2RS32

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs3200
1VBA3 1PGW2 4WM7A 1VBC2 1RMU3 1MEC2 1TME2 4RQPB 3VBRC 5CFDC 5C8CA 1R091 4FSJA 1BBT2 1VBD1 2RS52 2RM23 1AR83 1HX6A 4WM8A 2R043 1X36A 1PO11 1RVF3 2R062 3ZFEB 4CEYC 1CJDA 1EV13 4Q4X3 1AR71 3CJIB 1HRV1 1GFF2 5LK7B 5BNPB 4YVSC 5AC91 1AR63 2RMU3 3TN92 2RR13 4SBVA 1HQNA 4GMP3 4NWVA 1V9U2 1VBC3 2GSYA 1HXS2 3JD71 1QJY2 2R073 1RUI2 1VB2A 5CFCC 1RUD1 5ACA3 1QJX1 1VAKA 3DPRB 2X5IA 5L7OC 5C8CB 1MQTC 1RUF1 2HWB1 4CDWC 4IV3B 2HWF1 5D8AA 3ZXAC 1V9U3 4RR3C 4RHV2 1HXS3 1AR73 1C8M2 1QJY3 1F2NA 1NOVA 1RUI3 3VBHB 5AC93 1NCQC 3IDEA 1VBB1 2MEV1 2DF7A 4GB31 1IHMA 2RS32 4N43C 3FBMA 3ZFGC 2HWD1 1R081 3ZFFA 1H8TC 4Y5Z0 1AYM1 3JD73 2Y26A 3J8F1 1K5MB 5BNOC 2XBO2 1NCRA 2X5IB 1POV1 1RUH1 3VDDB 4JGZA 3VBOB 1FOD2 4JGYA 1POV0 1QJX3 1VBA1 1ND2B 4IV1A 1QJU2 1RMU1 4RFT0 4CDUB 4RS5A 2HWB3 1RUE2 5CFCB 2RM21 1AR81 1AL22 4RQPA 2R041 2RS33 4Q4X1 1NY72 2HWC2 4GH4C 4AEDC 3VBUC 5FOJB 3ZFEA 2XBO3 3CJIA 4CDXC 1AR61 5BNPA 1ASJ1 2VQ0A 1FOD3 4QPGC 1COV2 1PGW1 4GB33 1VBC1 1MEC1 3VBSC 1R083 1RUE3 1BBT1 5C9AC 1FPN2 3J8F3 1OOPB 1RUH3 2R061 2ZAHA 4RS5B 1H8TB 1NA1A 3DPRA 2FZ2A 1ND3C 4WM7C 5GKAC 4YVWA 3TN91 4IV3A 1COV3 1V9U1 5J98B 4WM8C 1HXS1 1VRH2 2FZ1A 5C4WC 1QJY1 1RUI1 3NAPB 1ZBE2 5JZGC 1FPN3 5FMOL 4PDWC 2QQPA 1ASJ3 3VBHA 3S6PA 1SMVA 2WFF2 3VBFC 1TME3 1MEC3 4CEWB 2RS12 1BEV2 1FMD2 1BBT3 2PLV2 2RS53 2WS92 3LOBA 4CDQC 4QPGB 2WWSA 1K5MA 1NA1B 4RHV1 1F8VA 2R063 3VDDA 1VRH3 4YVWB 3VBOA 4N53B 1C8M1 1PVC2 5C9AB 1ZBE3 1ND2A 4QPIC 4FTBA 4CDUA 1B35C 2BFUS 3TN93 2RS31 5CFCA 5D8AC 1HRI2 1PO22 5L7OA 3VBRB 5CFDB 1MQTA 2XBO1 1BEV3 1VBE2 2PLV3 4BCUA 1E57A 2HWE2 1FOD1 1BMV2 1D4M2 4CEYB 1QJU1 1PVC3 4Q4W2 4Q4V2 4RR3A 1RUE1 5JZGB 4YVSB 3ZFFC 5BNNC 1AL21 2WZR2 2BPA2 4Q4Y2 1NY71 1HRI3 1OOPA 2HWC1 1PO23 5K0UC 4JGZC 4RHV3 1C8M3 1AL0G 1RUJ2 2GH8A 3JBG2 1VBE3 4IV1C 1H8TA 4CDQB 5J96B 1PIV2 2HWE3 1OPOA 3JB4C 1COV1 1D4M3 5L7OB 1VB4A 4RQPC 1MQTB 5ABJC 4Q4W3 1W39A 4Q4V3 4CDWB 4QPIB 1C8NA 1FPN1 1PGL2 1RHI2 2BUKA 3ZFEC 5DDJ2 3NAPA 2IZWA 4FTEA 5A32B 4RR3B 1TMF2 1ZBA2 4LLFA 5BNPC 1OHFA 1QJU3 1TME1 1RUJ3 2RS51 5A33B 1EAH2 1NCQB 1PIV3 1AL23 1VBA2 4CEWA 1QQP2 4N43B 3ZFGB 1VRH1 1DDLA 2HWC3 1R1A2 4QPGA 1ZBE1 5BNNB 5BNOB 1AYN2 3VBSA 1RVF2 3DPRC 4N53A 5DDJ3 1EV12 5C9AA 5C8CC 5K0UB 2WFF1 1TMF3 1ZBA3 4IV3C 2RS11 1Z7S2 2RMU2 1BEV1 1FMD1 2RR12 2PLV1 2WS91 1RUC2 3VBRA 1AR92 1ND3A 5CFDA 2ZTNA 1QQP3 5FMOS 4GH4B 2R072 4AEDB 5ABJB 1R1A3 1PVC1 3VBUB 3VBHC 4CEYA 1CD3G 5ACA2 1AYN3 5C4WA 4CDXB 1RUG2 5JZGA 1AUYA 4YVSA 2WLPA 1HRI1 1PO21 4PDWA 3JB8A 3VBSB 4EJRA 1K5MC 1R092 1Z7S3 1VBD2 2X5IC 1VBE1 3VDDC 1RUC3 3VBFA 3VBOC 1AR93 2HWE1 1PO12 1BMV1 1D4M1 1ND2C 1AR72 1HRV2 4CDQA 2WFF3 4CDUC 4Q4W1 4Q4V1 5AC92 1ND3B 2RS13 4WM7B 4NWWA 1FMD3 2WS93 2WZR1 1RUG3 4CDWA 4Q4Y1 4QPIA 1B35A 2BFUL 3JD72 4WM8B 5C4WB 2XPJA 1R093 1VBD3 1RUJ1 5A32A 3JBG1 1WCDJ 1RUD2 1PIV1 1A6CA 1QJX2 1PO13 4PDWB 5A33A 1NCRC 1HRV3 1NCQA 1RUF2 2HWB2 1QJZA 3VBFB 4JGYC 1OOPC 2HWF2 4N43A 1PGL1 3ZFGA 1RHI1 4Y4YA 5DDJ1 4RS5C 5BNNA 5BNOA 4Z92B 1TMF1 1ZBA1 1X33A 5K0UA 1M06G 1EAH1 1RUD3 1VBB2 2MEV2 1B35B 4GB32 2WZR3 1QQP1 2BBVA 2HWD2 1R082 4Q4Y3 3CJIC 5D8AB 3HAGA 1RUF3 1R1A1 1AYM2 3NAPC 3J8F2 2HWF3 1AYN1 3JBG3 1RUH2 1RVF1 4GH4A 4AEDA 5ABJA 3VBUA 1EV11 2ZZQA 1NG0A 1RMU2 4CDXA 4CEWC 3M8LA 4FTSA 1Z7S1 2RMU1 2RM22 2RR11 3ZFFB 1RUC1 1AR82 1VBB3 2MEV3 4GMP1 2R042 1AR91 1RHI3 1NA1C 4GMP0 4Q4X2 1NCRB 2HWD3 4YVWC 2R071 4N53C 4JGZB 1AYM3 4JGYB 1RB8G 5ACA1 1POV3 4IV1B 1AR62 1ASJ2 1EAH3 1RUG1 2TBVA
chains in the Genus database with same CATH superfamily
1WLDA 3LFIA 3U14A 1X82A 2CGNA 4V1PA 5FFOC 1TNRA 5EJ3A 4RQPB 2VZVA 2ES3A 4JDOA 5CKQA 3MBWA 3Q8CA 2A6WA 1GQPA 1UOGA 4UI9L 3GBFA 4ARXA 1N1VA 1XYOA 3SEEA 3CLPA 1O4ZA 1AR83 4I3PA 1LKNA 3VKFC 2PYTA 4YGCA 4B7EA 1NYWA 1WMFA 2Y8KA 2DVFA 2P37A 4AHWA 4CEYC 1CJDA 3LB9A 1WLWA 4LBOA 2BOIA 3M3OA 5LK7B 1DLCA 3HOBA 2RG4A 3AMMA 4ZHNA 5FZHA 1Q8QA 4J6GA 2VMFA 4D0QA 1QKQA 3VZJA 1IKQA 5CG8A 4WZFA 2E26A 3C7EA 3TN92 3U0ZA 4ES9A 1D2SA 1UF2C 4SBVA 3ACFA 3VDBA 1SPPA 4GMP3 2B9VA 4YG0A 4XBLA 5D21A 3MGUA 2GSYA 1OA3A 4FVVA 2QQUA 2R073 3N36A 3GNEA 2PN5A 2XL9A 4QX5A 2IXLA 5CFCC 1LOGA 4QQHA 1CONA 5FMCA 1HW5A 4LR4A 4BDVB 3LAGA 3B9CA 4KWKA 1VAKA 4XAAA 4P9LA 3MIEA 1A8DA 4AHZA 5C8CB 1WWYA 1MQTC 4LUMA 3VDAA 5KXCA 4XOGA 1SFNA 1YFXA 4QPWA 4XAEA 4KU8A 5A3OA 3P5BA 4LMFA 2DYCA 1LOCA 4R9DA 3ZN4A 3C7HA 1DG6A 3MYXA 1FI2A 3I3MA 2JD4A 4JHZA 2WA4A 4C8DA 3U78A 2VUJA 4AWDA 2AYHA 2OQ6A 3DUIA 2YROA 2GN7A 4XXPA 5KC5A 1GP5A 1HXS3 1AR73 1RGSA 2E7AA 2DVBA 5C33A 1NOVA 3VBHB 3WY6A 4META 1XOYA 5AC93 1NCQC 4WZCA 1XE0A 2MEV1 1A78A 3I2GA 2GC3A 5IYYA 1IHMA 3Q8FA 1UCXA 2NLRA 3K77A 3W59A 5C8WA 3ZFGC 1EPZA 4D8MA 2P3YA 2WNUB 3OGRA 3BYWA 1GZWB 4Y5Z0 4W8JA 1JI6A 1YFUA 4ORFA 1K5MB 5BNOC 4AFMA 1MS1A 1W8ZA 3WHUA 1ZZ8A 2GNDA 1FOD2 4U36A 1S0FA 4ZY9A 4YZ1A 4XUNA 1BYHA 2I45A 2OA2A 2VMHA 3W21A 2BNOA 1LGCA 2AGSA 4OUMA 4CDUB 4NRQA 1AXYA 5FYMA 2J1SA 3HT1A 1VMJA 2R1BA 3E1F1 1AR81 2WA3A 4JRLA 1W8FA 4NHXA 1JUHA 3H7YA 