2RS52

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
255
structure length
255
Chain Sequence
GYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSVCRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSGCLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGNLLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPITVTIAPMCTEFSGIRSKSIVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
total genus 47
structure length 255
sequence length 255
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2rs5200
2RM22 1RHI1 4Q4W3 4QPGB 4WM7A 2BPA2 1PGL2 1GFF2 1R1A2 5DDJ2 2WZR3 1B35A 4GMP3 4PDWC 2TBVA 2DF7A 1HRI2 1MEC3 4Y5Z0 1RUC3 1EV13 1POV3 4GH4C 1NY72 5CFCA 3M8LA 1MQTB 3VBOB 1R083 1FPN1 3VDDC 1AR72 1W39A 2HWC2 1HQNA 1HRV3 2HWB3 2WFF3 4N53B 3VDDB 2MEV2 2FZ2A 3JB8A 1Z7S1 3VBHC 1BBT1 2FZ1A 2ZZQA 1C8NA 4LLFA 3VBHB 1H8TB 1PO22 3TN91 4RR3B 3JD71 1ZBE1 1K5MC 2WWSA 2RS13 5C8CC 2XPJA 2BFUS 3ZFEA 5AC91 1RHI2 3VBRA 3ZFFA 5K0UA 1AR62 4CDUA 2R073 1RUD2 1RUF2 5ACA1 1MQTC 4JGZA 1VBB2 1Z7S2 1PVC2 2R062 5J96B 5CFDA 1TMF3 1ND3A 1VAKA 1VBC1 3ZFEB 5BNOC 5BNPB 4QPIB 1RUE2 1EV11 2ZAHA 3ZFGA 1K5MA 4Q4V3 1AR92 2RS31 4GB32 3JD72 2X5IB 1COV1 1RUE3 1AYN3 2HWE2 3VBRC 1COV3 3J8F3 4Q4Y2 4RS5C 4RS5B 5L7OC 1TME2 3VBUC 4Q4X3 1IHMA 3VBFB 1AL21 1COV2 5A33B 5CFDC 4IV3B 5C4WC 1AR63 1PVC1 1QJX3 4Q4Y1 1NCRA 1PVC3 2WLPA 1VRH1 2WS91 1QJY2 3TN93 3ZFEC 4Z92B 1AR91 1RUI3 1B35B 4WM8B 1FMD3 2GSYA 4PDWA 4AEDB 1R093 1R092 4CDWC 4YVWC 3J8F2 3ZXAC 3JBG1 4RQPB 5LK7B 2X5IC 2HWF1 4WM8A 1FOD3 1H8TC 1EAH1 1RUG1 1D4M3 1QJX2 4WM7C 5C8CA 5D8AB 1VBB3 2RR13 2QQPA 1QQP3 2RR11 3VBUA 2HWE1 5FOJB 1RUH1 1FMD2 1ND3B 4N43C 1QJZA 1NCQB 1HRI3 1MEC2 1OHFA 4Q4X1 1ND3C 2HWF2 1EV12 1TME1 2GH8A 1VBE3 4JGYC 1K5MB 1VBE2 4CEWB 1AYM1 1OOPB 4RR3C 4FTBA 2WZR2 1NCQA 1PGL1 4CDWA 1RUC2 1HRV2 2WFF2 1V9U3 1FMD1 1QJY1 1F8VA 1RHI3 4Q4W1 2RR12 1AR73 1PO13 4QPGC 1ASJ2 1PGW1 3JBG3 4N43B 5ACA3 1D4M2 2PLV1 4YVWB 1RUD1 4GMP1 3VDDA 5C9AB 1HXS2 4RR3A 2RS52 2WZR1 1NOVA 4RFT0 1ASJ3 3JBG2 1RUG3 1RVF2 1ASJ1 1PGW2 1VBD3 1RUC1 2RS53 1AR83 4N43A 4Y4YA 4NWWA 4RHV2 1RVF3 4PDWB 4IV3C 1R082 2RMU1 1RUH3 4AEDA 1RB8G 3LOBA 1VB4A 2BUKA 3VBFC 1RUH2 1VBC2 4YVSB 3VBSB 1OPOA 2R042 2HWB2 4BCUA 2XBO2 3VBSC 1HXS1 2XBO3 1AL23 5FMOS 1AYM3 1HXS3 2PLV2 5FMOL 1B35C 5K0UC 1BBT3 1C8M3 1C8M2 5BNPC 1QJU2 1TMF2 4QPIA 1RMU1 5J98B 1PO21 1AR93 3VBFA 1VBA1 3JD73 1AR71 4CEWA 1ND2B 1R091 5L7OB 4CEYC 2MEV1 2R041 3VBRB 1RUF1 2PLV3 1M06G 2R071 1CJDA 1BEV1 1RUF3 1AUYA 1EAH3 3ZFFC 3NAPC 1VBD1 3DPRA 4CDQB 5BNNB 4CDUC 4QPIC 1VBC3 5D8AA 5BNOB 4EJRA 1ZBA1 1D4M1 2RS51 4CEWC 1AYN1 3JB4C 1ND2A 5C9AC 3DPRB 1RUJ2 1AR82 1VRH2 2WS92 1R1A1 4IV1A 5DDJ1 1NA1A 1VB2A 5C8CB 1HRV1 2WFF1 5A32B 1VRH3 2WS93 1QQP2 5D8AC 4Q4Y3 4RQPA 1ZBA2 4QPGA 4WM7B 1RUI1 1NG0A 3NAPB 1F2NA 5CFCC 5JZGB 2RS11 1VBA3 4N53C 4Q4W2 1QJY3 1NCQC 1E57A 3TN92 4RS5A 3DPRC 1RUJ1 4CDWB 2VQ0A 2BFUL 1RUJ3 1WCDJ 5A33A 1FOD1 4GH4B 2HWF3 1BMV1 1V9U2 1MEC1 3S6PA 1VBB1 1PIV2 5C4WB 2R072 1R081 2RMU2 5AC92 2RMU3 3VBUB 2R063 4CDXB 1FPN3 1R1A3 5DDJ3 5ABJC 2XBO1 3J8F1 2HWB1 3VBHA 1AR61 1VBE1 4AEDC 4WM8C 1C8M1 1QJU1 4IV1B 1PIV1 2RS12 1PO23 1HX6A 5CFDB 1OOPA 1MQTA 1NA1C 1PO12 1AL0G 4GB31 4RHV3 2MEV3 5L7OA 5BNPA 1RUD3 5AC93 1EAH2 4CDXC 3CJIA 4YVSC 2R043 4Q4V2 5C4WA 2ZTNA 1BEV2 3VBOA 3ZFGC 4NWVA 1BEV3 3VBSA 2HWC3 4CEYA 1AR81 5ACA2 4N53A 4Q4V1 4FTEA 1OOPC 1POV1 1AYN2 2HWE3 2R061 4JGZC 1HRI1 1RUE1 3CJIC 4YVSA 1TME3 3IDEA 1NCRC 3VBOC 1Z7S3 1ZBE2 4GH4A 5CFCB 5JZGC 1QJX1 1BBT2 4CDUB 3HAGA 1QJU3 1AYM2 3NAPA 1VBA2 1CD3G 4GB33 4RHV1 4IV3A 4JGYB 1V9U1 1VBD2 4FTSA 5BNOA 1NCRB 4RQPC 3CJIB 4JGZB 1NA1B 1SMVA 2HWD2 1NY71 5JZGA 1FOD2 1X33A 5A32A 2IZWA 4IV1C 1TMF1 1RMU2 5ABJA 2HWC1 4FSJA 3FBMA 4CDQC 5BNNC 3ZFFB 4YVWA 5K0UB 1ZBA3 3ZFGB 1DDLA 2RS32 1RVF1 4JGYA 2RS33 1QQP1 1BMV2 1FPN2 2X5IA 2RM23 4SBVA 1RUI2 1RUG2 2Y26A 5ABJB 2RM21 4CEYB 4GMP0 1H8TA 2HWD1 1ND2C 5C9AA 5GKAC 2HWD3 2BBVA 1A6CA 1POV0 4Q4X2 4CDQA 5BNNA 4CDXA 1ZBE3 1RMU3 1X36A 1AL22 1PIV3 1PO11
chains in the Genus database with same CATH superfamily
1LHUA 5DZEA 3PNAA 3D4KA 4RA0A 4CP9B 1QNWA 1RHI1 4QPGB 2UWCA 4HSJA 2P3IA 1GFF2 1GZWA 1KDKA 4XOGA 4LULA 1NQDA 3H3UA 4NIGA 2OX0A 1MS1A 1IKPA 3AZWA 2P2KA 1UOJA 1GZ9A 5JXGA 3WQ7A 1SFPA 3N7JA 4IEXA 3S30A 5FP8A 3SCHA 1TNFA 3S0MA 3NNGA 5FYYA 1C5HA 2QUOA 1POV3 3K4ZA 5FZ1A 3ETPA 3E6CC 2CAUA 3TAYA 3WNLA 1LU1A 4FPEA 4PT6A 3MV01 3VBOB 4LORA 1UYPA 1SLAA 1DZTA 2HWC2 4XMAA 4JC1A 4DXTA 1HQNA 3AM2A 3FLPA 2JWPA 2WFF3 3H8UA 3OD0A 2B8MA 2XGXA 2VOTA 2JIJA 5DXDA 3URFA 4CCNA 4Y5TA 4TTGA 1GWLA 1SLLA 5EJ3A 2XL9A 1TVGA 2QTWB 1ULDA 1Z7S1 3KSCA 2RDRA 5T5OA 3SNMA 4AHWA 1BBT1 3WD5A 4OHXA 2A5ZA 5FZ6A 4XTPA 2DWRA 4P08A 5E16A 5JLVA 4I30A 1V6JA 4YARA 1H8TB 4OHVA 4GWNA 4RR3B 4K9SA 5JVVA 1WGPA 1OD5A 2ID4A 2VZTA 4OHZA 2TNFA 1UYXA 3A7QA 1E5HA 4M00A 4AVBA 3AVSA 4NIDA 4HKWA 1YFYA 3T0BA 1Q56A 4Q0UA 4E4ZA 1W06A 2Q1MA 5FXXA 5A6XA 1JYTA 2PAMA 2VR4A 2R073 1RUD2 1MQTC 1VBB2 1Z7S2 2WINB 1MZEA 4XF0A 1IGOA 4U36A 1H2LA 5CFDA 1TMF3 4JZRA 1ND3A 1VAKA 1F35A 1WD4A 1VBC1 3KHBA 1PK6B 5FP4A 4B4RA 5BNOC 