2RSLA

Refinement of gamma delta resolvase reveals a strikingly flexible molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
115
Chain Sequence
b'MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA DELTA-RESOLVASE
publication title Refinement of gamma delta resolvase reveals a strikingly flexible molecule.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
total genus 42
structure length 115
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rslA00
3G13A 1GDTA 2RSLA 3UJ3X 1GHTA 3LHKA 1HX7A 1ZR2A 5C35A 4BQQA 3GUVA 2GM5A 2MHCA 2GM4A 3ILXA 3BVPA 2R0QC 5C34B 3LHFA 1ZR4A 3PKZA 5C31A 5C32A
chains in the Genus database with same CATH superfamily
4QOGA 3EXAA 4YP6A 1MT3A 4BEWA 2BFDA 4NZ9A 5JS2A 3C8HA 2FQQA 3AILA 2P9ZA 5B7GA 1JDSA 1TYDE 2D7CA 1RC0A 4HNSA 4N39A 5B36A 4I4TF 4WLOA 3M9XA 1C81A 3LAWA 2HF7A 4YAKA 5JWRA 4E33A 4BTEA 3O4IA 4N7MA 4TLLB 1M1YE 3VTZA 2M1ZA 5ALOA 4DUPA 1MX9A 2AZMA 2XNDA 2ID4A 2QLFA 3AF4A 3K4PA 3RARA 1J42A 4RZQA 3OD1A 4E22A 1YBMA 4BRZA 1U0GA 3SSOA 1OBHA 2Y1GA 3B48A 2OXTA 3AP1A 1HV8A 1RWQA 2ZAMA 4PG6A 1JR3A 1T9KA 2RSLA 1HLGA 2QLLA 3O3OB 4MWDA 5JARA 4M4SA 4OY3A 5FPSA 2BEUA 4K9OA 4YQZA 4UMVA 3UMFA 3WGZA 4LN1A 5EXTA 4DQKA 2YIMA 4FGSA 2FP4A 2MYPA 3V00A 3C8DA 5K3SA 1JA9A 1WBDA 1DAOA 1V37A 2OGSA 2JFHA 3VZPA 2ZWOA 5KCMA 2JI6A 3DF9A 1FP4A 1U81A 4MIKA 4C0AC 3R9XB 1MJFA 2VF8A 3RVQA 3DMYA 1IJBA 3EEFA 4K8RB 4PX9A 3IHKA 3G9QA 3M6IA 1MOQA 1C14A 3T4UA 4N7JA 2WIBA 1RLUA 4RD3A 3L4BC 1FP6A 4KN8A 4L95C 4RETA 1DO0A 3MWYW 1MD9A 4XYGA 1XZCA 5DX0A 4AUNA 4BN5A 3NPAA 4V2IA 2GAOA 1CS0A 2RHRA 1UC9A 2BY4A 1Q74A 3JZFA 1H2AS 4D9FA 3BIOA 3JASA 4EI2A 2GASA 3KOWA 3CH5A 5CFQA 5KOIA 2C2MA 1PSWA 1K75A 1QO9A 1T91A 3MJHA 4KR6A 2G5GX 4CNBA 3UPTA 1XCGB 1PJCA 4M37A 3RFUA 2EFYA 5JBNA 3ECAA 4DWWA 4X63A 1KL7A 3AR5A 1GQOA 3IAS6 3JQQA 1DIBA 2FW0A 1YS2X 4RTSA 4OI1A 5BV7A 1D2RA 5B37A 2B8WA 1DC6A 1CTQA 1PUIA 2P4HX 3V2IA 4Z9XA 1AZSC 1KKLA 2NX2A 3GRPA 2Z2IA 1V11B 2ZU6A 3GUUA 3P9KA 4W1QA 4BL5A 2F55A 1I7SB 3QE0A 5EE1A 1Q77A 1SR8A 1ZJJA 1RVV1 