4AHXA 1W8WA 5T52A 3K46A 5LEKA 1SQ4A 2X10A 3ACHA 5IK4A 4TWTA 3ES4A 5KR7A 5FOJB 1K5JA 2Q8OA 1OLME 3ZFEA 4K9SA 2XBO3 4LXLA 5FYCA 3ZPOA 3PU3A 4W50A 3JCIA 1PGSA 4Z1VA 3RSJA 1NLQA 3UT0A 1UD1A 3QOPA 5FPUA 3H3LA 1RXGA 4UYBA 1MEC1 4N90A 5L9VA 2Q0AA 4K6BA 1NZCA 2IXCA 5LBEA 1RUE3 1U0AA 5GM0A 3MHZA 4OYUA 2ZGKA 1XQNA 1KJRA 3UKVA 2E32A 1Q56A 3MFAA 1UMIA 3C7OA 4OHXA 2OIIA 1HJGA 3I54A 2P17A 4RS5B 1HB2A 1JYTA 3RZLA 2D5FA 1W06A 3SITA 1NA1A 2BWCA 4BMEA 4E9KA 1ND3C 3K75B 5G05L 4NIGA 4BQ2A 2XJPA 4QHZA 1EP0A 4MOAA 4CCDA 1WW5A 2PHDA 4DO0A 3AJZA 3LOIA 3V56A 1CAVB 4LO7A 5FUPA 3IBMA 1HXS1 1VRH2 2UWAA 1FYUA 2FZ1A 5FCCA 2DVGA 2ZMLA 4NJ4A 3KCYA 3NAPB 3TBDA 1MS4A 1ZBE2 2D6MA 4AFBA 1PMHX 4IE0A 4IUGA 1X9TA 2LM3A 1V6NA 1O3TA 3HQRA 3N9PA 3AP4A 5JI9A 3C3VA 2C9AA 3LPFA 3PU8A 1JZ3A 1N1TA 5F6LB 3BUCA 1TME3 2J1RA 3ETQA 1GWLA 2JDHA 2X09A 2VD7A 1O91A 1S0EA 2XOMA 3KF5A 3QLQA 5DAWA 1LENA 3GCWA 2QQIA 4Q0UA 1BEV2 3WCRA 4YZ2A 5JOXA 1WCKA 1YQ8A 2Y6JA 4ZU4A 2WZPP 3UK9A 1PK6C 1OQDA 1UOFA 1DQ2A 2PHWA 4QPGB 3ZN6A 5FZOA 4K8RB 3O7OA 3DYPA 1WW4A 1E5HA 3BGAA 4AVCA 1P8JA 2W52A 4ASLA 3VBOA 4N53B 4NOTA 2XKOA 1O3SA 4KWLA 1CWPA 2GC1A 5I8YA 5C9AB 3BIWE 4QX8A 5FRAA 1KITA 2VC9A 4QPIC 4BMBA 5IVEA 2QDRA 1CX4A 5CNAA 3SISA 4MO3M 1J84A 5FKBA 5HCFA 3WP5A 5IVFA 1WD3A 3BU0A 4LLOA 3B01A 3RFRA 3MF9A 1W8HA 4L99A 4JV4A 2O0OA 3U37A 5F1RA 3R4DB 2DCZA 2VCAA 1CAWA 3CZUA 1IS5A 1J83A 1HV0A 2XBO1 5CG9A 3LA3A 3G6JB 2JECA 1W9WA 2QZ3A 3NRUA 4LO4B 4QU1A 1SLBA 1E57A 5IVJA 1W05A 1RINA 1RIRA 5JIUA 4LE3A 4R9BA 2RDQA 1S0CA 4CEYB 3EHKA 1URXA 2QQKA 4LO8A 1QJU1 3FHQA 5DAXA 5F32A 5H9PA 1PVC3 1QWRA 1S0DA 4H55A 1BKZA 4Q4W2 5F3IA 3RYKA 4RR3A 5DUVA 1RUE1 5H9RA 3M1HA 3NJVA 4AGRA 1U5ZA 5BNNC 3LA7A 4QXKA 5EYYA 5CA6A 4OHVA 2Z2SB 3WSOA 1WZXA 2W47A 4FPJA 3B94A 4A44A 1VAMA 2BPA2 4XJ8A 2BRTA 2WO3A 3LE0A 2AEYA 4Q4Y2 2FDKA 1NY71 3GJAA 1HRI3 1OA2A 2EALA 2LROA 3I59B 4RHV3 1GZCA 4LKDA 5IK5A 1HQLA 3BKZA 5EHDA 1O6UA 3WT3A 3K3NA 4RSUA 1RUJ2 2GH8A 3JBG2 2JWPA 3VL8A 3WX5A 2WN3A 2FDIA 1YIPA 2KR2A 1W2AX 3NNLA 1SEFA 4QKDA 4CDQB 4QAWA 1EY2A 3LEGA 1J1LA 2VZ1A 1W03A 3ZVXA 2P1BA 3PHMA 4QXBA 4EN9B 3RWNA 1OF4A 4FPCA 1MQTB 4NN0A 5FZDA 5HI0A 1W6QB 1DGWA 1DGWX 3O14A 2VMGA 4AQ2A 2JG8A 5LRRA 2EIGA 5GLZA 1C8NA 5LB6A 4AQSA 4COUA 3H1MA 4YW6A 1AJOA 1HKDA 1JZ6A 3C7GA 1S1AA 3VV1A 1PZ7A 2BUKA 4OZOA 5E88A 3WINE 3ZFEC 1ACCA 4QKFA 3AM2A 3AXEA 4FTEA 4BXFA 3LD8A 4K1ZA 4BU2A 2VMEA 3A0NA 1TMF2 2NN8A 3JU9A 1QGLA 1C1LA 2JEMA 5FYVA 3SEPA 5FY4A 1TME1 4CA9A 4YNIA 4CYDA 3GZTB 5F39A 2XG3A 1CIWA 2A6YA 2A75A 4GWMA 1J59A 4RL7A 4FXGB 1NCQB 2UWBA 2JE9A 3KHBA 4P9IA 1AL23 4CEWA 4EN8B 5JXGA 4YW3A 4QHBA 1I3HA 2PXJA 1OUSA 1C1FA 3ZDSA 3AP6A 5C7GA 2GZWA 3BVCA 3ZFGB 3FJSA 1WBLA 2B4KA 3GALA 4URAA 3BPSA 5A3MA 3PUHA 1BVP1 2VW2A 1N1SA 2IC1A 2A70A 1SFPA 4CUCA 4PI0A 5BNOB 2KXLA 3BU7A 1HV1A 5IWFA 5KWRA 3J26N 2B42B 5EZWA 3KF3A 3GGLA 4CCCA 4MG2A 4YG3A 5CYYA 5DDJ3 2Q8DA 4NRPA 2YHJA 4QT6A 1MS3A 5T50A 2BGPA 4G9SB 5DUWA 4CZSA 1S2KA 3CU7A 1YYNA 3AYCA 4L8QA 5CBLA 4I01A 1Z7S2 4QU2A 4J1WA 2RMU2 1O4TA 5FY5A 3WCSA 3OGGA 2ZX0A 4A3XA 1UZ0A 4ZS3A 2EXJA 5FZKA 5CFDA 1PX3A 2FDHA 2ZZJA 4YGEA 4XTMA 5HCHA 2OVUA 3WD5A 3WF0A 1R1A3 1PVC1 2QDNA 1CN1A 3IZOA 1UWWA 4ITCA 5FZ3A 4E2GA 4HN0A 1GSLA 3JQWA 4QX2A 2GMEA 4MZUA 2WT1A 1O8SA 3NNJA 4LBMA 2VQAA 4DEVA 4HPKB 4E2SA 4LUKA 3B3QE 4Y1XA 5FBJA 3T2PA 4UFKA 3AP9A 5JZGA 5IK8A 2RJ2A 4LK7A 1FNYA 2L9LA 1HRI1 2QZ2A 3ZXKA 3OPZA 4FOVA 1OUXA 5KHIA 3JB8A 4LT5A 2JDAA 2WN2A 4K21A 3ITQA 4QGMA 2VOKA 3WNPA 2DCKA 1XB9A 2ZGOA 5AFBA 2CDPA 1CPMA 1RUC3 1ULEA 2R49A 3VBOC 3WEZA 2A7AA 2VNGA 5JDBA 3DV8A 3UJQA 3V0BA 4MGSA 2HEYF 3QCWA 4FAGA 2YBPA 1VR3A 2WFF3 2XWBB 1V6KA 2YV8A 5C71A 3J7NA 2AC1A 5JVVA 1BHGA 1ND3B 4QDRA 1T2XA 1Q8VA 1FMD3 1W0NA 1AX1A 2ZHNA 3D0SA 4XXAA 2DV9A 4RA0A 5JR2A 1RL3A 5KC6A 1AVBA 2HLEA 3EXUA 3ENRA 4IETA 4JAAA 2RDRA 3JD72 1R093 4C0HA 1VBD3 3BCWA 5A32A 2IXIA 3AK0A 4YGBA 2Q8CA 4FPHA 3N9OA 3AZXA 2ADEA 4XFAA 1RUD2 1A6CA 1QJX2 2QKDA 1PO13 3POFA 4ZZ5A 1MACA 1XNKA 4EWAA 2NYYA 4PQQA 5EWSA 2RDNA 4JTNA 3MEPA 1NCRC 1HRV3 4LA2A 2RHPA 5CB7A 2WNVC 3RS6A 4CXWA 2HWB2 5FOBB 3O1VA 1CVNA 4M00A 1SPPB 4YW4A 4DXRA 1XYNA 3WNOA 3PJYA 4N43A 1PGL1 3O1UA 4CCKA 1DCSA 1IGOA 2C24A 1O5LA 4Y22A 2Q1ZB 2NPIA 4WVZA 5DDJ1 1GNZA 1GUIA 3NV1A 5FWEA 4Z92B 3FZ3A 3ZIWA 4COYA 1B09A 1H2MA 2JIGA 1S2EA 1T6BX 4SLIA 3LWCA 3BALA 3N7KA 5K0UA 1QIQA 1AXKA 1IPKA 2NM1A 3WP4A 4NIDA 3AYEA 4B3NA 3EB7A 1VBB2 1J3PA 4R8HA 2D6PA 4BK5A 5DG1A 2A71A 2JG8C 5KHGA 2WZR3 3T4HB 3WQ0A 2HWD2 1R082 2FDGA 2W0XA 1RUF3 1R1A1 3LDRA 1UY1A 2W1UA 1AYM2 3ZXGA 4B7KA 3BTZA 3DXUA 2HWF3 3AC0A 5IAVA 1I9RA 3INAA 4S2FA 4AEDA 1RVF1 4EN7B 5ABJA 1QHDA 1FX5A 5JMCA 3IN9A 3NJXA 2Q5TA 2AEZA 3KHCA 4P9GA 4XFFA 1NG0A 4JKMA 3UNPA 4CEWC 2V5DA 5A1FA 4FTSA 2JDNA 1JYXA 1E5IA 1LU2A 2RR11 4QGNA 4ISQA 5GLUA 1RUC1 3CL1A 3I3DA 4ZU7A 3PDQA 1O8PA 3R4SA 2DFCA 3RGBA 1UL9A 4CU8A 3MO4A 1FNZA 4A4AA 2XHNA 2ATFA 4Q4X2 5A6YA 3KSCA 4PF1A 4YVWC 5A7OA 3VUOA 1GV9A 1LEMA 3KGZA 3HNBM 4B4RA 1REEA 3HNYM 4A7KA 3IM0A 5ACA1 1POV3 4A7YA 3OY8A 3RG0A 4Y1VA 5F5QA 