2RSLA

Refinement of gamma delta resolvase reveals a strikingly flexible molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
115
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refinement of gamma delta resolvase reveals a strikingly flexible molecule.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
molecule keywords GAMMA DELTA-RESOLVASE
total genus 42
structure length 115
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rslA00
4BQQA 1ZR2A 3LHFA 5C35A 2GM4A 5C31A 1GDTA 1HX7A 2GM5A 3BVPA 3UJ3X 3G13A 3GUVA 3ILXA 2R0QC 5C34B 1ZR4A 2RSLA 3LHKA 5C32A 1GHTA 2MHCA 3PKZA
chains in the Genus database with same CATH superfamily
4IX9A 1JH8A 1UQRA 2E6UX 4G9BA 4DLLA 5JRDS 1DJMA 4MR9A 1E1CA 1H2FA 1Y1SA 2ZRDA 3ZEIA 1CW2B 2ECPA 3C3MA 2G83A 3NZEA 4RZQA 5KHAA 1Z3CA 1HSOA 2PRKA 1SURA 2XDQB 1X7XA 4WCFB 3TL6A 3GBPA 1YFJA 3HTXA 1Z6ZA 2QVZX 3BPSA 5G0UA 2WR8A 3KE9A 4LHZA 1M1XB 1TCBA 4OAOA 4X1IA 3BRCA 3QMWA 4MW6A 2UVDA 3UCXA 4GPBA 4YNBA 4LDJA 1KSFX 5IJXA 5HBRA 1F4VA 2C84A 1TYEB 3RLIA 1V6SA 5IKPA 2GPJA 4EKNB 1VSVA 3D6VA 2Y66A 1KJQA 5TC4A 3D5EA 3BXXA 4X1KB 5HG0A 1V3TA 1KRXA 2C2KA 1T1EA 4JI0B 4H7JA 1SCQA 3T8YA 3MERA 3IQXA 4FZRA 1YB6A 1FTWA 4ZKEA 4BLSA 4IQ8A 3DMTA 4BE4A 3BK7A 4R9VA 5CIQA 1VRVA 4YJKA 5KTYA 2P9HA 1M75A 4IIEA 3V4OA 3NUGA 5DGDA 3BE5A 5C7YA 4YJFB 3WHKA 4CVNA 1KZHA 4IIFA 3RYCA 1DX9A 2EX4A 2ISSD 4MSUA 5JSHA 1MN6A 2XCUA 1T3HA 1D7AA 1OPXA 4R05A 2HTFA 3CISA 1L7NA 1KI1A 3FFAA 4EW6A 2FFRA 2DY1A 2ZSJA 1R64A 2VSXA 4UVEA 4YCJA 1P6XA 3KJIA 2ZRPA 3N86A 3Q3JB 5ALTA 1AGNA 1ECBA 3GLHB 1NE7A 1FRVA 1TFUA 4CQMB 2ETVA 4DSUA 3D81A 3G02A 1PVVA 1JFSA 4GOOD 4ZDJA 2D1SA 2BSXA 4FFBA 1GU7A 3RI3A 1KJ9A 3CLVA 1YMQA 1N7GA 4CKWB 4EEKA 3ZNPA 3T1NA 4UUMA 1QO9A 2CXUA 2IY9A 2OCXA 2RMKA 5ALXA 4RQBA 5GONA 2NUTA 3S2FA 2W93A 1JVNA 2GBLA 3CH7A 4CCSA 2O3UA 3L3BA 1YVPA 2XUJA 5B55A 4OA5A 2Q4EA 4J9VA 1ZD5A 4LC9A 3T95A 1QP7A 4B7CA 3VR6D 3AU8A 4B3MB 5DYIA 3BH7A 3KTFA 1ZUD1 4MAMA 1HK7A 3VU0A 1VLQA 4ODIA 3RWMB 2PXXA 4Q37A 3F6CA 3W8DA 1MTZA 2A1UB 3BXHA 3FGOA 4JITA 4ZCQA 2OLEA 3HUDA 5LP6C 5IKXA 3RARA 3OCYA 4DV2B 4N8SA 2WOJA 5JTTA 2RH8A 4S0XA 4K6HA 4OHCA 1GZSA 3HVKA 2V65A 4Y98A 5FLEX 2QL6A 4DW8A 1DBQA 1ZN7A 5AR1A 1G4AE 2V1XA 2I2WA 5ITZA 3BE8A 4CUJA 3WYGA 1ZXXA 2FZVA 4JGGA 4DXHA 1T6ZA 5E4YA 2FXVA 1JHDA 2ORIA 1ZWLA 1IY9A 4FHGA 1HZZA 1L1RA 4GOLD 2Z1NA 4P32A 3R9XB 4E94A 3KYIB 1W29A 2PWBA 1C2TA 5EXDA 2H8KA 2JGAA 5CT6A 4JP5A 2VH5R 5A3VA 1D09A 5ENZA 1CHDA 5IFLA 1HDRA 1J8YF 4YRKA 4CTMA 1DVRA 2XOEA 5TS2A 2CNNA 3N2EA 3LX6A 4MS1A 2R25B 4PRKA 2I4NA 4PZEA 4XE5A 4OV6B 4H3KB 1RWMA 3D8NA 2C8KA 1TQ6A 1R0ZA 3ANXA 2GPAA 5F3DA 2FG7C 1IIRA 3KU1A 2C0CA 3OCCA 1FYVA 4OQFA 4G85A 3HM2A 4KFSA 3I8SA 5IBCA 3AQ4A 3JD1A 3NIDB 1YR2A 1JR2A 2Y0DA 1TF2A 2QTBA 3HKBB 3NGMA 4MWGA 4FTWA 3OPQA 3GQBA 3IODA 4XD7A 2ZBUA 4AURA 5HM6A 3WA7A 3CUUA 4JJ4A 4OQEA 2RGAA 4DIUA 1HR0B 4GRDA 3LKBA 4GT1A 1KI3A 2QROA 5DHUA 3WHIA 3GPDG 3I73A 3B5EA 3B3JA 2J0QA 3FDZA 4M87A 2IBTA 1XHEA 3WRYC 1DEAA 4HLUA 2C00A 4TROA 1D6SA 1PJ3A 5I8PA 2ZPAA 1YOVB 1ZOOA 3N58A 4PANA 2QZ9A 5ER9A 3RLFA 3B1ZA 4PR0A 3A7EA 1JE1A 1PV2A 4DV3B 3VNRA 4CEHA 1IUNA 3CRVA 5ALSA 2LIPA 2WPDD 2PGDA 1YUMA 1X1AA 3IOCA 3SWWA 3IR7A 4IG9A 5DLPA 1IMOA 1O95C 4OQQA 1N8NA 3C3DA 1L7PA 1FTSA 2Q0XA 3STHA 2V6MA 4ZYTA 1HDYA 1OXKB 3Q7IA 3FYTA 1NMSA 1AGYA 1KNXA 5J4LA 2PX6A 4HNGA 3RVPA 4IZHA 3MSXA 4MUXA 3O82A 4CM1A 3VA7A 2QX7A 4ZZ0A 1D2NA 1Q57A 3TOXA 1N6LA 1KBZA 1A9SA 2NVUA 1X3LA 1Y9ZA 3NAZA 3WB1A 3CLSC 1SOVA 1WY7A 2AMJA 3EULA 4LX0A 2B0JA 4WZZA 4KPGA 1OBHA 5KWVA 2UU9B 2GUGA 3QVTA 4G1UC 2HHCA 2J9GA 3SYMA 2HRZA 2QBYA 4X93A 1UODA 1H8HA 4ZRNA 4OI0A 1SU7A 4A92A 3QPCA 1LW6E 4TV8F 1XDDA 1G64A 3ENWA 3HZOA 3B6KA 1XZCA 5L95A 2BM8A 5A9RA 1XNJA 4Q9LA 2VYVA 3A2MA 3VBEA 3GRYA 4LV6A 4NJEA 1YTLA 4CEIB 4PSAA 4BNFA 2UYCA 1YU6A 4M1MA 4DZTA 3DE0X 3M2PA 5FWAA 1MX5A 4A0SA 4CI0B 3TRFA 2HADA 1KPIA 1N1GA 1RAFA 1U31A 1HG0A 2X6RA 1Q44A 4L5AA 4L6IA 2Q2WA 4H15A 1SB9A 1CCWA 4P0TA 4Y0NA 4ALIA 5BUCA 1EK1A 1KMNA 2BMAA 3ZE6A 2ZAOA 1NOIA 3MPOA 3QXXA 1MAHA 2O8FA 2I2XB 1AKQA 2W6NA 3L06A 2YJ6A 1NP3A 3KYCB 5DM1A 3RRFA 1ZSYA 1QPGA 4YRTA 2X0IA 4GWKA 4MLDA 3B5IA 4LY6A 2YXEA 4X0EA 1TJ3A 5B6JA 2Z43A 2AC4A 2CB9A 1AXEA 5HIAA 2DXIA 1GD1O 1X86B 4G1VA 2J5BA 4MS3B 1LBIA 4RADA 4YBRA 5KNDH 1K27A 4UE6A 1XVTA 2EWVA 1JWAB 3RFXA 4E4TA 5JS7A 3W0LB 2O2HA 1P4GA 1C7RA 3B2NA 1JHYA 1VKOA 5TSDA 5KTTA 1XO1A 2ISQA 5SZJA 5LZ5A 1ODKA 5BSMA 2A88A 1EFPA 2W2KA 1GJRA 5JQGA 1P1IA 5C1BA 2WTXA 1SXGA 3DD5A 3HRKA 4ZREA 1Z29A 5IBPA 2O4CA 4X94A 3KT3A 3DLCA 4FFVA 2YZ7A 5KCMA 3UJ6A 3O1JC 4YIKA 4AUMA 4QBHA 1N0VC 4NBVA 1NR1A 4BP8A 2KBFA 3TR5A 1E3IA 1Y42X 3PGLA 3QUAA 4PSKA 3MRTA 2AH5A 3FETA 2WFZA 2HIMA 3DEYX 3PFKA 2IVZA 2OECA 2ASVA 1FVHA 1QE5A 2VWPA 4HEHA 4NZPA 3JTMA 3W2IA 4AKEA 1C30A 2Z4SA 4HEJA 4LEIA 4ZEMA 3MRSA 1PTKA 1GPWB 4J7UA 3JALA 4RHCA 1U2DA 2R1UA 3DAFA 3W7VA 2R5WA 3QWHA 2CV0A 4D6PA 3B36A 1OLXA 1X94A 1Z7YA 3KBOA 4M7PA 4J0JA 4GPZA 4C6RA 3EEFA 5K6TA 4NEHB 1J7KA 4XGIA 1OASA 1RLJA 3EGXB 4NCNA 4FI3C 3IEMA 1NRIA 1FVOA 3MWDB 2J5QA 4TUYA 5F2EA 5FI5A 2MINA 1LDMA 