1KEZA 1LY1A 2GAFA 2PMWB 1U98A 4PE5B 3TEFA 4XYLA 1CRWG 4KHZA 1P72A 2VZ8A 1MOPA 1NKTA 2FW1A 4W6QA 4B47A 1APBA 4MUAA 4AMYA 4C0HA 2X40A 2UYOA 1YFJA 1V43A 1QZTA 2XB8A 3RVPA 3DOCA 1IHDA 1W5SA 2W43A 5A3SA 4POOA 5ED4A 5KU7A 4FHGA 3T1TA 1RCTE 4MV6A 4BP3A 1V1MA 2P4EA 2CC2A 1ZI8A 2OORC 3DMGA 4HPJB 1HE8B 2FWNA 2R48A 5BYBA 1PNVA 4M99A 3ZC3A 4GOKA 3GRKA 1T6ZA 1XEWY 1KOLA 1MAUA 3HCCA 5FA5A 3ICWA 4LYGA 1KQOA 2C2ZA 4L4YA 1I2AA 3ELUA 3TXYA 2VC2B 4FZVA 3KQVA 5JNVA 3TTXA 4P86A 4UEOA 1MORA 1XPJA 1YSCA 2EKDA 1QG4A 3KJIA 2NSHA 2Q3HA 5EMJA 4I19A 3MAAC 1FFHA 4R8RA 2BT4A 4B35A 2A0WA 5ALEA 1NLYA 4F71A 1ZNWA 2V7UA 3KUXA 2IXFA 1HQYE 3W3AD 1PRYA 1J20A 5MDHA 1N7GA 5LXTB 4CRWB 3TW8B 1NM5C 2GRJA 2CL5A 3D3WB 3GJ3A 4MS4B 2F1KA 3T0GA 1QO0A 1UF9A 2B98A 3UJ8A 3IS3A 5CFRA 1LPOA 3QITA 4FDMA 1G21E 4GI7A 4PVDA 4UNQA 3UHJA 4AKSA 1RRVA 2GFHA 1E3IA 2DQKA 4UVEA 4Z4FA 1PZHA 2HRCA 3A6JA 1HM5A 1ZZEA 4EF4A 3F8SA 2SNIE 3FYTA 2VBCA 1ORRA 1IXKA 1ZKDA 1V2HE 3HHPA 3TJMA 3PXBA 1FSPA 2I65A 1V9LA 1HOTA 3C15C 1Q2UA 2YICA 3C1TA 3HFJA 3I09A 4EJ6A 3OMLA 4KO1S 4JLDA 4X20B 1HDGO 4JLKA 5AVJA 3EVTA 3OJ0A 4X7MA 3H2KA 1D4OA 1V8OA 1IIRA 4JZKA 1J0BA 4L1KA 3MINA 4QSHA 4B71A 3U19A 3ZNNA 2CB9A 3JWJA 2B5VA 3ZH2A 4DV4B 3W6OA 1ZJYA 3D7RA 5AESA 3LX4A 1KFKB 3M5WA 4Y2HA 5K5EA 2CMKA 3JY6A 2OLEA 2XT6A 3TTTA 5ADHA 4OP3A 3S1SA 5B58C 3WMGA 5IBPA 4E5VA 4H0NA 4BNZA 1K8QA 1X7YA 3CLUC 1C50A 4W9MC 2XUGA 5HFNA 4GP9A 3B1FA 4OFWA 4RZXA 2J3EA 4LYAA 4GI1A 2AOWA 4J9UE 1EP3B 1ZIDA 3ETLA 2H48A 4HNAB 1U3UA 3G0IA 5EKXA 5C9ZA 1F2TA 1UQUA 2QMOA 1MDBA 1VA4A 3QX9A 2EQ5A 1GO2A 2PU5A 3LL7A 2QXUA 1OFGA 2E0IA 2FZGA 2HEIA 3K6SB 5B1SA 3DDHA 2XT9A 5KMGB 3VC1A 2CDBA 1O0SA 2B0JA 2DFPA 2I78A 3GZTB 4L6CA 2W5UA 1KO4A 1CYEA 5M29A 1WOYA 1BKSB 3PR1A 3V9AA 3W0LB 2IHNA 1K9SA 2P6UA 1VLHA 1Z82A 1AHHA 1XVUA 3QELB 4IYJA 2IV3A 1H4VB 5K3EA 1PJZA 2H1WA 3FPFA 3ORRA 4ZT3A 5LZ4A 1UMBA 2ZDHA 1RYBA 2GCOA 5D1NA 2R8PA 4MB6A 4J0FA 3OZXA 4MPRA 4WHMA 2DUJA 5IAKA 4O4IF 1X8KA 2BFEB 4IDAA 2PFSA 1QG0A 3R9KA 4YMIA 3VR2D 4L9RA 3OWXA 1M1ZA 3KYBA 2GN2A 2VTKA 