1NXMA 4NAOA 2VPVA 3RRDA 4P9XA 3FUQA 2VG9A 1PGW2 2ZMKA 1VBC2 1RMU3 1ZM1A 5GLTA 4CTEA 3VLBB 3LEKA 5CFDC 1XU1A 5B4NA 3O1PA 3H1YA 1ZYBA 1R091 1IKPA 3ZDVA 1HB1A 4LBNA 4FSJA 1BBT2 1VBD1 1YQ2A 5HV4A 2D3PA 4EYUA 3MPBA 4G3YC 5LCWL 4WM8A 3ZKUA 3E6BA 3HBKA 4K40A 4O61A 1PO11 4LPLA 5LBFA 2R062 3ZFEB 5FXWA 1EV13 4FCAA 4KNCA 2VXRA 4Q0QA 1IQDC 1HRV1 5FZGA 3H3UA 2DTWA 4UFIA 4W65A 4JTOA 5GALA 3EYPA 5GJ6A 3IKWA 2W95A 4QB1A 3QH6A 3D5OA 1PZ8A 4LHKA 1D4VB 2WABA 4XF4A 4IDZA 1DU3D 3GXUA 1HQNA 2I2SA 4NWVA 1X9PA 1V9U2 2ILMA 3WF1A 4N7IA 5FPVA 1K12A 4Z07A 3VZKA 1UN1A 2PAEA 4UAPA 5JAXA 3N7JA 1QJY2 2NQYA 2XUEA 4XDPA 1GQGA 1JW6A 4WVMA 2DVDA 5HCBA 3AFGA 5FUIA 5LATA 3ORJA 1H1MA 2JX9A 3KQRA 1YRZA 4PQ9A 1JMUB 1OKQA 2CTVA 2X5IA 1LR5A 2BNMA 2XKPA 1JYCA 4QXHA 3WLUA 4YGDA 4LBQD 4LULA 4QB2A 4S2GA 5EXOA 5I8SA 1LGNA 3R4UA 1LAJA 2VZQA 2MPFA 1RUF1 3PMEA 3BTXA 4OCTA 2YC0A 5FMBA 5C3PA 4QDQA 2P5BA 4HG6B 1YFWA 4FOQA 4L11A 2HWF1 3W9AA 1YJKA 4A6SA 3DXTA 2CV6A 1BK0A 1ZRIA 3ZXAC 5JXIA 1H2LA 2EIDA 4QGLA 1VLNA 5K4LA 2DUQA 4PI2A 1L7RA 4FFFA 1L7LA 3H7JA 1DZRA 2J42A 3KB5A 1C8M2 3FC0A 4XYXA 3I97A 3B9IA 5FDBA 1MS8A 2HJIA 2VE1A 4LBQA 3IDEA 1H30A 3OOXA 1ONAA 2ID4A 2DF7A 3RQ0A 3ZIXA 4OI2A 4GB31 5CKMA 5L19A 3VKNA 4N43C 4C90A 4IL7A 2YU1A 2AUYA 4L92A 5FLIA 5DABA 5T5PA 1GU3A 3AJYA 4E4ZA 3ZN6B 5E16A 2Y26A 2Y6GA 5FZOB 3J8F1 3OYWA 3G7DA 1SLAA 5FYTA 5FP8A 3WOGA 1POV1 1Q8SA 1RUH1 3HR9A 4A2UA 3HQXA 3O5SA 5E8AA 2EIBA 2ZGTA 3VBOB 1JN2P 4EN6B 4UOJA 2CGPA 4LK6A 3N4MA 1POV0 4ES8A 3E97A 4XFGA 1MS5A 3RI8A 2JKXA 2JE7A 3RMXA 1MR5A 1RMU1 3IAQA 2WSVA 3JZVA 3VZMA 2VTXA 4QQ2A 2HEVF 2EXKA 3HMYA 5CZKA 2C6SA 3ILFA 3OEAA 4KGQA 4XURA 3TB0A 4CU6A 1XNBA 2ZJCA 4FT8A 1CAWB 1YQ6A 4OLLA 4CUAA 2HWC2 3ECQA 4XJZA 3ZSJA 4AEDC 4XQDA 4QM8A 4I0BA 3QACA 5AVPA 3RZZA 1SBEA 4CXXA 1V00A 2P3JA 4KG8A 3S57A 4IEZA 3T09A 4CP2A 2ZEWA 5BNPA 1ASJ1 2VQ0A 4R9CA 1PVXA 1FOD3 3F2ZA 4QPGC 1COV2 3JUUA 4UW5A 1GP6A 1YCIA 4FPKA 4UBHA 4PHZA 3VBSC 5JMOA 2PTMA 3O1MA 1Q8PA 5FZ7A 2IXHA 1MZEA 5C9AC 5I0RA 4P02B 4EWEA 1FPN2 4AZZA 2WNEA 2ARBA 3I2DA 4YWAA 3PJQA 3W58A 3ZN5A 2ZA9A 1JYIA 3POWA 5H9SA 3T0DA 2FMDA 1OQEA 1SCRA 3T2QA 3UL2A 1YI9A 3SCFA 3ZR5A 1OKOA 1WGPA 3DPRA 4AFAA 2WSUA 1WBFA 1QH7A 3R0RA 3LKJA 4INDA 3TRSB 5GKAC 3CKHA 2GC0A 1GKBA 3KT4A 2WDBA 3RYPA 3AKRA 3TN91 4FPGA 4E4HA 1WA4A 3BOWA 1DZQA 3AFKA 4QKBA 1UYZA 5F3EA 2JG8B 2FCTA 2VW1A 4WM8C 1PX4A 1JH5A 5C4WC 4H14A 5EJ1B 1K45A 2YB7A 3MPPG 5FP4A 4MXWA 3TEYA 5FZIA 4OUEA 1AZDA 2ZEZA 2CAVA 1UX6A 4FFIA 4PDWC 3UESA 4F83A 2QQPA 2YY1A 3AXDA 3AMNA 3S6PA 1SMVA 4YSFA 2NP0A 3WDXA 3HWJA 2Y6FA 5JLVA 1LGBA 3POYA 5T5LA 3H8RA 3VBFC 1MEC3 1RTVA 2H6CA 3ASIA 2PA7A 2RS12 1VE0A 2Y33A 4CEWB 4AI0A 2AENA 1EUUA 1WD4A 1YUDA 2RS53 2WS92 1OXCA 1XXNA 4NVPA 2VMDA 4XUQA 5B4XA 3U11A 4KQ7A 4BQWA 4CDQC 2G4IA 3WF2A 4DUXA 4AVBA 5JXJA 1F8VA 1ZX5A 2A1XA 4NPRA 3VZLA 1ZRFA 2MHFA 1VRH3 3VDDA 1ODNA 2A3XA 3KLSA 4YVWB 1LHNA 1VP6A 3LSDA 5FZBA 1FXZA 3HNMA 4D69A 1WW7A 3I8TA 1ZBE3 4Q0SA 2Y38A 3S7IA 5LASA 2JDYA 4TTGA 2CNAA 2ZGMA 5J48A 5B2GB 3FL7A 1B35C 2BFUS 3ME2A 2Y0OA 5D1IA 1G6NA 4BE3A 4BYYA 4AEKA 3NNMA 3TAYA 1RJ7A 1PO22 1XNCA 4BQ3A 1US3A 5FYZA 5L7OA 4QX1A 2OUJA 2ZBJA 4AK3A 1TVGA 5FK7A 5CFDB 1GBGA 1W28A 4FXKB 3HBZA 4UWDA 1BEV3 1JOPA 1VBE2 1JU3A 1FATA 1W9FA 3DECA 4QKNA 5FY8A 4AHYA 4AL9A 5FYIA 4BCUA 3OBZA 1I1EA 3L2HA 5EYXA 1FOD1 1OD3A 5FQ0A 1D4M2 1U5IA 4DXTA 4ARYA 4WVVA 5JPMB 3J7MA 4KBZA 1IS6A 3WDWA 3E6DA 4MXVA 2VUAA 3M70A 4Q4V2 1D7PM 1DQ6A 5JZGB 1SDWA 2AZ5A 1YNAA 1JS9A 4LNVA 4GZ9A 4PLNA 4BQXA 2ZEXA 3HN1A 3ZXFA 4BXSV 1H4HA 1G8WA 1TNFA 5F5AA 1DIWA 1OOPA 4IERA 4YM2A 2OS2A 4LO5B 5JWPA 3MLJA 4DEQA 4XJUA 2D6KA 4BQ1A 3N7LA 5BNQA 3E6CC 2Q30A 3V0BB 3WF4A 3ZSEA 2W91A 1SLLA 1H8TA 3WW2A 5I0TA 3ZXEA 3P1IA 5J7MA 5J96B 4HVOA 2B39A 4GWIA 4UW6A 3MICA 4FQ4A 3GZEA 2ADDA 3BTAA 3UYJA 4EE2A 3SKJE 1JZ7A 3OUHA 5A6ZA 3T2TA 4Q4W3 2DBNA 3AL5A 3K4ZA 5LK5A 3T30A 1DZTA 3RI9A 2ZGNA 3F95A 1RHI2 4LE4A 1OI6A 4MX3A 2XHKA 4RGGA 3ON7A 1YQCA 5J37A 3Q8AA 4KGGA 5A32B 1GZTA 1ZBA2 4LLFA 5BNPC 2W46A 1O3QA 1QJU3 1QOOA 3HJRA 3OGVA 5F6KA 1LHOA 5DN2A 1RUJ3 4URTA 1KDKA 2RS51 1EAH2 2XJUA 4E4SA 3D6EA 1UY2A 2X8KA 3PUIA 1UY4A 3U10A 2XR4A 3BB6A 3IDAA 4Y20A 1QQP2 5ERLA 1XU2A 2O8OA 1GP4A 4N43B 4AR2A 4BQ4A 1VRH1 1W9TA 3CQOA 3ZSKA 1CAXA 1H6YA 4Q26A 2VW0A 5A3LA 4MGIE 2ORXA 2Q4SA 5A7WA 3UETA 5J09A 1YXWA 5JCTA 1ZBE1 1QNWA 5DQ0A 3LSEA 2ZHMA 2XDVA 4AE2A 1DQ5A 3DPRC 4IEPA 1GZ9A 1ENXA 2WRAA 4HT1T 4PLOA 4JRAA 2B7YA 4I2OA 4LKEA 2VZUA 3LDKA 2W3JA 3RYRA 5K0UB 4D6RA 3PUQA 4KI5M 4DUVA 1TMF3 4BIOA 1UY0A 4B1LA 1MZFA 1DF0A 1POQA 4LOTA 4L97A 2JENA 2UY8A 4MADA 3X29B 4WV8A 4QXCA 5F9TA 4QPYA 1BEV1 2ZHLA 4ZXKA 1KD7A 5HCAA 1OMIA 1GWKA 4M4PA 1AF9A 3S0MA 1NZIA 1QXRA 1ZRCA 1Y9MA 2ZTNA 2A6VA 2WT2A 2WKKA 2OQ7A 5F5IA 3K4DA 4DZGA 1XPWA 2VUCA 4AEDB 1GR3A 2R072 5ABJB 4AAPA 4BH9A 2H0VA 5FXZA 2DUOA 2V09A 1BVVA 4ONUA 1W3XA 2OXBA 4M3CE 4B1MA 2GMMA 1RUG2 3WHTA 4Y1ZA 4YVSA 3MDPA 3NNFA 5CISA 5FJHA 2BBAA 5HBAA 1JZ2A 3VBSB 2UYBA 3RZJA 2P2KA 1Z7S3 1OURA 2B5HA 4LITA 3VDDC 4BIFA 3FWEA 2VVDA 2JDUA 1SLIA 