5I93A 2CNAA 4YW1A 4ARXA 4QPIB 1EV11 1W2AX 3ZFGA 1PMIA 4Q4V3 4R9AA 4E4HA 3IDAA 1AR92 1LRHA 4RGAA 3P5BA 2RS31 1W8NA 3JD72 4BPZA 2HWE2 3ZVXA 4LBQD 1XE7A 2ATFA 2XG3A 1BK0A 3WW1A 1AF9A 1S0DA 4RS5C 5LW9A 4MGYE 4XUPA 3IWZA 4YLZA 4RS5B 3WDUA 1LJ7A 4FPYA 4LITA 3WP3A 3VBUC 5HV0A 4Q4X3 5JMCA 1L7QA 1XRUA 1AL21 3WV6A 5CFDC 1UZVA 1VIWB 3OEAA 4IV3B 4AVCA 2J42A 1UOGA 1UWWA 2A7AA 5J7MA 5GLUA 2BOIA 1JHJA 1I9RA 2ZCWA 4UW6A 4FBFA 5DUUA 4ZKTB 5J48A 2WS91 4Y1VA 1QJY2 5D21A 2W1WA 2PXJA 5L73A 4X8NA 5EHDA 2X29A 1C3HA 2P5BA 3TN93 3ZFEC 3WDXA 4Z92B 1AR91 2JG8A 1PM4A 4YG6A 2QE3A 3IMMA 5IVVA 2IFWA 2GSYA 2B39A 3C2UA 5T52A 1DQ6A 4AEDB 1R093 4WBBA 1Q8VA 1UU6A 3LDKA 4BQXA 3O1TA 5SV8A 4CDWC 2OZ6A 4DXSA 3ZYBA 1JH5A 3LF7A 1ODNA 1HIXA 2WA3A 3QOPA 4C90A 2VUAA 1VP6A 3B69A 2DDUA 3BALA 3PUAA 1DBNA 4OMDA 3EO6A 4RQPB 4UF0A 4CU8A 2VQUA 3N9NA 3OBZA 2X10A 4HKOA 3WF4A 1GKBA 1JMUB 4Q27A 4LMFA 1CGPA 1JUIA 4ZXEA 1H8TC 4QPWA 2Y60A 4AI9A 1RUG1 1JYCA 1D4M3 2GZWA 4P02B 4UAPA 3WP6A 5C8CA 3HEIA 3TEYA 4QX5A 1JXNA 2JX9A 2DFBA 2BYVE 3RI8A 2LM3A 4COVA 5HXMA 3NNJA 3OB8A 1FXZA 5I0TA 3NVCA 2AH2A 4QB6A 1IS6A 2VCMA 4IQPA 4X8PA 1DQ1A 1NCQB 2GC1A 4EN6B 5EZWA 1Z0HA 1ND3C 5DZFA 2QQWA 5CKMA 1SDDB 3KZ4C 4Q26A 1VBE2 4GA9A 4CEWB 5C8WA 1DGLA 2AYHA 4FTBA 4EN0A 2WZR2 3DKWA 2EIEA 4HSLA 3WG3A 1ODMA 1XC6A 1ULCA 1ZZ6A 2YFUA 3UGGA 1YQCA 1N3PA 2A1XA 1SLBA 2XJTA 3M4FA 2D43A 4EWDA 3T2QA 2VCBA 2QZ3A 5DZGA 4LLOA 1HRV2 3F95A 1PZ8A 1REEA 4ARYA 2VY0A 1PNGA 3VKLA 3ZYIB 2WO1A 2RR12 1AR73 1LULA 3BTAA 1CX1A 5KXDA 4H55A 2E32A 1OF3A 2LRPA 4LKDA 1WMDA 2DTWA 1IS3A 2JKXA 2ZKNA 3GDBA 2JB4A 3POFA 2PLV1 2ZZJA 2RE9A 4N43B 4YVWB 5FRAA 4A7ZA 1XXNA 1DLLA 1ZRRA 3I2DA 3T09A 2F6BA 3AKTA 5J1XA 5FZAA 2WZR1 2EXKA 1NOVA 2XR4A 4RFT0 4GKYA 1GZTA 4P9WA 5F5AA 3OGRA 1QH6A 2AUYA 2VCAA 3NW4A 1YO8A 2W1UA 5FUNA 4BJ0A 3H1WA 3W5MA 2XQXA 2BTVC 1K3IA 3GBWA 4QB1A 5A3LA 4AHXA 2JD4A 4C8DA 5SV5A 1RUH3 1RB8G 1VB4A 2L9LA 3GCXA 4LBNA 2JJ6A 3GZEA 2FDJA 5FZHA 3ON7A 4YVSB 3BTXA 1T2XA 3NWKA 2Z42A 2XBO2 4MGQA 1AL23 4AI0A 3KMHA 4PLNA 1AYM3 5FMOL 3ME2A 3AK0A 3GBFA 3T3YA 2Y6GA 3B7MA 4MVTA 5FZBA 4AQTA 2QJVA 2HBTA 4QU1A 1S55A 2PQSA 5CAZA 3N9MA 3LFIA 2EVXA 2VGDA 4FXGB 5J98B 4TLGA 4EWAA 1F15A 3FHIB 1ZM1A 1VBA1 1TZOA 3DL3A 4LK7A 5CYYA 5LBBA 5I8YA 5A3NA 4JQRA 2ZGOA 2QQUA 4ZPIA 5AFBA 3BKZA 3POYA 2ZGMA 2J7MA 3D0SA 3E5QA 2CGOA 2E9QA 4YYOA 4LJHA 4COWA 5HCHA 1CWPA 3VBRB 1H2KA 1HQLA 1PMJX 4LO8A 4Y33A 2I74A 1WUVA 1LKNA 2PLV3 4P00B 4PI0A 4CCEA 1W8FA 4W8JA 1Q8OA 2PHLA 3PMEA 5F3EA 3RDIA 2Z5WA 5A1LA 5H9PA 3NAPC 3DPRA 5BNNB 4LOSA 4QPIC 3U37A 5L9BA 2W1SA 2ARBA 5D8AA 1GBGA 5JWPA 5FYMA 2F4LA 4H14A 4RFRB 3MZHA 3HIFA 1W9WA 2B9UA 2RS51 1P8JA 3ZXJA 4ITCA 1H9WA 4QX1A 5FQ0A 3R05A 2YMZA 4I02A 5LEKA 3AP4A 2VZ1A 3ACFA 2JB8A 1DF0A 2GMMA 4S2GA 2PAKA 4OUMA 5BV6A 2TUNA 3I3EA 3BGAA 1AR82 2ZGNA 4TZDA 1CAXB 3TEZA 3U78A 2OW4A 1UW8A 5DDJ1 1WCQA 5EWSA 1NA1A 2WRAA 3WZ1A 3ZM8A 5A1AA 5LZ6A 2EIGA 2WFF1 1HW5A 3K51A 2F4PA 2YU1A 3NNFA 2VW0A 3ETQA 2GNMA 5EFUA 4XW3A 2WN3A 1QQP2 4Y20A 4D94A 5I8TA 3I4IA 3RYKA 3KD4A 2H6CA 3ORJA 2AEYA 2JIGA 1TQ5A 1RITA 2VJXA 2Q1ZB 3B9IA 5CFCC 5IK7A 2VZSA 4F7ZA 3M7AA 4HVQA 1KJLA 5LK5A 5EYYA 1QJY3 1GP6A 2JG8C 2VZ3A 4NRMA 3T2TA 2R1BA 1W03A 2JDHA 2CGNA 1NCQC 1E57A 1L7RA 4RSUA 1HJFA 3TN92 5KR7A 5A7PA 1DQ2A 4CDWB 2J1TA 2VQ0A 4IGPA 5IATA 2DVFA 4ZU7A 4N90A 4GH4B 2WR9A 2DCKA 3RMYA 1YIFA 4ISQA 5A3WA 4HXCA 2WNUA 3OPZA 2GC0A 1GR3A 3C7EA 4QM9A 5F6LB 3AL5A 2XKPA 2VW1A 2QVSB 2VZPA 1NYWA 2ADDA 5CKNA 5IK4A 2B5HA 1GQPA 2R072 4MGIE 2NMNA 2I07B 5GM0A 4OZOA 5AC92 5A3UA 1YI7A 5FZLA 4GAZA 1H2MA 4BWOA 1V6NA 3DV8A 5IAXA 2Y64A 1FPN3 4FOYA 4P9GA 3HQXA 3N36A 3J8F1 2Q8EA 2DURA 2HEWF 3VBHA 4GKXA 3SEPA 4BM8A 3OY8B 1JYIA 1Q5OA 5CIRA 4XABA 3WW4A 1H9PA 1VBE1 3K3OA 3D5OA 4XFAA 3I97A 4XMIA 4N8MA 4NPMA 2IXCA 1SZBA 3U75A 2ZHNA 5FZ7A 4BDVB 1Y3TA 2XH6A 1C8M1 1SFYA 2VULA 4UI9L 4BMEA 4DY3A 5FO9B 2ZGPA 3MF9A 5FPVA 1S0EA 2SBAA 3AC0A 3VL9A 5A3PA 5FZIA 1PIV1 2UYBA 1O5LA 2RS12 3VDCA 5CFDB 3LPGA 3ZYFA 1YFWA 5D1IA 1AL0G 2EIBA 2XVKA 1W04A 2R0HA 2VG9A 1JN2P 2VECA 5T5LA 3E97A 1ULEA 4ATEA 5L7OA 1K12A 3RZHA 2ZOEB 5LY1A 4O61A 4HPKB 4C1WA 2YC0A 2I45A 1DGRA 1U5XA 3S57A 1XJAA 2CDOA 4TWTA 5H9SA 4PF1A 2F17A 3H7YA 4MADA 4YW5A 3CU7A 3OCPA 2QQJA 2HWC3 1CJPA 1FAYA 1MS9A 1E5RA 2D3RA 1I3HA 2ORZA 5I0RA 3RZGA 4AFAA 4INDA 4BQ4A 3O1RA 2A6ZA 4NO4A 5FWJA 3PJYA 4DEQA 4XIKA 1WW5A 2E7TA 4FP2A 2OUJA 1QHDA 2XJPA 1HRI1 1V6LA 1WA4A 5C5UA 4K20A 1TME3 4GWJA 3WR0A 5BYNA 2QFEA 1S2KA 2YYOA 3M3QA 4IEWA 3OUHA 3VDAA 4DRVA 1SACA 1V6OA 4LEJA 4ASKA 4PIYA 4UXAA 4XFFA 3WQ1A 3RNSA 5JZGC 3R0RA 4N9IA 4UFKA 2R32A 2Z2SB 1QJX1 2QQVA 4L97A 4M3CA 3VZMA 4XETA 4AVSA 1X8MA 1BBT2 2WABA 3ZXDA 5FZFA 4DPNA 3HAGA 3SXWA 1LAJA 2LS6A 5I91A 1W0NA 1BKZA 3NAPA 1Q8QA 1GSLA 2VMCA 3KGZA 3JXSA 2W08A 2KA3A 1VBA2 4M0NA 4GB33 4RHV1 5FZKA 3RWNA 2WC2A 4FFHA 2WQ4A 1V9U1 3MIEA 4JGYB 4YZ2A 4QX8A 4XF9A 5FPBA 3ZN6B 4MXWA 4K7JA 5FY7A 2PHXA 3SKJE 2G19A 2E63A 2JKBA 2VNOA 1CAWB 4DS0A 4XHBA 1MS8A 2FBEA 3P6BA 1O4YA 5C3PA 3O1PA 1TEIA 2NPIA 1MPXA 4B7KA 1WZXA 3ZSMA 5A32A 1M4WA 1O5UA 3ZN5A 3RVHA 2IZWA 3CBNA 2W91A 3FMGA 