2RSLA

Refinement of gamma delta resolvase reveals a strikingly flexible molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
115
Chain Sequence
b'MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA DELTA-RESOLVASE
publication title Refinement of gamma delta resolvase reveals a strikingly flexible molecule.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
total genus 42
structure length 115
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rslA00
1GHTA 3LHKA 3LHFA 1ZR2A 2MHCA 3G13A 5C35A 3ILXA 2R0QC 3PKZA 2RSLA 3UJ3X 1HX7A 2GM4A 2GM5A 1ZR4A 1GDTA 3BVPA 3GUVA 5C34B 5C32A 5C31A 4BQQA
chains in the Genus database with same CATH superfamily
5C51B 2QZ9A 1JKJA 2XUHA 1UC4B 4EUHA 1JLSA 4TLMB 5IZCC 5TGZA 4HR7A 5LLDA 3DDZX 3IX7A 4UNSA 1AN9A 4DTIA 5EHIA 1XZDA 3QE3A 3SR4A 1G3RA 3U61B 3ZWCA 3WL5A 2IF2A 3KE9A 4AIIA 4JI3B 1SA0B 2FZEA 4MVJM 4NCXA 2PD4A 2ZR9A 3TYXA 3KLPX 4PYLA 4DMCA 2NQTA 5HTOA 3AI3A 2GCPA 4ZZ0A 3BM5A 1KJJA 1PP4A 4H9GA 4I4CA 1P62B 3OEHD 1P4RA 4KQEA 5J5CA 2VKTA 5IS2A 2NW6A 2ALJA 4ZAWA 3UATA 4BQNA 1R4MB 3BB4A 3WQQA 2H18A 4KE8A 1T9GS 3AFIA 4S1TA 5EZ5A 2V7TA 2P0AA 3FNEA 1DC6A 3N05A 4DMHA 5KREA 4DV4B 2IZ7A 2ZJ2A 3ZNOA 4HWSA 1PVOA 2PVCA 2XA1A 4Z0PA 3LYLA 3VR6H 3ITDA 3A2KA 1VL2A 2FPPA 1RQNA 2LKDA 2QXTA 4Z49A 3C5VA 1K2WA 1TE2A 4OQMA 4ZC8A 1N2EA 2X0FA 3VR5A 1E9RA 3NHMA 3NALA 5JXJA 2VSYA 1JMKC 2LP4Y 2PTHA 3TF5A 1D6MA 1YT5A 2ZBFA 2OK8A 3K8YA 3UYKA 4KQKA 4AROA 1U2PA 1L7AA 2OWDA 1XP8A 2COKA 3CSUA 1AJEA 1X9GA 3K9GA 2C78A 5C7IO 2AKAB 3RROA 4B3HA 3AUSA 3O21A 4O8CA 5FPHA 4D1YA 1LRJA 2E87A 3CNLA 3F90A 1QGUA 1YR8A 5G0TA 1VLQA 1BHO1 3U37A 3HVRA 5K0SA 1YZLA 4S05A 2BFAA 4C6TB 3KT6A 3GLFB 4D25A 3H5WA 4DSZA 2JAPA 1T43A 3FSRA 4K2HA 3HZZA 5KHOC 3LUKA 2XDQB 1I9CA 1GKKA 5DX0A 4ALKA 4KO4S 1X86B 2CL0X 5EMHA 1W75A 4HFNA 3FYUA 4D8UA 4JP8A 4PTZA 1VI2A 4I3GA 4KDCA 2BI4A 1YVUA 3CEPB 3DJFA 1BFDA 4X97A 3T5BA 1XGKA 1GLGA 2WK1A 3R5JA 4S1OA 3P2OA 2BBOA 1CZLA 1BD3A 3AB8A 4Q3DA 2CVPA 3IR6A 3AM1A 1WD5A 2DTEA 3UWDA 1S5PA 3P20A 5EJ4A 4K0KB 1SOAA 5DHFA 1EVLA 1B16A 1LKZA 4W8HA 3OICA 1JEQB 5BUZA 1SO8A 2HSWA 1I01A 2GT1A 3MIZA 3CR7A 1NNI1 3FOCA 1CJUC 5C7OO 1P2BA 1ZD3A 4DV5B 2CXUA 1YBFA 1KORA 4F93B 2QTTA 1BYIA 3E05A 3C14C 3FROA 4PLYA 3EZFA 3I9JA 1N36B 4P22A 2D5BA 3NQ41 5DSTA 5B7QA 1F4LA 2FX5A 2OESA 1L4EA 4GVPA 1VE3A 5BMOA 1N6KA 1DOZA 4AZ3A 3NHSA 3VAZA 4D41A 3F73A 5G1NA 4L8WB 2D8MA 5JZ9A 1L0BA 1GRRA 2Y0BA 4KL8S 4MUEA 4PIVA 4TLLB 4Z8XA 4EQ6B 3IS3A 2IOQA 4GPEA 4TV8A 3JD1A 4N8SA 2I2XB 2G1PA 2BZ1A 1HDEA 1LPSA 3WA7A 2FY8A 2VJBA 1JN0A 3NGMA 2QVZX 3C48A 5DFAA 5ALLA 5K3AA 3SYMA 4A0GA 2G67A 4S1VA 4GT1A 1O1YA 2ZAYA 5FWDA 1UMBB 2GUWA 2VDVE 2FUEA 4DR5B 3U60B 3NHYA 3QE9Y 3FRJA 4KPUB 4IDPA 3G2IA 5BT9A 1ZNXA 2WYHA 4WDQA 3DNMA 5B37A 3PNKA 1OB5A 2X8JB 4O4IB 1QYXA 1ZH6A 3DV0A 1QDUA 3KQQA 1DX6A 4YQYA 2POCA 5SZIA 1M2VA 3WLEA 4P0QB 5DGIA 5EWLA 1M1YE 5CIWA 3VPDA 1C8BA 4B33A 5E6UB 4HRAA 4CQMB 3BT7A 4JXKA 1N1DA 4MV7A 1OE0A 1VB3A 3QVXA 1VI5A 4FZJA 4R2JA 3L4EA 4OM7A 4XM2A 1JSRA 3PGLA 3AESA 1OILA 2IYLD 1DRJA 5ECGC 3S27A 1ITZA 4IZHA 4AO6A 4UBKA 1Z3CA 1GV1A 1WHTA 4FW9A 1MB4A 1XTBA 5EINA 4L9AA 1G8MA 4W9NC 2Z1DA 1XRJA 1P1JA 3EQ6A 3PIRA 3V1UA 3V4RA 3O9ZA 4MIYA 3L7AA 3MJHA 4GM4A 5ICSA 3HNPA 2HIHA 1T3ZA 1N2SA 3IQIX 2CLDX 1IHOA 4TXLA 4V0SA 4LGYA 3F5FA 5JTUA 3EVBA 1EP3B 1ODLA 5ITZA 4Z9XA 3WFJA 3NS7A 1V41E 2J3LA 2ZI3A 5G2OA 4HDMA 5H1YA 3HN2A 4CT4B 5FOQA 4M8LA 3JSAA 5IT9A 3NTVA 2XB9A 3OIYA 4AY2A 2IYAA 2OCDA 4IX1A 4AY3A 1YUNA 3HP1A 4MEJA 4AXXA 4ER5A 4URYR 4CM1A 4IFIA 4MI6A 3PD7A 5SY4A 2F43B 1AKYA 1FU8A 1ZAKA 4NOJA 4AQYB 4ALLA 3UF0A 5FTNA 5DNCA 1E3EA 1R6XA 2R1UA 3TSWA 1AA6A 2UVPB 1R5JA 1E6WA 3PEUA 4RVFA 1TFUA 2BLNA 1RQ7A 4QGFA 1DAEA 4K9OA 1P7CA 3HWWA 2UYYA 3EC1A 2RD2A 1V11B 4J0EA 1MO3A 1U7XA 4DJ5X 1L8AA 3PC8C 3GEBA 1KC1A 4JQOA 4PN7A 3Q7RA 2K5UA 4R1TA 5DNWA 4UDOA 4EF4A 3KQUA 1XAJA 2IIVA 3AX6A 4OX9B 3MQ4A 1FU4A 2GXQA 1WAMA 3DKIA 3K5HA 1C9YA 1O9BA 1XCMA 2AZTA 4Y9UA 1UXOA 4QUAA 4YJHB 2JDID 2NPIA 4Y98A 5L3QB 2E89A 1CD5A 3ZCQA 2ZR7A 1RT9A 5HP4A 2W8BA 4Y67A 2XBMA 1GJRA 5A4AA 1EP9A 2AG6A 4B75A 4F7DA 2J48A 4QTYA 1W44A 1L7OA 1XLVA 2WAAA 5K99A 1NOJA 4YCDA 5B2ZA 3VSEA 2F9FA 2BC9A 1X9HA 3MB8A 4I9GA 4Z0TA 3PFWO 1QHEA 5DCUA 1K98A 2WU4A 4XFKA 2VH5R 2B3DA 4ZRDA 3DNFA 3U9TA 4DF3A 4EVQA 4Z4FA 5KI6A 4XPIB 2C2GA 1R5OA 5DISB 4D8TA 4IILA 2PH5A 3WO1A 3C8UA 1H2ZA 1RMQA 1VIAA 3EC2A 2OXFA 4Q15A 3QSYA 5EJ6A 1RHJA 1CWUA 4H35A 2ENWA 2HGZA 1ADJA 1PJ3A 5C1OA 4YAIA 2LGJA 4YQZA 1JR3E 1TFRA 3NANA 4MKRA 3PGXA 3HWSA 5KNDA 2FX3A 3OCYA 3FHCB 5LBTA 3QLUC 4MKHA 3BRQA 3JYPA 2IWRA 3BMOB 4YECA 1Z25A 2FPMA 1YDGA 3HN6A 1X2BA 2AQHA 3CNOA 3GH3A 1KEPA 1KGSA 2C2ZA 5BWBA 1H6AA 3BGIA 3N8HA 4DBVO 4E5SA 4RMJA 3G85A 2PCJA 4LYAA 3ANLA 1JTVA 4Q1DA 1FW8A 1JHUA 3W90A 1ABBA 3UQYS 1KJQA 4HAZA 4Z0HO 4BNKA 4EYGA 1WY7A 2UDPA 1O0CA 5HUQA 3KDPA 4Q7QA 3UHJA 4I9FA 4L6AA 1V96A 4AJ4A 4Q48A 2DQSA 1DKMA 5LA6A 1OWNA 1E3JA 1KJYA 4A15A 1CERA 3DR5A 2BELA 9ABPA 2I6FA 2A5YB 3F46A 3GR6A 5KYYB 4BYMA 1NBEA 4R2HA 1IZYA 1TEHA 4IDGA 5EYPA 1OAOC 4Q3AA 1UPBA 4MYSA 1FTYA 3MRXA 