1XKXA 5EZYA 4MHTA 1HNXB 5JCJA 1A8PA 3PVZA 4JI1B 2K87A 2ZKIA 1HE8B 3PDHA 3R7DA 1KERA 1KC3A 1OT5A 5HNKA 4WNAA 2Q4TA 1C4KA 2WSIA 5IX8A 1T91A 5JD5A 5I9MA 3VR1A 1FYDA 2H29A 5KNCD 1SC3A 1TYBE 3E7DA 2LVBA 4M1TA 1MB3A 1R37A 2ANCA 3VPAA 3W8FA 2H7XA 2YJZA 4RDHA 1QIEA 3ZGOA 4AG3A 5G53C 1BN7A 3LA6A 4P53A 1I7NA 2IXAA 4O2AF 1Q0ZA 2QK4A 3BDAA 2PGOA 4I4IA 1USVA 5H0IA 3QPDA 3SDZA 3WBBA 3OESA 3JZMA 3H4MA 3IP1A 1U6KA 4INPA 4CN9A 3DE3X 1BXRA 2H8GA 4ZVTA 1D04A 4JLVA 3NDBB 4AVYA 1DJQA 2OENG 5EIBC 4AY4A 5K5EA 1NVGA 2XNDD 2MSDB 2RHTA 1DAHA 2DKNA 1XTJA 1YL7A 3HNPA 3K8YA 4EH1A 4M9ZA 1SUCA 2FMKA 1KGSA 1NQWA 1TX4B 3V4VB 1O3YA 1JLSA 1XEWY 4KACA 4Q9IA 3ESQA 4MVJF 4ZFNA 4B7UA 2EKLA 1II9A 2AN3A 3FFTA 3OX3A 4QOSA 1BE8A 2I7VA 4L7VA 4XJXA 4CT0A 2GNOA 3JPWA 2C88A 4URVR 4MUJA 4KAFA 2QE7A 2AFIA 3A1FA 1PWZA 5LR6A 2WJGA 4ZV4A 3L07A 5BQ3A 3U81A 1MO3A 3JR7A 5HKKA 1WQ1R 5JY1A 2P6OA 3USZA 2OO5A 2QUBA 3OWXA 9MHTA 2C9YA 5DGCA 1TKAA 5JZSA 3QXSA 2WWRA 1HTWA 1X2EA 3HABA 2BBWA 3LUFA 4WXPA 1QQ5A 4TZ0A 4ZTZB 1T1RA 5GZ1A 3PYMA 1U8FO 3UUGA 4R1OA 1U0TA 1WZIA 2EV9A 4H0NA 1AQJA 3EZ7A 2QZSA 3QMPA 3GLIE 1DXOA 3P71T 2AN5A 5LWHA 2X2PA 1S3GA 3CLTD 1Z34A 4UBKA 2V9ZA 4DWVA 4X7BA 2C2BA 3TRJA 4G4IA 2JFWA 5K4HA 5DNVA 5C4IA 1TW2A 2WVGA 3DQZA 5DV9A 4GKJB 2XKAA 1KFKB 1TTHA 3L9XA 5B2ZA 3AI2A 5IJ9B 4UMDA 1GITA 3TZBA 3PGXA 2ZSKA 3AVUA 4F60A 1M2VA 1YRHA 2P6UA 4FC7A 2XD9A 1GT6A 1U99A 4I5DA 1NUUA 4ER7A 5E1MA 3RRYA 1NQOA 3LIPA 3KX2A 1CUVA 2WKRA 4ZT2A 5FBLB 2JFBA 3CKYA 1ZJJA 3IEPA 2O50A 4EQZA 1N0HA 3RYIB 1YL5A 5K51A 2QTWB 4LTNA 4HLQB 4E3WA 2ZB3A 5TQ0A 1F6DA 5EUCA 2W8BB 5FULA 3N2KA 2OCBA 2A9RA 2NW6A 3DO8A 3BRSA 4B76A 2GXQA 1UMBB 1YRQA 2NNLD 1A2BA 1VDZA 2WZDA 1L7EA 2F1IA 4OXXA 2X0KA 4QTYA 3D4LA 4UM8B 2IS4A 1BHJA 4C2TA 3FKSD 3FPKA 2IZ1A 4CKEB 2F6RA 2PH3A 1G55A 1EVLA 1F6BA 3OQIA 4BWGA 3VO1A 3ZTWA 5LU9A 3D2BA 5D3KA 5EWMB 3GJ4A 2BMEA 1CUBA 3CRMA 5FHRA 3RC2A 1A50B 2PLWA 2Q62A 1QHXA 1R6DA 4TWJA 3VKUA 4BJ5A 1VXRA 2WMOB 4YY3B 1KOJA 3JYOA 1K3TA 4KLNA 4MS4B 3WL8A 1Z74A 4JA2A 2VT3A 2VZ9A 1LBQA 1J39A 5HQJA 4ENPA 3TLXA 4WK0B 5ECDA 1JSCA 3D3NA 4B0PA 2GN4A 1QOPB 1JQJC 3QK7A 3WG9A 1DE0A 3H2IA 1ZJZA 4H6VA 2W70A 2XUIA 4YAGA 3EDMA 3VZSA 3G0HA 2PO5A 1P17A 2Y1EA 2ZIGA 4HH3C 4Q1FA 2R4TA 4E5YA 1LX7A 4H7EA 4WUTA 1AF4A 5DBEX 3DEAA 3JVIA 1T1SA 3NHFA 3P2YA 4U1RA 4ARZB 1KSJA 4EJSA 3BXGA 3BD7A 1KY2A 5CLIA 3QKIA 3ZWBA 1GAXA 4PIPA 5LZ8A 3DLHA 2EKDA 3D8TA 4RD2A 3LF2A 4Y2HA 4ECEA 4D96A 4FS3A 3ZDZB 1LDGA 2E5LB 3WTCA 5KKCA 1DOZA 1R12A 4L4YA 1KL7A 4EY6A 1C9EA 3PNOA 3KV1A 3I5AA 4Z2AA 1OYYA 3V4PB 1GO2A 1NIPA 1M0EA 1MDFA 1QLJA 2JIPA 1VP9A 3CM0A 3CB2A 5JAIA 5CAEB 3RRMA 1XTQA 1I9CA 2A67A 3HA7A 5HTOA 1ONBA 2HI0A 2J7PA 3QPBA 4WK4B 3IP9A 2UZIR 3CVWA 3CW8X 3H1BA 4Z3DA 1URPA 4PSUA 2VHCA 2VUUA 4OHPA 3ZVNA 3STXA 1N9GB 2VS1A 3QUTA 4KE9A 1T0BA 4OK6A 4H6WA 4XYBA 1SHLA 3PU6A 1VI2A 3GFPA 4ND5A 1PT9A 1EK2A 4DLWA 4RVSA 4K7JA 1XF1A 3C2QA 1PZNA 1KRHA 4EGJA 3ANTA 1V0JA 3AO0B 2V5VA 2WSSA 1NUSA 2YDYA 1WF3A 4F46A 1W36D 1PNRA 4IVRA 2W7TA 4W1SA 5J2TF 3EVDA 3QWFA 3V4LA 2NYVA 2W6ZA 1IY1A 3EVTA 4D6XA 5JAOA 7ABPA 1XQYA 4K9RA 4M1SA 4Q16A 3V8MA 1O96B 1P7ZA 3W06A 1PQYA 3B5JA 1R50A 1LC3A 3IJEB 1Z4NA 4LHWA 2ALJA 4D82A 2ODWA 4DIFA 5ISMA 5DOVA 4HAWA 1YMUA 2G3YA 2H07A 4HY3A 3K0FA 4OM8A 5CA0A 2AV6A 4CWAA 1WQ4A 4AAYA 5JG7A 2RB5A 4HHEA 3AC0A 3QNUA 4DM4A 1ZHOA 1NXVA 4ND8B 1SCUA 4R7GA 4JLDA 4G5FA 3II6X 1QVAA 3NYQA 5AOAA 2WAOA 2C9CA 5ALHA 4GKVA 5ES4B 1NVKA 3FPFA 3TLMA 1PG2A 3IE2A 1IRIA 1S7GA 3OQMA 2E37A 2RGNA 1U2GA 2HCBA 4R40A 2OOSA 4BMXA 4ZYVA 3PNVA 5IWAB 2WJVA 4M0LA 2QNRA 3MK31 4LDNA 1QNFA 1DO8A 2GEVA 1FBNA 4XYMA 4BWVA 4MRMA 3GEPA 4PLPA 3SD7A 2JHFA 2G5GX 3QI7A 1ORTA 5IT5A 4CQMD 5I7FA 1X9HA 3I42A 4BV3A 1TYZA 2AWNA 2B78A 2GN6A 2R8XA 4QTZA 5G1PA 1M1YB 2JH8A 3WSTA 4F2HA 1T10A 2VJYA 5FD8A 4ENSA 5ETJA 1GEEA 4K6CA 5CB4F 1HXHA 2NYRA 3G6KA 4UDYX 2WWVD 5BSKA 4OKIA 3VC3A 3WKEA 5LIPA 4V0RA 2C2OA 3IILA 3A26A 1ESDA 1KEPA 1R6TA 1YAHA 3TW6A 3N0XA 1N3YA 3E5RA 4TS9A 4HB4A 4RQTA 1MO4A 5CNMA 3TW4A 2B25A 4PYOA 4J3NA 4CKCA 3OOWA 2Q5IA 5IJZA 1PK8A 1QH8B 2YTZA 3GZJA 4BPRA 4F2WA 1T2UA 5DZSA 2JBWA 4CPDA 2XRFA 3OT4A 3A2KA 1DC3A 1Z5OA 1B1AA 2VJMA 5C51B 4AJKA 4EL0A 4YGYA 4LNUB 4EKEA 4FYVA 3F49S 4HZUB 1PJRA 4WSOA 3CPSA 3T06B 1XIVA 4DIEA 1GCIA 3PD7A 1GVHA 1MOSA 2NYAA 1CR1A 4U9IS 3WLIA 3S2SA 2C2MA 2OBYA 5FPKA 3ZS9A 2IIPA 1H66A 1NM5C 1R8JA 1V26A 2VK1A 3CW9A 3E1GA 3OCZA 4ZQEA 3VYRB 1H6BA 2BW0A 3TFQA 1P33A 2X5JO 4GPD1 2HSWA 1XCPA 1X38A 3BF7A 3T9AA 4HDOB 2I1LA 4RBNA 1SIOA 3GT4A 2ERYA 1FDTA 1NW3A 1BW9A 1NGSA 5E6RA 2PTGA 2EAUA 5KZMB 4NOKA 1ZI8A 3Q41A 1FF9A 4TM7A 3RNOA 4CU5A 1WVMA 2MT9A 4CYMA 2FWBA 4XM0A 3PXEA 1YI8A 5CLFA 1BIFA 1OA1A 2B98A 2AX3A 1RP1A 4W5WA 3G0DA 2HXSA 1VSQA 4MKGA 1C0PA 1YVRA 4B3IA 1MP0A 3IHLA 3P94A 4RK4A 3ZDYB 4R9RA 1KAEA 2GDJA 3BD6A 3TQIA 2OP0A 4GMGA 4BNJA 1X1RA 4Z9YA 5TGTA 4Y6GB 2FMTA 1MKYA 2BY4A 2VT6A 2WYHA 4OPMA 5CLGA 3CIOA 3QWBA 5F33A 4JU9A 3F4KA 1N6PA 4IXDA 5KJ1A 1X77A 3LPLA 1UFRA 2PGIA 4HWGA 2B37A 4KQHA 3CB4A 4G63A 1XRSB 4ZEVA 1LSOA 1Y9EA 3CSUA 3K0KA 4D3FA 4EMUA 5ALVA 4MHSA 5CLJA 3EPLA 