA 1JTZX 3ZSJA 4FP3A 2DVDA 2QZ3A 4JGYB 2WKKA 1D4VB 2ZKLA 1APNA 3VBUC 5ACA1 2GC3A 2BUKA 4LHLA 3PMSA 1IS5A 3DPRA 4JRLA 4EWEA 1H1IA 4AYUA 5ACA3 1EV11 3SXWA 2D5HA 4JV4A 2SBAA 1EV13 2DU0A 3WNXA 2Z5WA 2H0VA 3AZZA 3USUB 1CAVA 4BZ4A 1JXNA 1X8EA 1LHWA 2ET7A 5ABJB 1QF3A 1YNAA 3VBUB 1Q8VA 1AL21 2PHRA 4OHXA 1VB4A 4IEWA 5K7PA 3APBA 5GLZA 2XJRA 5HXVA 3VHPA 4D7TA 3NV4A 5FOBB 1YFYA 4WZCA 3IDEA 3MICA 3SITA 4UW5A 5C4WA 2R1DA 1I5ZA 1VAVA 1F5FA 5GZEA 1VR3A 4QU2A 4Q4Y2 2D3SA 3THPA 2ZGMA 3ZXJA 2D97A 4JGZA 1WUVA 2A71A 3R4DB 4RFT0 1A8DA 4Y20A 1RUD3 5CADA 2OYZA 4AQ6A 4AEJA 4AF9A 1R081 4CDXC 5FCCA 5BXXA 1QNWA 1POV0 2JG9C 4COZA 1I1EA 2LM3A 2YMZA 2GU9A 2I2SA 1ASJ2 4QPIA 1R083 3WQ0A 4YZ4A 4Q0UA 2B9UA 2DUOA 3NSTA 1G86A 1WD3A 4F8AA 3ZSLA 4FQ4A 4G4FA 4KWLA 4FOVA 3H3ZA 2CGNA 5KHJA 3ZXKA 4OHYA 1NQDA 1LOCA 3IIAA 3V0BB 4U36A 1YI7A 1I9RA 2EXHA 3N7JA 3MW4A 3J26N 4K21A 4I3GA 3V65A 2PELA 4HSLA 3GBFA 3WQ1A 1N1SA 4BYYA 2WNVB 5CG8A 2A3WA 4Y1ZA 5BUVA 4AK3A 1H8TB 4JCKA 5J48A 4Q4X1 1S0BA 3FWEA 1KS4A 3WCSA 2FMDA 4AEMA 2NYYA 4FPCA 4Q4X3 1W6OB 4FPLA 2PHDA 2ZGNA 1HKDA 2ZMNA 3AFGA 5CU1A 5A32B 2PAMA 2PHXA 1CAXA 1BMV2 5L7OC 4DOUA 1DQ0A 1GLHA 1NXD1 1NLSA 3QH6A 1SQ4A 4RQPC 3WDYA 4FPFA 4B8EA 2D6MA 2VU9A 3SLIA 5AFEA 1RHI2 1AYN2 3HN1A 3SNMA 2IFRA 3SCHA 1TQ5A 3S7EA 1PNFA 2CWMA 5JCTA 1ND2B 3IDBB 4Z07A 2PTMA 3I59B 5I8TA 1AXZA 3M3CA 1YFUA 4HMZA 2JENA 4CEYC 2ZHKA 3JB4C 2VOVA 3NKTA 5FO8B 1LECA 1UPSA 2VVDA 1XNCA 2ZX0A 2FBEA 4MXWA 1C5IA 4KBBA 2BGCA 3ZMNA 3X29B 1AJOA 1D4M1 3H1MA 4D94A 2IXJA 4S2HA 2PHUA 3IWZA 1DFQA 1QQP1 2UWCA 1D4M3 5LRRA 2XUMA 1REDA 1TMF2 4HVOA 3VN4A 1QQP3 3VBFC 3GBWA 4FPHA 3N36A 4JDOA 1AR71 5KXDA 4ATEA 3IT8A 1IKQA 2AH2A 2Q30A 4OLLA 1ZRDA 2XL9A 1RMU1 1YUDA 1AR73 4IV1A 3OBTA 1UPIA 2AZ5A 1NZCA 1RMU3 3MIFA 1YJLA 2BWCA 1GBGA 2HWF3 2QNKA 4CDWB 2AENA 2Y0OA 4QHBA 1FI2A 3MIBA 3TNQA 3A0KA 3VBFB 2GNMA 3RPQA 1OKQA 5DZGA 5IK4A 3SCGA 1OI6A 1QU0A 4CEWA 