4WOKA 1N25A 3GFBA 5A5VA 4NIMA 2Z4SA 5F35A 1YA6A 1U81A 1ZC4A 1CDDA 4UHJA 5HDBB 1AU9A 1OFUA 3CB2A 4UQPA 1BG6A 4CI9A 4J6FA 3U7RA 2O52A 1NN0A 5CEEA 2GN2A 1EB8A 1TT5B 1NI5A 1GXSB 5T6MA 1CR1A 2FEPA 2X6QA 4E5YA 5C8YA 2Z2YA 4IP0A 5FQOA 4DR7B 1RHRA 4HDRA 4XGRA 3OWOA 2GFQA 5GPBA 3T99A 3EPHA 1YKGA 1MQAA 4IDCA 4L50A 3AY6A 2Q5EA 3ZCRA 1KI6A 2ZCJA 4BXOB 1U63A 1LY1A 3THYB 1OHHD 4BX2A 2R79A 4RSRA 3WG9A 1SUCA 1ZMXA 1E1KA 3W9UA 4IVNA 3U4CA 2AN4A 5C9ZA 2PT5A 1UPCA 1RAGA 2L19A 3ZWVA 1RCFA 2J3HA 2PYIA 4ER6A 4K1LA 4X45A 3UPDA 1TO2E 3GFRA 4YJ2B 5IWCA 1WPRA 1CW2B 3OQMA 3AEQA 5JC1A 1Q91A 1O6CA 4K88A 3AJRA 3AJDA 1DPGA 3H05A 2C4UA 5CLHA 1RLOA 4NBRA 3A9SA 3I72A 1M74A 1YI0A 3E3OA 3MTGA 1QG6A 4MW6A 3K0FB 3M9LA 2YOGA 1HRDA 1Q0ZA 1Z15A 3A1EA 4RETA 5CR9A 5FAXA 3WMWA 3M2TA 3V7YA 1QTNA 1S3IA 3ZG6A 1ULSA 3SBDA 1KMCA 5F52A 1NW9B 4ZAVA 1ZCBA 1PFUA 4RMNA 1IUPA 4TSKA 5K8IA 3I73A 3ZVNA 2IXTA 4P0TA 1PJ2A 2ZSHA 3TL6A 5CYPA 5LFAA 2P65A 5K0LA 1W2HA 4WNAA 3PRHA 1Z28A 1OXSC 3MINB 1NU6A 5G0VA 1KZYC 2I4RA 2Q4BA 3QNUA 1F0YA 2Y1LA 3JQEA 4YAEA 3WWYA 2ZRLA 1QGDA 2R5NA 4DV1B 1KDTA 4C3VA 3M6MD 4BB0A 4EB6B 3K0KA 3ZR4B 5YASA 2C7VA 221PA 1Y81A 1SXJE 2XZDA 2WSIA 2ZDGA 5AK6A 1Q22A 3R2JA 1Y6RA 2I22A 5EESA 1CVRA 2VT2A 3BIFA 5IKPA 4MITA 3G2LA 3UC5A 4JWTA 2BFDA 4JA0A 2D1RA 2HV9A 2IHVA 3PQ8A 2DPXA 5A9SB 3W9SA 3LHKA 6PFKA 4WIAA 2RHRA 4PQGA 2NUAB 1M67A 2Z1MA 3A3YA 3TNFA 3W04A 1U7UA 1KBZA 3AKYA 1NUQA 4YCAA 3L6OO 2DXIA 3VSAA 4CN9A 5FADA 2WHXA 3VZDA 4PLGA 1ZA1A 3RU9A 4CM9D 1JS1X 2RHLA 3EIXA 1GCGA 4TVBA 1PYGA 3CG4A 5FULA 2YZNA 5IDYA 5JG7A 3FKSA 2FPGA 4QJBA 1Z0ZA 2LIVA 1PD0A 1QYCA 1MRZA 1PV2A 1ZEMA 2BBSA 2OT3B 1EZ4A 2GK6A 2P9ZA 3EGDA 4XCXA 4XCQA 2G36A 1O6FA 3A1UA 5K45A 5M2QA 1Q0HA 3CO0S 1EUZA 1OXTA 3BXFA 1Z45A 4G5OA 3BF8A 1IEQA 1IRXA 1K7EB 1H3NA 1F38A 4LGVA 5AHWA 1E2FA 1QLHA 5LZ9A 1MJHA 2H9AA 2NVUB 1FSFA 4CLRB 3VZQA 1YJAA 1T34A 4G4IA 3BAFA 3C7CB 4RQUA 4FMDB 5AK5A 4CQLA 5GADl 1SIUA 2GBPA 4UOQA 1QP4A 3RR2A 1JIUA 1P7PA 1CEXA 4J0IA 3H5VA 4V1CB 2R96A 2RG1A 1L4GA 2QI9F 4MX8A 3QVGB 3TL3A 4ND3A 1CZRA 2Q3EA 3TEMA 2C1ZA 4KIFA 5HZHA 2OMEA 2GD0A 3JSXA 5IDVA 5KDOA 3IUSA 2GN1A 4HRVA 1KI2A 4AJ1A 4C6RA 3QLJA 1KZ4A 3EXAA 3PEEA 2B92A 3PTZA 3BBPA 1EBUA 5TC4A 1TW2A 1LTHR 3QTBA 5A5FA 3HYSA 3DC7A 1FSGA 4I4IA 4IO1A 4XDZA 5ITWA 5K2OA 3MAJA 1YVRA 3A6DA 3V7FA 1N32B 4QNMA 1RW4A 3SJCA 5B53A 1N6PA 4Y8VA 1KVTA 2BGMA 5K3CA 2A57A 3SMVA 4DCTA 2IUFA 4MHSA 2C7BA 4PPNA 1MOQA 3AKDA 5IC5A 1KO4A 4N65A 1D6SA 2FLKA 4LTDA 2DGDA 3W4JA 3MMPA 1H6BA 3F7MA 3UMBA 1CXZA 3A31A 3PYMA 2J9GA 4PO1A 1WV1A 4F3RA 3ESBA 3A1CA 1H8HD 5JISA 2C3YA 3EBPA 2HXGA 3HB4X 2JFHA 4GYKA 4P32A 1M1UA 3JYOA 4YLGA 2B4TO 1A3CA 1X8KA 1YK0A 2DWPA 2DBRA 2OZEA 4GMHA 5EKXA 1WXHA 3VPCA 2DFTA 4UNRA 4M8SA 4GVXA 3JY6A 2OORC 1RPNA 1ONOA 3K70D 3TW6A 2BDEA 1EVKA 4I1VA 1IN7A 1VPLA 3O8BA 1LEHA 5E8RA 5SYMA 3TLEA 3NDIA 4Z3OA 3CWCA 4OH7A 1UJ4A 3GIWA 4WLVA 2X42A 4J1QA 4Q47A 4QM6A 3KYCB 3ROZA 3AF2A 3OLWA 3RW9A 1E0JA 2GYYA 3DWEX 5DHQA 3R8XA 1WDWB 3AI2A 1UMCB 3Q41A 1FNBA 3DTVA 3TFQA 3TZQA 1QPZA 2XOXA 2ZRNA 3P45A 4N0DA 3K0CA 1N2IA 2GJ8A 2H1CA 3KLOA 3PQ7A 3ZE8A 4DQLA 2R44A 4MRAA 3JQQA 3E53A 3IT3A 3L0ZA 4LJ9A 4C0WA 2ATVA 2PE5A 4IJVA 1GNVA 3PYXA 2H2AA 3CRNA 4LDPA 4NOLA 5I4KA 5KC9A 4MQBA 1RYZA 4N0PA 5KQRA 4A36A 2Q4EA 3M8KA 3LQ4A 4PSVA 1NXPA 2NIPA 2GK3A 2WWRA 4ETNA 1AK9A 5F2OA 2K4MA 3BSYA 2XHEA 1SIWA 2PS9A 3H2HA 1QRSA 3ANTA 3JVDA 3WIDA 1DGQA 1D7AA 4HNAB 3RHTA 1DEXA 3CXUA 1UT5A 5BXQC 4G5RA 4X1YB 1QGZA 2AOTB 4LPSA 1MVNA 1T3GA 1R4NA 1SG9A 4HPXB 2ZWOA 4KI0A 1UANA 4P7FA 5EKDA 4CJXA 5IEJA 1TT7A 2GA8A 1LDMA 1RKBA 2D2EA 1RQXA 4GS5A 3PT5A 3T5DA 3DT8A 4EMSA 1UZUA 1GG8A 3VU9B 5BWOA 2H0AA 4LE2A 4DIMA 1GHTA 3FTDA 1IBCA 1N2CA 1QLWA 2ZR8A 4MW5A 2QOEA 1UL1X 1GIAA 2XUAA 3ABOB 4OMDA 3SQDA 2GZ1A 4H7KA 2JAUA 1RPAA 4CDNA 4F8JA 1Y7LA 5GZ3A 3PC7A 5KYUB 1KSHA 2NZUG 4G26A 1L9KA 3KXPA 1PL6A 1JH9A 2C8VA 2GJSA 1AS0A 3HMKA 3K20A 1GQQA 1RIIA 4CDGA 1A1SA 1OH8A 2BTQB 2YN0A 1X1TA 1JUDA 1NG1A 3KTOA 3DAYA 4JU9A 4LJ6A 1JAZA 1Q1EA 2G72A 4X54A 3ROTA 1WWKA 2A4KA 4YVFA 4C78A 1FFXA 4UTVA 2CN1A 5JR3A 1AHHA 1Z6PA 3S6JA 3LC0A 4FN5A 4PYIA 1QFJA 3WL3A 5ILOA 1N5LA 2XMSA 4R71A 2PUBA 4DIEA 1U9CA 1LJ8A 1NV9A 2ZBEA 1ONBA 1DIHA 3P0FA 3VO1A 3NOQA 2IDKA 2P62A 3I92A 3HP7A 1K4MA 3IEPA 3Q5GA 3U62A 5B7GA 1FS6A 2J59A 3NDPA 1EFKA 2WMNB 1BW9A 2WVAA 2AJCA 3BTUA 5A5DA 3FTFA 2WV9A 1T91A 1FXSA 2NZXA 5K01A 5CG1A 3LT4A 1A69A 2Z5FA 3OZBA 4N3NA 2IBSA 1N8SA 3K5PA 2R66A 2M1XA 3TGLA 4TSRA 2NU8B 2REOA 4EG4A 1BRMA 1KVQA 1P77A 3HU2A 4O4LB 1SCAA 4KX3A 3E5HA 4QRDA 3TW8B 2ZSKA 3FVWA 3NETA 1U7OA 1W0KD 2WB4A 1Y3HA 3KOUA 3NRCA 3GVHA 3IVGA 4MP6A 4G0PA 2RGBA 5H9WA 1EQ2A 2FMTA 2XWBF 1LS1A 3CKYA 4FLMA 3UJ9A 5KYVA 3GLTA 4WXRA 2VG8A 5U4QA 1XR3A 1B6RA 2A9PA 1HZJA 2VNSA 4M9UA 1CPYA 1DQSA 4N7MA 5AW5A 3A6KA 3I28A 4D43A 4BJ6A 4L85A 5E9JA 5J2UF 4WHMA 1SXHA 1ST2A 1C30B 5LMCA 3MSXA 1UBGA 4M1QA 3N8KA 1BXKA 3NBKA 1BX1A 4HD8A 3U09A 3PQ4A 4HAOA 1EFUA 1ZGZA 2WA1A 2PIDA 1ZL0A 1JE0A 3IVRA 3SQXA 1NJ1A 3QGMA 2WF7A 3DOUA 3UMCA 1F9AA 4YLYA 4FILA 5KNLA 1V4NA 3HBFA 3OD5A 2ZRKA 4FIZA 1Z6XA 4D2IA 4Y6LA 