3BH6A 2HLHA 4GXTA 2PSJA 4LVOA 1SH7A 2QUJA 1NG9A 3IESA 3OZVA 3DXXA 1T4CA 4DV1B 4RESA 2G8LA 2C7PA 5F12A 5LQUA 1NF9A 2PZEA 3EEQA 2XMPA 3ON5A 3ZN2A 1IJFA 1EDZA 1QAQA 1GPKA 3DT9A 5JZBA 1IVNA 4LWQA 2IW1A 2GCIA 4UVDA 5FPPA 2C3UA 5LP6B 3BMCB 3EFBA 3WJ7A 4NP6A 4UD6A 3QYFA 1G2IA 3NOVA 4H4DA 3LCUA 5GWXA 1YH3A 3ETDA 3E6AA 2C3OA 2EKPA 1DL5A 3Q8XB 4I9HA 2V1UA 1GUZA 3STYA 1L7MA 2REQA 4QX6A 4DM3A 1Z08A 4WCFC 2PS3A 2X76A 3SS9X 1S89A 1KAMA 3DC7A 4KN9S 3VZPA 1NASA 1W4AA 3CPEA 2PZ8A 3MM4A 3WP1B 4A5SA 1DB3A 1ZGAA 2HU2A 4O4LA 2FPXA 4KE8A 4PX3A 5DSZA 4EPTA 4DCTA 1MAWA 4YAWA 1LQUA 1L4LA 4RJIA 5K03A 1VA4A 3MJEA 2IL1A 5FA6A 3VO2A 1Z7EA 1HFEL 4Y6RA 3O0DA 3P1JA 5BO5A 3AI3A 1VKJA 1R8XA 4IHJB 4MQUA 5AW2A 5I7VA 4DQ0A 4RORA 2P9JA 4DBLC 2PUCA 3D3JA 4DA7A 3U19A 3DEZA 1M34E 2VSQA 2XBMA 2BFFB 2D3WA 4DRZA 2UXBB 5JADA 1G6Q1 2MYUA 13PKA 1NI4A 2R68A 2UAGA 3DMTC 4Q3CA 1A7JA 4LQLA 4PZDA 4QO8A 4U3JB 3KV3O 3KVYA 1W1IA 4PC1A 5HPYB 4YJGA 1QHNA 4W1PA 5HFAA 3K4HA 1ZRSA 4E03A 4E0BA 4F7DA 5BNTA 2PT5A 4ZDKA 5FTJA 4EW2A 4FI3F 1LI5A 3EQ2A 3LCVB 2HSZA 4Y2JA 2NO4A 3FLMA 1DUVG 1ADFA 1U3VA 4JI4B 3PUWA 1XMVA 3UXMA 1YIAA 4KZPA 5TEWA 3GMIA 3FROA 1JSZA 3FVVA 1UZAA 3C48A 3CKLA 5HE9A 3RHZA 3WGIA 2ATXA 1ZFNA 4N40A 4AQYB 4IZOA 4C7KA 4KXUA 4OM7A 2Q1UA 4I55A 3O3NB 4PGHA 4YR7A 4XD2A 2CT8A 1PGQA 1N25A 5AUNB 1FB5A 1NYQA 4QICA 1JVBA 3ZVKA 1YOBA 2QTHA 3EVNA 3PKJA 1YI1A 3HBFA 3E03A 1VTKA 4TMXA 4TV9A 4EPWA 1UK7A 4YRLA 2GEBA 3AEYA 4WLFA 2NU6A 5K3CA 3QBVA 4R1SA 2SKCA 3UGTA 2QM3A 3I9KA 4YR9A 3HZHA 1N2OA 4GVPA 1KQOA 1AV7A 3NJ4A 4DM7A 1TCCA 4MUBA 4DMRA 3EAGA 3NV9A 5FH9A 4M8NE 1OWMA 3EG9B 4P58A 3FMOB 4Q6WA 4RL6A 4F11A 3SZMA 3FOWA 3M3DA 3QM1A 3A3KA 5I7RA 1JHQA 1LI4A 1UT8A 4FBMA 1JJVA 2GBGA 1YSCA 1SZJG 2XXAA 3OF2A 4UMEA 1DIBA 4O3MA 4R2XA 1XEAA 3RVJA 5EZYF 3I58A 3VKFA 2GWRA 2LUOA 3O95A 3ICEA 3HPQA 2C4WA 3OE1A 5K3AA 1D8AA 1JB1A 1ZINA 2JB9A 1V5WA 3M5PA 2QE6A 4BBAA 2JIMA 3HJTA 3LUGA 3KYBA 3GWZA 4Y6SA 1YQEA 3TQRA 1NPTO 1Z8NA 4BNXA 3CX4A 4ZN6A 1HYHA 4HVCA 4N76A 1V5FA 1MQ8B 4QUDA 3ZV6A 2Z3ZA 5DHPA 3CZRA 2AF3C 5KYKA 3EJ6A 3VYSB 1X1TA 1FUIA 2RK3A 4O2AA 4ZVSA 2ZUTA 1ZD2P 1XTPA 2OV3A 3DKKA 1DI0A 1TJ5A 4Q7MB 2W2OA 2AX4A 4H7PA 4PYQA 4RLQA 4CLRA 1XHLA 1E7QA 2EEZA 2PIAA 4BNKA 3PDIA 2QUHA 3GAZA 4MITA 4E2WA 1A2KC 1K6IA 4N65A 4D4HA 3HYNA 1R15A 4UHJA 5LJLA 1F8XA 1R27A 1YE3A 2IUFA 2TSYB 1H3FA 2WILA 2YHIB 2FSPA 3FYDA 3I45A 4RD4A 4DBVO 5GOTA 3SC4A 2NV6A 4IIGA 1ZGBA 4ZEXA 2UYYA 4TSKA 3RM3A 5JHHB 1I2AA 4AJHA 3RVKA 2CLIB 5HVNA 5IM4A 3TTTA 1ZH4A 2FUEA 3NRCA 5JJBA 1CS4C 2E21A 4Z5XA 3BWDD 3GVCA 3QG1A 2XYGA 3LKZA 5ILQA 5LFAA 3WQQA 3QKSA 2X19A 1FFGA 1D6JA 3UA4A 5JROA 2ODBA 1QYWA 2IXBA 3CN7A 1JIQA 2JVIA 1JYSA 1V6AA 2APJA 3GAAA 4HJXA 1QKJA 4JQYA 3M4XA 2EZUA 4NDAA 4Q6BA 4DQVA 3MMSA 1JIJA 2GMWA 4YPVA 1S3IA 1QG4A 3DBVO 5KS2A 3BSYA 3UVEA 1AH2A 2WRZA 4N48A 2P0EA 1B2RA 1B42A 1S1CA 3FJOA 3OKCA 4MJXA 4UNRA 4DPKA 3OD5A 1L8AA 1XROA 4HRYA 1C4XA 3QEOA 1I10A 2W2TA 3SXUB 1RYHA 1QF7A 3VVMA 1QIKA 1KC1A 4HDSB 4C0LA 2OCDA 1V8PA 3ASZA 3BS4A 3GQVA 3V8PA 1RWPA 3NWPA 3W6UA 5WRFA 2IZOA 1TGYA 5DYTA 4ITRC 2JRCA 1W19A 1XPUA 3TRKA 3AF3A 3ICWA 3EZ9A 1KJYA 3Q3HA 4J07A 2A14A 3FNBA 4LDQA 1TEHA 5K0LA 2FOIA 3BGIA 1YRYE 3ZBQA 3OQOA 2QZ4A 1E1QD 1KK1A 5LZ2A 1Q7GA 3CNNA 3L4BC 1FPQA 4II2A 3KM0A 3ZXXA 3SMVA 3G1TA 1KR2A 2WF8A 1V1JA 4MCJA 4D79A 2I87A 2R7NA 3F8WA 1XGKA 3TMKA 1CB0A 1EUCB 1MB9A 1TF7A 3N05A 5CLHA 2I22A 5GZ6A 1KDZA 3JRNA 3ZK9A 5JZOA 4MKFA 1P18A 1Q22A 1D07A 1L3BA 4XJTA 1RXSA 1K6JA 2PLAA 5IAAA 1N78A 1ZL2A 4FFWA 1T2EA 1JPJA 4YREA 1FYXA 1V3UA 1Z37A 3FZNA 1YBMA 3C43A 4RLFA 4A03A 3UANA 2I4IA 1E1RA 3PNYA 2VBIA 5E2IA 1PTJC 4HRXA 1H2XA 5CT9A 5IUNC 1FPMA 4IGFA 1PF7E 1OVMA 4M36A 1TA4A 1SUIA 5BW8A 2FJPA 2I7CA 3W5SA 1REQB 1CNMA 3UGQA 3VYWA 3LCJA 2IWRA 3WLRA 1R18A 3E84A 2HYDA 2WIFA 2XNCA 2JIDA 1UOOA 4FW8A 4J9UE 5K0TA 1DTSA 5EKDA 3MZ0A 4R1LA 5F2KA 5IEBA 2X5KO 1HTTA 4UVGA 2H85A 3T3HA 1DV1A 1XTIA 3ROKA 5FI0B 3A1NA 4Z7OB 3A1VA 1L8OA 4OTZA 3K1JA 2CLOB 5G40A 2XX3A 4JI5B 4URUR 2WD8A 1OX4B 4RVNA 3F6SA 1IJKA 4N0QA 4KGVA 4UQLA 2M1XA 4CJXA 2QNIA 3IOYA 1KBQA 3IOEA 3L4BA 5HK8A 3R24A 4B2IA 3A3NA 1HTBA 3AIOA 1XMIA 3C1UA 4B31A 3EXG2 1I7DA 4PZYA 4BMNA 5DHAA 1EX7A 3PC8A 2Y9PB 4G4JA 2Y76A 4JAVC 2WTNA 4JA0A 4EJ6A 3BC1A 2FFJA 1FC0A 4H60A 4EY5A 3DAPA 1T6NA 1ZD4A 3GU3A 2BGKA 1XYVA 4MLZA 3E3AA 1VYVA 4EP1A 2GKSA 3NG1A 1QIJA 1ZGHA 1P31A 2RBKA 3T0FA 4HFJA 3EJWA 3IP8A 1BEZA 1DINA 4QXQA 2DM6A 1ZJ4A 1ESEA 3LY7A 3S8MA 4BX8A 1RXEA 1HUQA 4FNOA 4NS4A 4EHIA 1HQCA 1E2JA 3C3WA 3AXTA 5AW5A 3B6ZA 5CX1B 1FX1A 3NDJA 3DULA 2ISCA 5KYYB 5AESA 4IHAA 2PH7A 4OD0A 1A8SA 3MYYA 2PANA 2Q0SA 4I2VA 1V95A 1RPZA 3UJDA 4MKIA 5TXGA 5ICCA 5F51A 4FYHA 3TRIA 4DKXA 5BXQC 2DWCA 4UFOA 4JJIA 3O8CA 2HU5A 4H35A 2V7WA 4IVPA 4LY0A 3ZXSA 4XZ3A 1J97A 1N9ZA 1Z2EA 4B3BA 5IWCA 5U1PA 4CCAA 4QG7A 2ZGVA 1SIBE 3B60A 1R0SA 4X92A 4XVCA 5KVAA 4KQIA 4YJ2F 1MJ5A 1A5ZA 4KIGA 4GI5A 3T4PA 4ZVKA 4UEQA 1DDIA 4N3AA 4LE1A 2OFFA 3VH2A 3ZCXA 4QM7A 4BOYA 4HGQA 2JEYA 2PWAA 4U39A 5I3ZA 3AHIA 1OSNA 4CFSA 3OOYA 2NN3C 4M0FA 2EW1A 5KNCH 1Y5LA 3EYAA 1TDJA 5EE1A 3KVRA 