2BGCA 4M3CA 5LY2A 3C8XA 3U07A 2OT7A 3B00A 1H4GA 1XYPA 1PMIA 2PHTA 3PUAA 3VD7A 1NLRA 2XB6C 5A7SA 1E5RA 1AR72 2HYXA 2ZX1A 1JHJA 2Z5WA 3OY8B 1F15A 5C3RA 1TQ5A 4Q4W1 4AW7A 4PLMA 4EZ4A 1Y4WA 2D98A 3DL3A 3DKQA 5AC92 1CGPA 3P3NA 3V64A 4BQ5A 3A23A 3IT8A 1SZBA 3BN6A 2LTNA 2W5FA 2XLGA 1H9PA 3CJXA 4ISRA 2ZGUA 4Q4Y1 3VL9A 1W90A 5FP7A 4CCOA 1VMFA 4WM8B 3BODA 2WO1A 1S0IA 3B7MA 5C4WB 4XEZA 4AI9A 1RUJ1 4XVHA 1UAIA 2QE3A 3JBG1 2ZGLA 1UOJA 1WCDJ 1O3RA 2R32A 5FO7B 4JDMA 4XIKA 4QQOA 5FV3A 1C4RA 1S0GA 4PDWB 2B8MA 2FDFA 3WVJA 4AF9A 5GZCA 5J3UA 5A33A 1MS0A 4XFHA 4Y24A 2WC2A 3VHOA 4RGAA 1QJZA 3VBFB 1W0OA 1S4CA 3P3PA 1OFNA 2W68A 3D3AA 3I4IA 1OOPC 3OGJA 5A80A 3KGLA 4KWJA 3ALQA 1PM7A 5EFUA 5IVVA 2UURA 5FBZA 1S55A 4WVMB 3MUY1 4HMZA 2WZ8A 1TMF1 5FPXA 1ST8A 2D93A 2WUHA 4Q0VA 2P6CA 5DMYA 1JTZX 4HXCA 3AKSA 4EN0A 1RUD3 4BZ4A 2FHRA 3VD9A 1B35B 4FQZA 4XUOA 1W8NA 2XVGA 2PHUA 1VJ2A 2Y6HA 3HN3A 4IW3A 5GLVA 3KD4A 4XIOA 3HAGA 1D0HA 2E53A 3VB9A 1UPIA 2JJ6A 4FOYA 1UIJA 2QQNA 4OMDA 2BTVC 1EYBA 3DCQA 3WP6A 2CHHA 4GH4A 5DG2A 1ULFA 2F4LA 1LU1A 1K3IA 1HJFA 2VZSA 4O9EA 2VOWA 3APBA 3NV2A 1ALYA 2R30A 2WFPA 3VN4A 4LBQB 2W1QA 1VRBA 4CDXA 2ETEA 1F31A 2ARAA 2WR9A 4IE6A 1S2BA 4LIVA 2LW8A 1TZOA 2J22A 3M8LA 1Z7S1 5IHRA 2RMU1 4OI0A 2G9GA 2RM22 3KV5A 3VD5A 1VBB3 2F6BA 2XUMA 5BXXA 3W20A 4MGZE 2R042 1NA1C 2QQWA 3MIDA 2D6LX 3OYWB 2BDRA 2HWD3 2CGOA 1J3QA 2YBSA 3C7FA 3GHNA 1KFXL 2E7QA 1AYM3 4Y5SA 5IW0A 5JR7B 4EV0A 3WXPA 2B45X 1MVEA 2EXHA 4LHSA 1VPHA 1PZ9A 4F7ZA 3A7QA 1AR62 1UZZA 5E89A 3MW2A 4LTAA 1QDCA 1W8OA 3ZSLA 4BWOA 1VBA3 4TLFA 2GU9A 1KJLA 1TME2 1W99A 4YFWA 2XQXA 4F3JA 4JVAA 5C8CA 2ZABA 1DGRA 5FZ1A 3RZMA 2X05A 1U12A 4CRQA 1XE7A 4G4FA 3V0AA 3AP7A 2F4PA 3FUOA 4HETA 1X36A 1RVF3 2D6OX 2FQPA 2ZHKA 5FZCA 3AZVA 2V73A 3NKGA 4TLGA 5LBBA 3LEMA 4Q4X3 5A7NA 1LCLA 1GLHA 5BY5A 3LA2A 1LOBA 1UPSA 2IUWA 2YMZA 1QH6A 2VUDA 5BNPB 3N9QA 2OUHA 4IEUA 4YVSC 3U4XA 1W9YA 1ZZCA 2VZ3A 3LIGA 2BZDA 2Y60A 4DIQA 5LA1A 1G9AA 2A6ZA 1XNAA 4FBFA 4MGQA 2RR13 5FPZA 1WCSA 4CCNA 4Q29A 3ZXJA 5J36A 2C0ZA 3S5QA 4ZPIA 3Q8BA 4LHNA 1VBC3 3K2OA 2I74A 3JD71 3ZYFA 4X6QB 1RUI2 1VB2A 4KMQA 2LALA 2BQPA 4EZHA 1T6GC 1ENRA 1RUD1 5EQUA 2R7EB 5ACA3 1QJX1 2ZGRA 2ET7A 2JE8A 3DPRB 5LEJA 2KA3A 4NE9A 4Q0PA 2R0HA 3I49A 3IB3A 3M3IA 4ZS2A 1LEDA 2HWB1 3CZJA 2WJSA 2VR4A 2DUPA 2WLQA 3VKMA 4BLJA 1UXZA 5JOWA 3WNNA 1UX7A 3PVOA 5GZGA 4FOWA 4CP1A 2EIEA 2WWUA 4H2AA 5D8AA 2JG9A 4OMCA 4Y3OA 2X29A 1V6MA 2VVEA 1V9U3 1VAVA 2RDSA 4RR3C 4RHV2 5D2AA 1WMDA 4MXWB 4GD4A 2VULA 4QWNA 1QJY3 4ZU5A 4N7UA 1ZRRA 1WMEA 3ZYBA 2EXIA 1FV2A 3MFCA 2V4VA 1LNSA 1GANA 1WLCA 2VTXJ 3DKWA 3H3ZA 3KCXA 5FPBA 4F8AA 3MW3A 2B46X 1VBB1 4DFSA 2K2SA 3CF6E 4M0HA 2JICA 2XL7A 4YZ3A 1RYYA 4XJWA 2RVAA 4AEMA 2RS32 1KDMA 1VIWB 4Y1UA 2GDFA 4TN7A 3FBMA 3UJOA 3UKNA 2HWD1 2V4AA 1R081 4OI4A 1DYOA 1JUIA 3N9NA 5FZLA 3ZFFA 4WVWA 2VXJA 3J9SA 2P4EA 5F3CA 4LORA 3RDIA 3ZMNA 1AYM1 4XCBA 5ANNA 3O1SA 1YWKA 2W92A 2ZPXA 2ZXQA 4XBNA 4Y1YA 3S7EA 4J1XA 2BP6A 3WQBA 5GZDA 3VDDB 4CP9A 2TNFA 2VO5A 4H3WA 1S0BA 2PELA 2VH9A 4JGYA 3BIEA 1VBA1 3U1XA 1W6NA 4GKYA 4IGOA 3ZO0B 4CUGA 3RZHA 4FO9A 4RFT0 4XC9A 4RS5A 1IZ3A 1WKYA 4MSVA 2XJRA 2C4XA 1V6OA 4CE8A 1H8VA 3CDZB 5KHHA 1AL22 5IFPA 1XNDA 1XRUA 5DAQA 3USSA 3GDBA 2FCUA 4FFGA 4OFGA 2YC2A 3A4UA 5F7UA 1ZZBA 4OZXA 4Q4X1 4LO6B 3ZYIB 4GH4C 1CAVA 1OC1A 2X53S 2QQMA 5FQ0B 1N1YA 1CZSA 3IAPA 4XPVA 3T1MA 3AYDA 3CJIA 4LQRA 4IXLA 4CDXC 4Q8KA 3KV4A 1WCQA 1ZVFA 5DZEA 3TNPB 1WMXA 3LGRA 3KVAA 1PGW1 3ES1A 4GB33 1VBC1 5FMDA 1SFYA 2J1EA 1GOHA 3PLQA 3PVBB 4NIIA 4UFMA 1BBT1 3DYMA 3MIFA 3WW4A 1KGYA 1GICA 3J8F3 1OOPB 2W2IA 3I2KA 3RVHA 4LEJA 3RWKX 4DNYA 5A7QA 4OHYA 1RUH3 2O1QA 2W9XA 2R061 4Q27A 3EMRA 3KCCA 2ZAHA 4RN5A 5SV8A 4BQYA 1QXJA 1CZTA 1C5IA 2RE9A 1H8TB 4HLTA 3SCHA 4COZA 3E5XA 3N35A 1UOBA 4GJYA 4DB5A 2FZ2A 2NMOA 1WLTA 3UGHA 2C1FA 2VCBA 1JZ4A 1OLQA 3QD6A 4NHLA 3VHNA 4UW3A 2J1UA 4IV3A 4DINB 3POEA 1COV3 1IQAA 1V9U1 4MVTA 4FPFA 4CPBA 3O12A 3P6BA 3VZOA 2P34A 1QJFA 2Y64A 5KXEA 3MZHA 2YBKA 1QJY1 2WYSA 1UYXA 1MPXA 1ZA4A 5JZGC 1W6OA 2ZX3A 1W04A 1FPN3 4TXWA 4KU7A 5K8SA 5FMOL 2YGMA 3OUIA 5KBFA 5LA0A 2LS6A 1ASJ3 5E6HA 3WNLA 5FIXA 4YFZA 2JIJA 2WFF2 2VECA 1DBNA 1UO9A 2Z79A 5CAZA 1I5PA 1OVPA 1CR7A 1HB3A 4AFDA 3M2MA 1LOEA 1O4YA 4K8FA 2E31A 1FMD2 4HFSA 4P5HA 4CVUA 2PLV2 2GNMA 4LKSA 2YU2A 1GYKA 1JZ8A 1CAXB 1BLZA 1DQ4A 3KWVA 1NA1B 1OH4A 4HK9A 5A7WB 3O1OA 1NT0A 2VQTA 3KQ4B 4IEVA 2XJVA 2V72A 1C8M1 2CU5A 4XJ9A 5GZFA 4CCMA 3I59A 1ND2A 2VZTA 1LESA 4NR1A 4FTBA 1DQ1A 3AZZA 4N9HA 1H2KA 3TN93 4LJHA 5KXDA 5CFCA 3QBQA 5HPOA 5A3TA 1YQ5A 3HVDA 4NPMA 5D8AC 5I93A 3NJYA 4MHUA 2JG9C 2VZRA 4AVTA 4MV2A 3RNSA 1UZWA 4UF0A 2QJVA 4D3WA 4H7MA 4RD7A 5FTTC 1MQTA 1RJ8A 2ZX2A 1YC61 2YPJA 5LA2A 2BERA 3A21A 1DFQA 1LHVA 1W0PA 2HWE2 2XVLA 3ILRA 1BMV2 3DF0A 2XWJB 5FYYA 1X7NA 4YW5A 4Y26A 4CUBA 1RUOA 4LBJA 5JUVA 3ROUA 2VL4A 1N47A 2WBKA 3IDBB 4HOOA 2Y6LA 3B5LB 5EP9A 3T4VA 1OT5A 3BTYA 3ELNA 4YVSB 5A7PA 3ZFFC 2QQJA 3EQEA 4QHOA 2R1DA 4UFJA 1QOSA 5L9BA 1OPMA 3VDCA 3ZYPA 4AYUA 2E9QA 2WZR2 3THTA 3RJ2X 5FY7A 1SG3A 