3GEMA 1QUFA 3QVUA 3TJMA 2WF8A 3GT7A 4XW2A 5U4XA 2ZWAA 1NJ6A 3OE1A 4R9RA 3HCDA 1OZ0A 2J0VA 1VGRA 3BN3A 3MCTA 3OA2A 1NMSA 3UCEA 1MAVA 5AVWA 3AVXA 1A96A 1V9SA 4XLZA 4L4RA 3VV2A 2CD7A 3W78A 3P9SA 1LJUA 3DV9A 3PPXA 1QAMA 1PRYA 1JEEA 1ZHFA 3EBLA 4F85A 2A6PA 2HAEA 1X92A 5EE3A 3FTQA 4BKOA 5CB4F 3ZY3A 4M7OA 2G9ZA 2EKDA 2VJLA 4OXXA 3SXUB 5LOVA 1CUYA 1ZM7A 1EVYA 2FUG1 1ENPA 3DSRA 2OCKA 4HYYA 3RVMA 5JNWA 2AT1A 2PV7A 5DLQC 5K20A 1BX0A 2P9YA 1NF3A 2J7PA 1MG0A 2IYZA 4JUFA 4FGKA 4N3CA 1NBME 2L69A 3GLHA 4PX9A 3GDWA 4UZFA 3RG2A 3CX7A 4UCFA 4EYSA 1N6OA 3VR5D 3OEWA 1QQBA 2AUMA 2VATA 3RFVA 4IHJF 5EWJA 3ZOKA 1R3UA 4EITA 5DGCA 4KUEA 1RC1A 4QXRA 3VDXA 1NJSA 1XALA 1V6AA 4MUKA 4O0LA 2CUZA 7YASA 4KQGA 3D0QA 1WV0A 2H07A 4OO3A 4ZT4A 3RTAA 1X9IA 1EE2A 1JPJA 2O8EA 1U3TA 4Q7JB 4R2XA 4C0BA 1QE5A 1YFZA 2INGX 4TOIA 1WMFA 2CVOA 3FIUA 3F97A 4OXQA 1NASA 2G8NA 1XZCA 2R1VB 1EFPA 1SVKA 2X2PA 2KW5A 2YNMC 1OZHA 1AO0A 3QFCA 4RLHA 3K73O 1BS9A 1KSJA 3VYWA 1YRYE 2A0FA 1T5LA 3KOMA 1GCAA 1R9GA 2PLRA 3HWX1 3LRPA 1ECCA 1HQYE 1OFVA 4HFMA 3WE7A 1PBNA 1ZX1A 3COSA 2V58A 3ECAA 4JK3A 2O05A 4LYGA 3VU8A 2JBWA 3AL2A 5I4IA 2DFKB 1XL1A 3HCRA 4Y2SA 1FUYB 3WA6A 4Q4JB 5JXIA 1W36B 4NFLA 1YHZA 2NUTA 1YOVB 2W4IA 3I0MA 4RESA 3MIIA 1CB0A 2VDNB 2M9MA 4RJIA 3ZE1B 3ZPXA 3PIIA 3M70A 1XPUA 4MLCA 5D1HA 1ZR2A 4AQDA 1H1LA 1L5YA 2WA2A 2XUFA 4PBRA 3U4AA 5AW7A 1JFFB 1J97A 1QZ3A 2WJGA 3PXBA 4MJLA 4NNPA 4BNIA 4YRKA 1YFJA 2C8JA 1BGWA 2ZCUA 1Q17A 1AGPA 4G37A 4RHYA 2UUAB 2VPIA 2PNJA 1ID1A 3E9CA 2B3TA 4EBBA 5HDQA 5HKAA 3CLSD 3HK2A 1FVXA 2CNLA 4PIPA 1V16A 4XWAA 13PKA 1RI1A 1MB0A 2EFJA 2ZRCA 5EMLA 3DPIA 1QJCA 3O1JC 4DTCA 2HA3A 1V7PC 3C6YA 1O6GA 2NV0A 3LGSA 1MC5A 1LWNA 3J7TA 4D8XA 3QXGA 1ZOOA 2AZDA 3QA9A 1HLDA 4MRMB 1E1LA 2FB9A 3K1AB 3C8MA 3U7HB 3GRZA 1GDHA 3R3YA 1Q0SA 1XKTA 2XUKA 4FINA 2GQ0A 5DXJA 2Z8YM 4UTPA 3HDGA 4NCIA 3BL5A 3VRHA 1K4KA 5JS6A 2TMYA 3Q5DA 1RYDA 2DPLA 4LNUA 3VTAA 4YAKA 1N2GA 4BU1A 2JLZA 5DCYA 1GUZA 1U3GA 3LFTA 2P68A 3OSUA 4ITVA 4HGRA 1JHMA 2IEBA 3D6MA 1Z7WA 2BP7A 2UV8A 3R6TA 5HYVA 4ZI7A 1WCIB 2WTUA 3BSSA 5CGQB 2B94A 1RKXA 2HFJA 1DARA 3OZSA 4JJ6A 4B82A 4XVCA 2QD2A 2Y27A 5KCMA 3KT8A 3WK5A 2I65A 2QVLA 3RC3A 2O07A 3BQNB 4UVEA 3T3EA 3G8BA 4LZNA 1T1EA 3CN9A 1XDGA 2V03A 3H9QA 3ZE2B 1NUAA 3MJSA 3WB1A 2IE8A 2JVJA 3L46A 2ID7A 3CVUA 4ZV9A 5GY7A 3UWPA 1C29B 4Z4GA 2WW8A 1OIXA 2EOAA 3P9RA 4D9HA 4Q93A 1JIQA 3TLAA 4HMOA 3BH0A 4HNSA 1X3LA 1U3FA 5LLSA 5BYKA 1R3DA 4PZDA 2EWVA 4B6GA 5JVDF 3WGVA 4OMFG 1XWIA 2F9MA 2P9QA 3UXEA 1RP1A 1L5LA 1EI9A 2VZ9A 3NHWA 4DDVA 1CY7A 3IPLA 3E9DA 4QTZA 2PX5A 2WT9A 1HTTA 3KRTA 3SK0A 2RHJA 3MAAC 4R3WA 1X70A 5HCUA 1E8NA 2IEIA 1CUAA 3DXZA 3ZU6A 1K3UB 5EIBC 4MVJA 1SN7A 5I6DA 4A1FA 2PL5A 2GWHA 3AEKA 2Z09A 2Q0QA 4XD7A 4Y9SA 4R1LA 2ODEA 4ZQIA 3T3GA 3U56A 4C7BA 4YV7A 4TVKA 1E4OA 4OUKX 4TPKA 4B3RB 4ILKA 3GRFA 4QEDA 1V7CA 2Q28A 3BE5A 4PANA 3BWEA 4P5EA 4S12A 3FZGA 2C7RA 3EEYA 2VXCA 4R2MA 4D8YA 2HHAA 4WGGA 4PGMA 1Z5VA 2Q3MA 5KQGA 1L7DA 4DIKA 3ROMA 3ROXA 3R7WA 3WGGA 3R24A 4NJOA 4BKMA 4RSMA 2JCGA 5TR9A 3V8NA 5IDWA 4BQRA 2QUIA 3ZDZB 4GECA 4PLHA 3RVSA 3PDIB 4F96A 4RA9A 4HB0A 4OFBA 4MWEA 4G1VA 1KOGA 3DAPA 4WADA 4ABYA 1QCCA 2C84A 3C6ZA 5E6RA 1O0BA 3AF6A 1NVXQ 2A1UA 4FM9A 5KWEA 2QRMA 2AKYA 3O7MA 3FF1A 1AKNA 2IV3A 2FPXA 3QTTA 4DV2B 4U7FA 3IIMA 2JLYA 3E2IA 3SQLA 8ADHA 1OH7A 1QPBA 1OWOA 1HA3A 1MO4A 1SK8A 3B3GA 4TXMA 4TV9F 3VH4A 3ZQUA 2BR3A 2I8CA 4WNIA 4ARSA 3NOOA 1Q92A 2FF5A 4QDUA 4JJFA 3P19A 5FUWA 1MN6A 4O3MA 4M98A 1G7SA 1MAHA 1SOMA 1GFWA 4LHEA 4B7ZA 3CX8A 4GC5A 1IH8A 3VYRB 1G4HA 4RORA 1P72A 3K35A 3PPYA 1ZD2P 3D8BA 2CLCX 4QQFA 2V9ZA 4DILA 5FL3A 5ALYA 4BLTA 4DLTA 5K3FB 3WDMA 1N2JA 3TE6A 5KNDD 1K68A 3EDYA 5EXTA 2A5GA 1W2WB 2Z2IA 2VH2A 3O03A 4MS4B 3RT1A 5B57C 2QL5A 2MMCA 1J25A 2VAWA 1UPFA 1DTSA 5CVUA 3RBZA 3U31A 2QE6A 2V4ZA 4G1MB 1ZR4A 1C7EA 3WLQA 4BX8A 1UFQA 2WNHA 3EEFA 1JHQA 1HDGO 4AJIA 2GO1A 2P0EA 2WPDA 3IDQA 4AWXA 3GCXA 4DLLA 5KYXA 3NBZC 1K88A 4M2LA 3GJTA 1AD2A 4WWHA 1QGED 4KQIA 4B4DA 1U1GA 2OK7A 4GSLA 4J76A 1Z9BA 4CMIB 1E89A 1R8XA 3RIXA 1DOAA 2C61A 2GBGA 2YICA 4KN5A 4OJNA 3FPGA 2ZYVX 1AUXA 3KAKA 3RSLA 2JVIA 3H0EA 1K2VN 2MWMA 3FLAA 3I04A 5CBPB 3ZQ6A 5IARA 1WXGA 3IT0A 1MEOA 3JQ7B 1NP6A 1E60A 4AJJA 1S2NA 3L0BA 1E9CA 1U8EA 5J59A 3S2IA 1VMIA 5IUJC 2PU7A 4LF5B 3I37X 5E2AA 4F9FA 1LJLA 2OQIA 3EY9A 3LTEA 3N8DA 1RXCA 3QBDA 1MOSA 5C34B 1ZD1A 3C45A 1ZUWA 1ZXBA 3ER6A 5BV7A 1FIUA 2D62A 5DEOA 4EGSA 4CKWA 3HO6A 5A0TA 4EJSA 1J7JA 2H1LA 1DQYA 2BFEA 3NBMA 5LYJA 4PEVA 3IDOA 4LKOA 2ONCA 5ITVA 5BRAA 1Z2DA 4R2IA 2ZS7A 2HR1A 4A73A 5BWNA 4O4LF 3OMWA 4MGYR 4KXQA 4V2IA 4HAWA 4ZN6A 1THTA 1ZM9A 3EUFA 1RC8A 1H3EA 4D79A 3MGKA 3FM9A 1E9FA 1XU9A 4QTTB 1MC4A 5C35A 5MN4A 4MW4A 3COZA 2WG2A 2ZSEA 3HBNA 1XDDA 2RGXA 2J41A 4LK3A 1WCXA 3G2JA 1ENOA 4A2QA 4DSUA 1KWKA 1C3JA 3KKLA 5LDDC 1UFVA 2GK4A 1WTCA 3I9V1 5CK4A 3T1HB 1ODJA 2Z83A 1UBUS 2Z3WA 5F7XA 3PZBA 4EYEA 1VKRA 1JVNA 2HIGA 3YASA 1AS2A 1JLHA 4D0NA 3LM8A 2W2QA 1GPUA 1XWWA 2IS4A 4ZZ1A 4YHHB 5TJ9A 2VH1A 1XAGA 2QENA 1W48A 5B1DA 2W90A 1PZXA 1GUYA 5IKXA 1THMA 1IK6A 1KQPA 3EVZA 3QEMB 3BH6A 