4Q0PA 1YNAA 2JENA 4OZXA 5ABJA 2HWC1 4MGZE 3AFKA 4C1XA 3E5XA 4LA2A 4CDQC 2VQAA 1F31A 1CAVB 5F39A 2JDNA 2JE7A 2MNGA 3ZXKA 1ZBA3 3FUQA 4H3WA 4IETA 1TG7A 2RS32 2Q8CA 4QD2A 1RVF1 3W5NA 5FZ8A 4QDQA 1FPN2 1N3OA 4CCKA 1BMV2 1L3JA 1PGSA 4KG8A 3MLLA 4OCTA 2WSUA 3UKVA 1J3QA 3KF3A 5ABJB 1JZ8A 1AXZA 1H8TA 1YEWA 5DUXA 4HLTA 1ULGA 3ILNA 5JUVA 1ZZ8A 2LALA 2YG0A 1X8EA 4K8FA 3OGJA 1SPPA 4BU2A 4JQTA 4CPBD 4CCDA 3BCWA 2ERFA 1DYKA 1ZZBA 2DCZA 2PA7A 3FFZA 4PIXA 5KHIA 4R9BA 2V5YA 5BNNA 3VKNA 2XB6C 1D2QA 4PBPA 1DYPA 5B2GB 4QQOA 1C1FA 4YSFA 3KT1A 4FPJA 4IW3A 5FQ0B 3LIGA 3TWIA 2W52A 3SEEA 5A6ZA 3AVRA 3MICA 2O0OA 4NPLA 3AJYA 3CJXA 1J1LA 5C7GA 4UBGA 5DG1A 4I0BA 1JZ5A 3VV1A 4WM7A 1OLMA 4D6SA 1PGL2 3MPBA 4LBLA 2ZEZA 2P1BA 3RPQA 3MIHA 3UV9A 1R1A2 1DZQA 2WZR3 3AYDA 1B35A 4GMP3 4AAPA 5A3MA 4YM1A 1PX3A 1QJEA 5LY2A 3U10A 1SG3A 4LHSA 1O4TA 2DF7A 4HMZA 3ZYRA 2YZ4A 3ATGA 2ILMA 4Y5Z0 1RUC3 5J3UA 3DEMA 2VL4A 2W94A 4XZPA 3N9QA 1MVQA 1NE4A 3S7EA 2VZQA 3IMNA 3Q8FA 1NY72 4WVMB 4F83A 2QDNA 5FY5A 2NN8A 1R083 1GNZA 2Y6JA 3EXUA 3I7DA 4IE4A 2GMPA 3H42B 5CBLA 5FO8B 5DAVA 4MH0E 5FYCA 4PF5A 3B9CA 4LIUA 4QKFA 4A6SA 3CO2A 3VDDB 2G9ZA 4N53B 3B93A 1FATA 5B4NA 1RIRA 1YJKA 2RDNA 3WNOA 5JI9A 2VPVA 1W2OA 2VZUA 4XACA 5CZKA 3JQXA 2JE9A 2FZ1A 3ZSKA 4BHPA 3WT3A 1AVBA 1SBDA 1CN1A 2QBXA 1GU3A 1DIWA 2BRTA 1QOSA 4LLFA 3U1XA 2K0GA 2IXLA 2XVGA 5A7NA 2CDPA 4DIQA 4I3PA 3TN91 4EN8B 2DVDA 3AXEA 4FOVA 1LOAA 4LPLA 2PHUA 3B01A 1YXWA 3AZVA 1HJGA 4X6RB 1YFUA 2VCCA 3ZFEA 4KGGA 3FJSA 4Y26A 1LCLA 1V6IA 3VBRA 2VZOA 3BPSA 5FMBA 5CB7A 2C9AA 2IC1A 4JGZA 2PELA 1S0BA 4FCAA 5KWRA 2HH9A 2R062 1W9TA 5J96B 3RZLA 2PAEA 3PU3A 2BBAA 3USUA 2JDMA 3UT0A 4AQSA 3ZFEB 3WCRA 2LROA 1OH3A 2MHFA 3KQ4B 1RUE2 1XYPA 3OUIA 5FY4A 2D44A 1AHSA 2E51A 2UY8A 4WV8A 3W59A 4AGGA 4AYUA 1SQ4A 3OEBA 2D6OX 4ATFA 3POEA 1VJ2A 2C0ZA 2E6VA 1COV1 3PLQA 2OA2A 4L99A 2ZGTA 3CL1A 1COV3 2VW2A 4Q2FA 4ZU5A 2DTYA 3AXDA 1T6GC 2GNBA 3LAGA 4IERA 1MS3A 1EUTA 2ZA9A 4YGBA 4A7KA 3HBKA 5IFTA 1I1EA 3JQWA 3RWKX 1TME2 4A7YA 1IHMA 1EUUA 1JUHA 4R4XA 3VBFB 2VTFA 4FPGA 1S0FA 1AR63 1PVC1 5DQ0A 1QJX3 4NIAA 3WQ0A 2A75A 3WW2A 4QX3A 1J83A 1NCRA 1J1TA 3H3LA 2VMGA 4LTAA 1QEXA 1OQDA 4QGLA 1CVNA 5FP9A 4DY5A 4M3CF 4XXPA 5IVCA 3FN9A 4H7LA 5J37A 1RUI3 4Y22A 1B35B 4HVOA 3ABZA 3FX3A 4NHLA 2ZX0A 4IE5A 2X8KA 5LRRA 4R4ZA 3OUJA 3N9LA 5IFPA 5HPOA 3I3MA 2JDUA 3WNPA 2J1EA 4CUGA 3MW4A 5JXHA 4NAOA 1WA6X 5LK7B 4NVPA 1UF2C 4NHXA 1F5JA 4LKFA 2V4VA 3VD9A 2VZRA 1CIYA 4I3GA 1LOEA 1FOD3 5FJHA 1LOFC 5F6KA 4ES9A 2R7EB 4D0QA 2EAKA 1OXCA 3GJAA 2WT1A 4C0HA 3NNLA 4QQLA 5EJZB 3HD8B 2ZX3A 2Y38A 3OSDA 4UFJA 5CNAA 4JTOA 4O7XA 2ET1A 3SITA 2QQPA 1QQP3 4BISA 3OPTA 4OQ8A 2J1RA 1NE6A 1RUH1 2DUOA 2DU1A 4HFSA 1FMD2 5FXZA 3T4VA 5FZ4A 4N43C 4B7EA 1QJZA 1HRI3 1MEC2 1OHFA 4MGTA 3LFMA 3H7JA 1ENRA 2XVLA 1QNYA 5A7SA 3CZJA 1XNKA 4V1PA 1IG0A 3EBRA 5IW0A 2DBIA 3THPA 1UY4A 3UGFA 1XYOA 1S1AA 1D4VB 2VNRA 1MS4A 4L8QA 1LHNA 4GJYA 1RYYA 2X05A 4B4PA 5C3QA 5FLHA 4BQ5A 2AC1A 3BIWE 2VUCA 3IDBB 1X7NA 2ZJCA 3NO8A 4NMIA 1PK6A 1X82A 4YWAA 2A6VA 2XONA 1AXYA 2VOVA 2RJ2A 4CDWA 1XB9A 1Z78A 4JDOA 3BIEA 1NKGA 2GNTA 1DYOA 5JOYA 1WCSA 4D69A 2IWGB 1DQ5A 3PUIA 4UFHA 2CWMA 4B8EA 1FMD1 5A1FA 2ES3A 4QHZA 4W50A 2BEOA 4IEPA 3RZKA 1LTEA 1PO13 3UESA 3MI8A 1ZA7A 2NLRA 1VR3A 1TNRA 2AGSA 4PQQA 3VDDA 3WUDA 2DVGA 5C9AB 5FBZA 1HXS2 3SC7X 1UOBA 2GU9A 4RR3A 1LOCA 5FV3A 2RS52 5CVRA 1FV3A 3MF6A 5LCWL 1B09A 1REDA 3GF6A 1C28A 1OA2A 1RUG3 4KWJA 3VHOA 1RVF2 1WLCA 4P5YA 4XCBA 1WCKA 3ZIWA 1GUIA 2C1FA 1BYHA 1RXFA 1AR83 2V09A 4FFGA 2W1QA 5DMYA 3T1MA 3VZLA 3WEZA 2PYTA 1XNAA 4PDWB 4F3JA 2RMU1 5AFEA 3LOBA 1OQEA 2O8QA 2RDQA 3AZYA 3FLRA 4KU7A 1NLSA 3JZVA 4YG3A 4LKEA 5IWFA 1Y7BA 3AMMA 1JODA 1VBC2 4AEJA 3VBSB 1VPHA 1XSQA 2R042 3V0BA 1W0PA 2XHNA 2HWB2 2PHRA 4LIVA 3PTYA 4FAHA 4MXVA 1HXS1 2Y6HA 2XBO3 1W8WA 2CYFA 1NT0A 3AYEA 4Q8LA 5FMOS 5A7OA 3WDYA 1LEMA 4LA3A 5L19A 4HN0A 3IT8A 5JSOA 3ZYGA 4XFCA 3U14A 2WZ8A 2PFWA 4D3WA 1UZZA 2Q5TA 1QJU2 1OVSA 1Q43A 1TMF2 2BV4A 4QPIA 4XBLA 1JI6A 3U07A 1OC1A 1JOBA 3B00A 4FPHA 5BY5A 3MEPA 1OD3A 1K45A 4P9LA 4BYYA 4DB5A 4IEZA 3MIBA 1QU0A 2G4IA 2BNNA 2RG4A 3IZOA 3JD73 4ES8A 5L36A 1R091 4BOWA 1KD7A 5AVAA 3B94A 4AOCA 5L7OB 4IEYA 3PDQA 1G9AA 5LA0A 1UMIA 2BVVA 3NSTA 4OQ9A 1GOFA 2VQTA 2VH9A 2OPKA 2Y0IA 5KXCA 1N47A 1RTVA 1UU4A 4IUGA 2R071 3EB7A 1UKRA 4MHUA 4XAEA 3BB6A 1FNYA 4FFIA 3FHAA 2BGPA 2VOWA 5IK8A 1VBD1 3EMRA 1ZRDA 4CDQB 3WW3A 2VAUA 1VBC3 3NRUA 2R6QA 3FZ3A 4DQAA 5BNOB 1D4M1 2XWJB 1LHVA 3LKJA 4XJUA 4FPLA 1O6UA 1NLQA 1KS5A 1UU5A 1JZ4A 1GWKA 1DQ0A 4QHOA 3SMHA 3U4XA 5TSWA 4URAA 2W9XA 4OLLA 4E4DX 1RUJ2 5EV7A 2IVJA 3RYRA 4YZ5A 1WMFA 2FCTA 5F7UA 4IV1A 4XDOA 4GWIA 4XIOA 1QWRA 3FFQA 1N1YA 1H8VA 2VBPA 1ZRIA 2ZEXA 4NPRA 3J7NA 1HRV1 2PQQA 4BXFA 1HN0A 2BJSA 4CZSA 2LW8A 4BQ2A 2BQPA 3K4AA 1RGSA 3ACHA 3PVOA 1LU2A 2ZGUA 1DU3D 3LSDA 4RQPA 4WM7B 5D8AC 2BWAA 1NG0A 3POGA 3WY6A 3NAPB 1GMMA 4Q0VA 5DABA 2Z4FA 2D5FA 1O59A 3CEWA 3I2IA 4N53C 2VXJA 4TYSA 5IVJA 3L2HA 3NKGA 5FY1A 1I5PA 1BZWA 5JR7B 4C0BA 4H7MA 2E31A 1DCSA 3WNXA 3C3VA 4FOQA 1SCRA 4G4FA 3UJQA 4YM3A 2G9GA 5FY0A 2EF6A 1QMJA 3IAQA 4M4PA 