1QY4A 3QH7A 3KV9A 3SNMA 5K0UC 2HWC1 1NQJA 1PO23 3JQXA 3FFQA 1H1AA 2KM2A 4M3CB 4XQWA 2Q8EA 3ZKYA 3ZYRA 3K4AA 3WNMA 2A3WA 2FMYA 4L2NA 1AL0G 1OH3A 5FAXA 1VBE3 3OF1A 3T08A 3WV6A 2VQUA 2K46A 3AMHA 4YRDA 3H42B 2VU9A 1PIV2 2VZPA 3VHRA 3JB4C 4P9WA 4HONA 1COV1 1D4M3 1W2OA 1VB4A 4HANA 1UU4A 2CWMA 2ET1A 4P14A 4NHMA 3T0AA 2AH2A 2YUEA 5ABJC 4R9AA 4NPLA 1W39A 4Q4V3 3ACLA 4QX0A 4QX7A 4D7TA 1FT9A 1SLCA 1FPN1 3O1RA 4FP2A 4IQPA 4RYDA 1EUTA 3HEIA 2Q1FA 1OQ1A 1US2A 5IATA 1V70A 3FFZA 3NV3A 4RR3B 4YM0A 2IXKA 4NIAA 3UV9A 1UNBA 2CDOA 2E7TA 2JDMA 2TUNA 2P3KA 3A22A 5LBCA 4Z2AA 3I2OA 4HZFA 4I3GA 2XH6A 3WW3A 5CU1A 3PUSA 3TEZA 5A33B 1V6LA 5EIYB 3GJBA 2ZACA 3AVRA 5IVCA 5FZFA 4Z2WA 2N7GA 4PCRA 4L9BA 3ZM8A 4JQTA 5L73A 4FPEA 2F17A 1DDLA 4PIXA 4JQRA 3KT7A 4BLIA 3AMQA 1UKGA 2BYVE 5GLWA 5HXVA 1AYN2 1L3JA 2XLAA 3J7HA 4OVEA 1CAUA 1J1TA 2GAUA 1RC6A 4FFHA 2JXAA 4PIZA 1LOFA 4XTPA 1EV12 3CHXA 2DCYA 5C3SA 1W6PA 1ZBA3 3PTYA 1RUNA 2B9UA 1IG3A 1TG7A 4IV3C 1L7QA 4TYSA 1REDA 4IE4A 2RS11 3ZPYA 5C5UA 1YLLA 1XSQA 3VD3A 1Q5OA 2WS91 5DUUA 1LB2A 1CQ9A 3M3EA 3KV6A 2OW4A 5F5CA 3VBRA 1NXD1 1AR92 1ND3A 2DURA 2D3SA 3SLIA 3WR0A 4OI1A 1QQP3 4MGYE 4HVQA 2ORZA 4GH4B 3DN7A 4JDNA 2I07B 4HSJA 4MGKE 2XGXA 2ZKNA 4S2DA 3B02A 5TSWA 2A6XA 3NWKA 2ARCA 4ATFA 2VBBA 1CD3G 3LZZA 4XF9A 1ZZ7A 1GOFA 2VTFA 5F2SA 4AAXA 4DY3A 4CDXB 4YZ4A 4CP0A 2RJKA 1CX1A 3WNXA 3NVCA 1U5YA 1OBNA 1AUYA 4Q2FA 3FX3A 4IE5A 3EO6A 4YM3A 1PO21 4IESA 4A3ZA 2CSGA 3OCPA 4I0WB 3WDVA 4EJRA 4XDQA 4ZZ8A 2X5IC 4NROA 4Y33A 1VBE1 2SBAA 3J4UH 4I30A 5FYSA 2WZEA 1WUVA 1Z0HA 2VBPA 2HH9A 4GA9A 1LOAA 3O0VA 2WQZC 4M0NA 4FI9A 1LTEA 4AGGA 4CU7A 5FKCA 1FV3A 1D4M1 1ND2C 2PAMA 1MZ6A 3M3QA 4W6XA 5CVRA 1PK6A 2VGDA 2QUOA 1R64A 2E33A 4MLOA 4XFBA 4AI2A 3KM5A 2MNGA 4GJZA 4Q4V1 5LA9A 1JHNA 2XJSA 4FP3A 4E8CA 1D2QA 2OZ6A 2HEWF 1OVSA 1I6XA 2DU1A 1RUG3 4CDWA 1SHWB 2CAUA 3K3OA 1W9SA 2VAUA 1SLTA 4QPIA 3SKVA 1BQPA 4HSLA 1H2NA 4L0PA 3CO2A 2WINB 4AI3A 2BFUL 1UY3A 5FY0A 3V0AB 3TNQA 3W5MA 1MS9A 3JXSA 2XPJA 2W39A 1HN1A 2EAKA 5JIAA 4YYOA 3U75A 3RPQA 4AVSA 3IWZA 2NMNA 3SH3A 2BOJA 1UW8A 4XUTA 1H1IA 4IEXA 3POBA 2VZOA 1NAEA 4HKOA 3FN9A 4PIYA 2ZOEB 3OJBA 3POIA 4Z82A 5IFTA 5FZAA 1RHI1 3I7DA 1SCSA 4Y4YA 5A3PA 2IVIB 3NJZA 5BNNA 1TEIA 2J1VA 3D0JA 3ZYGA 4BM8A 2FD8A 3M3CA 1ZBA1 3L9JT 1DQ0A 3I3QA 5EPAA 1O59A 3RMYA 2V5YA 3RJRA 2H0BA 1C5HA 4ET7A 1H9WA 1HQWA 1YI7A 2W08A 2VOXA 3OBRA 5GZEA 1LRHA 5F3GA 1M06G 1EAH1 5KHJA 3KMHA 4C1WA 2MEV2 5FLHA 3ATGA 1OF3A 3GHMA 1QDOA 5C70A 2E63A 1QQP1 3AZWA 1BZWA 4Q4Y3 2Z42A 5D8AB 4P00B 4LIUA 2JG9B 3MI8A 2ZS6B 1YJLA 1C28A 1YEWA 3WQ1A 1WA6X 2GN3A 3AP5A 3JBG3 2ZEYA 3VBUA 2ZGPA 4IGPA 1C3HA 1OD5A 5FO8B 2BW8A 5K9YA 3NMBA 2ZZQA 4JKLA 5F8PA 4M3CF 4DXSA 3MIGA 4P9JA 3SQOA 1JXNA 2D44A 4UBGA 4W6YA 1UKRA 4D6SA 4DRVA 2C9KA 3MW4A 4XE9A 4Y22B 4RGKA 1A3KA 2D40A 5A3WA 4Z8BA 2YG0A 3AKTA 2FBEA 3ZFFB 4A7ZA 1AR82 3FE5A 1UYYA 4GMP1 3AKQA 5T3NA 1KS5A 1PMJX 4K1YA 1W2TA 1JYWA 3ZXDA 2UYAA 4GMP0 4R4XA 2Z69A 3AMPA 1OLMA 4XBQA 2R071 2WO2A 4QX3A 3WP3A 4CP9B 1LOFC 3WNKA 2P6HA 4XMAA 4JGYB 4B4QA 1RB8G 3O0WA 3R6SA 1W6NB 3OD4A 4XACA 4RFRB 5FXVA 2J1TA 3FLRA 1SBFA 1N3OA 4TSVA 1RUG1 2DCTA 2XJTA 3S30A 4MYEA 1QF3A 2TBVA 2K9ZA 1VMHA 4WM7A 1Q8OA 4K20A 3IMNA 4NHYA 4XF3A 5DXDA 4YW2A 2XONA 4XF0A 3THPA 1MEC2 3GZAA 3LFMA 4K7JA 3VBRC 1DHKB 2PFWA 3NL1A 4ZKTB 3FHAA 2GH2A 5DZGA 3BOPA 2RS52 2RM23 1PNGA 2RJLA 3HD8B 3NSTA 5LRSA 1G9FA 1HX6A 4IEOA 4JZRA 3NV4A 3HIFA 2R043 1ZNPA 1AJKA 1GMMA 2IFRA 2WNOA 1IPSA 2JDKA 4XW3A 5FLJA 2PAKA 5ANQA 4KBBA 1AR71 1CESA 3CJIB 4ZXEA 4ASMB 5FYHA 2GC2A 1GFF2 5APAA 3ZSMA 3Q8EA 1F5FA 4GIQA 2EF6A 3TOJA 5AC91 2PHRA 4P9YA 1AR63 2RMU3 5FYUA 3UGFA 4DS0A 3WG2A 2RV9A 4HL0A 5JOYA 4D6QA 3I2HA 3M4FA 4FAHA 1HXS2 1W2NA 2XJQA 4IGQA 4XZPA 2O8QA 4P5YA 4OHZA 4A6OA 2ZGSA 3SH5A 1W6MA 3HQUA 1JOBA 4Y4RA 5L7OC 4YW1A 2FCVA 2ERFA 3HT2A 5FREA 3OD0A 4XQ4A 1S0JA 3SHRA 3CIHA 4CDWC 4IV3B 1NE6A 4A42A 2UWCA 5IT6A 1JODA 3PMSA 4LKFA 5CKNA 2DVAA 3B69A 2HBUA 2QQLA 1LODA 1R1ZA 3GBGA 5A3NA 3VD4A 1N3QA 1C57A 4FPYA 5FJKA 2OPWA 3LIHA 2JD9A 4QQLA 1UU5A 4Q8LA 2UY9A 1W6OB 3OTFA 4KG0A 2QBXA 2G19A 4HKLA 1K42A 4AI1A 1IOAA 4AGVA 4TZDA 1LULA 1F2NA 4BISA 2XXZA 5IJRA 1RUI3 4D94A 2GNTA 1UMZA 4O65A 3CBNA 2VCCA 5FUNA 3KS7A 2J1AA 1JYNA 1HN0A 1OSGA 4JC1A 1ZZ9A 2BWAA 1J58A 4DQAA 2DFBA 1M4WA 2EAAA 1H8TC 5C6CA 3GF6A 4WBBA 2CY6A 3UGGA 3IPVA 2WIIB 3JD73 2PHXA 3H8UA 3USUA 3WDYA 2XBO2 1NCRA 3UKTA 2X5IB 4FPOB 1IPJA 4KWUA 2WNVA 3GBWA 4JGZA 3GYDA 5CADA 1ENQA 4B8EA 1G9DA 3NO8A 1JU4A 1F4AA 4YG6A 1OFSA 3D82A 1QJX3 3SC7X 2PQSA 1ND2B 4H7LA 4IV1A 4C0BA 1QJU2 3POGA 1AXZA 1LHUA 1SDDB 3S5AA 1XE8A 3DEMA 3N9MA 3PVEA 2HWB3 1RUE2 5CFCB 2RM21 3WG3A 5FZ0A 2PHFA 5FXXA 4HVRA 4RQPA 3R05A 5FR3A 3KT1A 4PT6A 2R041 3OBTA 4YW7A 5HV0A 5T5OA 5T54A 1QEXA 1YIFA 2RS33 2DCJA 4UF0B 4JKKA 1NY72 1XSRA 5LWBA 1ULGA 3MV01 4IEQA 2BVBA 3DYOA 4Y5TA 3FBYA 1G7YA 3LQCA 4XHBA 5H9QA 3T2OA 3VBUC 4GALA 1KQRA 2W1WA 3N9LA 2YXSA 3PL0A 3WG1A 4LA3A 5HXMA 1AR61 3CEWA 5I8TA 5DPNA 2OYZA 1IG0A 1UYPA 3OEBA 4YPJA 1GNYA 3M7AA 4UW4A 3U4SA 1KXGA 4QQPA 