5JDCC 4TLCA 2QAJA 4IKOA 1M5RA 3RPEA 3ER8A 2H06A 2PQ6A 3GNLA 3KDSE 4BPBA 3B1ZA 1TYEB 4F6LA 5JAQA 1CUCA 4QYSA 1HX7A 5FWXA 1MGPA 5F2NA 1BXRA 2YMLA 1AUPA 5BVHA 3ZWYA 1FJ2A 1U28C 1MABB 2O9JA 3ZV6A 1SUSA 4NDNE 4MB6A 1R16A 2FWBA 1WBJB 5EKSA 3WHIA 3QMPA 2WBLC 1R5NA 4DC0A 3F6CA 1ABFA 4F9GA 1DV2A 1TGYA 2FE4A 2FETA 1K7XB 1NMYA 1RD4A 3KB6A 3MXTA 4G5HA 3ZN2A 4RPGA 4AF7A 1A4XA 1HLFA 2QQEA 3OQHA 1ESCA 5ERGB 1ATIA 4B3BA 3LBHA 2X9LA 4BQOA 4MWDA 4B5LA 3K09C 3AYXB 1B26A 1SVSA 1NMQA 4PX2A 3HQ4O 4MR7B 3R0ZA 4XDYA 4BKQA 4ERXA 4AMGA 4G0ZA 5EZYF 4BB6A 1RVDA 5ENVA 3LPMA 3KZCA 5CVTA 1FFHA 4FYIA 2Q41A 4RMHA 5T4FA 1P9RA 4XX0A 4JLUA 1OQAA 1E0AA 1ZVVA 3DVSX 3KVYA 1NJFA 4U0KA 3ZNQA 3ZDCA 3ZWNA 4MSUA 1MU0A 2DTXA 3K4QA 4II2A 4BC1A 3GLIE 1HEIA 3DG9A 3LDAA 3T3PB 4OJMX 4TTRA 1VLLA 1WU8A 4I2NA 3TLJA 2P40A 1XLTC 2CDRA 1JBEA 1K0FA 2ZRAA 3SS9X 2IVFA 4L5AA 3W79A 2O7SA 4EB8A 2RC6A 3LAWA 4J7AA 1GT91 1UK9A 4PFSA 1QCDA 5AVSA 2PL9A 1D7OA 1RXVA 1LB1B 1G19A 1VP9A 2CLIB 3QFFA 1OJLA 1QR6A 3GW8A 2QR5A 2KYRA 3SJAA 3OCUA 2EGUA 2NZ2A 3K9QO 3R7SA 1K0UA 1KZ1A 3OKAA 4V0RA 1E7RA 5F2EA 3EZNA 2LRHA 3TFWA 3ME5A 2OOKA 1SXIA 3H6GA 1NV8A 2YFHA 1GUFA 1YHYA 2PKXA 1AUVA 1LI7A 3DKRA 3IP1A 2I9KA 3OZGA 2JS7A 2C00A 2B25A 2EQAA 5J47A 2O19A 3PNVA 4ZOEA 5KSPA 3G2PA 1QU2A 4H1UA 5TQVA 4M53A 1PQ4A 1JDZA 2PQMA 1IY8A 3CH5A 2BV3A 3P1JA 1LLDA 1U1IA 3NEAA 4PNHA 3HUEA 2OA0A 4V0KA 4IY1A 1UEIA 2Y1EA 3MVEA 3Q1LA 3PUHA 4PU0A 5DW3A 2OBBA 2TECE 2WYOA 1E3IA 4BEJA 5E7JA 5TQ0A 3KXDA 3EZGA 2H0QA 5HQ3A 3WAJA 3WGQA 4CTKA 1Z5OA 3ZIAA 1ZK3A 4FX5A 3KQHA 3KTFA 5JI2E 1NZJA 3A32A 3QU5A 2M6RA 3JQ8B 2ORVA 1N4AA 2GA9A 4D3FA 4AG3A 1JJIA 2QT1A 4FOOA 3RLIA 4D0GA 4MUXA 2IOHA 3NHJA 4BP3A 2AEMA 1Z22A 3SC3A 4DM4A 1WXIA 4GZMA 5JFTA 3SM9A 2UVQA 2ACEA 4M0FA 3KR2A 1H1DA 1RPTA 1GWNA 1XMSA 3CBQA 1IL0A 3RYIB 2B0JA 1P1KA 1MTOA 2IVZA 2WP0A 2FPIB 2WSYB 4N39A 4NZ9A 4RCVA 1VG8A 4BRUA 2V7QA 4ZYLA 1IM8A 4BJHB 4BLRA 4C01A 4FR0A 1LBEA 1ZD5A 4O0MA 4UDYX 1CZNA 3B9RA 4L4UA 3CU5A 3DO6A 3HPQA 3AUYA 1CE8B 3CLUC 4IIXA 1SVWA 3DEHA 3E9MA 3QKWA 4YRGA 3T6KA 2DWOA 2GYWA 3CFYA 4X00A 3AC0A 1JSZA 3FBGA 4C30A 5DLYA 4L3VA 3FRHA 4S24A 4RGQA 4FWTA 1Z2PX 1CUGA 4N01A 1KRXA 1YUBA 4B09A 4IQ4A 1QH0A 2CXNA 3DTVD 2OWEA 1RAHA 2F2TA 3GQBA 4N47A 4L4YA 4LJ8A 2OBLA 1VHTA 3E1GA 1W35A 2P67A 2ZQYA 3NHPA 4JDUA 4MYDA 4OLFA 4B8YA 2JBAA 5CX1B 3OUUA 1OT5A 5FI1B 3HI4A 2R4UA 1SD5A 2VS1A 3B60A 1QYVA 2J6IA 2GHQA 2OFOA 3F4KA 4KWHA 1VC2A 3H65A 5T6BA 3C85A 3ESXA 1QB8A 3BMXA 1T13A 2XMGA 4I5GA 4J1TC 5BPHA 1HT2E 4MVJG 2AX4A 3LQRA 2VLBA 1Y3FE 2JFVA 2UUPA 3D7RA 1PQYA 3L1HA 1PZNA 2FWPA 3N8GA 4I4NA 3S81A 5BN3A 4HQ6A 4ED9A 3I2HA 5IM5A 3VKVA 4OHRA 4OYLA 4ZARA 4D82A 4BE4A 3PD0A 4ZAXA 5H5JA 1EMDA 4EABA 2YV5A 4BOYA 1FSZA 4CEIA 2P3QA 5BNTA 3QNWA 3BQMB 2I6TA 5COQA 1XRPA 2YWHA 4ZCQA 1HDRA 2AN3A 3G02A 5SZJA 1V8FA 1MMFB 3SI7A 4S35A 3WHKA 4FSDA 4MYTA 2D2XA 1KU0A 1PSDA 1R1DA 3ZWDA 5IANA 4MAMA 1U2ZA 1Z7YA 1OV6A 2J0UB 2P9HA 1VOTA 1COWD 5C8XA 2W2VA 4WESA 2IHYA 1Z2OX 2BKAA 4M88A 1QU3A 3N2LA 3KTAB 3ZDAA 4DL9A 1JE1A 3ZGXA 1G5HA 4PSDA 4ZK2A 1W85A 1LC3A 1S9HA 2CFIA 3CH4B 3U6BA 5BSWA 1WXDA 2I7XA 3HY3A 4CFZA 5A7FA 3A4IA 2R1TA 2VJDA 2W8ZA 3ESYA 3U1VA 1JEDA 3P52A 4K9RA 3R0VA 4PX5A 3JV7A 4E5PA 2E4WA 5IH3A 3QKRB 4PVDA 5JTTA 1Q3TA 1VJ5A 1CB7A 3QYJA 4WK0B 4CUJA 3I6IA 4HLNA 1U2EA 1QOPB 2VPZA 2JIOA 3FMVA 4HNVA 3ZHVA 5I4CA 4A82A 1Q0PA 4N7JA 2JJ2A 4IOMA 1U0JA 6Q21A 1BMDA 1GPJA 4OHKA 3V1YA 1V26A 3ETNA 2OHVA 2AZXA 2C57A 2QW0X 2YQ4A 3O8OA 3HKDA 4CL8A 4IL5A 3ONNA 4R40A 3Q72A 5BYAA 1TKAA 2H57A 3F4BA 3PI6A 5B4UA 1B74A 5IHXA 3IBFA 2WWVD 3B89A 2OY0A 2I3BA 2ZATA 1YRWA 2A5DA 5FRDA 2QIPA 3R3UA 1WSBA 3TBFA 4DCMA 1GYQA 3LS2A 2VBGA 2Y0CA 4IUCS 4F9EA 3LXUX 4JC4A 2H6EA 3A9RA 3EWAA 4M55A 5DI3A 1T0BA 3IT1A 1DC4A 3KUKA 1V3VA 5JCOC 2JH8A 1OAKA 4FNOA 1LBSA 5EPOA 3SZMA 2VRWA 2ZRPA 1U04A 4EY6A 2OG2A 4NH4A 5GINE 1EXNA 3FNIA 1U1FA 2BGUA 3HH8A 3KFXA 4KNVA 3VPFA 3FPEA 3K0HA 3OHPA 5E8JA 1MJNA 1OFGA 1TVKB 3FCSB 5FR2A 2PNFA 2CNKA 1Y9EA 2Q2OA 3H0KA 2BYTA 2OR3A 4GBGA 1D2AA 1DINA 1SR8A 2IY7A 3QWAA 3SJBA 4OOEA 5TQ2B 1PJBA 2GEDA 4GKAA 1YZYA 3UM9A 2Q8QA 2I29A 5FUXA 4ZTZB 3GXOA 4YPFA 1AQLA 1TA9A 4CHTA 3N07A 3GC6A 5BUQA 1WZUA 1JFTA 2C3MA 2YVUA 2B83A 2IEGA 5HJ7A 2JEYA 2XE7A 2FMHA 4IGAA 4BLOA 1RXWA 3KJNA 1EA7A 2I3DA 2Q1WA 2JHAA 2VP5A 4DLYA 4ZO7A 3E1SA 3KQYA 4FB4A 2PT6A 4FFPA 2I78A 3BGSA 2VF8A 5IK2A 2R5FA 3VBEA 4C4TA 5FHRA 3BWDD 4YJDA 5CFMA 1JTEA 2R8RA 1G0NA 2BONA 3AM5A 1FMLA 1LQUA 2E85A 4G09A 4ITRC 4MV3A 4YN3A 2WF9A 3CKLA 3ADPA 2Q6VA 1ATZA 1E1QA 3DMHA 3MWYW 4NVRA 5LD2C 2EKQA 5EE1A 2J7PD 4GC9A 1YI1A 1DJOA 2VHCA 1K6EA 3H1TA 4MQLA 4RK7A 4ROSA 1ARZA 3QOXA 4LHWA 3OZ7A 4KQ1A 3MJTA 1B2LA 4X1KB 1VLMA 3SJ7A 3U39A 3H9UA 4RD0A 4RYLA 3LOUA 1R6AA 2EP8A 4NCNA 4YYZA 4G84A 2UKDA 2VUIB 5F76A 3FUTA 5CDTA 3I2YX 4NX2A 4YB8A 1QE3A 1JJBA 2PKRA 2P78A 1YMUA 2I7VA 1NVWQ 4TWAA 4EHIA 2Q62A 2W5UA 3BMNB 4OOFA 3P96A 2F8TA 4IH1A 1RJFA 1JHXA 3O2NA 4QG7A 3EIHA 3IDSA 1UKCA 2FHPA 3PWTA 3GJZA 2Q4TA 4WKPA 4MO9A 3HZRA 3R7AA 4X93A 1SCQA 3U80A 5AKLA 3TQSA 4A8JC 1L7EA 4OF4A 1BCSA 1GDTA 1CNEA 3BSFA 4OA8A 1NPTO 