3E9DA 1B1CA 4GQIA 4H7JA 4TSRA 5KTKA 2IFTA 3PNBA 4LHZA 1ZMTA 4NICA 5F1OA 5BO5A 2BFBA 3AF5A 4XIYA 1Y3IA 4C4RA 3TEMA 2A67A 4TM7A 4ZD6A 4ROTA 3ZCUA 1FTQA 1OASA 1VYHA 2OCIA 7REQA 1RC1A 5BNIA 4H15A 2PO7A 4O02B 4QYIB 3WB0A 1SXQA 1FDIA 4PC2A 1KAQA 4TLEA 3NDIA 2AIRA 1RHKA 1U2EA 4XOIA 1F20A 2DT5A 2RHBA 3HLYA 3N2LA 3BD7A 2AD1A 5A1TA 3GJTA 5GONB 1MHPA 3VKHA 1E4VA 4JNKA 3VSBA 4D9CA 1N2CB 4NU6A 5BWOA 4W5NA 2CWDA 2C9OA 4F4UA 3ZHOA 1CWUA 1G64A 3SC2A 1FXUA 4IMRA 3F7MA 1TNDA 1YKFA 2VP5A 1AHNA 1PF7E 1W29A 1YZ3A 3D8SA 5DLEA 3TIIA 1ZAYA 5D01A 2DBZA 5J5VA 5FR2A 1TJYA 3RC3A 3KCNA 2A3NA 1VMIA 3FD8A 2RK6A 2XIJA 3MJEA 1NAHA 4Q12A 3RJ9A 1DO2A 1HT0A 2ZUSA 2IZ7A 4M0PA 2MSNA 5ICFA 1MZPA 3ZY3A 1N5DA 1TIPA 2PQ2A 2ZRPA 3QKUA 3UG6A 2ZIXA 1AF4A 2C98A 2NV6A 2O54A 4QM6A 3OY7A 2CSUA 1GRNA 2HPHA 2Q29A 4I7EA 1GUBA 4IFEA 1SVOA 5FJIA 3RS9A 2ZDGA 4OJNA 3FDZA 4KWHA 3KYJB 4XUEA 3B60A 3ZCTA 5DI3B 4EYSA 2BTOA 4AJLA 1GNLA 4ZEWA 3TOCA 1W0JD 1WABA 2XYVA 2FKNA 2J45A 3IP8A 3ANMA 2PXCA 4HZUB 3U17A 2A9VA 1C1XB 3NIFB 3TQSA 2FWPA 3A2LA 3OU6A 2P9FA 1X42A 1KEWA 3PGJA 5LJIA 1W5FA 2FMKA 1Z4OA 5IJ9B 1M8JA 4G0WA 2FFAA 1WMFA 5FPQA 4CIAA 2UXBB 3E3AA 4TQ9A 2ODBA 7ABPA 1J22A 4OU4A 1T6XA 2FPSA 2G28A 4EWLA 4QFBA 3FR8A 3Q7QA 2J6HA 3E9EA 2Z5VA 1W4RA 4NCXA 1JDBC 1WSDA 3TIGA 2G9VA 2QX7A 4PX3A 4H1VA 5E4TA 1MX3A 3OLQA 2MTBA 3RS3A 2WU8A 1TCCA 3N74A 3PNYA 1KETA 5G1PA 3T7IA 3WRYC 4F6RB 1EFAA 2QSZA 2V3WA 1KAOA 1MJGA 1ODTC 3HRKA 2EP8A 2JGLA 1C7RA 2W2KB 3KYDB 3LXMA 5CH3A 2PMCA 1VTKA 1QIFA 1QHSA 1RIFA 5EY5B 3VSAA 2IYNA 3IE2A 2FZWA 1H3NA 5HDBB 1WB9A 4LDPA 2HF2A 1GTMA 1QR6A 1VLLA 1NMEA 1VPTA 5CMLA 5TARA 4BFXA 4KXLA 1C9NA 1CUAA 2HRRA 2IYXA 2JHFA 3CWCA 4JC4A 3MCTA 5EWMB 5JFTA 2AGVA 4J7XA 4PGFA 4RHXA 1KO5A 1P5RA 4O4HF 1VKRA 3A9VA 4KBGA 1QVVA 4W63A 1YTUA 2WIAA 3FTFA 1OI3A 2I2AA 2O1WA 3WBKA 1IOLA 3PQ5A 3GLIB 5J2UB 1QTIA 1JR2A 5DGIA 4AJJA 1OLXA 1LFAA 4RWZA 2C57A 1EFKA 1VP3A 5DIZA 3LYAA 2HJSA 2XZLA 2ZJ2A 3IHLA 3OX3A 1SVMA 4PG7A 2GPTA 2RAUA 2QGZA 4QOSA 2M1XA 3VR4H 1QV7A 3LWZA 1XK7A 4GXNA 5CT6A 4UZSA 