2JB4A 4E27A 1ULCA 3IIIA 5IUQA 1R083 3GM8A 4AOCA 1RITA 2IXJA 2AR6A 2VMIA 5BPXA 4DPNA 5SV5A 1KFUL 3FLTA 1NUKA 3OPTA 5J1XA 4HK8A 4CCLA 5L36A 2WYFA 1ZREA 2DDUA 5A1LA 2K0GA 3NQHA 1XBFA 2PQQA 1BCXA 1JZ5A 3MIBA 3Q9OA 1X8MA 1DYKA 2YDEA 2C26A 2CL2A 1G9BA 3WG4A 4AQTA 4DMIA 1IS3A 1QMJA 4IEWA 2IWGB 3T0BA 4ASKA 2E6VA 4BJ0A 4WM7C 3L2YA 2BVVA 4V2WA 4D7SA 5FO9B 4YVWA 2YYOA 3K51A 1UIKA 3EJKA 1SBDA 5J98B 2D97A 5LW9A 3WZ1A 4YARA 3MLKA 3DGTA 3FLPA 4I02A 4Q5OA 3ZMOA 1I5ZA 2BNNA 2D7FA 1RUI1 5G04L 4E4DX 1NQDA 3GCXA 3H8OA 4MGTA 2CYFA 3VKOA 5I0DA 4OUSA 3VBHA 1AX0A 2VBDA 4X6RB 4NAMA 4BOWA 4CXYA 2EICA 1TE1B 4QD2A 3N7MA 1F35A 2VNOA 3WDTA 1CZVA 4PJYA 3ZOIA 1LECA 2XVKA 4PBPA 2WNUA 1BBT3 4AVAA 4NIHA 2CWSA 3PTRB 4CU9A 3LOBA 1GZWA 5T55A 2OPKA 5CIRA 2WWSA 3KVBA 1V6IA 1K5MA 2ENRA 1CIYA 1FAYA 2GMPA 5FYBA 4RHV1 4EWDA 5LY1A 2R063 1F5JA 3URFA 4U2AA 5FZMA 1CAUB 4W4ZA 4OHWA 2ZGQA 1PVC2 3LF7A 4CSWA 5A3UA 2EVXA 1ENSA 3SCGA 3SMHA 2ZX4A 1N3PA 1W6PB 4GWNA 4AFCA 4S2HA 4CDUA 3VGIA 3O1TA 1XNTA 1DLLA 2RS31 5FP9A 2WAAA 3ZLIA 2YGLA 1HRI2 3PVNA 4HBNA 2BGOA 4OQ8A 5E1RA 3RZGA 1XJAA 4OQ9A 1X8EA 3HPNA 3NKTA 4R52A 3ACGA 3VBRB 4AI8A 1RXFA 2KD7A 4BA6A 1AHSA 3T1LA 3ZX7A 3TEWA 2HBTA 2PLV3 2Q1MA 3FMGA 2BU9A 4HN1A 4AG4A 2QFEA 3I2JA 2YFZA 4GULA 2Y6KA 3CMGA 1NKGA 4MUVA 3ST7A 4DRRA 1QNYA 4B4PA 4XILA 4BPZA 2VY0A 3FHIB 3WDUA 1STMA 2VJXA 2Z4FA 5I91A 1Y43B 1YO8A 5LZ6A 1W3VA 1BK1A 2YZ4A 4MH0E 1E5SA 4XFIA 4XZUG 5FZ8A 3AL6A 1AL21 3WUDA 5C5TA 1DP0A 1H6XA 4DUWA 5DUXA 5FK8A 5BV6A 3AYAA 5KHKA 4KH9A 3WQ7A 3OBAA 2J7MA 2JB8A 3A0KA 3H9AA 1QU0A 4JGZC 2VM9A 2D3RA 2XMLA 4YLZA 3AVSA 4C91A 2D43A 2DTYA 1C8M3 4COVA 4IV1C 1V6JA 4E2QA 1PK6B 2LUWA 1H0BA 1REFA 2HWE3 1OPOA 2JKBA 4FPLA 5L7OB 1LHWA 1JOJA 3ZXLA 4NHKA 4RQPC 5DAVA 1XC6A 1A8MA 1OA4A 2JDZA 1G86A 3OG2A 5BYNA 4GWJA 4N9IA 1UXXX 1Y3TA 3J7LA 4IEYA 4XABA 4O9GA 2VVFA 4ZONA 4CDWB 4QPIB 4DY5A 3W5NA 2JDPA 1PGL2 4OULA 2AREA 1APNA 5DDJ2 3LCPA 3VKLA 5BUVA 3NAPA 5JSPA 3WF3A 2IZWA 1UZVA 1UU6A 5F37A 3MLLA 4JHTA 2ARXA 1V0AA 3BI3A 1OHFA 2C5DA 2R0FA 1NX9A 3SH4A 3E5UA 1GOGA 4CPBD 4W6WA 1Y9GA 3PNAA 1DGRN 1PIV3 4P08A 4PF5A 1BJQA 1JYVA 1VBA2 1J3RA 1UZYA 1VALA 2A73B 4LBKA 3OSDA 4NMIA 4QM9A 1HIXA 1ULDA 2VOVA 4DOUA 5A70A 1DGLA 5FZ6A 2E51A 1BXHA 3GZUC 2VCMA 2HWC3 1R1A2 1Q43A 3POJA 3OGSA 4QPGA 4XHXA 3H8XA 4KL1A 3K48A 1NE4A 4CCEA 5BNNB 4XCAA 3VBSA 1LJ7A 2WO7A 4MHRA 1RVF2 2W1SA 4N53A 2VNVA 4B29A 5K7PA 4GAZA 5C3QA 3ILNA 5C9AA 2UU8A 5C8CC 5F2WA 2WFF1 4GXLA 4BB3A 1GNHA 3AKPA 2Y0IA 3CNAA 1G9CA 4LBLA 3WUCA 2OX0A 1UMHA 3O0XA 5JSRA 5JXHA 1EPWA 2ZAAA 3D4KA 5AFEA 1YFYA 2GP5A 4YZ5A 1FMD1 2RR12 4DXZA 2PLV1 1A34A 1RUC2 3WW1A 1QOTA 3D8CA 2G9ZA 2YC4A 1UQXA 2XLFA 2QVSB 5C3OA 1ULPA 1MZ5A 1ZA7A 3AB0A 3MIHA 5FMOS 4XFCA 4LOSA 3VBUB 3TWIA 5FZ4A 2ZMNA 1NLSA 1IS4A 3VBHC 4GQ7A 4CEYA 2DU0A 4QDSA 5ACA2 1AYN3 4K3UA 5C4WA 4Y20B 4BK4A 4BHPA 1KRIA 4J25A 2BJSA 5T5JA 1X50A 5CEHA 1F4HA 3OB8A 1SACA 3I3EA 2WNUC 1ODMA 2GALA 2WLPA 3ZYHA 3MF6A 4XDOA 3OUJA 4PDWA 4M4RA 5I0UA 4YM1A 2VNRA 1K5MC 1R092 2IVJA 3BPZA 4XMIA 2BV4A 1VBD2 1O7FA 2TEPA 1PM4A 4NO4A 2BEOA 2AACA 3VBFA 1WW6A 1KEXA 1AR93 2HWE1 3H50A 1PO12 3IIAA 5ISLA 3LDBA 1BMV1 4A41A 4N8MA 4NUBA 2WQ4A 5M0TA 1QXPA 2HYKA 4UXAA 3VZNA 2O14A 4COWA 1MVQA 1HRV2 3MUZ1 2R6QA 4CDUC 4CDQA 3ABZA 5FP3A 2EA7A 4UFLA 5FWJA 1W8TA 2QQOA 3NW4A 3V65A 1Y7BA 1ZRDA 3ACIA 4PBOA 3PIGA 4WM7B 2RS13 3ZR6A 2PHLA 3LEIA 4JX0A 4NWWA 4V2VA 5IVYA 1W6QA 2WS93 2WZR1 2HKXA 3EBRA 4I09A 1KS4A 5EV7A 4AEJA 5FZEA 4E8DA 3VHPA 3RZKA 1B35A 5A6XA 4HKWA 1JBCA 2GP3A 4XUPA 1ZZ6A 2QNKA 2WL1A 5FPLA 2QQVA 4CCJA 4EQVA 2GNBA 1F9KA 1CJPA 1PIV1 2WT0A 3IDCB 1HDKA 1D0GA 1PHMA 3SXWA 1CPNA 4XETA 1Q3EA 2W87A 4NRMA 1OLRA 3TYJA 5JPNB 1NCQA 1RUF2 4AXOA 5FPAA 2LRPA 2R16A 4JGYC 2WAOA 5EJZB 3THCA 2HWF2 2QTWB 1YHFA 2OZJA 3AZYA 3PIJA 5FY9A 2WQ8A 4X8NA 3ZFGA 3I3BA 4AQ6A 2FDJA 5JOZA 3IMMA 5L9RA 3THDA 2IFWA 4RS5C 5DAPA 1ULOA 2OKXA 2ZKLA 4R4ZA 5BNOA 2SLIA 4A45A 1W6MB 2D6NA 1U5XA 2H6BA 2G1MA 2XQRA 1PNFA 3C2UA 3H1WA 1AX2A 1X33A 3I2IA 4EROA 1DYPA 4C1XA 3ZYJB 4XJAA 2ZCWA 1HLCA 5FZ9A 4LHLA 4AVVA 3MV11 2G9FA 2VMCA 2VOTA 2NZ9A 3LPGA 4XF1A 2A3YA 4GB32 5KXBA 3I2FA 2BBVA 3T3YA 3CJIC 4Q1PA 2YPDA 4O7XA 4I0AA 5DZFA 4UT5A 3NAPC 3J8F2 4D7YA 1AYN1 1RUH2 2DWRA 2P3IA 3E5QA 3H0OA 5IK7A 5JI7A 3POSA 1EV11 3TEXA 5JSOA 2WWJA 1W8UA 2QCSB 3KZ4C 1RMU2 4HPKA 1Z78A 4ATEA 4M01A 2D5HA 2DBIA 1WCUA 4Q1RA 2W94A 5A1AA 3NNGA 1GQHA 1QJEA 2MEV3 2YFUA 3N3HA 4JCKA 1AR91 1RHI3 5IAXA 4GKXA 3IPVB 1O5UA 1Y9QA 3USUB 4QB6A 5A6QA 1NCRB 3PURA 3AX4A 2WNVB 1GWMA 2A5ZA 2Y34A 4N53C 3ETPA 1HB4A 4JGZB 4IE7A 4X8PA 4UFHA 1W2UA 2PMWB 4QMAA 5AVAA 4IV1B 5FY1A 5IVBA 1ASJ2 5I0SA 3B93A 1EAH3 3OPWA
chains in the Genus database with same CATH topology