2IHNA 2YFKA 3T4XA 3WKEA 2J9RA 5I9MA 2WUDA 2B0CA 1P29A 1N0WA 4HK4A 4RANA 3HFJA 2BFMA 4U4AA 3FSEA 4B87A 1Y80A 2PUDA 1P9LA 1VCNA 1DG3A 4C1NA 2EKLA 4FHDA 3TDMA 3GARA 2B4KA 1E6EA 4KMSA 1ELOA 4ARUA 3FR7A 3G59A 5IVDA 1MLDA 3MJFA 4BJ3A 2VDMB 3K0BA 5K09A 3PWZA 3KWJA 3R8CA 4YASA 2ZRDA 4O4JB 5AXDA 1KETA 1M6YA 3C1OA 4QDKA 2DKNA 3VJKA 2V7UA 2XCTB 4E5KA 3ZE6A 1Z7BA 1J9GA 4TTPA 1E62A 4I9HA 5ITSA 5CDYA 1V8BA 4HDAA 3HG7A 2HF2A 3WMXA 3NXKA 4CV3A 2DE0X 5TVKA 4LC1A 1GGHA 2GUGA 3RREA 1L4LA 3D6HA 1JQBA 4MS3A 3WLSA 1EIWA 5BQFA 1HETA 4BUJA 1F8YA 1DAPA 4KW7A 1Q7TA 3GDHA 3OIWA 2WJ3A 5J2TB 1GTSA 2B4QA 2V74B 1CRQA 3AF3A 3OJCA 4PC2A 2SKDA 2ZJ8A 2PL3A 4YTEA 2ZYHA 3TZCA 1E4VA 2H1HA 4KNWA 3MGGA 4H1HA 3WK8A 4D4LA 5JANA 4JL8A 2NMVA 1MF7A 4C04A 5CG2A 3IBSA 4XTCS 4PICA 1KO7A 4I1OA 5KYNA 2OKGA 2FXVA 1UFKA 5E9WA 3UJ3X 3C74A 3I6MA 2HD4A 3ND8A 1NVTA 4IXMA 4K7JA 5DGXA 4QREA 5ILQA 1XQ6A 2OECA 1HLPA 1QG4A 4MTCA 4KO3S 2ZB7A 4RQBA 3BTSA 4UU8A 1JT9A 3KAQA 4WCVA 3FYSA 5CTJA 3PE3A 2X3UA 4I1SA 1JSLA 1A8QA 2QMYA 3LOQA 1EK6A 3HV0A 4GW3A 3UAYA 3USZA 4EMBA 5KJFA 2B78A 4O2BB 1BROA 4PYRA 3IMCA 2XAAA 1I0ZA 3QQPA 1AK2A 5DO9A 3EVAA 1E3DA 1Z36A 1U3CA 2IQ5A 4LC9A 2B61A 4WMLA 5T3UA 4QYIB 2R97A 3RBXA 1PJTA 2J3KA 1N3IA 2BL4A 3KBOA 4XYEA 1JQEA 2WG0A 4BWVA 5HW0A 3F47A 4X95A 5LOVF 3OLVA 4BMSA 5AI0A 4IJUA 3HUDA 3OIVA 5DWVA 1L4BA 4GKKB 1JALA 1DLJA 4HDNB 421PA 2QNRA 4DSAA 1IJBA 1Q6ZA 3Q8KA 2BSQA 1GPBA 3CNQS 3IEMA 5IW8A 4GPD1 2BPOA 4X7RA 1EX9A 3GJRA 1HYEA 3FN4A 3P71T 4XXHA 3VXKA 1OLSB 1SOUA 3GVPA 3WRWA 4K8RB 4F21A 3HTXA 1F0NA 1SUAA 4BBPA 4EUFA 4J2HA 2QF7A 2Y1OA 5KWIA 3JAMA 3ICCA 2GN0A 4WZAB 3D8HA 4L4ZA 4RADA 3R5SA 1AGXA 2OHXA 4KLRA 4N7RA 4WZBB 3KAJA 2A1TR 1SKYE 3EEBA 3SEQA 1M6NA 4B6PA 2P2LA 2NSDA 3BK1A 3HS3A 4N8EA 1H0HA 4QGAA 3IPYA 4FLEA 1OAAA 4RLQA 2ERYA 4DN6A 3EG9B 4RJ2A 1KPIA 2QUHA 4Q05A 4QELA 4V24A 1BZYA 1E94E 5I7UA 4XM1A 4WLNA 3VH1A 3FUVA 4XD7D 3SHOA 1HH4A 5KAMA 1NMXA 4KACA 2D59A 4OYHA 5A06A 4RTPA 2NZ8A 3LGXA 3RADC 1GARA 4MA5A 4HUJA 1RLJA 4RZXA 3IKVA 4RJKA 2FFQA 2H7XA 2VDRB 5JSFA 1JXAA 2IEZA 3C3MA 1QFYA 3KU4A 4GUDA 1C1XA 5HG0A 1AURA 1SBYA 1G16A 1WUYA 2WPNA 4Q1VA 1ZGJA 2BEWA 4ACAA 4D6YA 2QWXA 5DEIA 4RFVA 5AQEA 1XBTA 2ZT5A 4EQZA 3HB9A 1TU0A 4KXWA 5CYFA 2E4YA 1R8YA 1UBTS 4LYEA 4XJTA 1P4SA 4OQDA 2C4NA 3RC9A 2IL1A 1NR7A 1LQ2A 3D4BA 2D5LA 2TMKA 4TGLA 3TTTA 4BFYA 1MGOA 2ZZNA 1U2DC 1Y3DE 1TK9A 4TMWA 1MNQA 1WCV1 3OZWA 3WYBA 1PGNA 4WN9B 3LK6A 3IQHX 2YXLA 1VYHA 3HKBB 4KCGA 7REQA 2H2IA 3ONVA 4DW8A 4JCOA 2PS3A 4LFAB 3M6FA 2C9CA 5KB3A 1A9XA 1SHKA 4OXRA 1YQEA 4J4TA 2Z95A 4DLBA 2CXHA 4JA2A 3GMDA 3GI1A 4UEKA 1VECA 3VI3B 5CXQA 4YCNA 1F9EA 2PUVA 3DFIA 1ZRSA 2WMOB 2R7KA 3A25A 1O97C 1SRQA 4JLBA 4BWYA 3B1VA 5A2GA 1Q95A 2A2ZA 4JOBA 1KRHA 5AKYA 1EIZA 3S3TA 3DF7A 1ISGA 1IJFA 4DT1A 3V33A 3TOZA 4F3YA 3R5XA 4W9NA 2G7MC 4KE6A 1Q44A 3OX3A 1DIGA 5L40A 1UKZA 3EXIA 4NMWA 4JI1B 3RS8A 3FVTA 3ML1A 3AERA 2WPDD 1HG0A 3HJBA 1UM9B 3EMBA 2I76A 2IYWA 3KWFA 3GAAA 1K7CA 4ZPXA 5GGXA 4YRBA 4CM6A 2A9QA 1TUBA 4M9RA 3CVJA 5THXA 1LDYA 2JEZA 4Q4CA 1FP4A 2AJLI 1U7DA 1Y82A 4HLCA 4LOAA 5BN1A 5IT5A 4JXJA 2WJIA 4QQNA 3RI3A 4QVIA 4DGQA 5JJIA 1JSCA 1JLLA 2AQKA 5JJBA 4BRZA 1EK0A 2QPOA 2RHBA 2NU9A 3IP9A 4LOKA 3HEAA 2CY0A 3OE7A 3OOSA 4YBZA 2PGXA 4XRGA 5BSGA 3RAFC 4NZYA 1QP7A 4R81A 5LDHA 3FWPA 2VTBA 5EVCA 4KHPB 2PGNA 4PC7A 2EZTA 4Z54A 2BEUB 3I1FA 3O1LA 2Z8YA 4NS1A 4OKSA 1B6GA 1HORA 2IA5A 2LCFA 3OZEA 4HQNA 1OPRA 4P36A 3HV2A 1PR5A 4MVJF 5BR7A 2R7NA 4Z2AA 3BJEA 3AM3A 3O7WA 4BE9A 1ZH0A 3KQVA 2RHOA 3PC8A 4IDOA 4PHFA 2GRAA 4PG5A 4RIIA 5JH7B 2VBIA 3OWXA 1B14A 1WABA 4B31A 5K05A 2XMRA 3N3BC 3W4IA 4CQJA 4N3BA 4EB3A 4BNYA 2P4HX 3H2KA 1XYYA 2YHSA 3R3JA 3IR7A 4ZOLA 3EEQA 5EFOA 5D51S 3EUAA 4LWPA 4ZREA 5KJEA 3RSHA 4UUAA 4MA4A 1Y6FA 2O06A 3NBXX 3UFXB 1TU3A 4H16A 1Q1QA 2G17A 2VHJA 2JFXA 1O58A 2XUDA 4FFRA 3MM4A 2Y8EA 4XSVA 1EWRA 4GI1A 1GU0A 2QSJA 4ZVSA 4AJPA 3COPA 2G83A 1PFYA 4IS3A 1IHPA 2YR0A 4DLNA 3GZNB 3E2PA 1J9ZA 1I3CA 3L1JA 4CU2A 1WB5A 5AHKA 4JLJA 1TM1E 3ZV4A 3A0RB 3W34A 3ZS9A 3TLYA 1N6IA 2ZUEA 1VL5A 3KPYA 5AJYA 5KOHA 3VR4H 2HTFA 1LDNA 3IOEA 5AT1A 1ZK2A 1BQEA 1Y5NA 2HCBA 3IMKA 3QOFA 3F98A 3X1JA 4AMBA 5I4BA 5J4LA 5LP6B 3N2KB 3P0IA 2FSVC 1WM1A 4GI2A 5BQ3A 1U65A 1NXOA 3DHYA 3N2ZB 1ACMA 3NTXA 4HWRA 3QLUA 3V42A 2VZ8A 5I01A 1CZUA 4OHCA 5JE8A 2NQ2C 1JIKA 1MZPA 3ZOZA 3I9MA 3KKNA 2QM3A 5EJAA 1VIVA 1SUWA 3QE2A 4FYVA 4DWWA 1XA4A 4OQZA 1XTRA 3AR6A 3F7NA 4O6VA 2I4TA 4QUHA 4B45A 3K70B 2KE5A 2OFFA 2WHYA 3QKTA 1R8SA 3REGA 1R37A 4NK4A 1J2TA 1JHVA 1X14A 5FP0A 2A9KA 1XQYA 2GR9A 2CCKA 3E03A 4ZT6A 5C37A 4BGEA 3TQCA 2GPYA 3IURA 1OX4A 3P2IA 3UKJA 1P17A 1XZMA 1RRGA 5CVJA 1GZ6A 2N1BA 2OGTA 3AZPA 3NUGA 4G4SO 3VX3A 5TGDA 4MLPA 1HYGA 2ZJZA 1R0ZA 4C6SA 4ZTBA 2QYTA 3JVEA 1MOPA 4FFDA 4EHAA 4Y6GB 2TRSB 1DMSA 4BL5A 2JAXA 2XUOA 1VRWA 5DYWA 1XNJA 2CLEB 3CINA 1LDEA 2XPCA 1HZZA 4XGQA 3ZYCA 1TRHA 3UGQA 3VSBA 3CVWA 1QANA 4KJXA 1XMQB 1EM8B 5KU7A 2IK8A 1KOLA 4R68A 5EIOA 3ZWQA 3F6SA 1DRKA 3GN2A 3DV2A 1C7JA 3QBEA 2WTXA 2HFKA 1IM2A 1IATA 3BXEA 3GUZA 1UIRA 3JS5A 1FX0B 3BKWA 2I7TA 4ND2A 3ZE7A 4DMGA 