1SXJA 4U7JA 1SQ0A 2HA7A 3BQ9A 3JQBC 5I9MA 3GXBA 1L8XA 1W1IA 3QTLA 3HA7A 4RS3A 4S2UA 4N3AA 5FPTA 5HZKA 3W5AA 5K3FB 2I22A 1C2TA 1O54A 3TOVA 3LSYA 3H11A 1I6WA 4JXXA 1YJ8A 2WG0A 1JHPA 4JP2A 2QN1A 2RGUA 4HMOA 4YRLA 5G0SA 5J47A 3MHPA 1KYTA 4GOJA 2OP1A 2IKSA 1AIPA 3IPXA 1QRUA 1O96A 4C1NA 4LRSB 5TQ0A 5BRAA 2Q3LA 1O94A 2IWRA 2CLCX 5LM3A 1CYDA 2O8BA 4DM3A 2IYUA 3MW8A 5F1KA 3TPFA 3CRRA 1RADA 3QBTA 4D92A 3DNMA 3HDHA 1D2CA 4F3KA 1GTVA 2J0UB 1CUWA 2ZEJA 4NP6A 4EHJA 2C83A 3CSSA 4G4SO 2D1YA 4KAFA 2ZRGA 3UGQA 1FFBA 3MELA 3FWNA 3AF3A 2YQ4A 5DX1A 1NP6A 1TMKA 2ATCA 2XZDA 4Q9KA 3RKUA 1SC4A 4JI7B 3UJ7A 3N0RA 2ZB2A 3FZGA 1FFXA 1V8FA 2X4IA 3HJNA 2P9GA 2IOQA 4XCXA 1L8LA 5DGCA 2MYNA 2E4ZA 1FB5A 4MDYA 2H6EA 4O3FA 3VOSA 2VNKA 1U2QA 3DPIA 3GGDA 1X94A 3VHQA 3WY9A 4MPTA 1EVZA 2OGWA 3DVAA 3TLMA 4CMKA 4EVRA 1H9CA 2DPGA 3BZUA 2PZ8A 3M4NA 4Q3LA 3ZK9A 2HHHB 2DPLA 1ISRA 2C0PA 3ZQKA 1D9ZA 5B6JA 3VR6D 4AP9A 2HBZA 4ZGWA 1I0IA 2LIVA 3D6NB 3V7NA 5EMHA 4GPZA 4QPNA 3HJRA 1GPH1 1NJ2A 3NVKI 3FRHA 1TF5A 1G4UR 1WEHA 4GKBA 3DP9A 1FVHA 2XSZA 2PMKA 3O4RA 4E2XA 2BHSA 2V9PA 1VZ3A 1AA9A 4MLZA 4JI2B 2C2WA 1L0BA 2E1RA 3HO6A 4QDJA 3ILVA 4DCGA 1B00A 1MH1A 5HF6A 1JI3A 3D7NA 5DHPA 3VX4A 4KBFA 2ZIUB 4B81A 2JGJA 4I4TA 2ZYVX 4WCDA 4J0CA 2K87A 2X9LA 1Q92A 3KOYA 4MTLA 3ABRB 3KVNA 4OMDA 1ZJZA 2IDZA 1ZISA 3OLZA 3CRVA 2QJTA 4F9FA 2P5TB 4MGZR 3VYTB 2ZXFA 4IXWA 4NY1A 3RT1A 4UUNA 4RPHA 4W5JA 4JU8A 2GRAA 3K5PA 5KYNA 4KAAA 4M6WA 4KOEC 2QSYA 1U3DA 1KI2A 2R8XA 4UKDA 4O2BF 3LBNA 4LHXA 1N78A 5EHNA 3W6UA 1C8LA 3DGEC 4HOYA 3WLEA 4WY5A 4XLZA 4J0DA 3V4ZA 4DVGA 4HJRA 1HNNA 2AN1A 2V55B 3A9RA 6NULA 4KLZA 1POXA 2V6IA 4RJJA 1XLWA 3H2YA 4CI9A 4XX0B 5A7HA 2Y1DA 2OSVA 3DLTA 3CBGA 2IYEA 4Q4AA 2IYVA 5CHYA 2HR1A 4K2HA 2BUBA 2UDPA 2YV3A 4B3GA 1FNNA 3ONFA 1OXUA 2JRCA 3DE3X 4M21A 1M8GA 4UOQA 1GYPA 4NC9A 4PPQA 1EM8A 1N6PA 2JH8A 1JYFA 1PFWA 2JEOA 3NT2A 2QVYX 2BEJA 4C4AA 2OHOA 4GPIB 5IM4F 1QOZA 2P68A 4RESA 5T8KC 3K70C 4WLVA 2QPTA 2B21A 3TR0A 3UENA 3HM2A 3T3GA 4OP2A 2D0IA 8GPBA 4TSFD 1VSBA 2IEGA 3REQB 3ZDFA 