4NHKA 1QJFA 5FZ3A 2HWF3 1VAMA 5DUVA 3VZKA 1QXRA 1SLCA 4L0PA 2YXSA 4YZ4A 5E1RA 4C91A 5FCCA 2Z79A 4HANA 3MFCA 3S6PA 2CHHA 5FZDA 2KD7A 3KVAA 2PHDA 3NJXA 4NAMA 4XF3A 3LE0A 3UETA 5C4WB 1R081 1W3VA 2J22A 3RFRA 1F4AA 1JYVA 5IVEA 1EY2A 2ETEA 2EXIA 2GC2A 1GYKA 2PHFA 4Q0QA 4CDXB 1R1A3 4UWDA 2XOMA 2ZMLA 5GALA 3LEMA 3SH4A 2VUDA 4LO6B 5LB6A 4BB3A 4COYA 3UKTA 2VMEA 4ASMB 3NV4A 4AEDC 5K4LA 4PIZA 4XXAA 4KWLA 2JG9B 4QMAA 3LEKA 4OI4A 4WM8C 4FVVA 3T2PA 2WKKA 4OUSA 1QOTA 2AZ5A 1NUKA 4AW7A 4XBQA 1W6QB 4HKLA 1DFQA 2OIIA 2W47A 4JKLA 2B7YA 2QCSB 3DECA 2P34A 4BK5A 2VU9A 3MUY1 4O65A 5JOWA 1HX6A 2DYCA 4EROA 1MQTA 2VOKA 5C71A 4P9YA 4GB31 4RHV3 4XPVA 5A6YA 1UD1A 1VMFA 4KQ7A 2WO3A 5BNPA 3E5UA 1RUD3 4LQRA 4CDXC 4J6GA 4YVSC 3ZN4A 5JI7A 5J09A 2ZKLA 4Q4V2 1OT5A 2ZTNA 2XJVA 3M3CA 1BEV2 4JRAA 4AZZA 4A45A 4FPOB 1YUDA 3VBSA 5FPAA 1AR81 1ZNPA 3TB0A 3AZXA 3KLSA 4UT5A 3ZIXA 4N53A 1LB2A 4IEOA 1NAEA 3VKOA 3W20A 4FTEA 3O0WA 2HWE3 1G9FA 2Q8OA 5L9RA 1US2A 1WLTA 1HV1A 4LXLA 1S2BA 2WNUB 1RUE1 2J1UA 3LDRA 3PHMA 5FYSA 2WBKA 4YVSA 2OKXA 2B4KA 1W6NA 2QDRA 2ZGSA 3IDEA 1NCRC 2G9FA 5AVPA 4GWMA 5A7WB 1H1MA 3WOGA 1CIWA 4CRQA 1RUNA 1E5SA 2ZEYA 4OFGA 4MUVA 4YZ3A 3VBOC 4QWNA 3ZOIA 3W21A 5FYBA 1ZBE2 4QQPA 2X09A 5E8AA 2FHRA 2YGLA 3WF3A 1JU3A 3WVJA 2YBSA 1W2NA 3ECQA 3RJ2X 3BUCA 5FPXA 4TXWA 3H1YA 3THCA 3TRSB 3J26N 4XAAA 1QXJA 3KM5A 2QQLA 4CCCA 4JX0A 3H0OA 3WINE 1QJU3 1XNBA 4NE9A 2VVEA 4XQWA 1QH7A 4TSVA 1HLCA 1BCXA 1KGYA 2VMHA 1WD3A 2A3YA 2IVIB 4CUBA 3I59A 1SHWB 1UYZA 3CJIB 1BVP1 4XHXA 4FQZA 4JDNA 1L7LA 1A78A 1QDOA 3KV6A 4K40A 1NA1B 5FPZA 5A3OA 3KHCA 1NY71 2VVFA 3Q8AA 4QAWA 1X33A 4OMCA 3I2JA 1G7YA 4D8MA 1U12A 1LEDA 1O7FA 4P5HA 3R4UA 3NJVA 2R1DA 4LBKA 1TMF1 5FDBA 4J25A 1CESA 2FDGA 4FOWA 3BPZA 1JBCA 3OTFA 5KC5A 4LUKA 3S7IA 5F3GA 2JDZA 2HYKA 3NQHA 5JSRA 2P4EA 4MG2A 3ZYPA 4AGVA 5FMDA 1JTZX 3A23A 1ZZ9A 3BYWA 1CPMA 1O4ZA 1RUI2 1RUG2 3HWJA 4QDSA 4MOAA 1OUSA 1J3PA 3KT4A 4A4AA 3GM8A 1CAVA 2LUWA 1ND2C 3D8CA 5C9AA 5GKAC 2HWD3 3O1MA 2FDFA 1XE8A 3P3NA 1JYWA 3IKWA 3VD3A 4S2HA 4ORFA 5JCTA 1H0BA 3AL6A 1CZSA 1POV0 5EQUA 3MLKA 4CDXA 3DCQA 3I3BA 3N7MA 2YUEA 3LA3A 3B5LB 5HCBA 1UOFA 3WG2A 3AFGA 2WNVC 1RMU3 3POJA 3MIFA 1X36A 5IHRA 4A6OA 2CSGA 3U11A 5FOBB 1PO11 4FPKA 1AZDA 1YCIA 4RD7A 3WX5A 2BPA2 2XLGA 3ASIA 5JSPA 2R0FA 1OFNA 2RHPA 5BPXA 2FDKA 4GULA 3AJZA 3SLIA 1GP5A 2OYZA 3P3PA 3BI3A 3ZDVA 3KCXA 2Q30A 5T55A 3VDBA 5DPNA 5GJ6A 4NROA 1HRI2 1MEC3 2H6BA 4UFLA 1D2SA 5HCFA 5C3RA 3LD8A 4AL9A 3LDBA 3HNMA 1EV13 1UQXA 4CCOA 5BUVA 1YC61 1CAUB 1GOGA 4QX2A 3VN4A 2WQZC 1AXKA 3ZR6A 1CR7A 1G86A 1R1ZA 2E7AA 2R30A 5FZOB 5CFCA 4ZHNA 5A7QA 4BLIA 1KFUL 3AYCA 4D6QA 1MQTB 4HONA 4IEUA 4UW3A 3VDDC 3THTA 2QQNA 3USUB 3ILFA 4O9GA 1NQJA 3QCWA 2OQ7A 3VD5A 3H50A 1ULPA 4XBNA 1UY3A 5FPUA 5HI0A 4CP0A 3D6EA 2MEV2 4CCMA 3I8TA 2JECA 5LWBA 2WL1A 2WNVA 3UK9A 1IQAA 4LUMA 1LGNA 3QD6A 3BN6A 4KNCA 2PHTA 3VBHC 1CX4A 2UURA 1V6KA 1JOJA 1O91A 3MV11 4Y1UA 1YQ8A 1DGWX 1W6QA 2NM1A 1QF3A 2BOJA 1PO22 4AI8A 2W92A 3L2YA 1OKOA 3JD71 5F5CA 1RXGA 3WCSA 3ZXGA 1KRIA 1HDKA 1UAIA 2BGCA 2D93A 2ZABA 2WWSA 4PHZA 3POBA 3NJZA 5HBAA 2XPJA 2CTVA 1JS9A 2JD9A 1ENSA 3OYWA 1RHI2 4ONUA 2GC3A 1GP4A 1IOAA 1D7PM 2XLAA 4JV4A 4KWUA 5K0UA 3SHRA 3UGHA 3E6BA 4I01A 3OD4A 4JVAA 5HCAA 2WYFA 3WSOA 4E2GA 4E2QA 4XUOA 1UO9A 1Y43B 3H1MA 2W95A 1W8TA 4M01A 1BVVA 1W0OA 5E88A 4CU6A 1XU1A 1FYUA 2OPWA 2XWBB 4Q1PA 1YQ6A 2E7QA 1NZIA 2AENA 1ULOA 4LO5B 4CCLA 4GB32 2ZX1A 2X5IB 2JDYA 5FWEA 1RUE3 3N9PA 3CIHA 1W8OA 3GHNA 4KWKA 4BIOA 2KXLA 4OHWA 1I6XA 1CQ9A 3BVCA 3J8F3 2CV6A 4G9SB 4Q4Y2 3UL2A 5LBEA 3WQBA 4LHNA 2WYSA 2PTMA 4I0WB 4W4ZA 4XFGA 4YM2A 2HLEA 1W3XA 3C7FA 1COV2 2WJSA 5A33B 3THDA 4HL0A 5C4WC 1D0GA 1W6PA 1DGRN 2J1VA 3K4DA 3GALA 2YY1A 4BE3A 5FKCA 3R4SA 2VBBA 2D6NA 2D3PA 2RDSA 3I2FA 2NP0A 5FYHA 2YFZA 3O1SA 1W28A 3G6JB 2BNMA 3GNEA 2C4XA 1ALYA 2ENRA 1AX0A 1CONA 4PDWA 5FYTA 3QH6A 5IVBA 3GCWA 1WLDA 3M70A 1X50A 2EXHA 4XJ9A 3KVBA 3IAPA 4YVWC 3J8F2 3VKMA 2JXAA 3ZKYA 2UYAA 2XXZA 2ZMNA 2NMOA 2ZBJA 2AR6A 1W2TA 3IIIA 3BOPA 1HB1A 4ZXKA 5LASA 4AFDA 2BVBA 2V72A 2GALA 2DVAA 2HWF1 1JHNA 4WM8A 1EPWA 2W2IA 2VVDA 2W39A 1KEXA 5ANNA 1V70A 2HKXA 2IFRA 4IGOA 4JHZA 4MO3M 2WDBA 2C26A 3E1F1 5JOXA 2JEMA 3DF0A 2QNKA 1SBFA 4NHMA 4WM7C 2ZGKA 2Y6KA 5G04L 4QGMA 1VAVA 3SH5A 4A3ZA 4EZ4A 2RR13 2Y0OA 1H4GA 1LGCA 4JDMA 1MZ6A 2RR11 3MGUA 3VBUA 2HWE1 5FK7A 2VC9A 3WP5A 1OA3A 1ND3B 4GALA 1Q8PA 4GXLA 1Q8SA 1J84A 2EALA 2HWF2 1POQA 2GH8A 5J36A 5FZEA 5CEHA 4LO7A 1K5MB 4LK6A 3NKTA 1STMA 1MZFA 1SEFA 2QQOA 4FT8A 4RR3C 1HV0A 4FI9A 2GN7A 3NL1A 4ET7A 4DOUA 3MYXA 4OHYA 3FWEA 4MYEA 4NHYA 4MV2A 1NXMA 4XVHA 2ZS6B 3AP6A 3WXPA 5C33A 1RUC2 1OVPA 1OA4A 1T6BX 1V9U3 2PHWA 3ZMOA 4CUAA 4QDRA 1O3RA 1J59A 1RHI3 1F8VA 1C57A 3DYMA 3I54A 4QPGC 4QXCA 1ASJ2 1PGW1 1UXXX 5FTTC 1D4M2 3UJOA 3ZO0B 1N1VA 2ZACA 4LBQA 5F5IA 3RMXA 5FZOA 2YGMA 2VXRA 3VKFC 1A8MA 4B1MA 3EQEA 1ZREA 1FNZA 1UKGA 4BZ4A 3JBG2 1E5IA 1W9FA 2DUQA 2YBKA 1XNCA 1KS4A 1OBNA 1TE1B 1VBD3 2BU9A 4AF9A 5JIUA 1RUC1 2RS53 3DXUA 5FAXA 1VRBA 4Y4YA 2P3YA 3O0XA 2Q8DA 3PIGA 4NWWA 4RHV2 1H1IA 1RVF3 3OOXA 4EQVA 2FCVA 5JXJA 5E6HA 3OBRA 