1I7QB 1N0IA 2XRMA 4QUIA 2Y6UA 4TKUA 521PA 4DQDA 3T7SA 4EGQA 4HLQB 3G2NA 2YN2A 2WIDA 1BAPA 2O7NA 4KAAA 4NARA 1M6EX 3OTWA 3T1NA 1GU7A 4KO2S 4F5DA 4XWOA 1FJGB 5JPCA 3DCYA 4HNGA 2P7IA 4U2DA 4P38A 2XBUA 4K5QA 3U3MA 3ZE9A 4FHFA 2WQ6A 1GPDG 3NVDA 1G7CA 2WTAA 4Q9HA 4XVUA 2ZXEA 3B9BA 3RS3A 1CQWA 1QIEA 3RRBA 2WT8A 3IUNA 1E4EB 2R4QA 2RAUA 2BJWA 3G49A 3AV3A 1LTQA 4V0NA 2FWNA 2RC5A 4AUKA 4ID3A 4CMEC 4CEHB 3ZLTA 2JK1A 4N8DA 1J5PA 1FZTA 4MQ6A 3M6UA 2HMYB 3I9FA 3DW1X 1K6XA 3GZ4A 5DTIA 3ZIAD 2JIMA 4ZGGA 4RS4A 5KAPA 4EVIA 2GAAA 2ODTX 4G8BA 4ZYWA 1VZ2A 1M6VB 4OTZA 2PUJA 2FE1A 3GN1A 1T1IA 1TUIA 2PZJA 1U8AA 3ZJ4A 2W71A 4RNDB 3K9NA 2ZT8A 1J8FA 3B3AA 1Z38A 3ZTTA 1P5ZB 3C98A 1BH2A 3MERA 1CUVA 5C80A 1YQUA 1N78A 3TQHA 3G2HA 3HA2A 4P31A 4H4CA 1GLVA 2QTLA 3IKJA 1Y8RB 2C4KA 1BOOA 1K66A 2ORED 3BHJA 3T7DA 3GPCA 4GKJB 5ERXA 1MHPA 4KNYA 1UZMA 2WIJA 2LPMA 2DHDA 3BDAA 2V7QD 2EFEB 3NJ4A 3WNZA 2R8BA 5DBOA 1T15A 1Q83A 5BYJA 2BVNA 1XMOB 3ZS8A 2WTMA 4PX3A 3KFVA 2R87A 4FZVA 4JKYA 4UOZA 3D0KA 5G4KA 5FO0A 5C1IA 4W8OA 1ZMBA 3SM3A 1SXJB 4LXUA 1M33A 3G89A 3N2GA 4LWZA 4LVNA 3W7BA 2GEFA 2H2FA 3NBQA 5JZOA 3WFIA 4FE3A 4E4RA 1CQZA 5AKJA 1PJAA 3CZ4A 1Z8HA 2FLWA 1V8PA 1SZJG 2O2ZA 1WBDA 3WY9A 1UMKA 1XQVA 2RE8A 1NE2A 3R3VA 1GFIA 1HYQA 4BBJA 2CXPA 3MB5A 3AVOA 1DDGA 1E1CB 4CT5A 1M2FA 1XQXA 3KSDO 1NATA 3I3SR 3WYFA 5T67A 3O73A 3PPWA 1M2EA 4KQJA 3G5MA 4TKVB 1KQOA 1IUKA 1W76A 3MS2A 1ISJA 2GFIA 1M75A 3CZ5A 3M83A 4FZRA 4GPTA 3EXHC 3I34X 4WXYB 1ZMOA 3FCAA 4F6CA 4QARA 4WT7A 2PK3A 4RTNA 2LCIA 3V9AA 1ANKA 2WV7A 4CNBA 1ZHOA 2JZOA 3LHDA 4FMCB 4QWMA 4C2AA 1W4AA 5DGTA 2G1UA 3HXTA 4PINA 4RIGA 3DE7X 5BNZA 3AP1A 5E0KB 6REQA 2VAXA 1CRPA 5E0OA 1DELA 4TRMA 5EVJA 2FP3A 5GONF 2XCSB 1OXVA 1YE8A 4IDNA 4PC1A 4JYBA 4QBFA 5TS2A 4N03A 1ZK4A 2OYSA 4KIJA 3SX0A 4E30A 1SQSA 2CLOB 2WTBA 2XTAA 4HGOA 5TQJA 4G89A 3X2SA 4HGNA 2QI9C 1M54A 1GFSA 2I1QA 1DC5A 1SC1A 1C4XA 1JG1A 1V1RB 2MYPA 3SN6A 5KSWB 2EKBA 2P5YA 4MYUA 5BO5A 1CRWG 2I4NA 1IMJA 1WMEA 1OROA 2HJRA 4FWBA 3H4VA 3GGPA 2P27A 2Z9BA 3ET4A 2EP7A 1C2YA 4PN3A 1OWLA 2ZYTX 4ZDKA 4HWGA 2IBTA 4C4XA 1GPNA 3GLGE 4TQAA 4NWIA 1EP1B 3AHJA 3BG5A 3MMZA 4FXOA 3BZBA 1F8GA 1C80A 3K2BA 3VTFA 4X61A 4M54A 3ZHXA 3DUWA 3EB9A 4GE3A 1PHRA 4PCLA 3CLHA 3KT3A 1XCPA 1IHXA 4LSWA 3THSA 1R0RE 1ZKMA 3U7EB 3O74A 3NPAA 4F1JA 2C0CA 2CSUA 3V2GA 4LHYA 2CJXA 5AIBA 4L76A 1FYWA 5JCXA 2G9NA 1PLKA 1ENYA 4L9SA 2ATCA 4I9NA 2JJ2D 4CLHA 4DPLA 1RM4A 3SD7A 5HZKA 4B71A 4YMIA 4K46A 2ROQA 2OORA 3K0AA 2QRVA 3B1KA 4YCSA 1C0EA 1F4VA 1M8PA 3MTAA 3DS8A 1Y1KE 2XWPA 5DP1A 1DADA 3URKA 2Y0DA 2VHTA 4EFMA 4CDRA 2GPSA 1KA9H 5FV7A 3G1TA 1KJWA 1MPTA 1YB6A 4HFJA 1PF7E 3FYUB 4WA8A 1CUEA 1HDXA 3A14A 5J63A 4GP7A 3LC2O 4HYTA 3MCZA 3VNSA 4DR4B 2FZLA 4MZDA 2QTGA 1YNOA 4RAOA 4V03A 1JAIA 1OMOA 4BQSA 4OAQA 6LDHA 3PVCA 1Z33A 4TX1A 3OA0A 5IN4A 4MKXA 4I9UA 1G291 4A6XA 2ZSFA 4ENPA 3I64A 2REBA 3A7EA 1BEEA 1F0KA 3E5NA 4L78A 3B8HA 3KETA 1JFRA 4XIGS 5BVGA 1ZH2A 1HQCA 2HNBA 1ZZGA 3B6EA 3D3KA 4JBXA 3KG2A 16PKA 5T4HA 4G0WA 1RC0A 3ZVRA 5M3BA 3C1AA 3U7IA 1G3UA 2GEBA 3VUEA 4B3IA 1XI2A 1J1UA 5DYGA 4AZ3B 2CW5A 3LW7A 2WB2A 2XF2A 3R1IA 3CT4A 3P94A 4TV8B 1LBQA 1AKVA 1E7QA 4YFVA 1DQZA 1FTGA 4R1SA 5DRTA 5ELMA 4HKTA 5EXPA 3OCVA 3W0LB 1B43A 5JSZA 1G59A 1U2GC 5IK2D 5HE9A 2MMGA 2CHVA 3NWJA 5DWDA 3GJ4A 1FCJA 3CUEF 1OTYA 4EEXA 4EGAA 3HDHA 4Q3LA 1GNLA 1EYZA 3HM9A 1HDYA 3EPKA 1QF6A 1E1QD 1TQHA 3DV0B 3PWSA 4GWGA 2O5RA 2AIRA 2YC4C 2PKQP 3GT4A 1M2VB 4G07A 2IPLA 4YV0A 4I4TB 4IH4A 4LMAA 5HSGA 1YIOA 4CM4A 2ZXFA 1JAXA 3G23A 5BSRA 1I30A 1KI3A 3D6FA 1OZGA 2VTVA 2IYFA 3GZTB 4ENTA 2GM3A 5PNTA 3AESB 2QROA 4B76A 3UGJA 2P9GA 1I7PA 3AKCA 2YH2A 3REOA 3UC9A 2P30A 4MWTA 3WYAA 3OJ0A 2RHDA 3RAJA 1PLLA 2DECA 1N9ZA 2W6IA 5I7RA 2HCJB 2IYPA 1KAHA 3MLAA 2ZVPX 4U3JA 3I9KA 3AJEA 4B6FA 5DH9A 1KY3A 3ZW9A 4BNHA 1Q5PA 3BGVA 1JEYA 3H1PA 2AN1A 3QU2A 4LHXA 1UR5A 4HG2A 1H2EA 5ITZB 5E1MA 4EK9A 1R0WA 2ATIA 2QVYX 3ZWOA 5HR5A 4HDMB 4Y2JA 5BSFA 2E21A 4BEWA 2IPAB 1U2SA 1Q21A 1J39A 2R7AA 3E4CA 4FQ7A 4QVKA 5CA0A 3FLEA 3ZW7A 4ETWA 2Q1SA 1S3GA 4QA9A 3GT3A 3DBLA 3S1SA 2V8BA 4URFA 4HZUA 5JZBA 2CMGA 4CQNA 4KQXA 5JC8A 5LNK6 1HG1A 1UMDB 4DR2B 1G9SA 4QOSA 2QXUA 3WRYA 4L02A 1HNXB 1IOZA 3OM9A 2VLIA 4NNOA 4IJ6A 5ESRA 2X8AA 1DBWA 4P84A 1OFTA 5EWMA 1YGYA 1U6KA 2ZI5A 4LJKA 4KDEA 3TEJA 3ETCA 1QFZA 4LRYA 1QRUA 5JSKA 5BNFA 1MDFA 2EHDA 4MEBA 3H5LA 3H0CA 1KU6A 1PX0A 3PUKA 2NO7A 1P4HA 3DQPA 3HVHA 3P8ZA 4MW2A 5JT1A 3GRYA 2D4AA 3I2GA 1F48A 1UZLA 3LX6A 4U7JA 5AKEA 2AWOA 4LRXA 2R6AA 5K51A 4RV4A 4YRPA 4B4UA 1GQFA 4FP9A 3A3PA 3ZUPA 1L4NA 2PX8A 4FMPA 3N87A 1EP2B 3AI1A 2Q4RA 1TCCA 1ZRHA 1WB6A 3QX8A 4X7PA 5F7ZA 1JTFA 1HKHA 4L4SA 2X6RA 1QO9A 2NAPA 1KJIA 3AHEA 5CW1A 3SYTA 4CIVA 1Q1BA 1F2DA 1F7VA 2BI8A 3CIFA 3GLVA 1T6ZA 1VCMA 2FGKA 3PQFA 4Q4HB 4FT4A 4EI9A 3KVRA 1C9EA 3KOXA 4E07A 5CA1A 1QHSA 5D85A 3UAGA 3AVPA 1ZN9A 3FWHA 1A8IA 1RBYA 3QBVA 1Q12A 1J24A 3HCCA 1W4RA 4H6XA 4YMSA 1JBKA 3H4TA 2VPQA 3LYAA 3PZRA 4LE1A 4YWHA 4R31A 2QTBA 3FJYA 2YWGA 2OXRA 2Z9CA 1Z13A 2RB4A 3R0QA 4HQOA 4CL3A 1DIRA 4EVSA 3IUQA 3LKVA 3EGCA 4WW0A 2JKZA 3ND5A 2PD3A 4IR7A 