2VR1A 1EDZA 3O38A 4V0KA 5ALDA 4KL8S 3U9TA 2A9RA 1XCOA 1UMDB 2G0AA 3L07A 5JAOA 1D07A 1GN8A 1QBGA 2QN2A 5H3LA 1THMA 1BDMA 1C5KA 1N77A 4A0FA 3HPRA 1BOFA 1XTPA 2G9RA 3ETDA 3PS9A 2Q9UA 4WJZA 2NTVA 2WTEA 2WJAA 1I2CA 4I4NA 4ISCA 3DB2A 4O6VA 4OMFG 3DBVO 2YW2A 4JR2A 5EQJB 4EITA 5JD3A 1U7XA 3MGKA 2C3PA 4WGFA 3L01A 2E9SA 1RI5A 2BVNA 1LBHA 4DMUB 4OO3A 1R0YA 3OFJA 1ZMBA 3FZQA 5KTSA 2V4MA 1X1DA 2B6NA 2FGKA 5P21A 1XNQB 3RABA 2GK6A 1V5FA 5K20A 3C8UA 3Q9NA 1FJGB 1YNSA 3GI1A 5IK2A 1L8AA 4JBIA 1BOOA 1PNOA 2GHTA 3VU8A 5FOVA 5JE8A 3OUUA 1QPGA 1NW8A 1WP9A 1PQPA 4DIEA 3BMOB 1FYFA 4JK3A 4U2CA 2FMUA 4H59A 4MKHA 3I34X 1V3VA 3A37A 4I55F 4IOKA 1HTWA 3PNOA 4PANA 1L4GA 5ETJA 2YVQA 3TW0A 4BGVA 4HWGA 4CMAA 3S2EA 1V16B 5KYXA 2JIZA 2F1HA 4XWGA 1YA6A 2AVNA 2E6UX 4JOSA 1BDHA 2HEGA 2BFWA 3GPIA 3HDJA 3OC6A 1JEQA 4MVJG 4DCTA 4A8JC 1TRHA 1DX4A 4AQ7A 2NO0A 3FTQA 1Z3CA 4J1NA 1BVUA 4DSAA 2EX4A 1I7PA 4B3CA 3UAOA 1HEIA 3CX6A 3MC1A 3D4PA 2A0FA 1NC1A 2B1GA 5LZ5A 4D6YA 1ESZA 1W76A 2ZETA 3M1LA 1KQPA 2V97A 4JNCA 4PXYA 4QBTA 4YRPA 2ONJA 3AEYA 3OEHD 3VC3A 4QWMA 3N0XA 5DNVA 5ITSA 1WHSA 4L4XA 2EQBA 1T9DA 2WYWA 2M6RA 1GGFA 2YR0A 1ANKA 1CDZA 3M6FA 2UUPA 5BSVA 4PBRA 5BXQC 2H54A 4EW3A 1KDOA 3CKYA 2VNJA 3UK1A 3VJLA 1GL3A 4ZVMA 3DE5X 2BBOA 1W88B 3MSXA 2A0XA 3OTWA 5FRDA 1ZPDA 2QM0A 5ALMA 3QV2A 2P65A 1X1EA 2ISQA 1NURA 1VMKA 1YS6A 3L1VA 4LQ4A 4S0ZA 3CKLA 3KEMA 4CCAA 1KOFA 5I45A 1Y3FE 2F67A 3CUVA 2Q62A 2EKLA 3FOFC 2R60A 5F73A 2QW0X 2JLAA 4ALKA 2XB6A 2XCQA 4QQRA 2B2CA 2MJLA 2CF6A 1EWTA 2B1JA 5EFOA 1Z07A 1GGHA 2ZRMA 1XPUA 2AOUA 5HILA 5L7YA 5IC6A 2ERXA 5JC1A 2PSDA 2X6TA 4BKOA 1AUXA 4FC6A 3HMKA 3ONWA 1DEKA 1R0CA 1XV5A 1P2FA 5CK4A 3CINA 4C7XA 2B6HA 4QT4A 4YMVA 1Y3DE 4BXOA 3MK31 4HAIA 4DLTA 3L0SA 3EMDA 1SVWA 1G16A 2AVDA 2C3MA 1A9QA 4DNOA 2J09A 3WBFA 3H5IA 5HHTA 4S35A 2WWXA 1PT9A 4FNAA 4HX9A 4OGFA 1USWA 1HYHA 1PBTA 1Q7CA 1RWOA 1YI8A 4LWOA 3STUA 4ZEXA 4YFYA 4ZOLB 5JC8A 4NYIQ 3QOFA 1T24A 3C3JA 1OBOA 1NBMD 5HW0A 3G1UA 5L3SB 1Z6GA 1J25A 3WMXA 4MR9A 4ZFNA 2RGXA 3DMPA 1CVIA 2YJ4A 4TL7A 