3JWHA 2QLMA 4P3PA 4NTZA 5IC5A 5C34B 4AZ0B 1I36A 2QA5A 2R8RA 5EIEA 1CRLA 2GF0A 3F8TA 4CE6A 1M7GA 1CUDA 3H7IA 3K9LA 5JMPA 2R96A 1ACLA 2WI8A 2B7CA 3PRYA 1FW8A 3TEMA 3X1WA 4DXAA 1NQAO 2XQVA 1YJ5A 4MGYR 3VZDA 3TNLA 1SQFA 5JC8A 4JY7A 4MUHA 3BKXA 4RPCA 5KNCA 1J5XA 3PQ5A 2GAJA 5ES3A 2ZUEA 1FFBA 3PCRB 2VCYA 421PA 3A1UA 2ZWIA 5IXSA 2G7MC 3QU7A 4ZDWA 1PR0A 1Q1QA 3LLCA 4JQSA 3UAXA 1KVUA 2ZRGA 3AXSA 1SKQA 4GQBA 4QATA 1OFHA 4RH1A 5DT2A 4CM3A 2G25A 3DE7X 1GTJ1 2RKOA 5ALLA 2W00A 3E3NA 4XIGS 4QJ5A 4XTRA 2QIPA 1SVNA 1QBGA 1JDVA 3OZEA 1TOAA 5KNBH 5KYXB 4EUNA 1CY4A 4OQPA 4DMUB 1QOQB 4JB3A 4CR8A 5I47A 2W9XA 4GXQA 3FCUB 4MR8B 4XH9B 3RASA 3U49A 4GR5A 2PBRA 4TT3A 3K9HA 4YJ3A 2ZRKA 5D00A 2WM8A 3OI7A 5HIJA 1IZ7A 2IYSA 3DZ8A 2PPLA 2GD2A 3JWPA 4KYTA 2AEMA 2H0AA 4DA4A 3H5WA 3QTTA 1UPAA 3Q1LA 2NSDA 1WDMA 4B8YA 2ZITA 4QAJA 3ZGVA 5I9BA 3IQIX 1OXTA 3DUWA 5LPNA 1W581 3MCAA 2Q2QA 2WEKA 3DFMA 5G1NA 1O87A 1II0A 2C57A 3RS3A 2JI7A 4N0EA 3VPBA 2RGNC 3ORFA 1PZHA 3BCUA 4RHFA 2FPIA 3WS7A 4Z99A 3LAWA 4G23A 1ZOSA 3INYA 2WJJA 1T0HB 3KB1A 3QOWA 4HUQA 5FLKA 3IR6A 1A8UA 1IULA 1GN9A 2X42A 5BN1A 3OU6A 1U7WA 2ZANA 4YI3A 1J4AA 2EJWA 3FFWA 3L93A 2XJ9A 1H85A 3YASA 2EFHB 2GM4A 2HMSA 2CFIA 4L2IA 2P68A 4XVRA 1JTVA 1RLIA 1J06A 3L43A 4MP3A 3GJTA 3WQHA 3VJLA 1UADA 5ECYA 4YP9A 1PZEA 4C4SA 4OXKA 5EINA 1V71A 3SY8A 1VMIA 4W5NA 4WXEA 4YRFA 4E21A 4F45A 4LXIA 1Q7TA 2ZI3A 2J31A 3LDAA 3MLBA 1UXHA 3P9KA 3PFNA 1PFWA 1Q92A 1XRQA 4RF3A 1M2VB 4ZCRA 3O3MB 4LTDA 3FYCA 3ZU4A 2XVYA 3I2YX 3IS3A 4V2IA 1J2JA 4GI3A 2QAGA 5B3LA 2BTEA 4CODB 5G4KA 4WOCA 1SIUA 1EUDB 1ZI6A 1DQRA 1WG8A 2BV3A 1DS6A 1IE3A 2GPYA 3AB3A 3D6TB 2EQ5A 1JHZA 1YZNA 1LRJA 2F9MA 2HR1A 4J1SA 3JQ7A 1SELA 4NPCA 2W8BA 3O2SB 2RBGA 2GHTA 2R8ZA 3K3PA 3H5IA 3QF7A 4I2NA 3ZNNA 5BQFA 3A0RB 1UBUS 2V8BA 4OA8A 3QXHA 3E9RA 4O8ZA 6ABPA 3DOHA 4IQ4A 4Y2PA 3NNSA 4ZVLA 1ZBQA 5HQ3A 1CZHA 4WJKB 3RVOA 3WO0A 5ICSA 5BSUA 4WN9A 3VTAA 5AVSA 3JW8A 3QLUC 1COWD 3SIRA 1B16A 1XA3A 3KB8A 1MIOB 4MKXA 4BZXA 4B83A 3ZJUA 4KQ9A 2FVXA 5P8WA 3ZHZA 4BFCA 2X8JA 2ZZNA 2I3AA 1XD2A 2VTEA 4PPYA 1M2KA 3FCYA 2FN7A 2SCUA 4E1VA 3C4QA 3B9QA 4FGKA 4KQEA 5CA1B 3QVGB 3IDOA 4TSFD 5JO0A 3E9QA 3PJRA 5F7ZA 3OF5A 4IDCA 3IAUA 3HJBA 2GBIA 1VE7A 3SHVA 2IITA 4H17A 1SM4A 4FFPA 4IPTA 2HQSA 4KDRA 1UBEA 3SS8A 1WSDA 2OMEA 4GECA 1XNGA 1M8GA 1NR5A 2EP5A 3AESB 4YP7A 5SICE 1SCKA 2DBYA 4Z51A 4I50F 4QGAA 5JFGA 5DTQA 5JYEA 3GFBA 4RC9A 1OCEA 2ON6A 1C9NA 3DMRA 5D6NA 3W78A 4DLNA 4I08A 4QSHA 1I3MA 5I9LA 1JDSA 3V42A 4OSEA 1H0HA 3SF8B 1F17A 1K66A 3LFHA 3REQA 1OH5A 2EKZA 2VPIA 1HOXA 2I7DA 1QU2A 4CIXA 3G9QA 2N75A 3T0IA 4P3NA 3U7QA 2IEBA 2QYSA 1TI7A 1OREA 2WMDA 5FBHA 4ZCTA 1IHDA 2ACWA 2A1IA 3EPHA 2P35A 3BICA 4G0VA 2QR3A 4I99A 2GZAA 4QDZA 1F48A 2V3VA 3FPBA 4IGEA 4ZCSA 4NATA 1KMIY 2A33A 1TADA 3JASA 1RRCA 4OSPA 3BHJA 1U7TA 4XX0B 5KJ6A 2GN9A 1V2HE 4DC1A 1DKMA 3D31A 3I34X 4MVJE 2R79A 3V55A 2GCOA 1NW5A 1UJ4A 3GRKA 5TLSA 5EWLB 2H51A 1XLTC 2JI8A 3LUCA 1ZDMA 3AG5A 2CLCX 3P0HA 5AHKA 1V43A 4EITA 2GHQA 3D1LA 2QVXX 1Y7LA 3E05A 4LV5B 3WGJA 2HSDA 3OPXA 3SVTA 4Z2YA 3NIGB 4MK4A 4E7PA 4YXWD 1EGAA 1QDEA 2V7QA 3HCPA 5K8CA 1NBHA 2ZR7A 3ND8A 4G5GA 3JQBA 4EMTA 5AM3A 1FS4A 2HUPA 1D2AA 2OTCA 3SBOA 1QO7A 1N8TA 1U2GC 4YJHB 5TB5A 3TZCA 5ALPA 1BKSB 2J3JA 4MUMA 4MMYB 3I53A 3C15C 3AJDA 3KDAA 3RUIA 5H68A 4QOJA 3K8QA 2VAXA 2PE5A 1QF6A 3H2ZA 3FB1A 4RDIA 2NO5A 4DTIA 2X5XA 4BXOB 1QDLB 3D0OA 4K9OA 3B48A 3BQMB 1E69A 4GW3A 4RY8A 1Z2CA 2H31A 1Q1GA 4TTJA 4EG4A 2Z6UA 2WNHA 3LDHA 2CBGA 3EODA 5ALGA 1PJ2A 4AUNA 1TEZA 2A84A 3RV3A 1W0JD 3BILA 4BMDA 5K99A 2ACKA 3GCDA 3NHZA 1OH8A 4DC0A 2OHXA 4ZVMA 1YB7A 1KQ3A 3U0BA 3AUYA 2CFTA 3M5CA 2RGXA 1Z0AA 3TSZA 1ZBDA 1Y3DE 3OM1A 3PWKA 4AJPA 3NR2A 1WXWA 2HA2A 2XCRB 2J07A 4QYWA 1KAGA 2ZWPA 5BN3B 2R62A 2D54A 4L5BA 4Y2XA 4C4PA 4DR6B 2HK8A 3HQ4O 4V24A 4PLZA 1CF4A 4XUEA 2C9BA 3G0OA 3DG9A 2Q3HA 3R4VA 1E9EA 4FX2A 1F4PA 3NVMB 1YHNA 1P2VA 4DLSA 3HM9A 2NO0A 3EGDB 4G0NA 4L1KA 1L5FA 1VKZA 3MTQA 4B8WA 4DLXA 4Z7NB 2WYOA 2PMCA 4FYPA 1TZ2A 4XYEA 1OWOA 3AG6A 4X5OA 4C5AA 4QWMA 4B82A 3BZWA 1R0LA 5LM3A 3EX7C 3D8UA 1VJ1A 4FEYA 2Q99A 2Q46A 3WL3A 4REQA 2X0DA 3ZNOA 4TPKA 5B7GA 3SKYA 5IVPA 3BBLA 1QIDA 2PGJA 4DQLA 3QJYA 3ZX5A 2FEAA 4WVLA 4HO1X 1M34A 4GZLA 1AS3A 3K96A 2CFRA 1M5TA 2PX5A 1SBYA 1JXAA 2NV2B 5JARA 2ZJ4A 1PG5A 1N0UA 1JEAA 1C8KA 1YR6A 3FWHA 3LC7O 4MA5A 4NK4A 4EEZA 4B6PA 5A03A 1E9VA 5HFJA 3IOMA 3BDIA 2Y67A 2PEYA 3GY0A 3HCFA 1O97D 2I55A 4NQRA 2YIVX 4XLLA 3WWZA 1S2GA 2PRJA 1I7PA 1NPDA 3GJ0A 1XFAA 2NTJA 3D6AA 3MMZA 1XQ6A 3L5KA 4FR0A 4GHWA 5DN6A 4JT2A 3ZDEA 3WGKA 2A5LA 2DP4E 1GUDA 4YCAA 3T7KA 3VR2A 3ZD8A 5FNVF 3A7DA 2GTHA 3UK7A 1Q12A 1V4BA 5E7QA 1L5WA 2O3JA 1GRNA 2XNKA 3AIMA 4HGRA 1QR6A 2AJDA 3WGNA 3E9CA 2E87A 2P2NA 1SK8A 4JKOA 1BGWA 2NSLA 3U2QA 2WU4A 3PQEA 1JF8A 3KLOA 1C1DB 4OOEA 5DW0A 2RONA 2W58A 2XWPA 5AOVA 2UVPA 2BJVA 3LUBA 3RSOA 3QV2A 4IEEA 1SG6A 1TEVA 4FOSA 4YCNA 3L0PA 3CUYA 5E6SA 2JZOA 4ZVNA 1UAYA 4XDZA 4X20B 5EJ5A 3RBZA 1Q7RA 1RADA 1RMQA 3H2HA 4AD8A 3I05A 3AM4A 4QEZA 4U4AA 4W1RA 4ZOCA 4C43A 3QG5A 3GFGA 4M0EA 1QANA 4RWEA 5DI9A 2A58A 2QD5A 