1WLDA 1X82A 2CGNA 4V1PA 5FFOC 1TNRA 5EJ3A 4RQPB 4JDOA 2ES3A 2A6WA 3GBFA 1N1VA 1XYOA 3CLPA 1O4ZA 1AR83 4I3PA 1LKNA 3VKFC 2PYTA 4YGCA 4B7EA 1NYWA 1WMFA 2DVFA 2P37A 4AHWA 4CEYC 1CJDA 3LB9A 1WLWA 4LBOA 3M3OA 5LK7B 3AMMA 1Q8QA 4J6GA 1QKQA 3VZJA 1IKQA 5CG8A 4WZFA 3TN92 3U0ZA 4ES9A 1D2SA 1UF2C 4SBVA 4GMP3 4YG0A 4XBLA 3MGUA 2GSYA 1OA3A 4FVVA 2R073 3N36A 3GNEA 2PN5A 2XL9A 4QX5A 2IXLA 5CFCC 1LOGA 4QQHA 1CONA 1HW5A 4LR4A 3LAGA 3B9CA 4KWKA 1VAKA 4P9LA 3MIEA 1A8DA 5C8CB 1MQTC 4LUMA 5KXCA 4XOGA 1SFNA 1YFXA 4KU8A 4R9DA 2DYCA 1LOCA 3ZN4A 1DG6A 3MYXA 1FI2A 2JD4A 2WA4A 2VUJA 4AWDA 2AYHA 3DUIA 2YROA 2GN7A 4XXPA 5KC5A 1HXS3 1AR73 1RGSA 2E7AA 2DVBA 5C33A 1NOVA 3VBHB 3WY6A 4META 5AC93 1NCQC 4WZCA 2MEV1 1A78A 2GC3A 1IHMA 3W59A 1UCXA 2NLRA 5C8WA 3ZFGC 1EPZA 2WNUB 1GZWB 4Y5Z0 1YFUA 4ORFA 1K5MB 5BNOC 4AFMA 1MS1A 3WHUA 1ZZ8A 2GNDA 1FOD2 4U36A 1S0FA 4YZ1A 1BYHA 2I45A 2OA2A 2VMHA 2BNOA 1LGCA 2AGSA 4OUMA 4CDUB 1AXYA 3HT1A 2R1BA 1AR81 2WA3A 4JRLA 1JUHA 3H7YA 4AHXA 5T52A 5LEKA 1SQ4A 5IK4A 4TWTA 3ES4A 5FOJB 2Q8OA 3ZFEA 4K9SA 2XBO3 3JCIA 1PGSA 4Z1VA 3RSJA 1UD1A 3QOPA 1MEC1 4N90A 2Q0AA 4K6BA 1NZCA 2IXCA 1RUE3 1U0AA 5GM0A 2ZGKA 1XQNA 1KJRA 3UKVA 1Q56A 3MFAA 4OHXA 2OIIA 3I54A 2P17A 4RS5B 2D5FA 3SITA 1NA1A 2BWCA 4BMEA 4E9KA 1ND3C 2XJPA 1EP0A 1WW5A 2PHDA 3AJZA 3LOIA 3V56A 1CAVB 4LO7A 3IBMA 1HXS1 1VRH2 2UWAA 1FYUA 2FZ1A 5FCCA 2DVGA 2ZMLA 3KCYA 3NAPB 3TBDA 1MS4A 1ZBE2 2D6MA 4AFBA 2LM3A 1V6NA 1O3TA 3AP4A 5JI9A 3C3VA 2C9AA 1N1TA 5F6LB 1TME3 3ETQA 3QLQA 5JR7B 1O91A 1S0EA 4YZ2A 1LENA 4Q0UA 3WCRA 5JOXA 1BEV2 1WCKA 2WZPP 4ZU4A 3UK9A 1PK6C 1OQDA 2PHWA 1DQ2A 4QPGB 3ZN6A 3O7OA 1WW4A 4AVCA 4ASLA 2W52A 3VBOA 4N53B 4NOTA 2XKOA 1O3SA 4KWLA 2GC1A 5I8YA 5C9AB 3BIWE 5FRAA 1KITA 4QPIC 4BMBA 2QDRA 1CX4A 5CNAA 3SISA 5HCFA 3WP5A 1WD3A 4LLOA 3B01A 3MF9A 4L99A 4JV4A 2O0OA 5F1RA 3R4DB 2DCZA 1CAWA 1IS5A 1HV0A 2XBO1 5CG9A 3LA3A 3G6JB 2JECA 2QZ3A 4LO4B 1SLBA 1E57A 1RINA 1RIRA 5JIUA 4LE3A 4R9BA 1S0CA 4CEYB 3EHKA 1URXA 4LO8A 1QJU1 5H9PA 1PVC3 1QWRA 1S0DA 4H55A 1BKZA 4Q4W2 3RYKA 4RR3A 5DUVA 1RUE1 5H9RA 3M1HA 4AGRA 1U5ZA 5BNNC 3LA7A 4QXKA 5EYYA 5CA6A 4OHVA 2Z2SB 4FPJA 3B94A 1VAMA 2BPA2 4XJ8A 4Q4Y2 1NY71 1HRI3 1OA2A 2EALA 3I59B 4RHV3 1GZCA 5IK5A 1HQLA 3WT3A 4RSUA 1RUJ2 2GH8A 3JBG2 3VL8A 3WX5A 1YIPA 1SEFA 4CDQB 1EY2A 1J1LA 3ZVXA 3PHMA 4EN9B 3RWNA 4FPCA 1MQTB 4NN0A 5HI0A 1W6QB 1DGWA 1DGWX 3O14A 2VMGA 4AQ2A 2JG8A 5LRRA 2EIGA 5GLZA 1C8NA 4AQSA 4COUA 3H1MA 1AJOA 1HKDA 1S1AA 3VV1A 1PZ7A 2BUKA 5E88A 3WINE 3ZFEC 3AM2A 3AXEA 4FTEA 4K1ZA 3A0NA 1TMF2 2NN8A 3JU9A 1QGLA 1C1LA 2JEMA 1TME1 4YNIA 4CYDA 3GZTB 2XG3A 1CIWA 2A6YA 2A75A 4GWMA 4RL7A 4FXGB 1NCQB 2UWBA 2JE9A 4P9IA 1AL23 4CEWA 4EN8B 4YW3A 4QHBA 1I3HA 1C1FA 3ZDSA 3AP6A 2GZWA 3ZFGB 3FJSA 1WBLA 3GALA 5A3MA 1BVP1 2VW2A 1N1SA 2IC1A 2A70A 5BNOB 2KXLA 3BU7A 1HV1A 5KWRA 3J26N 2B42B 5EZWA 4YG3A 5DDJ3 2YHJA 4QT6A 1MS3A 5T50A 5DUWA 4G9SB 4CZSA 1S2KA 3CU7A 1YYNA 3AYCA 4L8QA 5CBLA 4I01A 1Z7S2 4QU2A 4J1WA 2RMU2 1O4TA 3WCSA 3OGGA 2ZX0A 4A3XA 2EXJA 5CFDA 2ZZJA 4YGEA 4XTMA 2OVUA 3WD5A 1R1A3 1PVC1 2QDNA 1CN1A 4ITCA 4E2GA 4HN0A 1GSLA 3JQWA 2GMEA 4MZUA 2WT1A 4LBMA 2VQAA 4HPKB 4E2SA 4LUKA 3B3QE 4Y1XA 3AP9A 5JZGA 5IK8A 1FNYA 1HRI1 2QZ2A 3ZXKA 3OPZA 4FOVA 5KHIA 3JB8A 4LT5A 4K21A 4QGMA 2VOKA 2DCKA 2ZGOA 5AFBA 2R49A 1CPMA 1RUC3 1ULEA 3VBOC 2A7AA 2VNGA 5JDBA 3DV8A 3UJQA 3V0BA 2HEYF 3QCWA 4FAGA 1VR3A 2WFF3 2XWBB 1V6KA 2YV8A 5JVVA 1ND3B 1Q8VA 1FMD3 1AX1A 2ZHNA 3D0SA 4XXAA 2DV9A 4RA0A 1RL3A 5KC6A 1AVBA 3EXUA 3ENRA 4IETA 4JAAA 3JD72 1R093 4C0HA 1VBD3 3BCWA 5A32A 2IXIA 3AK0A 4YGBA 4FPHA 3AZXA 4XFAA 1RUD2 1A6CA 1QJX2 2QKDA 1PO13 1MACA 1XNKA 4EWAA 2NYYA 5EWSA 4JTNA 3MEPA 1NCRC 1HRV3 4LA2A 2RHPA 5CB7A 2WNVC 3RS6A 2HWB2 5FOBB 1CVNA 4M00A 4YW4A 1XYNA 3PJYA 4N43A 1PGL1 1IGOA 1O5LA 4Y22A 2Q1ZB 2NPIA 4WVZA 5DDJ1 1GNZA 3NV1A 4Z92B 3FZ3A 3ZIWA 4COYA 1B09A 1H2MA 4SLIA 3LWCA 3BALA 3N7KA 5K0UA 1AXKA 1IPKA 2NM1A 3WP4A 3AYEA 4B3NA 1VBB2 1J3PA 4R8HA 2D6PA 5DG1A 2A71A 2JG8C 5KHGA 2WZR3 3WQ0A 2HWD2 1R082 2W0XA 1RUF3 1R1A1 1AYM2 3ZXGA 4B7KA 2HWF3 1I9RA 3INAA 4S2FA 4AEDA 1RVF1 4EN7B 5ABJA 1QHDA 1FX5A 5JMCA 3IN9A 2Q5TA 4P9GA 4XFFA 1NG0A 4CEWC 4FTSA 2RR11 1LU2A 4QGNA 4ISQA 5GLUA 1RUC1 3CL1A 4ZU7A 3R4SA 2DFCA 1UL9A 1FNZA 2ATFA 4Q4X2 3KSCA 4YVWC 3VUOA 1GV9A 1LEMA 3KGZA 4B4RA 1REEA 4A7KA 3IM0A 5ACA1 1POV3 4A7YA 3OY8A 3RG0A 4Y1VA 5F5QA 1NXMA 2VPVA 3RRDA 4P9XA 3FUQA 2VG9A 1PGW2 2ZMKA 1VBC2 1RMU3 1ZM1A 5GLTA 4CTEA 3VLBB 5CFDC 1XU1A 3H1YA 1ZYBA 1R091 1IKPA 4LBNA 4FSJA 1BBT2 1VBD1 2D3PA 3MPBA 4G3YC 4WM8A 3E6BA 4K40A 1PO11 2R062 3ZFEB 1EV13 4FCAA 4KNCA 2VXRA 4Q0QA 1HRV1 3H3UA 2DTWA 4W65A 5GALA 4JTOA 5GJ6A 3IKWA 3QH6A 3D5OA 1PZ8A 4LHKA 1D4VB 4XF4A 1DU3D 1HQNA 2I2SA 4NWVA 1V9U2 2ILMA 4N7IA 4Z07A 3VZKA 1UN1A 2PAEA 5JAXA 3N7JA 1QJY2 2NQYA 1GQGA 1JW6A 4WVMA 2DVDA 5HCBA 3AFGA 1H1MA 2JX9A 3KQRA 1YRZA 4PQ9A 1OKQA 2CTVA 2X5IA 1LR5A 2BNMA 2XKPA 1JYCA 3WLUA 4YGDA 4LBQD 4LULA 4S2GA 5EXOA 5I8SA 1LGNA 3R4UA 2MPFA 1RUF1 3PMEA 2YC0A 1YFWA 4FOQA 4L11A 2HWF1 3W9AA 1YJKA 2CV6A 3ZXAC 1H2LA 4QGLA 1VLNA 2DUQA 3H7JA 1DZRA 3KB5A 1C8M2 3FC0A 4XYXA 3B9IA 5FDBA 1MS8A 2HJIA 4LBQA 3IDEA 1H30A 1ONAA 3ZIXA 2DF7A 3RQ0A 4OI2A 4GB31 5L19A 3VKNA 4N43C 4C90A 4IL7A 4L92A 2AUYA 5FLIA 5T5PA 3AJYA 4E4ZA 3ZN6B 5E16A 2Y26A 3J8F1 3OYWA 3G7DA 1SLAA 3WOGA 1POV1 1Q8SA 1RUH1 3HR9A 3HQXA 3O5SA 5E8AA 2ZGTA 3VBOB 4EN6B 