3LDFA 4YXFA 1OHHA 2BGIA 4GM0A 4LXYA 4QOFA 5FORA 4ZGBA 1RZRA 3TH5A 3NGXA 2EKQA 3FSEA 1C4XA 2W4MA 2JB9A 1GU0A 3L7MA 2NN3C 4P8RA 4BO1A 5AOBA 5KNCH 2X8AA 3LO8A 3QPVA 4MRRA 4R1LA 4UCXA 5CIQA 1DSSG 4C3UA 3ROXA 2J85A 5HJ7A 2VJMB 4MGIR 2YC2C 2RHOA 3WK7A 3GFSA 3KYCB 2PS3A 4EHKA 1TPZA 1Y48E 2W6QA 1M1YA 4L9SA 1HWYA 3UGKA 1GQRA 1X7WB 2AMVA 2RK3A 4IUCS 4YRJA 3X1MA 2GAAA 2QBYA 4YBZA 3GD7A 1YIDA 1W87A 3K8ZA 4Y67A 1T8PA 3QVOA 4P4UA 1IM8A 3MJTA 3JTEA 3ZHYA 3C3WA 1LPMA 3ET5A 3H5VA 2NZ8A 1XE3A 5L51A 1TJPB 4ITVA 1QANA 5EHIA 3D5EA 3TCXB 1CUYA 1GDDA 2FV8A 2YHAA 4BEVA 2YMMA 4MQEB 5BYAA 2BE7A 2K5UA 3D64A 5THQA 5I7UA 4A8HA 5I7HA 2LE0A 5D51S 3WXMA 2CV0A 4Q4HA 3E7WA 2GK4A 1PQYA 4DQUA 4A4DA 2IEZA 3P94A 2O2SA 1B43A 5KHLB 3URKA 3DFKA 5E8RA 2FXIA 2XTAA 2EZTA 3DHNA 4BO6A 3IQDB 3PCXA 4I9FA 4AZTA 2BGJA 2UXCB 1N8SA 5CJPA 4H18A 1UXGA 2YASA 3HL4A 2WM9B 821PA 1FYVA 4EG3A 2XE7A 4BVEA 2I1QA 3SCZA 4CTKA 3DDSA 3QWHA 2CMHA 3ELYA 4R41A 3CNQS 1UK7A 3C4VA 1MT0A 2O57A 3INRA 1SKUA 4AURA 1Q50A 3PEWA 5KC9A 2ODEA 5AHKA 1UJ6A 1ENOA 1BEEA 3FBGA 3FZNA 1JEAA 1R8SA 3BXHA 2G63A 4RQAA 2LWIA 3V6MA 3V4SA 5J2TB 2X5XA 1D4AA 2H7CA 3QNMA 3S6JA 4RXUA 3K6JA 4HDRB 2C9YA 3EDRA 4I50B 4P7FA 4JIMA 3HXTA 1BYUA 3LRTA 1RE1A 4URHA 3TMAA 4NCJA 2X19A 4QNMA 4GI5A 4AY3A 2RDMA 4G1CA 4MULA 3B5IA 3JQPA 2RE8A 3COZA 1Z5OA 3IP9A 1XQ9A 1T5BA 3GVCA 2PWPA 3NUQA 1JFFA 2XVMA 1I6KA 3JVDA 3PFWO 4C88A 3DG9A 3L0BA 1UMCA 4UFPA 3WMWA 3KJGA 1ULZA 2GM4A 1SMKA 1R6VA 3BGOS 3H2BA 1R5OA 2XGSA 4EW6A 1SRRA 3CLRD 3PD1A 1IL0A 3WJ2A 3X2SA 3C14C 2HGSA 3NHSA 4L74A 4HAZA 4X8LA 2HRQA 3HB9A 4OUDA 3ANNA 1Y9ZA 4YRFA 2P3SA 4NQRA 4EYGA 4EB3A 2GXSA 1E2BA 2JFPA 2YXEA 4FGKA 4QG7A 4AX4A 1E5LA 5KTYA 1M0TA 5C7IO 2BPOA 5AVWA 1ZAKA 3IEPA 4NESA 5IF3A 2WAMA 2D2IA 1AB5A 3MBIA 1D9XA 3OCXA 1Z35A 3WP0A 2MR5A 5LWHA 4QUBA 1T8UA 1BCSB 3E9YA 3OZUA 1U28C 1D5CA 1CY7A 2BI4A 3LGXA 4LUCA 3WKCA 4FGWA 2HJ9A 4LK2A 4NVRA 1FE8A 4Y2JA 3RYHB 5IAGA 1ONSA 3LXUX 1TL7C 3UMRA 3IE1A 2W42A 1M1NB 3H16A 4KQMA 1J8YF 4MO9A 3WSVA 5AFSA 3EUAA 4JI1B 3MWEA 5F2NA 4M89A 3GUZA 