1HQWA 3OPWA 3T0AA 2JICA 4QX0A 1GNHA 4BCUA 4FQ4A 3B3QE 3J7LA 3SQOA 2VBDA 2XLFA 5FZ0A 4Y24A 2ZX4A 3NV1A 2PLV2 2UU8A 1S2EA 4A42A 2OS2A 1BBT3 3ZN6A 3D82A 1C8M2 1DQ4A 1OQ1A 4A44A 2QQKA 2WSVA 4ISRA 5BNPC 3DYOA 3S5QA 2GDFA 4JHTA 4AE2A 3R4DB 2CU5A 5A7WA 1PO21 3O1OA 1NX9A 3VZOA 3VBFA 2VD7A 2E26A 1WBLA 4KL1A 4I2OA 3IN9A 4AQ6A 1V0AA 3O5SA 4WVZA 3ZMNA 5ISLA 4EZHA 1A34A 1YYNA 1LNSA 3ALQA 2IXHA 3PUHA 4CEYC 2BERA 2CY6A 1XNDA 2MEV1 2Q0AA 3K77A 4JCKA 4ZZ5A 3OY8A 2WUHA 2HJIA 4WVVA 3KWVA 3O14A 1CJDA 1UN1A 4YNIA 1AUYA 1YQ2A 5CKQA 3WNNA 4RN5A 1UX6A 5GZDA 3BU0A 3N3HA 4K1ZA 5FFOC 1ZVFA 5M0TA 2OVUA 3N4MA 5JDBA 1X9TA 3HJRA 1KDMA 3I49A 1UZ0A 4IL7A 3WF2A 3JB4C 1V00A 4O9EA 4KBBA 1G6NA 3RRDA 4E8DA 2Y6LA 3LPFA 3A4UA 3ES4A 3CQOA 3M3OA 4XEZA 3I2OA 3PU8A 4UOJA 1VRH2 1R1A1 3O7OA 3POIA 1NLRA 1J3RA 4Y3OA 3SISA 2VOXA 5C8CB 1REFA 3T1LA 1PHMA 4URTA 3S5AA 3INAA 1Y9GA 4R9DA 2DCTA 5A32B 1I5ZA 4JAAA 4ZY9A 1J58A 2WFPA 2WS93 3PUQA 4HETA 4AGRA 1XBFA 2KM2A 4BQ1A 4Q4Y3 4LNVA 4QPGA 4WZCA 1GV9A 3OG2A 1MVEA 2ET7A 2Q4SA 3VD7A 3FBYA 1F9KA 3KQRA 3PTRB 5C5TA 5JZGB 1SDWA 3N7KA 2RS11 3WDTA 4IESA 1VBA3 4Q4W2 2OT7A 1SFNA 4KMQA 2P3JA 3PJQA 1OUXA 4XUTA 4Y20B 3DUIA 1IKQA 2B45X 4CP1A 2IXIA 4LOTA 1W05A 3DPRC 4OYUA 1N3QA 3RJRA 3RS6A 4DEVA 5IUQA 5KHKA 1HB3A 5FYIA 3UNPA 3K75B 3NV2A 5DN2A 4ZZ8A 5IVYA 4OI2A 4V2WA 3ZXFA 1SCSA 4RL7A 4Q1RA 3TEXA 4LHLA 4D7YA 3MIDA 2A3XA 3EYPA 1H30A 4AAXA 4R9CA 4QQ2A 1PIV2 3CDZB 1XQNA 3MPPG 2ZAAA 4Z07A 2BDRA 4CYDA 1ZZ7A 1X9PA 3IB3A 2DCJA 1G9BA 3BU7A 2GN3A 2YC2A 2YPJA 2RMU3 1LGBA 1H1AA 3H8RA 4S2DA 3CZUA 4XUQA 4YFZA 2RJKA 1ZRFA 4L9BA 3T4HB 1YFXA 5FR3A 1UL9A 2PN5A 3HQUA 3WDVA 2JDKA 4YPJA 5GLWA 5CU1A 1AR61 4AVAA 2EAAA 3QLQA 1S4CA 5JXIA 4BIFA 4QKBA 1VE0A 2VMFA 5JIAA 1C4RA 1OF4A 3T30A 1GZWB 1FI2A 2Z69A 3ES1A 1MR5A 2EXJA 4NN0A 4PI2A 4YW7A 4XFBA 4FPFA 4IV1B 5FY9A 5FP7A 2W68A 1W6MB 1WWYA 3DKQA 2WQ8A 3KT7A 5JPNB 5KBFA 3FHQA 4BXSV 1NA1C 3I2KA 2QKDA 4AI3A 1AJKA 4YFWA 1QXPA 4P9JA 5K7PA 2MEV3 1IPJA 1UCXA 4XFHA 5AC93 3HNBM 3QBQA 3LOIA 5FLJA 4AK3A 2AACA 5I0UA 1BLZA 2R043 5C4WA 4LKSA 3ZDSA 4PLMA 1IPSA 1OFSA 3KF5A 4NWVA 1BEV3 3LQCA 1CPNA 1R64A 3WG1A 5FZGA 1JZ3A 2VTXJ 4Q4V1 3PIJA 2FQPA 5EPAA 2OZJA 5LATA 1OOPC 2VMDA 1AYN2 1URXA 2YBPA 3AMQA 3Q8CA 2R061 3I3DA 4CVUA 3BOWA 4CSWA 5KXBA 5DG2A 3ITQA 4Q0SA 4P9XA 5DAQA 2WT0A 4JGZC 2OXBA 4MXWB 4LBMA 2DU0A 4AVTA 4YGDA 3J7MA 4AI2A 1XU2A 1Z7S3 2A6XA 3HN3A 5JR2A 4GH4A 3VZJA 2BP6A 2RVAA 1BXHA 5CFCB 1SPPB 1VMJA 3ROUA 3LGRA 2A73B 3KCCA 4E4SA 5DUWA 1WMXA 4QB2A 4CDUB 4FXKB 3G7DA 1AYM2 5HV4A 2WWJA 1SLTA 1VALA 4MLOA 4IEVA 3AP5A 5F37A 2NZ9A 4AEKA 1PZ7A 4XC9A 3POWA 4IV3A 1UZWA 2D6KA 5FO7B 3BTYA 4B1LA 4FTSA 1UIJA 3HNYM 5BNOA 1NCRB 1ENQA 4RQPC 5CG9A 4KG0A 4LBJA 5I0DA 5KC6A 4Z2AA 4I09A 4MGKE 3V0AB 2OQ6A 4LT5A 2FCUA 2D97A 1GICA 4XJWA 2DVBA 5JZGA 1FOD2 3GYDA 1W90A 4HN1A 4QT6A 4WVWA 3TOJA 3WUCA 4EN9B 4B3NA 4IV1C 3WP4A 2DBNA 3X29B 4UYBA 1H6YA 1W8UA 2O8OA 4N9HA 3MFAA 4FSJA 4RGKA 1OLME 5DAXA 4PQ9A 4BA6A 3A22A 4XDPA 1A3KA 5K0UB 3ZLIA 3IPVB 4OULA 4ASLA 4M0HA 1DDLA 4UW4A 3MHZA 4JGYA 2QQMA 1LECA 5F5QA 1QQP1 1S0GA 2BWCA 1JOPA 2RM23 2H0BA 3GBGA 4SBVA 1LR5A 2XUEA 5FBJA 2RM21 3KV4A 3USSA 1OKQA 4CEYB 4GMP0 2FDIA 4HG6B 5BNQA 2BBVA 3IBMA 2RJLA 4W6YA 1UYYA 1AX1A 4M4RA 5EIYB 1A6CA 5CISA 4XCAA 2DV9A 1OPMA 4YM0A 3V0BB 4L2NA 3K48A 1IS5A 1RL3A 2X53S 1ZX5A 1ZBE3 2XJSA 2K46A 1DZRA 3MO4A 1AL22 4NJ4A 4XF1A 1PMHX 3IIAA 1GZCA 4YGEA 4YW2A 2RM22 4FO9A 4EV0A 2AREA 1RUOA 3WF1A 2ZX2A 4PCRA 4KBZA 4Q4W3 1JW6A 4MHRA 3P1IA 3J4UH 5F32A 3MUZ1 4IE6A 4LO4B 5FK8A 5DDJ2 1N1TA 4DMIA 2YC4A 4YW4A 4L92A 4PDWC 4RGGA 4E27A 4YZ1A 2P6HA 1W6PB 2VM9A 4Y1XA 4AFBA 2TBVA 4EN7B 3AKPA 2WT2A 3AP9A 3C7HA 2GP3A 3KGLA 5FYVA 5T5PA 3I59B 1KJRA 2YROA 4HK8A 4AQ2A 4YGCA 2EIDA 5K9YA 1H4HA 5T3NA 1YJLA 5FYZA 3C7GA 4GH4C 1NZCA 5F3IA 3M8LA 4NUBA 4A2UA 1FPN1 4BLJA 5JAXA 1XOYA 1AR72 3TNPB 1W39A 1WW4A 5CADA 4N7IA 1H6XA 3TYJA 4HVRA 4BK4A 4Y22B 1W6NB 4CXWA 5IT6A 1ENXA 1HRV3 2HWB3 1EP0A 3ZSJA 3Q8BA 4CU7A 2FZ2A 3JB8A 1DP0A 5KHHA 3KV5A 4L11A 2W3JA 3MBWA 4BMBA 4WZFA 4F8AA 1JZ7A 2V5DA 3AMPA 5BXXA 5GLTA 2QZ2A 2ZZQA 2XHKA 1UIKA 1C8NA 5T50A 2HEYF 1UY2A 4RYDA 3T2OA 5H9QA 4GZ9A 5GLZA 3VBHB 4AR2A 4DUXA 2Q1FA 1CZVA 4Z82A 1WBFA 1ZBE1 2RV9A 1UNBA 1K5MC 4MX3A 3RGBA 3CHXA 2RS13 4GJZA 3WLUA 2R16A 2BFUS 3LWCA 4IXLA 2XDVA 4BQYA 5C8CC 5AC91 4OI0A 1JZ6A 3GXUA 2C5DA 5FYUA 5A80A 3ZFFA 3I3QA 4E2SA 2CAVA 2P6CA 1UMHA 4D6RA 4CDUA 1AR62 1RUF2 5ACA1 3AX4A 1PVC2 4LBQB 3J7HA 2Y34A 5EP9A 4AHYA 4CP2A 1PX4A 2GH2A 2R49A 1UPSA 2D40A 3HR9A 3LB9A 5LBFA 3POSA 5BNPB 4K3UA 5A6QA 1YIPA 5E89A 2ZAHA 3MW3A 3D3AA 4QM8A 3KB5A 1K5MA 2PMWB 3OBAA 1LHWA 2Y8KA 3AYAA 3K46A 2JG9A 4S2FA 2TEPA 1IZ3A 2BGOA 2FD8A 1AYN3 3ACGA 1BK1A 2XQRA 3VBRC 2SLIA 4XZUG 1UMZA 2XL7A 3JU9A 4W6WA 1BQPA 5FPLA 3ZXLA 2W0XA 2O1QA 5F8PA 5L7OC 1HN1A 1KFXL 1S0JA 2JDPA 1W2UA 4ZU4A 3HN1A 3CMGA 1Y9QA 5A70A 4DUVA 3CKHA 4Q4Y1 1PVC3 2WLPA 1VRH1 3AMHA 2A6YA 5JOZA 1CAXA 5C70A 4AFMA 3AP7A 2JG9C 1FMD3 2YDEA 4WM8B 4FP3A 3APBA 4COUA 4CU9A 5L9VA 1OI6A 5B4XA 3PVEA 1R092 2G1MA 2W5FA 3NV3A 2V73A 2E33A 3ZXAC 3JBG1 4W6XA 5FP3A 5HXVA 3GZUC 3H8OA 