2PA7A 4D7SA 1DQ2A 1F2NA 2QDRA 3PLQA 4XPVA 1B09A 4QM8A 4WVMA 4INDA 5JIAA 2Z69A 3WHTA 1J3QA 5AFBA 1KDMA 3VZOA 4WVVA 5BNNB 1QJX1 1B35C 1VRH1 3AMMA 5JSRA 4YZ2A 2MEV3 4XF0A 4Q4V1 3OGGA 3ZFEB 1AR63 4B7KA 1QJX3 4BCUA 1XE7A 3WP6A 1Q56A 1VRH3 2CAUA 3FJSA 5KXBA 4Q4V3 5DDJ2 4K7JA 1OSGA 2YGMA 4GMP1 1ULFA 2ET1A 3NL1A 4MYEA 1V6JA 4GMP3 4Y5Z0 4LBNA 3ZYPA 2VY0A 3LZZA 2B7YA 5C9AA 1V6LA 1PO22 2D40A 1VBE1 4HL0A 4IETA 4P9IA 3D0SA 1VBE3 4M0HA 4LBQB 1MQTB 1PGSA 3AM2A 2K9ZA 1PVXA 3RG0A 2V5YA 1SEFA 2YV8A 1IPKA 3WG2A 1LGNA 4B4QA 2CY6A 2BYVE 1TME2 1VBC2 4R52A 4XTPA 2E9QA 3I4IA 4C0BA 3RJ2X 5BNPC 2R49A 4XQDA 1RUJ1 3WXPA 2PN5A 2I07B 4ZU4A 1U5ZA 3WDVA 4MUVA 2XWBB 4GH4A 4B4PA 2A3XA 1UIKA 2RS11 5BPXA 1RITA 4F83A 1NY72 1PNGA 1MVQA 2D5FA 2AYHA 2RS13 4B29A 1UKRA 2D6OX 3TBDA 4XFFA 1MR5A 1WCSA 1UN1A 4XBLA 4RHV1 3RJRA 1ONAA 2R042 4IQPA 4LE3A 3O14A 4XILA 4AVAA 5BNPB 3VUOA 1LHUA 4RHV3 2UY8A 3INAA 5CBLA 4HANA 1IGOA 1QH6A 3ZFGC 4E27A 1SBEA 4L8QA 1GR3A 4YG3A 3CLPA 4FT8A 1LOAA 4XYXA 4Z82A 3IDCB 2XL7A 1AX0A 1RUF2 2DCTA 2DCKA 4FPEA 2UYAA 4XDQA 2DYCA 2RS52 3LGRA 4YZ1A 2KM2A 1AXKA 1AJKA 2PHWA 2EALA 4K20A 3TWIA 1MEC2 1WD4A 4JRAA 1NCRB 5KC5A 3JCIA 3MF9A 1C3HA 5I8SA 5J96B 3WVJA 3KGZA 3WP3A 2NZ9A 2JJ6A 4ZXKA 3WW1A 1C8M1 2XLGA 1H2MA 1ZZ9A 3BALA 1SLBA 2XLFA 2GC0A 4MGZE 4NHLA 2RR12 4YLZA 1O3RA 2X29A 4V1PA 1LR5A 1O4ZA 4YARA 5EXOA 2WLPA 1IQAA 1KD7A 1UIJA 4XQWA 1QOOA 1RVF1 3D6EA 3MGUA 3ILNA 1W6PA 2GNDA 3I7DA 4AEDA 4M01A 1ULDA 3VBSA 4P14A 2WSVA 3AK0A 2OA2A 2HWC2 4OUSA 1ZRCA 2GC2A 3TAYA 5JZGC 3DF0A 1PGW1 4BM8A 1AX2A 1X8MA 3NAPA 4J6GA 1H9PA 4GULA 4HKOA 1CIWA 5CFCC 2NMOA 1FMD2 5CVRA 4NVPA 3M70A 1HQWA 1HRV2 1MZEA 3QOPA 4RS5C 4N43C 3HIFA 1HQNA 2R062 4C1XA 4GB32 3TRSB 1C57A 1OA2A 3WD5A 2VECA 2W0XA 5DUXA 4Q0SA 1ZBE1 1LEDA 4A2UA 3VBHA 2OZJA 5F1RA 2EIGA 1JH5A 1FT9A 3IN9A 1N3QA 2VXRA 1YI9A 2BTVC 2D6LX 1VBA1 3BB6A 1V9U1 2ATFA 4N43B 3C2UA 1ND3C 1MS1A 4KGQA 