2PZMA 1DFHA 2TRSB 5H81A 4Z54A 3DR3A 5A5EA 5FFFA 3EAGA 4FYYA 2NU8B 5MN5A 4B80A 4O4HA 2H4WA 4NABA 1Z47A 3F7TA 4P2GA 1CFZA 1HYEA 1WXHA 5HPYB 4IH9A 5KB3A 1FU4A 1UH5A 3N8DA 2YKGA 2ATEA 1WB5A 4UCWA 5B3KA 1CJMA 3X43A 2NU7A 4FFRA 3W5SA 2RK4A 1PG2A 3H5LA 1Z5GA 5EUMA 3OT5A 2Y4NA 5KTNA 4MWCA 1FP2A 2ZWMA 4ER6A 3ZX4A 3HK2A 1L7OA 5AHWA 1EFDN 1OX6A 3A4TA 3KKKA 1V39A 4PONA 5ALGA 2PL3A 4HNQA 3TWOA 1G21A 2VHCA 3OOJA 4G4JA 4S1NA 4BFLA 4EABA 1D03A 3H5AA 5E3HA 4WXHA 4D5EA 3OTIA 4ARCA 2RAFA 3KLOA 2P69A 5IVIA 1FVXA 2HDHA 2AN5A 4DCUA 1KWGA 2FN4A 4RO0A 4WKBA 4BQNA 1EQUA 5LJLA 3TG2A 1A7AA 1WQ1R 4HDMB 2O1SA 2QAIA 4RL4A 5A5GA 5DM2A 4GZ5A 4B8ZA 3NXSA 1KNXA 5FLYA 5IJ0B 1Y89A 1T0HB 1L4NA 2DKFA 2HBQA 3GT0A 4OOEA 4QUDA 3VR3D 1W9MA 4FT4A 3M1AA 4HV4A 2GPYA 3NIDB 2YY5A 2KJQA 5EKDA 2V0NA 1FQOA 3ECSA 3Q0IA 1L4BA 1J9EA 4HNHA 4EVIA 3E0XA 1ZWKA 3WJAA 3C5CA 5I4IA 3LP6A 3TXAA 3LQKA 4EG7A 4LF7B 2ZWIA 3L0ZA 4NAVA 5IJXA 3EIXA 3RVBA 2BJWA 2HREA 3A1UA 3P2KA 4LNUB 3WLLA 2RH8A 3R40A 1SUBA 5CXUA 2A9JA 4DLPA 3HVIA 4XD7D 1RKQA 4XYMA 1H2ZA 3UANA 5E7JA 3WTCA 2ZYAA 4DKXA 2VCEA 4RXTA 2VHJA 4CM8B 1VL5A 2ZANA 3A3KA 5CNIA 4FSDA 4A82A 1HR0B 3HL0A 3TMYA 2WAOA 1XZBA 2C1EA 2X1HA 3IL2A 2FOLA 2WK1A 2NO5A 2J3KA 4PTYA 2G67A 3AX6A 3Q3GE 3GRVA 1QKJA 4Z9FA 4US2R 3N2IA 1PR0A 2H9YA 1WE2A 2V7EA 1TCVA 4GLFA 3ITEA 4DDKA 1A9ZA 3E81A 3ONVA 5GGXA 1BQ4A 2XA2A 2A6PA 4O2AB 2V7QD 1E5VA 1PT5A 5I4BA 1KZGB 4N5NA 4I81A 1W5EA 2X0DA 1CUDA 3HR8A 3CR7A 3UB3A 4MWZA 4EHNA 5IARA 3ZHCA 2YC4C 3ET4A 4D8YA 5KWSA 3G2OA 4XE5A 3THXB 3LLUA 4AZ3B 1B2RA 1RWPA 3SE0A 5ESRA 2R3SA 5KYYB 3ERCA 4WZAE 5T5QA 1I33A 1QH1B 2O59A 3FGPA 1GAXA 1GLGA 2WB2A 5SY9A 2OPHA 1TVEA 1XNGA 4OB7A 1ATIA 4J0HA 2F3UA 1VBFA 2Y1CA 5CU7A 1P4SA 4R1TA 2QD4A 2QM3A 4Y1FA 5EZQA 3NNDA 2C5BA 1GUZA 1HL7A 2EL9A 4KKXB 3RS5A 1M7BA 2O0HA 1T9AA 2VJYA 4O2BA 1SHZA 4PN3A 1OR8A 1NVVR 1U8CB 3AONB 2GEDA 1FP7A 5LP6A 4K9MA 1W49A 1YZNA 2YIDA 3H6KA 1I4WA 1BGWA 1KY3A 1EVEA 1AMNA 2QR2A 1NT2A 1YJQA 3E03A 1MKYA 2AT1A 2HU5A 3BWCA 4BP9A 3ZXXA 3ONNA 2A84A 1HF3A 5M2QA 1WQ3A 