1JN2P 2CGPA 3N4MA 1POV0 4ES8A 3E97A 4XFGA 1MS5A 3RI8A 2JE7A 3RMXA 1MR5A 1RMU1 2WSVA 3JZVA 3VZMA 4QQ2A 2HEVF 2EXKA 3HMYA 3ILFA 4KGQA 3TB0A 1XNBA 2ZJCA 4FT8A 1CAWB 4OLLA 2HWC2 3ECQA 4XJZA 3ZSJA 4AEDC 4XQDA 4QM8A 4I0BA 3QACA 5AVPA 3RZZA 1SBEA 1V00A 2P3JA 4KG8A 4IEZA 4CP2A 5BNPA 1ASJ1 2VQ0A 4R9CA 1PVXA 1FOD3 4QPGC 1COV2 3JUUA 4UW5A 1YCIA 4FPKA 4UBHA 3VBSC 2PTMA 1Q8PA 2IXHA 1MZEA 5C9AC 5I0RA 4EWEA 1FPN2 2WNEA 2ARBA 3I2DA 3PJQA 3W58A 3ZN5A 2ZA9A 1JYIA 3POWA 5H9SA 2FMDA 1OQEA 1SCRA 3UL2A 1YI9A 3SCFA 1WGPA 4AFAA 3DPRA 2WSUA 1WBFA 1QH7A 3R0RA 3LKJA 4INDA 3TRSB 5GKAC 2GC0A 1GKBA 3KT4A 3RYPA 3AKRA 3TN91 4FPGA 1WA4A 3BOWA 1DZQA 3AFKA 2JG8B 2VW1A 4WM8C 1JH5A 5C4WC 4H14A 3MPPG 4MXWA 1AZDA 4PDWC 2CAVA 1UX6A 4F83A 2QQPA 2YY1A 3AXDA 3AMNA 3S6PA 1SMVA 4YSFA 2NP0A 3WDXA 3HWJA 5JLVA 1LGBA 3POYA 5T5LA 3VBFC 1MEC3 1RTVA 2H6CA 3ASIA 2PA7A 2RS12 4CEWB 4AI0A 2AENA 1WD4A 1YUDA 2RS53 2WS92 1XXNA 4NVPA 3U11A 4KQ7A 4CDQC 2G4IA 4AVBA 1F8VA 1ZX5A 4NPRA 3VZLA 1ZRFA 2MHFA 1VRH3 3VDDA 2A3XA 3KLSA 4YVWB 1LHNA 1VP6A 3LSDA 1FXZA 4D69A 1WW7A 3I8TA 1ZBE3 4Q0SA 2Y38A 3S7IA 2CNAA 2ZGMA 5J48A 5B2GB 1B35C 2BFUS 3ME2A 2Y0OA 5D1IA 1G6NA 4BE3A 4BYYA 4AEKA 1RJ7A 1PO22 1XNCA 5L7OA 2OUJA 2ZBJA 4AK3A 5CFDB 1GBGA 4FXKB 3HBZA 1BEV3 1VBE2 1FATA 4AHYA 4BCUA 1I1EA 3L2HA 5EYXA 1FOD1 5FQ0A 1D4M2 1U5IA 4WVVA 5JPMB 3WDWA 1IS6A 3E6DA 4MXVA 2VUAA 3M70A 4Q4V2 5JZGB 1DQ6A 1SDWA 2AZ5A 1YNAA 4LNVA 4PLNA 3HN1A 3ZXFA 1H4HA 1G8WA 1TNFA 1DIWA 1OOPA 4IERA 4YM2A 4LO5B 5JWPA 3MLJA 4XJUA 2D6KA 4BQ1A 3N7LA 3E6CC 2Q30A 3V0BB 3ZSEA 1SLLA 1H8TA 3WW2A 5I0TA 3ZXEA 5J7MA 5J96B 4HVOA 2B39A 4UW6A 3MICA 4FQ4A 3BTAA 3T2TA 4Q4W3 5LK5A 1DZTA 3RI9A 2ZGNA 1RHI2 4LE4A 1OI6A 4MX3A 2XHKA 4RGGA 5J37A 4KGGA 5A32B 1ZBA2 4LLFA 5BNPC 1O3QA 1QJU3 1QOOA 5F6KA 1LHOA 1RUJ3 4URTA 1KDKA 2RS51 1EAH2 2XJUA 4E4SA 3D6EA 2X8KA 3U10A 3BB6A 4Y20A 1QQP2 1XU2A 2O8OA 4N43B 1VRH1 3ZSKA 1CAXA 4Q26A 2VW0A 5A3LA 4MGIE 5J09A 2Q4SA 5JCTA 1YXWA 1ZBE1 1QNWA 3LSEA 2ZHMA 4AE2A 1DQ5A 3DPRC 4IEPA 1GZ9A 1ENXA 4PLOA 4HT1T 4I2OA 4JRAA 2B7YA 3RYRA 5K0UB 1TMF3 4BIOA 1MZFA 1DF0A 4L97A 2JENA 2UY8A 3X29B 4WV8A 5F9TA 4QPYA 1BEV1 2ZHLA 4ZXKA 1KD7A 5HCAA 1OMIA 1AF9A 3S0MA 1ZRCA 1QXRA 2ZTNA 2A6VA 2WT2A 2WKKA 4DZGA 4AEDB 1GR3A 2R072 5ABJB 4BH9A 2H0VA 2DUOA 2V09A 1BVVA 4ONUA 4M3CE 2GMMA 1RUG2 3WHTA 4Y1ZA 4YVSA 3MDPA 5HBAA 3VBSB 2UYBA 2P2KA 1Z7S3 2B5HA 3VDDC 4BIFA 3FWEA 2VVDA 4M3CA 1SLIA 2BGCA 3U07A 3B00A 1H4GA 1XYPA 1PMIA 2PHTA 1NLRA 2XB6C 1AR72 2ZX1A 2Z5WA 3OY8B 1TQ5A 4Q4W1 4AW7A 4PLMA 2D98A 3DL3A 5AC92 1CGPA 3P3NA 3V64A 3IT8A 2LTNA 2XLGA 1H9PA 3CJXA 4ISRA 2ZGUA 4Q4Y1 3VL9A 4WM8B 3BODA 1S0IA 3B7MA 5C4WB 4XEZA 1RUJ1 1UAIA 2QE3A 3JBG1 2ZGLA 1WCDJ 1O3RA 2R32A 5FO7B 4JDMA 4XIKA 4QQOA 1C4RA 1S0GA 4PDWB 2B8MA 3WVJA 4AF9A 5GZCA 5J3UA 5A33A 1MS0A 4XFHA 4Y24A 2WC2A 3VHOA 4RGAA 1QJZA 3VBFB 1W0OA 3P3PA 1OFNA 2W68A 3I4IA 3OGJA 1OOPC 3KGLA 4KWJA 3ALQA 1PM7A 5EFUA 2UURA 5FBZA 1S55A 4WVMB 4HMZA 1TMF1 5FPXA 2D93A 4Q0VA 1JTZX 3AKSA 4EN0A 1RUD3 4BZ4A 2FHRA 1B35B 4FQZA 2XVGA 2PHUA 1VJ2A 5GLVA 3KD4A 4XIOA 3HAGA 1D0HA 2E53A 1UPIA 2JJ6A 4FOYA 1UIJA 2BTVC 1EYBA 3WP6A 4GH4A 5DG2A 1ULFA 1LU1A 4O9EA 2VOWA 3APBA 3NV2A 1ALYA 2R30A 2WFPA 3VN4A 4LBQB 4CDXA 2ETEA 1F31A 1S2BA 3M8LA 1Z7S1 4OI0A 2RMU1 2G9GA 2RM22 1VBB3 2F6BA 2XUMA 5BXXA 4MGZE 2R042 1NA1C 3MIDA 3OYWB 2D6LX 2HWD3 2CGOA 1J3QA 3GHNA 1KFXL 2E7QA 1AYM3 4EV0A 3WXPA 2B45X 1MVEA 2EXHA 1PZ9A 4F7ZA 1AR62 1UZZA 5E89A 3MW2A 4LTAA 1QDCA 3ZSLA 4BWOA 1VBA3 4TLFA 2GU9A 1KJLA 1TME2 4YFWA 4F3JA 4JVAA 5C8CA 2ZABA 1DGRA 1U12A 4CRQA 1XE7A 4G4FA 3V0AA 3AP7A 2F4PA 3FUOA 4HETA 1X36A 1RVF3 2D6OX 2FQPA 2ZHKA 3AZVA 2V73A 3NKGA 4Q4X3 5BY5A 1LCLA 1GLHA 3LA2A 1LOBA 1UPSA 2YMZA 1QH6A 5BNPB 2OUHA 4IEUA 4YVSC 3U4XA 1ZZCA 1G9AA 2A6ZA 4FBFA 5FPZA 2RR13 1WCSA 4Q29A 3ZXJA 5J36A 2C0ZA 4LHNA 1VBC3 2I74A 3JD71 4X6QB 1RUI2 1VB2A 2LALA 2BQPA 1T6GC 1ENRA 1RUD1 5ACA3 1QJX1 2ZGRA 2ET7A 3DPRB 5LEJA 2KA3A 4Q0PA 2R0HA 3M3IA 1LEDA 2HWB1 3VKMA 2WJSA 2DUPA 2WLQA 4BLJA 5JOWA 3PVOA 5GZGA 4FOWA 4CP1A 5D8AA 2JG9A 2X29A 1V6MA 2VVEA 1V9U3 1VAVA 4RR3C 4RHV2 1WMDA 4MXWB 2VULA 1QJY3 4ZU5A 4N7UA 1ZRRA 1WMEA 2EXIA 1FV2A 3MFCA 3DKWA 1GANA 1WLCA 4F8AA 3H3ZA 3KCXA 3MW3A 2B46X 1VBB1 4DFSA 2K2SA 3CF6E 4M0HA 2JICA 2XL7A 4YZ3A 4AEMA 4XJWA 2RS32 1KDMA 1VIWB 4Y1UA 2GDFA 3UJOA 3FBMA 3UKNA 2HWD1 1R081 4OI4A 1JUIA 3ZFFA 4WVWA 3J9SA 3RDIA 3ZMNA 1AYM1 1YWKA 2ZPXA 4XBNA 4Y1YA 3S7EA 4J1XA 5GZDA 3VDDB 2TNFA 4H3WA 1S0BA 2PELA 2VH9A 4JGYA 1VBA1 1W6NA 4GKYA 3ZO0B 4FO9A 4RFT0 4RS5A 1IZ3A 4MSVA 2XJRA 1V6OA 1H8VA 5KHHA 1AL22 1XNDA 1XRUA 3USSA 4OFGA 3A4UA 1ZZBA 4OZXA 4Q4X1 4LO6B 3ZYIB 4GH4C 1CAVA 2X53S 5FQ0B 1N1YA 4XPVA 3T1MA 3AYDA 3CJIA 4IXLA 4CDXC 4Q8KA 1ZVFA 5DZEA 3TNPB 3LGRA 1PGW1 3ES1A 4GB33 1VBC1 1SFYA 3PLQA 3PVBB 1BBT1 3MIFA 3WW4A 1GICA 3J8F3 1OOPB 4LEJA 4DNYA 4OHYA 1RUH3 2O1QA 1J59A 2R061 4Q27A 5SV8A 3KCCA 2ZAHA 1QXJA 2RE9A 1C5IA 1H8TB 4HLTA 3SCHA 4COZA 3E5XA 3N35A 4DB5A 2FZ2A 2NMOA 1WLTA 2C1FA 1OLQA 3QD6A 4NHLA 3VHNA 4UW3A 4IV3A 4DINB 1COV3 1IQAA 1V9U1