4K9SA 2QCSB 1O4TA 4IEZA 1OQDA 4ISQA 3NKGA 1NXMA 2X5IB 1FAYA 3IMNA 1NCQB 1Q3EA 4YYOA 2D3RA 2GALA 1BBT2 1GZWA 5IK7A 1IS6A 2XWJB 3ZN4A 2VUJA 3AZWA 1AYM2 1WCDJ 4E2QA 1OOPC 3OCPA 4XHXA 1FV3A 1LB2A 3FUQA 2VPVA 2XJUA 3B00A 5CFDA 1FX5A 1SLTA 1ND3B 1QGLA 1W6QA 5FQ0A 1MS4A 4IEYA 2PFWA 2WZR1 4IESA 4ASMB 1O4YA 4R9CA 2ZJCA 3GALA 2RJKA 3QBQA 3JZVA 4RL7A 2WZR3 3RZZA 2RS32 4AG4A 2E7QA 1K5MC 1IKPA 4OUMA 3AXEA 4P9JA 4B7EA 4DRVA 1AX1A 2ZZQA 1OOPB 4BIFA 1N3OA 3VKOA 1BKZA 1RUC1 1QHDA 4LE4A 3O0WA 3WY6A 2JG8C 4RR3A 2JE7A 1CX4A 4N53B 3PJYA 4TZDA 1Y7BA 2XGXA 4Q1PA 4EV0A 3RI8A 5D8AA 2QQPA 2WT1A 2ARBA 4PDWC 3AP9A 3ES4A 1NA1C 1BVVA 3HWJA 4HBNA 4LULA 1LHVA 2D7FA 2G9GA 2C9AA 3JBG1 2JD4A 5JSPA 1LTEA 1CESA 3JBG3 3MW3A 1DYKA 4XF3A 1ZBA1 3VZLA 3H8UA 5J37A 3FUOA 4JTNA 4NPRA 2ZAHA 5E1RA 4HZFA 4Y24A 5HBAA 4AVVA 2JG8B 1ZBA3 3P3NA 4HPKB 1Y3TA 1ZM1A 3WINE 4BWOA 1Z78A 3BPZA 4K3UA 4DS0A 1MS9A 1BEV2 1PK6C 2DURA 5LK5A 5FAXA 1GQHA 4QD2A 3N7MA 3TB0A 2A7AA 4XQ4A 3B01A 1S0CA 1UU5A 1VAKA 3FZ3A 2ZGSA 4XE9A 4F3JA 4WVWA 2A3YA 2A6WA 2IC1A 1WMDA 4QGNA 1XXNA 3MI8A 1U5YA 2IFWA 3VDDB 2BW8A 2ERFA 5I0UA 1OFNA 2Z2SB 3AKSA 3AB0A 1PZ9A 1WLDA 3HD8B 4HETA 4JDMA 1W6MB 2DUQA 3BU7A 4HLTA 5H9PA 1JUIA 2VMGA 3WG1A 3U07A 2UU8A 4K6BA 3N4MA 3MPBA 1J3RA 1KDKA 4YGCA 1YO8A 4QX5A 4YM3A 2D6KA 2GN3A 3T2TA 3MW2A 1RUI3 4YVWA 4IXLA 2LUWA 4QPGB 2B8MA 4X6RB 5SV8A 2WNUC 4JGYA 3A0NA 3UKVA 5AVAA 3FMGA 1AHSA 1W0PA 4MZUA 5F5QA 1FXZA 4PCRA 4S2DA 3PVOA 3RYRA 4OZXA 2WQZC 2HEVF 4CDQA 3JD71 4XOGA 4H55A 5GZDA 3RI9A 1X7NA 4YRDA 3JD73 4YVSA 4NOTA 1H0BA 1GYKA 1LHNA 3VBRC 2HWE2 2ILMA 2RM23 4LO6B 3USUA 2B5HA 2GN7A 3POYA 3DV8A 3OTFA 5JPMB 2OIIA 1NYWA 3LOBA 2YHJA 2RMU2 3H1WA 3VBUA 3AP5A 5GKAC 5DUUA 3KT1A 3E6BA 4I0BA 2WA3A 2BVVA 3FLRA 1O3TA 3IM0A 3MYXA 5LRSA 3KMHA 2BFUL 3KT4A 1UU4A 1MZ5A 4PLOA 2W52A 3AKTA 2R072 3W59A 3CJIB 4HSJA 2HWB2 1ENXA 1CAUA 3B02A 1V6MA 2ZX2A 2F4PA 3CO2A 2DVBA 1VBB2