3RUAA 1P73A 1B1AA 3ZCVA 3UJBA 3A28A 1AMUA 1KK3A 1T3TA 2V7WA 3QY0A 2VL7A 4HUQB 3K2IA 1CJMA 1AHPA 3M0EA 3PC6A 1PFKA 4O63O 5CURA 4Q02A 5K3BA 4BMVA 2WZDA 4M0KA 3N7TA 5CDUA 3ZHYA 2CUNA 2QTWB 2LD4A 1V7QA 1F6BA 3ERCA 2E4VA 4QFCA 2ZE7A 4QJ4A 1Z88A 1DP4A 3IBGA 4W99A 1B23P 3CISA 2NX2A 4MCJA 4B4KA 4YRIA 2O2CA 1PFWA 1DMRA 2WILA 3BOSA 1ZUIA 3LVQE 5I9TA 4CMBA 4K9SA 2Q6TA 2JIRA 1F2UA 5LDGA 4DLPA 1IZ0A 3M6AA 4MYHA 4TT8A 3TBKA 5JJLA 3BFXA 1XTIA 2YS6A 4IMRA 3U0BA 4FFBA 3H2YA 5JQGA 3JTEA 3KJQA 3QXSA 4PW0A 3VDRA 2YNMA 2GRUA 1M1ZA 4FBGA 4DVGA 1FRQA 1PE0A 5D5QA 1NZDA 4PG6A 2LZ0A 4PFQA 2ZPTX 3S55A 5BWCA 3IULA 2QV7A 5A0VA 4I5IA 4MKGA 3UT5A 2REXB 3U7FB 1Y3AA 5LA6B 2TMDA 3FR8A 1FS4A 5AK3A 3K9LA 3KTDA 5LPNA 2V7EA 1OKKA 1GR1A 2MINA 1NQVA 4LEIA 4PG4A 3U7JA 2BTEA 3DDCA 2CHQA 4C7XA 3CF4A 3RJTA 1KDOA 2CF5A 1KBOA 5KYGA 2Q27A 4MJXA 5KNCA 1FFCA 1CNFA 2EC5A 3MYYA 1JB9A 3WK6A 4GXRA 4DMLA 4CGZA 2N75A 5A6VA 2PCLA 4DNOA 4OYYA 5D84A 3RS5A 3VR6A 2WWHA 4LF4B 4AMUA 4N6GA 4YI5A 1LLUA 2WMYA 4ZT7A 5C8YB 2XRFA 4AZ0B 4HDRB 2HLDD 4RWZA 4O4HF 5IF9A 2V6GA 5C1PA 5DASA 4U00A 1DXYA 1Q20A 3K53A 4LZZA 1KI6B 3HO1A 1MEJA 1RYYA 2GNAA 4I5DA 1KERA 3LRXA 4MUAA 4P3NA 1WB4A 2N9UA 2P1DA 3HDTA 1KEEA 3DF9A 3V4ZA 3QNMA 4YYEA 4YGXB 1VQ1A 3G7SA 1CTQA 5K5EA 1TZKA 2XNDA 3V55A 1GG2A 1LSOA 3AEQB 4S1PA 5CCDA 5IJXA 1V43A 5LXTA 1I3OA 4LBWA 3JYQA 5TPZA 3WRVA 4ECEA 1YU9A 3TNYA 2XGOA 2X14A 4OREX 3MWDB 4QHYA 3LF2A 5DRYA 1HM5A 4ZEOA 4ALNA 5JUWA 1NHWA 1XPJA 4Q3OA 1FX1A 4M87A 1NT4A 2A0KA 1E2QA 1FBNA 2C5LA 4V3CA 2ZAMA 4NXMB 1V5GA 1G6Q1 3KPUA 5E3IA 5HQJA 4CKCA 4CVNA 2O7VA 2Z9DA 2HTEA 3AHHA 2ZJ3A 1E8DA 3QPWA 5CPFA 3BL8A 4HMQA 3TDKA 2CHUA 2EYUA 4LSZA 2NQ8A 2A9VA 4INPA 1R64A 1FS5A 3B1YA 4WNAB 2RHWA 5CP8A 2V97A 1U3UA 1NKVA 4RVHA 2VBCA 4BO9A 2DYKA 4C0HA 4LNHA 1G8KA 3PXDA 1J8QA 3LUFA 1EFVA 2BZGA 2I4OA 1KI8A 2V3VA 2QMUA 3F6PA 4KSYA 1YDWA 1N8KA 3PE6A 3R7FA 3RVPA 3MCUA 2P5UA 1TAUA 1NTRA 2IZ5A 4Q9KA 3N2YA 2QN1A 5D3KA 3BQ9A 1XEXB 2D2FA 2PZ8A 1Y42X 1Z0JA 4HQ0A 4A26A 1VRCA 5LQKA 1NLMA 1JR6A 4YT5A 2IW1A 1VA4A 4RPIA 2YVLA 2XT6A 1G17A 2XXAA 3O9VA 4LDAA 2P9BA 2GCNA 1Z8FA 4MWGA 1QP0A 1FMFA 1U1EA 2UYQA 1MRSA 3CZMA 3SZUA 5JAOA 3CLRD 3WAGA 3A2LA 1IZ7A 2O23A 1AGRA 5IAAA 3IKTA 1G8YA 4P53A 3AXSA 3S1AA 4EO4A 1HFEL 2FZ4A 4LJ5A 4MQUA 5EL0A 2GERA 4YRAA 5JSHA 1BSVA 4URZR 2AFIA 2O8DB 3WKCA 3HXLA 1AMNA 3TQIA 2YJNA 3JRNA 3PDHA 3LVBA 2FMUA 2FUCA 1XLUA 3HC7A 3WGZA 4AF8A 4BDTA 5CFPA 3GLFE 2FPLA 2ZREA 2IEDA 3VPBA 1E96A 1TTTA 3DZBA 3RRJA 4POOA 5I9NA 4GUAA 4OB6A 2FPGB 3B13B 3V4FA 3OCCA 4R8RA 4WDRA 3WDLA 3GB9A 5IUKC 3EF1A 4X1IA 2GSWA 3OFKA 2MCFA 3FJ1A 2A7XA 3ETHA 1QBGA 4F11A 4EW6A 1QVVA 5SY6A 5HKKA 2JAWA 4G0NA 1T6NA 4TUYF 3T61A 1H23A 2H2HA 4H18A 1IMOA 3WLRA 4CQLB 4NV0A 1FMJA 2GGSA 1G7TA 4N9WA 4RX1A 5EZ6B 2PRYA 5BOSA 2HO4A 4IIEA 1C3LA 4QATA 1AHIA 5KO2A 3GRKA 3MT9A 3TJZA 1E1NA 1MUUA 3IEKA 2B8JA 1F2VA 3H11A 3NFRA 1XVVA 1PKEA 2JGDA 4RHUA 4DCNA 3L0DA 1TF2A 1W46A 5D1NA 4YROA 4C4AA 4PO8A 1XB2A 5UKDA 3RSQA 3IP5A 4BNLA 2OQVA 1GQSA 1TZ2A 4M7RA 1M1NA 1MQ8B 5DJ5A 2NU6A 4GWKA 2WHPB 3FMGA 1B8VA 4HH4A 4J8PA 1P7ZA 1BVYF 1T2NA 2V9PA 3BWBA 3SSAA 1NI4B 3S44A 2WZQA 3IBYA 3EGWA 4L0DA 3PD1A 4PLVA 1AH2A 4FCWA 1JEAA 2Z08A 1LCIA 3L43A 3SR0A 2XTZA 1V8OA 4BNJA 5KIAA 1EFHA 5KQMA 2P4QA 2F1KA 3PX2A 2WUFA 4MVJH 5NLLA 4O2AB 3IUPA 2AE1A 3SSNA 4XLLA 2HPVA 3ZCTA 3KVOA 4RY8A 1QRRA 3PX3A 1NUPA 1U11A 3QX9A 2PGAA 3NTRA 4X8HA 3EAQA 5KPJA 3ZGOA 3FDFA 2JCVA 5CEJA 1NQXA 3AVUA 3UJ8A 1O5IA 5HMLA 3ESDA 4RH1A 4GOOD 1Z2AA 3HYNA 3MWJA 2H5IA 3D4LA 2EP5A 2RSLA 2Y1CA 4FHCA 1B15A 3JAKA 4PR0A 5K0NA 3UW3A 4G5GA 3QPDA 3Q15C 3TLGA 4DLVA 2W2MA 5A03A 1L1QA 1SXPA 3GEGA 1JA0A 2V4MA 4JLWA 1Y7IA 5JAIA 4KH1A 2H5EA 4JLPA 2HHJA 1Y5RA 2YCLA 2C31A 3FOWA 1AT1A 4JYAB 4D4KA 3H17A 1WZCA 4CIWA 3DTVB 1CR2A 4FBMA 4D74A 4B44A 2ATXA 3RM3A 5HX7A 1CU1A 4BZWA 1TYCA 1YKSA 2FHSA 5CNKA 3L6CA 4W63A 4ZCRA 4A2CA 4MWSA 3UMGA 3FSGA 3L41A 1A9QA 3CC8A 4HY3A 2XDWA 4JH0A 1RAEA 2Q1UA 2C04A 2VF2A 5K6AC 2GWRA 3FPKA 3STHA 1VJGA 2DHQA 4IIHA 4I3HA 5FV4A 3THWA 2XA2A 2RI1A 3ORRA 5G40A 1L3CA 2P6PA 3I0NA 4KQFA 3I9LA 4NMMA 3S28A 2IUYA 2N47A 5DDIP 2PGIA 3FBWA 4O2RA 3ODPA 3N0VA 3LXXA 5U1PA 1IE3A 4KOEC 3A27A 1S2MA 3AKEA 2MIIA 3N74A 5IBCA 5KTSA 2HU5A 2O1WA 1B6SA 5J1SB 4EUNA 4BKRA 1IBSA 1XNQB 1BFUA 4UNPA 1J9EA 1OA1A 3CRRA 3OEEA 3PTAA 4EKNB 1R4NB 4X84A 4MW0A 3EPJA 1Y37A 2JJMA 4N40A 3KZOA 4DABA 3MJCA 2P9TA 5DBGA 4EW3A 1YNSA 2WJAA 4HVLA 1T2FA 2LIPA 3D8TA 1VL1A 2VBFA 3ES9A 3O8QA 3QLTA 5EN4A 2SICE 4DQVA 1YVDA 4XDHA 3R41A 3MBOA 3SZRA 1N2CB 1CULC 4JMPA 5JY1A 1KEWA 2ACVA 1U2RA 3KO8A 5B1SA 1IBLB 4LGMA 4E51A 5C18A 1IIBA 4PHHA 5L3SA 5B3AA 3E0QA 5AHOA 5BR8B 1U1DA 1OCEA 1P9WA 5JDCA 1KMHA 3TAXA 1W1UA 2X0EA 4IYRA 5EGNA 3MTEA 5JZMA 2EW8A 2F7SA 4EW1A 4QOEA 1OGIA 1E9EA 2SKEA 3EDCA 2WJYA 5J58A 2AUNA 2Q3LA 2HA5A 2NYVA 4WCFC 3PCRB 1MHTA 4IAOA 4FMBB 1U28A 1OGJA 4RF3A 1FTWA 3QYPA 1JDTA 1PEDA 2SCUA 4U0JA 2OBNA 3OPYI 1QQTA 4OJKA 2FWMX 3WMFA 4I8IA 4BP1A 3EG5A 1VB5A 5I9LA 4HATA 3RNOA 4XH9B 2BR4A 2WDZA 2FW1A 5CITA 1Q57A 1NUTA 2AOXA 3MCVA 3RS9A 3HPRA 1CVLA 3K09A 2ASEA 2AGVA 