2WLTA 4WRRA 4A2CA 5HEKA 1GFSA 2EGGA 1FXUA 1CUXA 3QLVC 3V7FA 2AUTA 2H00A 4NU6A 4DA0A 5L40A 3GUZA 2QTRA 3O8QA 4F4FA 3ZBPA 4L5YA 5BSRA 3ZJ4A 5E1BA 1JG2A 2DPGA 3IEUA 4NJOA 2HGZA 3NGXA 2XF2A 4UMVA 3DMGA 2LKCA 5K2OA 3JX9A 4LYFA 3DEFA 2H57A 1G18A 4LHYA 4A5OA 3CEPB 3C41J 3DM9B 5C1PA 2WDZA 4G84A 4KR3A 5GJCA 1SC4A 3ZWPA 1IZ0A 2EWMA 1C1YA 2J7KA 3JD2A 3PJFA 4N5MA 5I6DA 5KC9A 2D7DA 4RW0A 1ULHA 1ZESA 2XITA 4ER0A 1QRRA 5CVCA 1XEXA 2WU1A 1WEKA 3I6MA 4BVFA 4HMQA 5KAPA 4IDFA 1T5BA 3A37A 5JH7A 1EVKA 2VBCA 4HXEB 1P9NA 2G4CA 7GPBA 2OBNA 3VPSA 4BFYA 1N77A 4OLBA 3HB0A 3K35A 5GOZA 2MJLA 3DDOA 5CA1F 1GR0A 4FONA 3TINA 5JNRA 4D99A 1GTZA 1ENPA 3EK2A 1IPEA 3P9RA 4RK0A 4AMGA 5ITZB 5GADl 1PTJA 2XCSB 3W5HA 2RIRA 2A9VA 2FX2A 1H2BA 2DHEA 2QORA 2AJTA 3IFSA 3EGOA 1BCSA 3DP9A 2JJ2A 2O1XA 2XI4A 1K08A 4JBGA 1VC2A 1DBPA 4YVFA 3PHLA 3GA0A 4TTPA 4B3TB 2IDZA 3D7RA 1G8PA 1YDFA 3CTPA 2XPCA 5A9SB 2FPPA 3LRXA 4B4KA 3ONFA 4BCCA 4DLZA 1DKOA 3B8EA 4H3HB 3F6BX 1B8NA 4R98A 3K9FC 1V45E 1CNEA 1A3CA 1P1FA 1GZ5A 1Q1AA 2PH1A 1GRRA 4Q7JB 3THOA 3QEMB 1BQ4A 3NHPA 1HFWA 2HFJA 2HWYA 2WINI 1QYRA 3ORHA 4Y9UA 5EKXA 3VAYA 3F78A 2ZETA 4ESOA 3WFZA 1YZFA 3H7AA 5HRCA 4NARA 4CI9A 2WYWA 1PL8A 2DHCA 1OMOA 1Y4UA 3OO1A 3KT6A 3K9WA 4HDKA 4DJDC 1JIKA 3LX8A 4N1AA 5TDHA 5FFFA 4DJTA 5DBIA 3RYFA 4E11A 2DQYA 2JZCA 1UDXA 1NXTA 1PLLA 2R6HA 2QX9A 3D3KA 4COKA 3BREA 2PEZA 3EBPA 4D3XA 5HMLA 3FZYA 1KY4A 1AKWA 4FCTA 4Q15A 3ZWVA 1CJVC 5JS2A 3GUYA 3ZCTA 1YGPA 3DL7A 2ORVA 5T6MA 1YBVA 3RRZA 2DFNA 1YHZA 1Y81A 1GL6A 2JVKA 5CT4A 2VH2A 3HL0A 3AIIA 4JYPA 3A14A 3ACDA 4QQKA 3DBRB 2AMVA 2ABWA 1XDGA 1ETHA 3O4RA 2X8BA 1V7PC 1W94A 4O4JB 4PC3A 5B36A 2QX8A 4EB6A 2JFVA 3KUKA 4C4XA 3N74A 2W22A 5FWXA 3HWX1 5LOVA 5CHEA 1E7SA 2R1TA 1PT8A 4M1QA 5GONF 2C3MA 1QCYA 4RYLA 2BHRA 3R0IA 1IPFA 1IONA 3AVPA 3T38A 1FJXA 4O4HA 3ZI7A 1UBLS 3LUJA 5DTJA 4Y6LA 4F5EA 4DY4A 3IUNA 1L5LA 4P2GA 2WNIA 3AUJB 5IT4A 2BGJA 3F4LA 5KNLA 3ELBA 2XGSA 2CNKA 5SY4A 1AQYA 1MPTA 2MSKA 1KNQA 1G291 1MB0A 1UBNA 1X87A 1YNSA 2Z5GA 3HCRA 2W11A 4LZOA 3RFFA 4UOEA 1Q19A 1NFQA 4KWCA 1WSAA 4LN1A 2VG8A 3NIWA 3X2SA 2HSJA 2VDNB 2XMQA 3BUSA 4OX9B 1X1SA 4KDEA 4N0DA 2E4YA 4N03A 2YZ2A 1OF1A 3I39X 4ANFA 4AWBA 1MO5A 2JGNA 3MB8A 3R3WA 4FE7A 2HCFA 2V6BA 4TXHA 4XGRA 2XE7A 2ZYGA 2X40A 2I6UA 4W8GA 1XMJA 4CHGA 3HB9A 1WEHA 2WPNA 2ZJ0A 2IOQA 2LKDA 2ERCA 3H4VA 3OQJA 2FLKA 3CG0A 4IZ6A 4BNZA 4RTKA 3VMFA 1U0LA 2XTZA 4WV3A 3TLGB 3HPRA 1UH5A 3V1KA 2FMHA 1W48A 1WDLA 1DG9A 4AUEA 5HRAA 4BZWA 4DMCA 2Q6LA 4R69A 2YMQA 1Z7WA 1SWWA 3GLFE 4HBZA 5ED0A 2JFHA 1PT5A 1R2QA 3I12A 5T8KC 1DRJA 5BSGA 4PLVA 1DFHA 1F14A 2GJ8A 1U0GA 3AGPA 3S29A 3V48A 4NG4A 3AR4A 4HB0A 3VR4A 2Q41A 1JDJA 1MEEA 1V8FA 5DCYA 4A1OA 1N3BA 3AY6A 2PFKA 3OPYA 3RVBA 3V1TC 4ER6A 1EXDA 3QF4A 4KX5A 4NCXA 4DLBA 3O75A 3KJXA 2CWWA 4IXWA 1OW3B 5HS4A 1N36B 4FC6A 2Z56A 4JJZA 4E88A 3Q6NA 2XUAA 2FDRA 4DN6A 1EINA 1ND6A 2Q4DA 2OAGA 3UXYA 5HQTA 1XLVA 3OKAA 4HGNA 2B4AA 2H9YA 1H9BA 4HAUA 1IBRA 5BWLA 1FMTA 4I1UA 4YACA 2XSZD 5BYJA 2I2CA 1BH2A 1JWBB 3G9XA 2CSUA 3P0EA 3SR3A 2BE7A 2F43A 3TZHA 3VAAA 1JIUA 2V7TA 3MBIA 5K3SA 2I6FA 3WLKX 4MVJA 4NBTA 1EUCA 2K5UA 4L78A 2DX7A 4UZFA 3FPHA 4B4VA 4FFMA 1KZ9A 1N2BA 1QJ4A 1Z33A 4C1BA 4HV4A 4ADSG 2Q2OA 1AG9A 5J4VA 1NURA 2ZCVA 1CY0A 3L7IA 4LOAA 4B4DA 1S3SA 1DEHA 2WE7A 4RF2A 2J3EA 2OV6A 3UXEA 5JSZA 2REOA 2ZTLA 4JOQA 1PL0A 3NIFB 4NMMA 1GZ4A 2E1RA 2GN0A 3DGEC 3I04M 3FNRA 4U2BA 1KZYC 4KBFA 5KKAA 3UK2A 4CM9A 3V7WA 2BFPA 1ADJA 4XFJA 2O19A 2HUNA 1SAYA 3V5NA 1KYVA 2O0JA 4ETWA 4H1WA 4AJJA 4BKUA 1A9XB 2PHZA 2XBLA 1QYXA 4LY9A 3SZGA 3OZXA 5TS3A 3H9QA 1HA3A 3ABZA 4R68A 3WLSA 4KMOA 3UWSA 5KYWA 5I9NA 5AKKA 3ZZNA 2FW8A 4B34A 1LPOA 1T43A 4QDXA 3MWLA 4GX0A 1DADA 5EJFA 3I6IA 1BCRB 4WE3A 3E27A 5T57A 4V1CB 3VC1A 1RZRD 4X91A 2F8TA 4BMVA 1C29B 4P7FA 1IY0A 3UPDA 4BMPB 1JZSA 4G8JA 4PHCA 3O8RA 6YASA 1PWHA 3HU3A 5JH7F 4PAOA 3R4CA 1WCWA 1EDEA 3AHDA 1UT6A 5EVJA 1R0XA 4NESA 4OMDA 5GVSA 5HGXA 1L4HA 2D5LA 3EPKA 5CEFA 1OH6A 4AK9A 1K7SN 1IQRA 2GAIA 1L4YA 3BORA 1SCDA 3R0VA 4IIJB 1G5TA 4L95C 1M0WA 3IEXA 3O93A 3TG2A 4WHMA 3I3SR 4C7OA 2FE1A 4N3NA 3SN6A 1BMTA 2HJHA 1R7RA 1F20A 1SBIA 2YFHA 4GYWA 4DIBA 4C6SA 1QUFA 1PR9A 1E2KA 2EU8A 2VP2A 1BWRA 3N2GA 4HL6A 4BGIA 1SXHA 1IL0A 4RTSA 2ZRFA 5C8VA 1TD9A 4IWYA 2LWIA 2H17A 1T9GR 2RGWA 3PEEA 2YS7A 5C5IA 1VI6A 2BGRA 2WTEA 3IBFA 3ONVA 4EPYA 1LDEA 3IKMB 5KYTA 2MWMA 2ZCJA 1JTEA 3FCAA 5FNVA 1UEXC 2Y1CA 5IVKA 3BMOA 3TZKA 2PZBA 4CG3A 1XTZA 4RGVA 3CRNA 1O95D 3DUFA 3LT4A 4ISCA 4RKEA 4A8JC 1B0UA 2VA8A 3D6FA 3ODPA 4WZ6A 5KSZA 4ZAXA 3BB4A 1LB1B 4POAA 4C04A 4MX8A 1NNI1 1T34A 4CZ2A 4E09A 5KTPA 5G1OA 4J3JA 3AVTA 2YHBA 4HN2A 1QIIA 5AM4A 2FPGA 4CF6A 5G0VA 1ZICA 1NF8A 5JVDB 3QKRA 3ZV5A 1FJHA 2HZBA 3K72B 2RJNA 3H4TA 4TN5A 1GRVA 3NONA 3QVLA 5HKLA 4YUAA 1H5NA 2QLLA 1RPJA 2W6QA 2Y1KA 4P6VF 4KXXA 4TQAA 2JFYA 2P67A 1EGVB 4UUOA 1WO8A 3MTDA 1P2SA 5CXUA 2WDPA 4ZO6A 5KBYA 1CV2A 3KKMA 2AG0A 4TV8B 1NA5A 2IZ6A 2Q5QA 2SBTA 4KNWA 4X1YB 5JNLA 4LX8A 2C7GA 2H9AA 3FNIA 4FBGA 3ZDRA 4A7PA 4MGKR 1RZ3A 3DKIA 3N53A 2ZUVA 4NJEB 4EG6A 1GPAA 1QGYA 2Y0BA 1MOQA 1VHTA 3PTLA 