1WW6A 5LRSA 1PVXA 4AWDA 2XMLA 2WO7A 3OF1A 4XURA 2VMIA 2I2SA 1XYNA 2X5IC 4AHZA 1MZ5A 3M3EA 4EWEA 2A70A 2C6SA 3WNMA 4ZONA 2ZMKA 2J1AA 4Q8KA 3A21A 1EAH1 2ZGRA 3CLPA 4ZS3A 4UFIA 4YW3A 5I0SA 1QJX2 2WIIB 2Y33A 4P14A 5D8AB 4AVVA 1YLLA 2A71A 3JCIA 1GANA 1ONAA 1VBB3 1OSGA 2A3WA 1WMEA 3GZTB 5FIXA 3J9SA 4TLFA 3AZZA 1XE0A 2GMEA 4Y5SA 1JU4A 4R8HA 1A8DA 4CE8A 5FOJB 3VGIA 3EHKA 4CXYA 3V65A 4QX7A 3HBZA 1VLNA 1W6OA 2C9KA 4Q4X1 5I8SA 1EV12 1TME1 1VBE3 4JGYC 3ELNA 2WO2A 3C8XA 4IDZA 1G9DA 3MLJA 1AYM1 1OOPB 3KCYA 1RJ8A 2WNOA 3RZJA 3RI9A 4CP9A 3OGSA 3DXTA 4XTMA 1LHOA 2FMDA 1NCQA 2JE8A 5EYXA 2UWAA 1PGL1 2GNDA 1NXD1 1UXZA 2B46X 5APAA 4DFSA 1DG6A 4MSVA 2N7GA 1G9CA 3GJBA 2WFF2 3HVDA 4OI1A 2ZHKA 1XSRA 4LR4A 1QJY1 4KU8A 3I2HA 4NIIA 4Q4W1 5A3TA 2D6PA 3OYWB 1ZYBA 3LIHA 1O3SA 3JBG3 5ACA3 4QHBA 3NNMA 1RUD1 4GMP1 5FXVA 5IVFA 1PZ9A 2P37A 3ACLA 3PVBB 4JRLA 1ZRCA 3VLBB 1GQGA 4NOTA 2H0VA 4CPBA 1ASJ3 5T54A 5GZCA 3M3IA 1ASJ1 1PGW2 3MDPA 1W8HA 4W65A 1W8ZA 4JKMA 2YV8A 4N43A 1OURA 4YRDA 1CAWA 3OGVA 4K21A 3RSJA 2IXKA 3PVNA 2BW8A 1DLCA 4AEDA 2D6LX 4IV3C 1R082 3O12A 3RQ0A 5FLIA 2BUKA 2WAOA 3T08A 1RUH2 2P3KA 2DFCA 3VBFC 5EXOA 3WHTA 2NYYA 1OPOA 1IQDC 1S0CA 2Y6FA 1XPWA 3GZAA 4QXKA 3VBSC 1SBEA 3W58A 1WW7A 5LEJA 1LOFA 1SLIA 4CA9A 4Z2WA 1HXS3 2YHJA 3O0VA 2QQIA 4XFIA 1F5FA 3LSEA 1B35C 3H9AA 3V56A 1GWMA 1BHGA 1C8M3 5K0UC 3HOBA 4EE2A 1OMIA 4J1XA 4AXOA 2OUHA 1O8PA 1ST8A 4DRRA 1BJQA 1RMU1 1ULFA 5D2AA 4AEMA 1C1LA 4Z8BA 3VB9A 1AR93 4YG0A 1LOBA 3LZZA 5KHGA 1AR71 3U4SA 1LODA 1ND2B 3VL8A 4CEWA 2ZXQA 2ZHMA 5GZFA 4SLIA 5DAPA 1U0AA 1DHKB 2R041 4NRPA 3QACA 1IS4A 1US3A 1RUF1 1M06G 3VZNA 3IDCB 4UFMA 2HEVF 1BEV1 1OH4A 1RUF3 3AMNA 3NJYA 2VZVA 3PURA 1FV2A 5EJ1B 4AFCA 3LEIA 4FAGA 1EAH3 2XUMA 3MW2A 4LHKA 3ZFFC 1YHFA 3HT2A 4PLOA 4XQ4A 3E6DA 5FZMA 4UBHA 3IM0A 4CDUC 3L9JT 4QKNA 4EJRA 4CUCA 1ZBA1 3O1VA 1AX2A 3IPVA 5JMOA 4HPKA 1U5YA 4Y1YA 3EJKA 3WF0A 4DINB 4CEWC 1AYN1 1ND2A 5C9AC 1MS5A 4G3YC 3N9OA 3WG4A 1F4HA 1QKQA 1UPIA 3BODA 3DPRB 1VMHA 2ARXA 4K8RB 2JG8B 2WS92 4UF0B 2WNEA 4D7TA 1N1SA 3AKSA 4B29A 3V0AA 1VB2A 2V4AA 3B02A 2MPFA 3FUOA 4CCJA 3RZMA 3HQRA 3ZYJB 1JZ2A 3VUOA 2VE1A 5K8SA 2WZEA 4Y4RA 1VRH3 3ZXEA 4XJZA 5FJKA 2XKOA 2D3SA 4META 1QDCA 4E9KA 3KS7A 1ZBA2 4K6BA 4M3CB 1Y4WA 1YRZA 1RUI1 1CAUA 2B9VA 2ZGQA 5DAWA 4A41A 4YW6A 3ZYHA 2YPDA 4IGQA 3WDWA 1F2NA 4GQ7A 1C5IA 2HYXA 4KGQA 2HBUA 5C3SA 5LA1A 1O8SA 4Q29A 5CA6A 3FC0A 4XJAA 2ARCA 3AKQA 2UY9A 4DXRA 1WCUA 3ENRA 1IPKA 1OLQA 3ST7A 4RS5A 1DGWA 4J1WA 1RUJ1 2VUJA 5GZEA 2ZPXA 5FMCA 1JYNA 2D98A 2BFUL 1RUJ3 2P17A 1WCDJ 3DN7A 2B42B 5A33A 1FOD1 2IXJA 4UW5A 1MACA 5F9TA 1H2NA 4BH9A 1BMV1 1V9U2 5GZGA 4QPYA 1RINA 4I0AA 1MEC1 3CNAA 2VTXA 4DXZA 1G8WA 1WLWA 1VBB1 4N7UA 3ILRA 1PM7A 4P9IA 3SCFA 1YQ5A 1O3TA 1QGLA 3DYPA 3W9AA 3Q9OA 4COZA 4XDQA 2RMU2 4KH9A 5H9RA 3A0NA 1O3QA 1Q3EA 2WN2A 4X6QB 2AEZA 2GP5A 1QOOA 2R063 3VBUB 3ZPYA 3LCPA 5F2SA 3T0DA 3LA2A 5DDJ3 3QH7A 5ABJC 3UKNA 2XBO1 1ZA4A 2HWB1 4Y1ZA 2E53A 2NQYA 2A6WA 4GD4A 3SH3A 3N7LA 1GOHA 4MZUA 3LA7A 5FZCA 2XJRA 3KV9A 2FDHA 3FE5A 3AKRA 4TN7A 3TEWA 2DCYA 3TBDA 1OLRA 3O1UA 2BNOA 3R6SA 5KXEA 4M3CE 5FKBA 3C7OA 5GLVA 5IJRA 1QJU1 2WWUA 3TNQA 1WKYA 1KQRA 3M2MA 1HB2A 4ZS2A 2O14A 1V6MA 3GGLA 4DUWA 2LTNA 2XJQA 2JDAA 1PO23 1QY4A 4CXXA 5ERLA 3SCGA 1OOPA 1CZTA 4PBOA 2KR2A 2ZGLA 1PO12 1ACCA 1GQHA 3HMYA 4HOOA 3I2GA 4QKDA 4H2AA 4EYUA 5F3CA 1EAH2 1W6OB 5KHJA 3CJIA 4NR1A 2GAUA 2CWSA 3HPNA 3M1HA 4OUEA 4HZFA 4Z1VA 5FY8A 1LESA 5LA9A 3GHMA 3FL7A 4FPCA 3VBOA 3ZFGC 3ZSEA 1KXGA 2VNGA 2EICA 4A3XA 2D6MA 4QXBA 3RG0A 4K1YA 4CEYA 3HT1A 1PK6C 1S0IA 5FUPA 5ACA2 4BQ3A 5G05L 3Q8EA 3PL0A 4HBNA 1YWKA 1GLHA 1POV1 4FFFA 5FZ9A 4XQDA 2WZPP 2K2SA 1EPZA 1HKDA 4AI1A 4QU2A 4DO0A 3F2ZA 4IEQA 1Y9MA 1YI9A 2BZDA 1K5JA 3CJIC 3VHRA 3ZPOA 2W87A 2ADEA 2WNUC 1KITA 3VHNA 5FREA 4HT1T 4XYXA 2YU2A 5LBCA 4LE3A 3JUUA 2IUWA 3OGGA 2VO5A 2WLQA 2ORXA 5JPMB 5F1RA 3SKVA 3NMBA 5IAVA 1EYBA 3RZZA 4AG4A 4LBOA 4XF4A 1D0HA 1LOGA 4NRQA 5C6CA 3PMSA 4QGNA 1IG3A 3RYPA 1RC6A 2W46A 4LE4A 1CD3G 1RJ7A 3N35A 4WVMA 1U5IA 1W99A 4GIQA 3K2OA 1VBD2 3ZKUA 3V64A 5F2WA 2FMYA 2CGPA 4JTNA 3DGTA 3ZSLA 4DZGA 1QIQA 4HK9A 1LENA 1UZYA 4JGZB 2C24A 2WAAA 1SMVA 2ARAA 2HWD2 4PJYA 4QXHA 2D5HA 3LEGA 2VNVA 2WNVB 4R52A 2CL2A 3VHPA 4JKKA 4MGSA 3ACIA 1ZZCA 2ZHLA 1RMU2 4IE7A 3CF6E 3FBMA 4XUNA 4OVEA 4B4QA 4E8CA 5BNNC 1FX5A 4Q5OA 5CG8A 3MIGA 5FXWA 4YVWA 3ZFFB 1W9YA 4NIHA 5C3OA 3ZFGB 1MS0A 4BQWA 1FT9A 3H8XA 3AB0A 4XJ8A 3UYJA 3U0ZA 2RS33 3VD4A 1K42A 1HB4A 3H3ZA 2X5IA 3K3NA 3OJBA 3OBTA 5LA2A 2Y26A 5IYYA 5ANQA 4IE0A 2HWD1 4KI5M 3D0JA 4DNYA 4XE9A 1W9SA 4V2VA 1APNA 1XNTA 1UY0A 2DUPA 4U2AA 1UX7A 2WA4A 3WHUA 1UY1A 2J1SA 3WNKA 3ZX7A 3FLTA 4Q4X2 4D7SA 4CDQA 3ZR5A 2UWBA 2EA7A 2K9ZA 2XJUA 4XILA 4CTEA 5IK5A 1U5ZA 1AJOA 1GNYA 3PUSA 1PNFA 2D7FA 5FUIA 1JYXA 2YB7A 5T5JA 3A0KA 3BTZA 4QQHA 1PIV3 1W6MA 2ZEWA
chains in the Genus database with same CATH topology