3IDAA 4CM8A 1BJKA 3W2GA 1RLMA 4JR2A 4AL4A 2YOHA 3NYQA 3NJRA 4QEZA 4MB0A 2WSSA 3INTA 1T2EA 3SYNA 1SCBA 2QUBA 1B00A 5CRIA 1TTHA 2BMVA 4F2PA 4F4DA 4DNXA 4DDKA 4LF7B 1RZUA 1BHSA 3HJHA 1ZUHA 1VI6A 4FR2A 5IULC 2GEKA 4PLTA 2OBXA 4EAQA 1XRNA 1Y4UA 2BFFA 1AB5A 1H69A 3N0TA 3OSZA 1KRWA 2OFWA 1Z35A 4LMRA 1MXFA 3W8DA 2FG7C 1USKA 2QW1A 3H1EA 4TVSA 5BR1A 3GLIB 1XRSB 4MR8A 4Q5IA 1RWWA 4L9WA 3DB1A 2O2XA 4G0YA 2R8ZA 3A9TA 4KGDA 3WX0A 1EDZA 3IJPA 4XJSA 4I8XA 5KJ1A 2Q5CA 1VKJA 2CE7A 3ZI4A 2FG6C 4IVRA 4Q3EA 1NSTA 4TWZA 4D6XA 3U7GA 3CA8A 4JX8A 3MWLA 1ULHA 2O8CA 4PHTA 1TGVA 1T1RA 2QQFA 3DZFA 3JAWA 4WFKA 1ORRA 5F9MA 4AS3A 4AULA 1E63A 3PS9A 3P2KA 4GMXA 1LBTA 2RGWA 4ZQEA 4EUEA 5IDQA 5AVZA 4PXYA 1JU3A 1GILA 1NGSA 4Z4EA 4RWEA 1GZ4A 5LU8A 3A1VA 3HJNA 5I7WA 2VEDA 3IE1A 4XZ3A 4P54A 1PLJA 4XWWA 5A0FA 4URVR 1XJQA 1YO6A 4UAVA 3VPHA 2FR0A 2GBFA 3EZXA 3HNRA 3HVKA 3I1YA 1TL7C 5FFFA 5CD9A 5K8TA 4JMLA 3KJGA 1ZNZA 2PSDA 2DFLA 1QQ6A 3I5UA 3RSZA 3T34A 4BGDA 1PAUA 1V48A 2CV0A 4X66B 3SQNA 1RRPA 2C95A 4QWWA 3R3HA 1Y3BE 2E7ZA 3WIUA 2AKEA 1Q14A 3ECSA 1S01A 1ZIOA 2E3JA 3ELDA 4M0LA 4C3OB 2I4LA 2O6HA 5B6JA 4PLCA 1UKYA 3LD9A 4P83A 1JU4A 4XLTA 4J0JA 4TZTA 1MC1A 1B8UA 1QO0A 1BWPA 1DV1A 4XFJA 4RVCA 2Y2VA 5DTQA 1X1SA 5EPEA 2Q4DA 3EHEA 4Q12A 5J40A 3IB3A 4JZKA 2R65A 4QLAA 4HLDA 1NUSA 1RE0A 2CEKA 4G2TA 3NFYA 4G9GA 2D5CA 3KHTA 4OHMA 3UUEA 2FOLA 1A77A 1TD1A 3AOGA 3T8YA 4RFSA 3F8WA 3QUTA 4RLFA 1KYVA 3DVRX 4X90A 1Y6ZA 1M2OA 1SHLA 3VZRA 1QRTA 1EFPB 1UBNA 1BD4A 4GLLA 1KIMA 3B48A 4PSKA 4BMDA 4CMIA 1G6OA 3FOEC 4R8VA 2P4UA 1J1IA 2O6LA 2BD0A 1QVRA 4LUCA 4YEDA 1AQ6A 1DBPA 2DFPA 2X22A 3A9WA 1I7DA 4LQ4A 4RVNA 5AVQA 2WWIA 1A9TA 1J8VA 4NBSA 1ZXLA 1ZONA 2JFFA 4CTOA 1IJKA 2X19A 2Z3VA 5DZSA 4A0HA 5FUMA 1E2HA 5D7BA 4AM8A 4EG7A 3AI7A 3E6AA 3NVAA 1RQRA 1I13A 3AR2A 4MPDA 2GAFA 3SYRA 5HOQA 1IQRA 1U6JA 1PG5A 2MU1A 1H1LB 4Q24A 4LVCA 5CFNA 3OZAA 3U7QA 2C99A 4OSPA 4YMLA 4IXNA 4P86A 4WXEA 5GM1A 4BNGA 4J1TA 2G80A 3RVKA 2PT9A 2UYCA 3DFZA 2PLAA 1J00A 4IGFA 2AJTA 2QLNA 4Y2XA 1V16B 5I9IA 4BMZA 1DOHA 2GZ2A 3HJTA 1R15A 1FVHA 4MUBA 4RJJA 4Q82A 4IF6A 5FTWA 3VR2A 5KHLB 1WA5A 1ZVMA 2OHFA 4F5YA 1JQJC 3S2YA 4BO6A 2JGAA 2IPXA 4PHCA 4I1IA 2HRRA 4QT0A 3SHQA 5I3ZA 5CEFA 3NVKI 2H29A 1R12A 1QH1A 2F90A 3W8FA 5JBIA 2ZIEA 3PVZA 3DE3X 5L4NA 5AJVB 2PXXA 1VJ0A 1IJEA 3E2MA 3M1LA 5ED0A 4ZCLA 3QOYA 1ZGAA 3VKWA 5EUCA 2PO5A 5HF5A 2ZAGA 4XVQA 3VA7A 1BDJA 1JG2A 4ZZIA 5JEDA 2C88A 4B2IA 1WDTA 4OGWA 1RWKA 4QQKA 2RB5A 4DLAA 4ZI7B 2XYRA 1EEXB 4FFSA 2FMFA 1Z26A 4AKHA 1YQGA 3I6YA 4DR6B 1SUPA 2FSUA 2PO7A 4KLZA 4DQXA 4BEVA 1EVIA 4ZO6A 4WLFA 2DM6A 5EHNA 4IJ5A 4II3A 1NQTA 2BT4A 1JI0A 4RCYA 4X64B 1IXZA 4NBWA 2EARA 1Z0IA 2G77B 2F3PA 4FKBA 4LY6A 1ZSYA 1Z18A 2WJ4A 3WYCA 2IH4A 3SEFA 1Z74A 2YWEA 1NC3A 2W6ID 3IAM6 3LNCA 2JFYA 4QPJC 3SE0A 3B2QA 3SQMA 2IOYA 3EE6A 1WXWA 5FJJA 5BW8A 4P8RA 4GRAA 1USWA 3E5RA 3S2ZA 3QITA 4GQAA 2E49A 5DI9A 2I80A 2UZ4A 4ZRMA 2HOQA 4REMA 1VIYA 1RQPA 3LKDA 4DZRA 3RKRA 4JBNA 2VZ0A 3UUGA 3ZD8A 2X86A 2XUJA 3TLKA 1J2YA 1R8JA 1TM7E 4RTRA 1L9XA 1JLKA 1FBTA 1G5RA 4P4NA 5EMMA 4BNNA 4EGJA 5LQAA 1VHWA 2J9FA 4ARVA 2D00A 3IAS1 1ORIA 2IW3A 5ALEA 2EAUA 3AEKB 3ZY5A 5JCOA 3F3KA 4MGIR 1B2RA 1XZIA 2OCYC 5JLAA 1ZYUA 5TMDA 4D4GA 5JBNA 1KP9A 3HY4A 3W06A 2CHFA 2V7VA 3QVLA 4G65A 2VHWA 5CH5A 5T64A 4OI1A 1MG5A 2R7LA 3EN0A 1F20A 3RC2A 2LNDA 1UZNA 2Q3JA 2D0OB 2IKSA 3GBSA 4CKYA 3ZJVA 5GM2A 2WKQA 3W05A 3BZUA 3DC2A 3DE5X 3R7WB 2FAXA 4PSCA 4WH0A 3B20A 1H65A 1LDBA 1JDBB 1N5MA 2GM4A 3QU7A 5ER6A 1PTJC 4UQOA 4JI2B 1NM5C 1YL6A 5AJTA 3I52A 5ALRA 1E6KA 4PLZA 3K0CC 4WBNA 4D9CA 5EIFA 5E6RB 1EKXA 3TTUA 3PTLA 1H2YA 1X8LA 1ONNA 2A1UB 4IMJB 2PZMA 1H0RA 3H2ZA 4NHOA 4RZHA 4YMWA 4EMUA 1J2UA 3C7TA 4MMYB 3CNEA 5CVVA 5LSAA 4QASA 1DBIA 3FDIA 3NKFA 5D8DA 4G8CA 4JSRA 3QQ5A 5AVXA 3SBXA 1TO6A 2IZOA 1IEVA 2GAJA 3K72B 1CG6A 1JI3A 2NTYC 5C0OE 1RM3A 4KR0A 3EODA 3HUFA 4FB5A 2IYXA 2P2YA 1ZAYA 2HDNB 3M1IA 3OJLA 4BZQA 4DXDA 4P3XA 1G2PA 1B0PA 3B6KA 3BD8A 2VOEA 4G5QA 3SR3A 4U63A 5FOUA 2VF5X 2YRWA 3ZZNA 3G82C 3DMYA 3GFSA 4GGOA 4EA6A 1WTAA 5ADVA 4BEBA 3RANA 2WZBA 2EG5A 1K8ZB 1QV9A 2BGRA 1M0EA 1TF7A 4YO7A 3W3AH 4RMGA 4QAJA 4CR6A 1U8FO 2G3YA 1DSSG 5TMPA 3HVUA 3NDBB 1FPMA 4DIDA 4EJFA 3R6GA 4U2GA 2O5CA 2EL9A 3KNZA 1W19A 4RIEA 5KYXB 2A67A 1WKCA 3FKQA 3KR1A 2A5JA 5AO9A 1VLZA 2LCQA 1BNCA 3OT5A 2DWUA 3FUXA 4N5DA 4Q4DA 2BFCA 2YNMD 4W1PA 3N8IA 3GJXC 1Z63A 3TD2A 4NBTA 2CKMA 4DS3A 2C42A 3B82A 4C3ZA 1L7BA 1OBFO 4W5WA 4B35A 1LNQA 5G0UA 2DETA 3GJQA 4KZKA 1ML4A 1B1CA 3DD5A 1RFLA 5FBRB 2Q5IA 1UBEA 3CZPA 2O0HA 1OKKD 2GAIA 2X2OA 5DYNA 3RS7A 5BURA 1DE0A 4CLDA 2YZGA 4U8GA 1AKQA 1AQUA 2IY9A 3C39A 2AI1A 2I8AA 4UVHA 4B7CA 4TZ6A 2FX2A 5BMVB 4M1TA 4MVJP 4CFSA 4KDRA 2AJBA 3UAXA 1QZXA 3E22A 2QL9A 3COVA 3DT6A 3T7JA 4CMAA 4DBLC 4I5EA 5CA0F 3ZWAA 4CKWB 4F04A 1JHYA 4YH1A 3K3PA 1ZBDA 2BFEB 4INAA 4GR9A 5REQA 4BN4A 3VR6D 2AW3A 1QZUA 5LYJB 1NLZA 2DX7A 1BDMA 3IXLA 1ZD8A 3VOBA 2DCUA 4BLVA 3AVWA 4WJKB 1OIVA 1T8RA 3OOJA 2QD4A 3W8RA 3TZ6A 3H04A 1G9TA 1BHQ1 3VSCA 1KY2A 3PFNA 4TRNA 4HH3C 3GK3A 3IJ5A 4ASUD 1EVZA 1NJGA 2G7ZA 3FVVA 3RHZA 1HDOA