2D5CA 1JUDA 3T7EA 1NMZA 2BGIA 3ELDA 1C8LA 1E5QA 4QTUB 3DO6A 3WLFA 3VV2A 1SVLA 2FN9A 4U2FA 1XRNA 1EZZA 1F4LA 1G8YA 5FA5A 1RR6A 3D3WB 3H9EO 3HY3A 2PSEA 1Z17A 4CLOB 1ZMBA 2XLCA 3OWOA 3DGFC 3T1TA 1VB3A 1Z07A 3P4YA 3N2KB 1XJ5A 3O3CA 4JUAA 1Z25A 4F12A 2JJ1A 3AY3A 4OBWA 1TE2A 2JFNA 2X7HA 4JGIA 4RLHA 2IHYA 4TMTA 3DCNA 4RXTA 4OJYA 2R5NA 1OLSA 3PIIA 3BWMA 3L1VA 1QHHA 3N8HA 4EAQA 1DEKA 3ICQB 2OO3A 2DYKA 4WD3A 4G07A 3KSAC 4DHEA 1XLWA 2O48X 3ML1A 2YCLA 3D2AA 3OZFA 5TQ2A 3AVWA 2M32A 3O8OB 5C3MA 3D0RA 4IRXA 4BIMA 1ICIA 1YD7A 2PZFA 3FB4A 2RHBA 4EB0A 2Q8NA 5B4TA 4LZNA 2AXQA 1XOIA 3MNFA 2HU8A 3ZZTA 3O47A 1BYIA 1QR2A 4RJJA 1W44A 5FOQA 5K0EA 1P72A 4Y2SA 1J0BA 1KQPA 4C3ZA 1FP4B 3GJ8A 2BGNA 3I4CA 4DT1A 5TGDA 3LC1O 1QOZA 1SBZA 4PZ9A 1X8KA 1M2GA 2D74A 1CLEA 2ZBGA 4MULA 4OF4A 5L51A 3PTAA 4GX2A 4BQPA 1WWKA 4MVJD 4RIFA 3B20A 3W9UA 3CXRA 3LSTA 1AKNA 1AKTA 1U8XX 1YK0A 3OJEA 4CIDA 3NT5A 1HL3A 4POOA 3FUTA 1J33A 4JP8A 4Y67A 4P3YA 5F5XA 3QKUA 4QBFA 5KSYA 3GRRA 5K4AA 2Q2NA 2IEDA 1U9IA 2A35A 1N9KA 1G5IA 2WWIA 4H16A 4GRAA 3HUUA 4HNHA 1EB9A 4MUAA 5FR2A 3HL4A 2GFQA 3HKCA 2H3EA 2RHDA 4WFIA 4ENTA 2P79A 4ZJPA 4F2PA 4RJKA 1UIRA 2GLXA 2RCYA 1U9JA 4ZZ2A 3USES 1NP7A 2PZMA 5BVHA 4MCHA 4TGLA 4GGMX 3MTEA 1IEWA 2O8DA 1A0OA 3CH5A 3UT0A 3WSWA 4HB3A 1MA0A 5TV2A 1IOVA 5K01A 4CIAA 5JOQA 4AMUA 1HT1E 4N82A 2H1WA 4KIFA 3WGZA 1M2OB 4TWAA 2H4WA 2BMJA 1L4NA 3LT2A 3OZSA 3Q8KA 3G23A 4GD3Q 4QIHA 2YQ5A 2QX6A 2XHZA 3FLAA 3HFJA 4DNFA 1ENOA 4JXZA 3VSAA 2R00C 1SQ6A 1ZL0A 3E1KA 3K0AA 3ENQA 3EUEA 2X9QA 4Q1AA 3LXRA 1F6WA 3IIEA 2DGDA 4PGAA 1DIRA 4RPKA 4AM8A 2ZBDA 4G36A 3AJ8A 3T5BA 4C0AC 4M22A 1FQJA 3OO0A 2IYEA 3JQAD 3S6JA 2FSFA 1TNDA 2Z04A 3UIEA 1JECA 3VNVA 4NHOA 1QG2A 3AKCA 1E3MA 4F1JA 3CSSA 4ZALA 3QU9A 3L0CA 2I9PA 1N4AA 3T4XA 1HE5A 1KDRA 1Q50A 2WIBA 2B69A 3THXA 2P2ZA 4EECA 5A3RA 1UFOA 1GTMA 1U3UA 2PGNA 3KQNA 4ZI3A 4HWKA 4Q05A 3RFVA 2VSYA 3TD9A 4I1PA 5TF4A 3DV9A 1DO2A 1NVDA 3QJGA 3SIXA 5CM8B 4PLWA 3R6GA 1CR2A 1B8OA 1SUBA 1CE8A 5IPFA 3GC6A 4XW2A 3AFGA 3V8RA 4XVUA 5JUWA 1QFMA 2C07A 2UUAB 5IYZA 1J2EA 4Z4CA 3PQ8A 2EQAA 1ZXLA 3CLHA 1MJGA 5FRDA 3S1AB 3U7FB 3KKEA 4KGZA 3E81A 1LVUA 3RUPA 3BA1A 4IINA 4HMOA 2AR9A 1BVRA 3DDNA 4IDPA 4AXBA 2D1QA 4L4RA 3OBIA 1JIVA 4H3SA 4M49A 4MA4A 2D62A 4NBUA 1MA3A 3AWIA 3LYAA 4XR4A 4BZQA 2FZEA 5DTMA 4TLAA 2EATA 2WHQA 1RVDA 3CX7A 4EVSA 2CDCA 3WMFA 3ECCA 5E1DA 2HK7A 4OI4A 2YWFA 1SXJD 2ZEJA 1EA7A 1AJEA 3HYRA 1DCFA 1JQAA 5DN9A 3UWKA 4B6JA 1LTKA 1L8QA 3P19A 4HNQA 1U3DA 2PL1A 3QY9A 2RH4A 3ND7A 4J8PA 1F0KA 2ZRQA 5CD9A 5GM2A 3N8KA 4HZUA 2HLPA 4IHJF 3SICE 4BB0A 4EGSA 2ORED 1U04A 2X77A 1SG0A 2QYTA 2YX1A 3C8HA 4BKMA 2YV1A 3MJVA 5F4ZA 5JZMA 3ZPXA 4GO1A 4OBBA 2XD4A 1E60A 2JATA 2WHXA 2W6JA 5JBIA 3AI1A 4DMLA 1YJ8A 1ITZA 1ZCZA 2OBXA 1UBFA 4N7JA 4BVEA 1R6VA 4F6LA 1Q6ZA 4H1UA 5JAHA 2FMXA 2QTZA 1SU4A 4Y0AA 3UG6A 1HPLA 3Q5DA 2J5KA 2ZTVA 2AR0A 4RHUA 3QVWA 4R2MA 2XYQA 4O25A 4RA9A 2QSJA 2VDMB 2XDYA 3PC6A 5DX0A 4JELA 5SZIA 5L3VA 4LKOA 1LRLA 5AH0A 4TKLA 5C1IA 2OB2A 3IUPA 4KXFB 1BXZA 2CYAA 5F35A 3UB4A 4C0SA 4D9GA 6Q21A 3NHKA 5KCZA 1GN8A 4FSDA 1GUBA 4ZZ3A 2IUUA 2VDWA 1I6MA 2JGRA 2VNJA 2GYVA 2JBAB 4WY8A 4O1IA 3K0HA 3IVAA 1VRWA 4ZJYA 5CM2Z 3TIIA 2ZS8A 3K16A 1PT7A 1L6RA 1PFVA 3SDBA 4U9HS 3EMDA 4ARUA 4C7MA 2GA9A 1QS0B 5IXYA 2TMGA 4GMDA 1ODIA 2DKOA 2ERXA 5FPYA 2IKSA 4GIBA 3WYNA 3DHVA 4J7AA 1AT1A 5JMOA 3IDSA 5K3FA 2X9VA 4ZA2A 2UZ0A 2IXDA 2WUWE 4LXYA 2C5GA 4QUAA 5FR1A 3VR4D 3OFNA 5CDSA 3U1BA 2B3TA 1H2WA 4TS4A 1D5WA 1PWEA 1VPDA 2J9FA 1KO7A 4G0PA 5DXFA 3TLBA 1II8A 1TVMA 2NVWA 2AI2A 3LK7A 4ESEA 5AQ1A 3LX4A 2XHEA 3JYLA 3RFCA 3WLOA 3DOUA 4OP3A 1QMGA 3PC3A 4BV2A 1RXCA 3P5BA 2RI0A 1TA0A 5D7NA 4HNUA 1IZ9A 3EY4A 4UPEA 4AQ7A 4R51A 4A6EA 4BFTA 4BGEA 2AOTB 2OR3A 2P1ZA 4C4AA 2OXRA 4MAAA 3EBLA 2EP8A 3H4IA 4J3FA 5AK4A 4MVYA 4H1VA 1RHUA 2XA9A 5J2UA 3SC6A 2PCLA 2YC4C 4G0OA 4N6GA 3W9YA 2VPYA 2J0VA 2P27A 4N01A 1WMBA 1VA5A 2VCHA 1ES9A 4K5QA 4BNNA 3KHKA 4BX9A 3MT7A 2KQUA 2JGEA 2VYND 1HE1C 4MW0A 2FSVA 1U2ZA 5AYVA 4C89A 3AGQA 5HW0A 5IXJA 4YJ2A 2BLLA 1UP7A 5GPBA 2FQYA 1M7BA 1XRJA 1SPBS 2JASA 2POCA 1CQJA 4MRRA 4R8LA 1ISRA 2QRVB 4P4SB 5FUWA 5HDBB 4GAEA 2V0CA 2MCFA 5KDDA 3FFXA 1OIWA 1YDMA 4HYQA 3FOZA 3BFKA 4U2GA 5J2TB 5IF9A 1D4AA 4J0HA 2QN7A 5LUBA 2ZSEA 3FTFA 1RHRA 4NCKA 4OIFA 2NQ2C 2QRKA 2VJPA 1EWYA 1XA0A 3ABOB 4AMBA 1LPSA 1RPAA 2IU3A 4ZVPA 1G3IA 3F9CA 1N7IA 4MUIA 2YMPA 3LUDA 1J2YA 1APBA 4X6LA 1T2VA 5CA0B 2DT8A 2RB4A 4FHFA 4TXJA 3JAKB 4BNVA 2O8EA 3Q8WA 4QTTB 1Q95A 3QNWA 4LE2A 1QMPA 2FB9A 1WMEA 2YY6A 4MWOA 4KDCA 3EVCA 2AQ8A 4I5IA 4PO9A 3AUXA 1MGOA 3C4VA 3KKOA 4LJKA 4R41A 4RV4A 1GM5A 5FOSA 2VYQA 4FFSA 4R3WA 5HA5A 2HQRA 4MV7A 1U11A 1RWXA 4WCVA 3TQHA 1M8PA 2WT8A 4KXYA 3I04A 4FDLA 4D9EA 4MUYA 5L4SA 4BKQA 3EWAA 1RCFA 1ZNXA 4EG1A 1JMKC 4FE4A 1SZDA 2YWJA 3M1LA 1K7YA 4KRFA 2CFSA 3FNGA 4PZLA 3T9BA 4H77A 1B73A 4UBNA 4ZPJA 1VPEA 3MQFA 2C95A 3AHHA 1PVDA 3N2YA 5GIPE 3MWYW 1BGXT 3WHLA 4GQAA 5K0ZA 1W0KA 2WE8A 2XOXA 4D46A 5BNWA 1S2DA 2IOHA 3FSEA 3HJUA 1V4VA 2CJFA 2DJIA 1ZVJA 3K70B 4HR7A 1GPNA 4FX5A 1Q77A 4LGCA 2IYLD 4ZOLA 4DF3A 2ASEA 3OF3A 