1LHUA 5DZEA 3PNAA 3D4KA 4RA0A 1QNWA 1RHI1 4QPGB 2UWCA 4HSJA 2P3IA 1GFF2 1GZWA 1KDKA 4XOGA 4LULA 1NQDA 3H3UA 1MS1A 1IKPA 3AZWA 2P2KA 1GZ9A 3WQ7A 3N7JA 4IEXA 3S30A 3SCHA 1TNFA 3S0MA 1C5HA 2QUOA 1POV3 3E6CC 2CAUA 3TAYA 1LU1A 4FPEA 3VBOB 1SLAA 1DZTA 2HWC2 4XMAA 4JC1A 1HQNA 3AM2A 3FLPA 4ATEA 2WFF3 3H8UA 3OD0A 2B8MA 2XGXA 5DXDA 3URFA 1SLLA 5EJ3A 2XL9A 3KSCA 3SNMA 1ULDA 1Z7S1 5T5OA 4AHWA 1BBT1 3WD5A 4OHXA 2A5ZA 4XTPA 2DWRA 5E16A 5JLVA 4I30A 1V6JA 4YARA 1H8TB 4OHVA 4GWNA 4RR3B 4K9SA 5JVVA 1WGPA 1OD5A 4OHZA 2TNFA 4M00A 4AVBA 4HKWA 1YFYA 1Q56A 4Q0UA 4E4ZA 2Q1MA 2PAMA 2R073 1RUD2 1MQTC 1VBB2 1Z7S2 2WINB 1MZEA 4XF0A 1IGOA 4U36A 1H2LA 5CFDA 1TMF3 1ND3A 1VAKA 1WD4A 1VBC1 1PK6B 4B4RA 5BNOC 5I93A 2CNAA 4YW1A 4QPIB 1EV11 3ZFGA 1PMIA 4Q4V3 4R9AA 4RGAA 1AR92 1LRHA 2RS31 3JD72 4BPZA 2HWE2 3ZVXA 4LBQD 1XE7A 2ATFA 2XG3A 3WW1A 1AF9A 1S0DA 4RS5C 4MGYE 3IWZA 4YLZA 4RS5B 3WDUA 1LJ7A 4FPYA 3WP3A 3VBUC 4Q4X3 5JMCA 1XRUA 3WV6A 1AL21 5CFDC 1VIWB 4IV3B 4AVCA 5J7MA 2A7AA 5GLUA 1I9RA 2ZCWA 4UW6A 5J48A 4FBFA 5DUUA 4ZKTB 2WS91 4Y1VA 1QJY2 5L73A 4X8NA 2X29A 1C3HA 3TN93 3ZFEC 3WDXA 4Z92B 1AR91 2JG8A 4YG6A 2QE3A 2IFWA 2GSYA 2B39A 3C2UA 5T52A 1DQ6A 4AEDB 1R093 4WBBA 1Q8VA 1UU6A 5SV8A 4CDWC 2OZ6A 1JH5A 3QOPA 2WA3A 1HIXA 4C90A 2VUAA 1VP6A 3B69A 3BALA 4RQPB 1DBNA 3EO6A 4HKOA 1GKBA 1CGPA 4Q27A 1JUIA 1H8TC 1RUG1 1JYCA 1D4M3 2GZWA 3WP6A 5C8CA 4QX5A 1JXNA 2JX9A 2DFBA 2BYVE 3RI8A 2LM3A 4COVA 1FXZA 5I0TA 3NVCA 2AH2A 1IS6A 4IQPA 4X8PA 1DQ1A 1NCQB 2GC1A 4EN6B 5EZWA 1Z0HA 1ND3C 5DZFA 3KZ4C 4Q26A 1VBE2 4GA9A 4CEWB 5C8WA 1DGLA 2AYHA 4FTBA 4EN0A 2WZR2 3DKWA 4HSLA 3WG3A 1ZZ6A 1ULCA 2XJTA 1N3PA 1SLBA 3M4FA 2D43A 4EWDA 2QZ3A 5DZGA 4LLOA 1HRV2 1PZ8A 1REEA 2VY0A 1PNGA 3VKLA 3ZYIB 2RR12 1AR73 1LULA 3BTAA 5KXDA 4H55A 3W9AA 1WMDA 2DTWA 1IS3A 2ZKNA 4N43B 3WP5A 4A7ZA 2PLV1 2ZZJA 2RE9A 4YVWB 5FRAA 1XXNA 1DLLA 1ZRRA 3I2DA 2F6BA 3AKTA 2WZR1 2EXKA 1NOVA 4RFT0 4GKYA 4P9WA 1QH6A 2AUYA 3NW4A 1YO8A 3H1WA 2BTVC 3GBWA 5A3LA 4AHXA 2JD4A 5SV5A 1RUH3 1RB8G 1VB4A 4LBNA 2JJ6A 4YVSB 3NWKA 2Z42A 2XBO2 1AL23 4AI0A 3KMHA 4PLNA 1AYM3 5FMOL 3ME2A 3AK0A 3GBFA 3B7MA 4MVTA 4AQTA 2QJVA 5CAZA 1S55A 2EVXA 2VGDA 4FXGB 5J98B 4EWAA 3FHIB 1ZM1A 1VBA1 3DL3A 5I8YA 4JQRA 2ZGOA 5AFBA 3POYA 2ZGMA 3D0SA 3E5QA 4YYOA 2CGOA 2E9QA 4COWA 3VBRB 1H2KA 1HQLA 4LO8A 2I74A 1WUVA 1LKNA 2PLV3 1Q8OA 2PHLA 3PMEA 3RDIA 2Z5WA 5H9PA 3NAPC 3DPRA 5BNNB 4QPIC 2ARBA 5D8AA 1GBGA 5JWPA 4H14A 3HIFA 3ZXJA 2B9UA 2RS51 5FQ0A 4ITCA 1H9WA 3R05A 2YMZA 4I02A 5LEKA 3AP4A 1DF0A 2GMMA 4S2GA 2PAKA 4OUMA 5BV6A 2TUNA 1AR82 2ZGNA 1CAXB 2OW4A 1UW8A 5DDJ1 5EWSA 1NA1A 3WZ1A 2EIGA 2WFF1 1HW5A 3K51A 2F4PA 2VW0A 3ETQA 2GNMA 5EFUA 4XW3A 1QQP2 4Y20A 4D94A 5I8TA 3I4IA 3RYKA 3KD4A 2H6CA 1TQ5A 1RITA 2Q1ZB 3B9IA 5CFCC 5IK7A 4F7ZA 3M7AA 4HVQA 1KJLA 5LK5A 5EYYA 1QJY3 2JG8C 3T2TA 2R1BA 1NCQC 2CGNA 1E57A 3TN92 4RSUA 1DQ2A 4CDWB 2VQ0A 2DVFA 4ZU7A 4N90A 4GH4B 2DCKA 3RMYA 1YIFA 4ISQA 2WNUA 3OPZA 2GC0A 1GR3A 4QM9A 5F6LB 2XKPA 2VW1A 2QVSB 1NYWA 5IK4A 2B5HA 2R072 4MGIE 2NMNA 2I07B 5GM0A 5AC92 1YI7A 1H2MA 4BWOA 1V6NA 3DV8A 1FPN3 4FOYA 4P9GA 3HQXA 3N36A 3J8F1 2DURA 2HEWF 3VBHA 4GKXA 4BM8A 3OY8B 1JYIA 1Q5OA 5CIRA 3WW4A 1H9PA 1VBE1 3D5OA 4XFAA 4XMIA 2IXCA 2ZHNA 1Y3TA 2XH6A 1C8M1 1SFYA 2VULA 4BMEA 4DY3A 5FO9B 2ZGPA 3MF9A 1S0EA 2SBAA 3VL9A 1PIV1 2UYBA 1O5LA 2RS12 5CFDB 1YFWA 5D1IA 1AL0G 2XVKA 2R0HA 2VG9A 1JN2P 2VECA 5T5LA 3E97A 1ULEA 5L7OA 2ZOEB 4HPKB 4C1WA 2YC0A 2I45A 1DGRA 1U5XA 4TWTA 5H9SA 3H7YA 4YW5A 3CU7A 3OCPA 2HWC3 1CJPA 1FAYA 1MS9A 2D3RA 1I3HA 5I0RA 4AFAA 4INDA 2A6ZA 4NO4A 3PJYA 4XIKA 1WW5A 2E7TA 4FP2A 2OUJA 2XJPA 1QHDA 1HRI1 1V6LA 1WA4A 4K20A 1TME3 3WR0A 5BYNA 2QFEA 1S2KA 2YYOA 3M3QA 4IEWA 4DRVA 1SACA 1V6OA 4LEJA 4PIYA 4UXAA 4XFFA 3WQ1A 3RNSA 5JZGC 3R0RA 4N9IA 2R32A 2Z2SB 1QJX1 4M3CA 4L97A 3VZMA 4AVSA 4XETA 1X8MA 1BBT2 3ZXDA 4DPNA 3HAGA 3SXWA 5I91A 1BKZA 3NAPA 1Q8QA 1GSLA 3KGZA 2W08A 2KA3A 1VBA2 4M0NA 4GB33 4RHV1 3RWNA 2WC2A 4JGYB 2WQ4A 1V9U1 3MIEA 4YZ2A 4XF9A 3ZN6B 4MXWA 4K7JA 2PHXA 2E63A 2JKBA 2VNOA 1CAWB 4XHBA 1MS8A 2FBEA 1O4YA 1TEIA 2NPIA 4B7KA 3ZSMA 5A32A 1M4WA 1O5UA 3ZN5A 2IZWA 3FMGA 4Q0PA 1YNAA 2JENA 4OZXA 5ABJA 2HWC1 4MGZE 3AFKA 4C1XA 3E5XA 4LA2A 4CDQC 2VQAA 1F31A 1CAVB 2JE7A 2MNGA 3ZXKA 1ZBA3 3FUQA 4H3WA 4IETA 2RS32 4QD2A 1RVF1 1BMV2 1FPN2 1N3OA 1L3JA 1PGSA 4KG8A 3MLLA 3UKVA 2WSUA 5ABJB 1J3QA 1AXZA 1H8TA 5DUXA 4HLTA 1ULGA 3ILNA 1ZZ8A 2LALA 4K8FA 1X8EA 3OGJA 3BCWA 2ERFA 1DYKA 1ZZBA 2DCZA 2PA7A 3FFZA 4PIXA 5KHIA 4R9BA 2V5YA 5BNNA 3VKNA 2XB6C 1D2QA 4PBPA 1DYPA 5B2GB 4QQOA 1C1FA 4YSFA 3KT1A 4FPJA 5FQ0B 3TWIA 2W52A 3MICA 2O0OA 3AJYA 3CJXA 1J1LA 4UBGA 5DG1A 4I0BA 3VV1A 4WM7A 1PGL2 3MPBA 4LBLA 3RPQA 3MIHA 3UV9A 1R1A2 1DZQA 2WZR3 3AYDA 1B35A 4GMP3 5A3MA 4YM1A 3U10A 3ZYRA 1O4TA 2DF7A 4HMZA 2YZ4A 3ATGA 2ILMA 4Y5Z0 1RUC3 5J3UA 4XZPA 1MVQA 1NE4A 3S7EA 3IMNA 1NY72 4WVMB 4F83A 2QDNA 2NN8A 1R083 1GNZA 3EXUA 3I7DA 2GMPA 5CBLA 5FO8B 4MH0E 4PF5A 3B9CA 3CO2A 3VDDB 4N53B 3B93A 1FATA 1RIRA 1YJKA 5JI9A 2VPVA 3JQXA 2JE9A 2FZ1A 3ZSKA 4BHPA 3WT3A 1AVBA 1SBDA 1CN1A 3MZHA 1DIWA 1QOSA 4LLFA 2K0GA 2IXLA 2XVGA 4I3PA 3TN91 4EN8B 2DVDA 3AXEA 4FOVA 1LOAA 2PHUA 3B01A 1YXWA 3AZVA 4X6RB 1YFUA 3ZFEA 4KGGA 3FJSA 4Y26A 1LCLA 1V6IA 3VBRA 5CB7A 2C9AA 2IC1A 4JGZA 2PELA 1S0BA 4FCAA 2R062 5J96B 2PAEA 3USUA 4AQSA 3ZFEB 