2ZI7A 2AVDA 4BP9A 4I9GA 3EQ6A 3FOAA 2OHOA 1AV6A 4G4SP 1T36B 4G2TA 3C45A 1K6XA 2Z2IA 3X1JA 2HWXA 2ZYVX 4RTJA 1OU4A 3NWEA 3SQWA 1T5TA 4K6KA 1L7BA 1ZD8A 4EJFA 4NMLA 5H7XA 2JLUA 1EWRA 1E66A 2CBZA 5TGZA 3RAEC 4LRWA 3S3TA 4C7VA 3GZNB 2IH2A 3UZUA 1ZCJA 4JEIA 2JIZA 3HLYA 2ZG6A 4L75A 4MCIA 1OLOA 4PE5B 4AYWA 5CFMA 1AZTA 1LBSA 1XP8A 3IDAA 2Q3JA 1NDQA 2V7QD 4AZWA 4Q39A 7MDHA 1I6WA 3BHIA 3V2GA 4PX9A 2HM7A 1MW9X 1XZEA 3FJYA 1FFWA 3KYDA 2IOYA 4LNHA 1BW9B 2RGEA 5FT9A 3STUA 1R0BA 1ZPDA 1JLLA 1Z39A 3FD8A 1NHWA 3GRZA 3OEED 4H59A 4YECA 3RC9A 1P81A 3QYAA 1OJLA 1P74A 1Z75A 4TQGA 5SYAA 3VX3A 4D8XA 3I5XA 5KOJB 1WVGA 3RRJA 3F8SA 3R09A 5FPSA 1O0SA 3O94A 1QX4A 1EP3B 1D5CA 3BOSA 5I8ZA 1E77A 1Q17A 2VHZA 4DV6B 3O4JA 2RJ3A 3WMEA 4FCCA 3C24A 4EJMA 4J4BA 4ZOAA 3NH9A 2D00A 1NT2A 2H1VA 4CMEC 2ZE7A 2D1RA 3KXLA 5BYBA 4AN0A 2VNSA 1NU6A 4HTFB 3D59A 1TJPB 2DFDA 3CWQA 5AOBA 5A2GA 2DFPA 3A6JA 4AFNA 3E22B 4BO1A 4MRPA 1T5LA 3PR3A 1G7TA 3Q5EA 5CFPA 4IJ5A 5B1SA 1V3QE 1Z62A 1H5UA 1P4HA 4HAZA 1J20A 4OHXA 4S3MA 5FFMA 3M9LA 5JIBA 3WL5A 2O7VA 1IN8A 5C5DA 3BWVA 4LZZA 3BD9A 4NYMR 1KSGA 3N6RA 4WXHA 4JBLA 1B6SA 4MJ7A 4MMZB 3GCXA 2R1ZA 3OJWA 3LJKA 3AR8A 1UMDA 3NM6B 1F06A 3T5DA 2B94A 3CLTC 2EJVA 5D3QA 4LZPA 4MIKA 4LYGA 1NUPA 4Q3KA 4QYIB 4US1R 1K98A 4TLLB 4ITVA 3LG2A 4M2LA 5AHOA 4YRQA 5DHQA 2WSLA 5TY0A 2V9CA 1LEHA 1HQYE 3QA9A 3FSJX 2QG4A 1ESMA 4RZXA 3ZWMA 3L6DA 4MP8A 1B93A 1DTEA 1Z3IX 5JY6A 5K3OA 3ABIA 5ALZA 1MX3A 5GZ3A 4R7ZA 5AIBA 3FUUA 3TW8A 4IG4A 1E9SA 2QJOA 3GH1A 3GVHA 4C01A 4DIDA 1YF3A 1NI5A 2CDRA 2ODPA 3KQVA 1G20A 4UMFA 3DXZA 4BC0A 4CIWA 1GNPA 3LHDA 1KPHA 1TT5A 2H4ZA 2NAPA 3FSGD 4DQUA 4E2XA 3PQ3A 1G38A 2QD4A 2FHSA 4X7RA 2IW3A 1JKJB 4WGFA 4BEJA 3AERB 1MB4A 3GEMA 3S5JA 1E1DA 4JMPA 3L6CA 2UDPA 4RZ3A 3M3HA 2PBFA 3N70A 5CURA 3ZKWA 3FOFC 1Z26A 4PYRA 2VTKA 2DVMA 3FTDA 4OGFA 4KZKA 3HCBA 5BSWA 4ARIA 1NLUA 2PMBA 5EFZA 5LD2C 1WP4A 2XUHA 3FKQA 4NENA 1JLRA 4YJGB 5AM5A 4JR0A 3JWIA 4QYMA 1JKFA 3RS8A 3TOZA 3WBJA 4ENWA 5J58A 1CD5A 2BE9A 2AQKA 2D1YA 2XGGA 3DKRA 4NYJR 4Y7DA 4ZU3A 4RXUA 1U65A 3H1EA 3DVSX 3W90A 3Q40A 4WK6A 4ARAA 3R9XA 3NHMA 4LBVA 2JCVA 2OHHA 4BU1A 1CUWA 2XYRA 3U26A 3PXAA 4XPIA 1V11A 1XEFA 2JAHA 2Z5LA 3H8JA 1Z06A 4LBWA 4O3FA 1Z9BA 1LS1A 2WJ4A 1OX6A 3L4EA 5DK4A 5EC8A 4K6GA 2HHHB 1JHPA 1W49A 1OFUA 2NWQA 4BO0A 1UBHS 1YV9A 2MHCA 4JD5A 1YWGO 2DSTA 5HIKA 5AKHA 2G1AA 4J4TA 4MQFA 3VPGA 4C4TA 5EJAA 1P2GA 2CGEA 4FJ2A 3N8GA 3TKLA 3FCSB 3ZD7A 2IZ5A 3OD1A 1UBRS 1Z0UA 2CLLB 3KXIA 2PXHA 2EBUA 5FADA 2Q9UA 2QJFA 1XZHA 1WIWA 4H08A 4V0KA 4DA9A 1NQVA 3NEYA 2WJAA 4CL0A 5I7EA 4QEKA 4HVAA 5LJIA 2G04A 1XLUA 2XCTB 2JI4A 2WWYA 3LT5A 5EG5A 5MFZA 1AVTA 2O9JA 3CVXA 2OPBA 3AUKA 3IQEA 4GE3A 5EJIA 4LAFA 1TQ2A 3D54D 2O5VA 4PO8A 2Q4RA 3AL0C 3BGSA 2JK0A 4YAIA 4DDTA 3SIPA 1XBTA 4IO1A 4O2BA 5EXSA 4AZTA 1RZVA 4MW4A 3ZV4A 4FKZA 1PR6A 4LF6B 4DAOA 1XQ1A 1MGPA 4WKOA 1XV5A 2QLTA 1UJNA 4R54A 4HX9A 4C30A 3ZH9B 1C3OB 2IEZA 3INGA 4W4TA 1G8HA 1YRLA 2KS6A 2XDAA 2A5JA 3G59A 2WKPA 3WC4A 1C30B 1LSSA 1O89A 3WFJA 2R5FA 2XUGA 4CCYA 3CCCA 2YH2A 3EDCA 1E6WA 5KYUB 3IVRA 3OMWA 2J6BA 2XZDA 1YZHA 1OBVA 4MQ4A 4OH7A 4MINA 3DEKA 2VJOA 1RWQA 4R6XA 4TL6A 1OLXB 4HNSA 4UW9A 4CU2A 1D2EA 3A8TA 3JS5A 3FR7A 4W6QA 3NNNA 4CM8B 2X7JA 3R5XA 1HZJA 5E9JA 3DW1X 1XU4A 1Z4LA 2WD7B 4PHGA 3MWDA 4EG8A 3BEDA 1QKKA 1Y3HA 3REGA 3T3IA 1CT9A 1VG1A 2NVUB 1JHMA 3LBIA 3U3DA 4PONA 1TO6A 2RHJA 1T15A 1DX6A 3L77A 1T25A 4U5XA 3CKMA 4YAFA 1IVYA 4YDRA 3DE4X 3VBCA 5F9FA 4MYUA 2C8JA 4O1MA 1P5RA 1ENYA 1O0CA 1JR6A 5BUSA 2XECA 3PX3A 4R16A 4EVIA 3VO8A 2QSZA 3TLCA 1JEYB 1JFFA 2V6FA 4GP7A 1RQ2A 1V6CA 2P78A 4ESVA 2JGDA 4MGZR 3AUUA 5H82A 3UFXB 5FL7A 3HK2A 2A2ZA 3A36A 3OSZA 4QOGA 1H2YA 1IG3A 2YWGA 1TL7C 1T9ZA 4GM4A 9LDBA 5KVVA 3IUYA 2GZMA 4AUKA 4AROA 3VKGA 4TXNA 1USIA 1IH8A 1JT9A 3M49A 4L8LA 2F3QA 4QU5A 1M7HA 2WJYA 3ADBA 1NXPA 5HILA 4EYKA 3RSQA 4HSGA 1I7LA 4Z86A 2ZI6A 1KO4A 1Q91A 2HMAA 2ZQ5A 4IIXA 4CGYA 3EEOA 1JXOA 4K9KA 1CY8A 1NSFA 1O77A 2JIRA 4WY2A 1VSTA 5LBTA 2IV2X 1LLUA 1J56A 1KKUA 3ESBA 4LF5B 2P6RA 4AC9A 1D2CA 1D6MA 1PJSA 3GR6A 4TSFA 1VE6A 2NACA 3FNQA 3DTTA 1DC4A 1JR3A 1AC5A 4KQ1A 5H70A 3S28A 3SJAA 5BXYA 2QGZA 1GWNA 3I8OA 1GNLA 4BLQA 3OUUA 3WOHA 3OPMA 3G17A 3OQPA 5HZMA 1E2UA 2EFYA 3R3JA 1IHPA 3IHTA 4RFSB 2Q0HA 2C5LA 3SYKA 1EQUA 4URWR 2QAGC 3HZRA 3MGBA 2L0XA 1GFWA 3DAYA 1CY1A 5CA1A 1EWTA 1ZNZA 4G3XA 4KYIB 1DUSA 4WA8A 4C3VA 5TEVA 1FFSA 2Y8EA 3GMDA 3FBTA 4OGLA 1BXKA 3AEQA 1A5SB 2H2WA 3NOQA 2BFBB 2HMWA 4ND2A 3QW2A 3A4TA 2XWSA 3C3XA 3ASYA 4Y8VA 1TVKB 2GM5A 2J41A 1CFJA 3GLHE 5H83A 4NV0A 2IA5A 4BNUA 2IQIA 2TYSB 1HGXA 2YQ4A 3LGAA 1MABA 2OP1A 1WKBA 5CT8A 5EQFA 3ED1A 4GUAA 2QTVB 2VF7A 5DCUA 1BA3A 1IG0A 1CHNA 2Y27A 2PR7A 4RDCA 5BOSB 4R0VA 4RU1A 3WZ2A 4FHZA 2VDPB 1HFJA 2VIIA 3IR5A 3PHJA 2OXTA 3TAXA 4Y6OA 5B6PA 1RYYA 4OY3A 1YONA 4P9NA 3GRPA 2BJWA 2GA8A 3M5WA 3W04A 2ZYDA 5ED4A 3MJCA 4DV4B 2ZT8A 5FIUA 2GEJA 4O2RA 1ILEA 3TIVA 4IUCS 1XL1A 3GGDA 4ZQHA 4Q5IA 3PR1A 3AFIA 4ZIRA 1LDYA 5AUPB 3MS7A 3KXPA 4JN6B 2MR5A 3A9CA 4R2WA 1WB6A 1EUZA 1GNRA 1DOAA 4L5IA 4J91A 1SXIA 1TQHA 3L79A 5CTAA 1RVV1 2QD1A 1SCIA 4LISA 4M9RA 5K0CA 3RSCA 1NVVQ 3DSRA 5HE8A 5K45A 2VBFA 3L1UA 1C80A 2PQ2A 3R7WA 2E55A 5AVWA 3HXKA 3D3WA 4IDEA 4RV9A 3V6MA 3O1LA 5IK2D 4EPVA 1RC0A 5ABPA 3DLBA 4M0MA 5C1OA 1NMXA 2C7OA 4JYAB 3HEMA 2H1HA 3WNCA 4AY2A 3MAGA 1NKVA 1QC5B 2DC1A 2PKWA 2R3SA 3UF0A 2ZJYA 2EC5A 1ZGZA 5DTRA 4UCFA 2ZM5A 3TBHA 5ILGA 4YRPA 3JU3A 1ESCA 3T7DA 4GOJA 3WRWA 1Y8RB 3HS3A 4KXVA 5BWMA 3HKDB 1XZPA 1W6RA 1B15A 1KHHA 1Q3KA 5CLQA 1Z2NX 4PPGA 1Z4IA 2GHIA 3OZCA 1A9TA 1JU4A 3K8OE 3PJEA 3DMFA 4TS1A 3FUWA 4V02A 3RWOA 4Q4JA 3GF4A 4EJ0A 5KDOA 1NVUQ 2XZTA 3BFVA 1RQ7A 3QE3A 1U7ZA 2H65A 5FTWA 2BRUC 2G76A 3GW8A 2GGSA 4L02A 4R8MA 2QOEA 2VXOA 3K5HA 2YXNA 2Z6VA 3GARA 1QFSA 3L8ZA 3CUTA 3UMGA 3NWBA 2JFPA 4PXYA 1XZLA 5ALRA 5EMKA 5A06A 2ZUFA 4KU4A 3ICCA 4ZYZA 3KJQA 1G41A 5KQMA 4PPNA 1KORA 2KJQA 3OEHA 4PBTA 3KZOA 3IAS1 3S44A 4RZIA 1EJ6A 2J0EA 5DASA 3MINB 5TMEA 3UJBA 3OAAD 5MGNA 2NU7A 4CFYA 2GPNA 3SF8A 2XWJI 1R74A 3OG9A 3SLGA 3ILXA 4PIMA 4H7FA 5DRYA 5F64A 3KQHA 1BVUA 2BUCA 1A9RA 3L40A 3GRCA 1GCUA 3ZE1B 2C9OA 2HB6A 2BM9A 2JDIA 3HB4X 2G6TA 1HURA 2J9XB 3T4UA 3PNBA 4H1HA 5E7IA 1EFVA 1CVRA 2R00A 3DB1A 4HQKA 4ZANA 3VDQA 3I2GA 2DUMA 3T9CA 4Y9TA 4FMCF 2QG6A 4RETA 1YA8A 1YS9A 3Q0TA 3TI7A 1VECA 1BX0A 1TCUA 3HGTA 3E7PA 3FX2A 1QHSA 4ZAWA 1E2LA 5E9AA 1FP1D 4BL5A 1HYEA 1IUKA 2F9FA 1V16B 2G0TA 4I3HA 1YUBA 3CRZA 1VZ2A 1TAUA 2B0CA 1C50A 1VB5A 2I4RA 3DDWA 4GNKA 3T5PA 2PR2A 4GI1A 1PW7A 4YT5A 1RJEA 3I9JA 3BSSA 3AL3A 3NWOA 3ABRB 4EY3A 2ZBVA 1XMPA 4IIHA 5IFKA 3U44A 3EXHC 1WBJB 3K1YA 4KQCA 5H9VA 4UTNA 3OPNA 1DIGA 3QFHA 1NE2A 2B1IA 2C94A 2GFHA 3KTAB 4LJ8A 4MEAA 2VVTA 4Q9KA 3SDSA 3SZRA 4TMVA 1ZCBA 1SHKA 4GPAA 1RYFA 3KD3A 4U7WA 2VTBB 2JIQA 4IXTA 4MTLA 1GG2A 5AHXA 4A2PA 2PAFA 2QZPA 5EWMA 5JDIC 3AEUB 4RY2A 5ADVA 4FYWA 1EWKA 1KI7A 1H23A 1P3DA 1N57A 2CUKA 3KHSA 5A6SA 4B6OA 1JX6A 2D5BA 1ND5A 3FZQA 4DPMA 5LDGA 1IQPA 1EFKA 1KAOA 4E7OA 2C0PA 4TM8A 3KQSA 1P1KA 3KKZA 1C0KA 1NVWQ 3ZLUA 4ZEWA 4OCZA 1M6VA 2R66A 3R3YA 2X0RA 3MEQA 4GC5A 1WUKS 2V0NA 4QVKA 4KPUA 3VJMA 3VR5A 3WQBA 3W8RA 5LQJA 1KI6B 4LJ6A 4QZVA 1CETA 3KLMX 4LMAA 2OORA 3UMRA 1XEWX 5I45A 3NM5A 4OHYA 1KBOA 4FMDF 2GK4A 2FQ1A 1FE8A 3CUKA 4LECA 3WZMA 3L49A 1PFKA 1KVQA 3IPLA 3LO8A 4N8EA 3R5JA 1CU1A 2BKXA 5FUYA 1GZ6A 4MVJI 3G82C 3ZJ5A 2C96A 3VI3B 1OZGA 2IX3A 1JIXA 1FP7A 2I6SA 3NIBA 4IMRA 1JAXA 3OCVA 3ODGA 1EX9A 1P7VA 4MV0A 4OUKX 3RROA 1IDOA 1KO5A 1BO6A 1IXZA 1EK5A 1N2GA 1OYVA 4ZYUA 1UJCA 1TJ4A 3SC2A 3W3AH 3AW8A 3D5TA 3OTWA 3ORYA 1KTVA 4TMYA 1E89A 5EZSA 3DH0A 2XLBA 1UJ2A 2IOFA 3TOVA 2Y2VA 3ILYA 1Q7EA 5JHGB 3KEGA 5JFTA 5KOIA 4ZICA 1FXWA 7MHTA 3MJDA 1H6CA 5HZGA 2WOOA 1LZLA 1CJSA 2OV4A 5C3UA 3DHEA 3JATA 5CPFA 4ID3A 3VV3A 4N3GA 3TEJA 3UJAA 1I7QB 3UCFA 1E1CB 1U0EA 2YWCA 4BO8A 3E3MA 3J81k 4E15A 2WMNB 3OSUA 1HDIA 5C7OO 2W6CX 4ED9A 3A1TA 4PZUA 3ONEA 2ZCUA 2O7SA 1FRQA 4EY7A 1WZUA 3T99A 1BS9A 5EUMA 3NLLA 1JU9A 2VLBA 3RS4A 5FBQB 1TPYA 3BFPA 4CN8A 1M2JA 2FQQA 3CVUA 1ZUHA 1U3FA 3R23A 2O59A 1GYQA 1ECFA 1OOEA 1T0PA 4NL4H 1JG6A 2JJ1D 3FRJA 4W9NC 4U5QA 4DDWA 2VPWA 2B6NA 1B4DA 1T3ZA 4PZZA 5AW4A 1IJBA 1RNLA 3UMYA 1A1VA 5ALDA 3BERA 3ZJVA 1T5SA 2JLQA 4HAOA 4IQGA 5FA8A 2VDWB 3L9WA 4M83A 4AMYA 1Y6RA 1VYTA 2PFGA 4QASA 3W5CA 1NX6A 1PU2A 4GNRA 4IZIA 2OZLB 2OXFA 2ZRBA 4JB8A 2WIJA 5BN5A 2NX2A 2R7LA 3B6JA 5M29A 5CB0A 2EF1A 5E6SB 3BDVA 3OLQA 3IAFA 4E6PA 1IEXA 4DCJA 5KOYA 1OD6A 4M8KA 4TYWA 2A9QA 4MWEA 2QRJA 2WHPA 3DMDA 4XLTA 4CIBA 1Q15A 4XM2A 4AJLA 2YHAA 4EGCB 2AD1A 1QWOA 1SQ5A 5C46F 3WK4A 2XE6A 2ZYHA 3M5DA 3T3PB 2ZRNA 5FYQA 4E4YA 5JBQA 2DHQA 4B5LA 2K7FA 5DIFA 4J43A 4EG3A 1GYRA 5DBGA 3NCHA 3R74A 1W6UA 3DOJA 4D9HA 2LZ0A 2VOEA 2B99A 2XT0A 1QNLA 1T5OA 3P9QA 2GRJA 2XKBA 3GLHA 3IKVA 5E9QA 5EFOA 3UKDA 1B26A 2NNWB 4OEHA 4CM4A 3C3PA 1BX3A 2P3SA 3N5CA 2P9QA 1P62B 3HCOA 4AX8A 3LO5A 1AKEA 4H6PA 1U9ZA 1DWOA 3JASB 2CZGA 1R5OA 4K9LA 3MGCA 2QU8A 1B3BA 4CQMA 2ZSIA 2WKSA 4QYXA 4RHTA 1K5PA 2AFHA 2IYYA 2BSQA 2HPZA 3GO4A 3H8VA 2VQ6A 3SX0A 4ENVA 1NLZA 3IRUA 3LVFO 4QPJC 3KR0A 4V0QA 5YASA 3BH0A 2FNAA 1ACMA 2I62A 4MR7A 2YUTA 2YIMA 4A0RA 2HQ1A 4NNOA 1TRKA 1MT0A 3HXTA 3KPWA 3IJRA 4IICA 4OP2A 3SSMA 4UM9B 4F96A 5MN5A 2D4AA 2ATIA 5KWIA 4R2LA 3TGLA 5J2TA 3V00A 2Z3WA 3IQFA 5AMXA 3VPCA 1Q2UA 1YMVA 2Q45A 3FHTA 2OM6A 3S8EA 3ETHA 3UMJA 1DRWA 1NAHA 1YZQA 3JY6A 1A9YA 1JI3A 1I4DD 1ZMTA 3CLUD 2O7QA 3H6KA 4FEAA 4TLBA 4BVGA 3JD4A 3THSA 1T5IA 1WETA 2NMVA 2VAMA 2ZRJA 2OV8A 4GOMD 3DBIA 4NS1A 4Q00A 2O0KA 3ASUA 1E9FA 2FUG6 1T3TA 5KI6A 3TW0A 5IHXA 1C3JA 4WKPA 3SJZA 4N49A 3UT6A 5AOCA 4QJBA 3LW8A 1C5KA 2QMQA 4C7OB 3PHHA 5BT9A 4AY6A 1KKLA 5A04A 5K8TA 1G3RA 5HBGA 2A9PA 3O84A 3NANA 3SSNA 3UBMA 3LZDA 4WEOA 2JCSA 4AWAA 1NY5A 2YVAA 2GZSA 3IEIA 4XQ0A 5ERGB 4TMKA 3TRHA 2VN8A 1KS2A 3D4PA 3HI4A 4WTOA 5HKAA 1T9AA 5DP2A 1NBOA 4LA4A 3K5WA 3ANSA 3UC5A 3V34A 2VNAA 3MIZA 1UJMA 2P4QA 1AHNA 2ZIEA 2EJCA 3QVXA 3Q9LA 4HGPA 3RU7A 5LYJF 2C2ZA 3DDZX 2Z9BA 3DA8A 4KMMA 1RYEA 3WA6A 1OFUX 3FPSA 2ZUBA 2FP3A 3AR2A 3F67A 2WG1A 3KQTA 4HQOA 3WGTA 2OK8A 5FBWB 1PJAA 2OFXA 3OE5A 3QE4A 2H08A 3WWEA 1JYEA 1THZA 4ZYWA 1RBMA 1Y9JA 2A30A 2RKWA 1A9PA 2QWXA 4R1NA 4D44A 4DJFC