3WCRA 2MHFA 1RUE2 1XYPA 2D44A 1AHSA 2E51A 2UY8A 4WV8A 3W59A 4AGGA 4AYUA 1SQ4A 2D6OX 4ATFA 1VJ2A 2C0ZA 1COV1 2E6VA 3PLQA 2OA2A 4L99A 2ZGTA 3CL1A 1COV3 2VW2A 4Q2FA 4ZU5A 2DTYA 3AXDA 1T6GC 2GNBA 3LAGA 4IERA 1MS3A 2ZA9A 4YGBA 4A7KA 1I1EA 3JQWA 1TME2 4A7YA 1IHMA 3VBFB 1JUHA 4R4XA 4FPGA 1S0FA 1AR63 1PVC1 1QJX3 3WQ0A 3WW2A 2A75A 1NCRA 1J1TA 2VMGA 4LTAA 1OQDA 4QGLA 1CVNA 4DY5A 4M3CF 4XXPA 5J37A 4H7LA 1RUI3 4Y22A 1B35B 4HVOA 3FX3A 4NHLA 2ZX0A 2X8KA 5LRRA 4R4ZA 3MW4A 5LK7B 4NVPA 1UF2C 1F5JA 4I3GA 1LOEA 1FOD3 4ES9A 1LOFC 5F6KA 2EAKA 2WT1A 4C0HA 4QQLA 3HD8B 2ZX3A 2Y38A 5CNAA 4JTOA 2ET1A 3SITA 2QQPA 1QQP3 1NE6A 1RUH1 2DUOA 4HFSA 2DU1A 1FMD2 4B7EA 4N43C 1QJZA 1HRI3 1MEC2 1OHFA 3H7JA 1ENRA 2XVLA 1QNYA 4BH9A 1XNKA 4V1PA 3EBRA 3THPA 1XYOA 1S1AA 1D4VB 2VNRA 1MS4A 4L8QA 1LHNA 4B4PA 5FLHA 3BIWE 3IDBB 1X7NA 2ZJCA 3NO8A 1PK6A 1X82A 2A6VA 1AXYA 2VOVA 4CDWA 1Z78A 4JDOA 2GNTA 5JOYA 1WCSA 4D69A 2IWGB 1DQ5A 2CWMA 4B8EA 1FMD1 2ES3A 2BEOA 4IEPA 1LTEA 1PO13 3MI8A 2NLRA 1VR3A 1TNRA 2AGSA 3WUDA 3VDDA 2DVGA 5C9AB 5FBZA 1HXS2 2GU9A 4RR3A 1LOCA 2RS52 5CVRA 1FV3A 3MF6A 1B09A 1REDA 3GF6A 1C28A 1OA2A 1RUG3 4KWJA 3VHOA 1RVF2 1WLCA 1WCKA 3ZIWA 2C1FA 1BYHA 1AR83 2V09A 3T1MA 3VZLA 2PYTA 4PDWB 3LOBA 4F3JA 2RMU1 5AFEA 1OQEA 2O8QA 3AZYA 4KU7A 3FLRA 4YG3A 1NLSA 3JZVA 1Y7BA 3AMMA 1VBC2 4AEJA 3VBSB 2R042 3V0BA 1W0PA 2HWB2 2PHRA 4FAHA 3PTYA 4MXVA 1HXS1 3WDYA 2XBO3 2CYFA 3AYEA 4Q8LA 5FMOS 1LEMA 4LA3A 5L19A 4HN0A 3IT8A 5JSOA 3ZYGA 4XFCA 2PFWA 1UZZA 2Q5TA 1QJU2 1Q43A 1TMF2 4QPIA 4XBLA 3U07A 3B00A 4FPHA 5BY5A 3MEPA 4BYYA 4P9LA 4DB5A 4IEZA 3MIBA 1QU0A 2G4IA 2BNNA 4ES8A 3JD73 5L36A 1R091 4BOWA 1KD7A 5AVAA 3B94A 5L7OB 4IEYA 1G9AA 2BVVA 3NSTA 2VH9A 2OPKA 2Y0IA 5KXCA 1N47A 1RTVA 1UU4A 2R071 1UKRA 3BB6A 1FNYA 2VOWA 5IK8A 1VBD1 1ZRDA 4CDQB 3WW3A 1VBC3 2R6QA 3FZ3A 4DQAA 5BNOB 1D4M1 2XWJB 1LHVA 3LKJA 4XJUA 4FPLA 1KS5A 1UU5A 3U4XA 1DQ0A 3SMHA 5TSWA 4OLLA 4E4DX 1RUJ2 5EV7A 3RYRA 4YZ5A 1WMFA 4IV1A 4XIOA 1QWRA 3FFQA 1N1YA 1H8VA 4NPRA 1HRV1 2PQQA 4CZSA 2BQPA 1RGSA 3PVOA 5D8AC 1LU2A 2ZGUA 1DU3D 3LSDA 4RQPA 4WM7B 5KWRA 2BWAA 1NG0A 3WY6A 3NAPB 4Q0VA 2D5FA 3CEWA 4N53C 4TYSA 3L2HA 3NKGA 1BZWA 5JR7B 4C0BA 4H7MA 3WNXA 3C3VA 4FOQA 1SCRA 4G4FA 3UJQA 4YM3A 2G9GA 2EF6A 1QMJA 4NHKA 2HWF3 1VAMA 5DUVA 3VZKA 1QXRA 1SLCA 2YXSA 4YZ4A 5E1RA 4C91A 5FCCA 2Z79A 4HANA 3MFCA 3S6PA 2PHDA 4XF3A 5C4WB 1R081 1EY2A 2ETEA 2EXIA 2GC2A 1GYKA 2PHFA 4Q0QA 4CDXB 1R1A3 2ZMLA 5GALA 3SH4A 4LO6B 4COYA 3UKTA 4ASMB 3NV4A 4AEDC 4PIZA 4XXAA 4KWLA 2JG9B 4QMAA 4WM8C 4OI4A 4FVVA 2WKKA 4OUSA 1QOTA 2AZ5A 4AW7A 4XBQA 1W6QB 4HKLA 1DFQA 2OIIA 2B7YA 2QCSB 2P34A 2VU9A 5JOWA 1HX6A 2DYCA 4EROA 1MQTA 2VOKA 4P9YA 4GB31 4RHV3 4XPVA 1UD1A 4KQ7A 5BNPA 3E5UA 1RUD3 4CDXC 4J6GA 4YVSC 3ZN4A 5JI7A 5J09A 2ZKLA 4Q4V2 2ZTNA 2XJVA 3M3CA 1BEV2 4JRAA 4FPOB 1YUDA 3VBSA 1AR81 1ZNPA 3TB0A 3AZXA 3KLSA 1LB2A 3ZIXA 4N53A 4IEOA 3VKOA 4FTEA 3O0WA 2HWE3 1G9FA 2Q8OA 1WLTA 1HV1A 1S2BA 2WNUB 1RUE1 3PHMA 4YVSA 2QDRA 1W6NA 2ZGSA 3IDEA 5AVPA 1NCRC 2G9FA 3WOGA 4GWMA 4CRQA 1H1MA 1RUNA 1CIWA 4OFGA 4MUVA 4YZ3A 3VBOC 5JPMB 5K8SA 1ZBE2 4QQPA 5E8AA 3WVJA 2FHRA 2YGLA 3ECQA 3RJ2X 5FPXA 3H1YA 3TRSB 3J26N 1QXJA 3KM5A 3H0OA 3WINE 1QJU3 1XNBA 2VVEA 4XQWA 1QH7A 4TSVA 1HLCA 1BCXA 2VMHA 1WD3A 2A3YA 3I59A 3CJIB 1BVP1 4XHXA 4FQZA 4JDNA 1QDOA 1A78A 5FPZA 4K40A 1NA1B 1NY71 2VVFA 1X33A 1G7YA 1U12A 1LEDA 1O7FA 4P5HA 3R4UA 2R1DA 4LBKA 1TMF1 5FDBA 1CESA 4FOWA 3BPZA 1JBCA 3OTFA 5KC5A 4LUKA 3S7IA 2JDZA 2HYKA 5JSRA 3ZYPA 4AGVA 1JTZX 1ZZ9A 1CPMA 1O4ZA 1RUI2 1RUG2 3HWJA 1J3PA 3KT4A 1CAVA 2LUWA 1ND2C 3D8CA 5C9AA 5GKAC 2HWD3 1XE8A 3P3NA 3IKWA 4S2HA 4ORFA 5JCTA 1H0BA 1POV0 3MLKA 4CDXA 3N7MA 2YUEA 3LA3A 3B5LB 5HCBA 3WG2A 3AFGA 2WNVC 1RMU3 3MIFA 1X36A 3U11A 5FOBB 1PO11 4FPKA 1AZDA 1YCIA 4RD7A 3WX5A 2BPA2 2XLGA 3ASIA 5JSPA 2R0FA 1OFNA 2RHPA 5BPXA 4GULA 3AJZA 3SLIA 2OYZA 3P3PA 3KCXA 2Q30A 5T55A 5GJ6A 5HCFA 1HRI2 1MEC3 2H6BA 1D2SA 1EV13 5BUVA 1CAUB 3VN4A 2WQZC 1AXKA 1CR7A 1G86A 1R1ZA 2E7AA 2R30A 5CFCA 4BLIA 1KFUL 3AYCA 1MQTB 4IEUA 4UW3A 3VDDC 3THTA 3USUB 3ILFA 4O9GA 1NQJA 3QCWA 3H50A 4XBNA 5HI0A 4CP0A 3D6EA 2MEV2 3I8TA 2JECA 2WL1A 2WNVA 3UK9A 1IQAA 4LUMA 1LGNA 3QD6A 4KNCA 2PHTA 3VBHC 1CX4A 2UURA 1V6KA 1JOJA 1O91A 4Y1UA 1DGWX 1W6QA 2NM1A 1QF3A 1PO22 4AI8A 3L2YA 3ZXGA 3JD71 3WCSA 1KRIA 1HDKA 1UAIA 2BGCA 2D93A 2ZABA 2WWSA 3NJZA 5HBAA 2XPJA 2CTVA 3OYWA 1ENSA 1RHI2 4ONUA 2GC3A 2XLAA 1IOAA 4JV4A 5K0UA 3SHRA 3E6BA 4I01A 3OD4A 4JVAA 5HCAA 4E2GA 4E2QA 1Y43B 3H1MA 4M01A 1BVVA 1W0OA 5E88A 1XU1A 1FYUA 2XWBB 4Q1PA 2E7QA 2AENA 4LO5B 4GB32 2ZX1A 2X5IB 1RUE3 4KWKA 3GHNA 4BIOA 2KXLA 4OHWA 1I6XA 1CQ9A 3J8F3 3UL2A 2CV6A 4G9SB 4Q4Y2 4DS0A 4LHNA 2PTMA 4I0WB 4XFGA 4YM2A 1COV2 2WJSA 5A33B 4HL0A 5C4WC 1D0GA 1W6PA 1DGRN 3GALA 2YY1A 4BE3A 3R4SA 2D6NA 2D3PA 2NP0A 3G6JB 2BNMA 3GNEA 1ALYA 2ENRA 1AX0A 1CONA 4PDWA 3QH6A 1WLDA 3M70A 1X50A 2EXHA 4XJ9A 4YVWC 3VKMA 3J8F2 2JXAA 2UYAA 2ZMNA 2NMOA 2ZBJA 2AR6A 3BOPA 4ZXKA 4AFDA 2BVBA 2GALA 2DVAA 2HWF1 1JHNA 4WM8A 1EPWA 2VVDA 2W39A 1V70A 2HKXA 2IFRA 5JOXA 2JEMA 3DF0A 2QNKA 1SBFA 4NHMA 4WM7C 2ZGKA 4QGMA 1VAVA