2QG6A 1Q12A 4MYRA 4EHHA 1NULA 3SHOA 1FPMA 1QTNA 2XWSA 3OKPA 2JVKA 2OZPA 2VF4X 1CY1A 3GAZA 4PPNA 2Z2YA 5IM4A 5LCXA 1E5TA 1BHQ1 1F4LA 2HX1A 2LBPA 3E7XA 3J81k 1CUXA 4H60A 2IWHA 2I34A 1EE2A 3K73O 4QVKA 3VNBA 5EJ4A 1X87A 4HXGA 3X44A 3NNSA 3GQVA 1PGPA 4ESOA 4DBLE 3ZOZA 2FMHA 4Z3KA 1RRGA 2ES4A 3LY9A 3TRJA 3G0GA 3OCVA 3ZDBA 2XUIA 9GPBA 3DAOA 2QUAA 1WUYA 4YYZA 4CMIA 3TZEA 2NTJA 2ZI5A 2Q7DA 3F96A 3I6ZA 1A9XB 3BC1A 5DP1A 4V1CB 1NZDA 1EG2A 3DO8A 3ABZA 4LVNA 1T5SA 3CCFA 5MN4A 3AEQB 4L5AA 4C30A 3W6NA 4QAJA 4QXMA 2IQ5A 3I83A 1E8NA 1DAIA 2I4LA 3A1NA 4Q37A 2ZR0A 4UAUA 3SGLA 4BJ3A 4E15A 4DYHA 2IPXA 1ES9A 1S9DA 2FJPA 3TE7A 5LNK1 2E21A 1CULC 4M1KA 2SKDA 3MJRA 3PRJA 4IJUA 2D2VA 3GP8A 2ZAYA 4DEYA 1RM0A 3ELDA 4ZYZA 1OSNA 4S3MA 2ZSDA 3BL5A 3KETA 2Y1EA 4UARA 3VZSA 4UQPA 1B15A 1I4DD 3A27A 3T95A 5FR1A 2V7PA 4I55A 4EJSB 1XVTA 3CXUA 5LQSA 2VJQA 1H1DA 3ZH9B 2RGNA 4B17A 3JSXA 1QYWA 4HUTA 4Q9AA 4UVHA 3RBVA 4B84A 2BWJA 2B36A 5BNWA 3PQ4A 1ZR2A 5BYJA 3AI1A 5F33A 5HKKD 1IY1A 1E7QA 1MW9X 2PXAA 3HFSA 1NXQA 2PA0A 3ZYCA 4CZ2A 1QAMA 5IAAA 3AU9A 3G0HA 1FX0A 4LJ8A 4KIWA 4GS5A 2FRDA 5AVOA 3ZHXA 4Z8YA 3AKCA 1YC5A 3TVDA 3E7FA 4UEKA 2V7BA 2Z3WA 1SVUA 4XQ9A 5KHAA 5A4DA 1PEDA 2FLWA 4BBJA 4KHPB 4YJGA 2BD0A 1FNCA 4OXXA 4D4IA 4F85A 3RRJA 4F2PA 1KQFA 4BVJA 2QX4A 2I66A 4EFLA 4YMTA 2AEJA 3CZRA 4B4UA 2HIHA 2AB0A 1ZGBA 4RUKA 3U7EB 3BEDA 5CLGA 4YPFA 2GBCA 2PRSA 4BP8A 2IS6A 1LF0A 1AUPA 2Y2VA 1RWMA 1K6JA 3EARA 1K66A 3OURA 4OHFA 5FOSA 1G2PA 2P91A 3BBLA 1L5RA 3LYUA 3PHIA 3B1WA 4G63A 1Y4SA 1FLDA 1MRZA 2P6MA 2ZKLA 4IY1A 4LAFA 4LBYA 4QULA 4QX6A 4NJMA 4GGPA 1N6RA 1GZ4A 3DFMA 2Q3FA 4MAFA 2A2ZA 3HBNA 4NDAA 4F96A 2IHBA 2WWIA 3CO0S 2Q1UA 4ND7A 4XGIA 3C3CA 3S44A 3TRFA 2MINA 4M49A 3WOHA 1Z4LA 1K63A 1KJNA 3TAUA 1I7QB 4PLVA 3AJDA 4GRDA 4LC1A 1O87A 3HY4A 5DNCA 3NDPA 4FZRA 4PLGA 4ZYLA 4ECEA 4FWIB 3NOVA 1R0KA 4A0RA 4O4LB 4KQ6A 1P1JA 4OXNA 1X0VA 4DYDA 4LY6A 1PI3A 2W2QA 1FUIA 3Q7RA 2XKAA 1JQDA 4QFMA 3OBBA 4HLQB 1TPYA 3H7IA 2PEYA 2QROA 5C8DA 2Z9BA 3MZ0A 2BFPA 2O7VA 5LQNA 1H65A 3MLEA 3ML1A 3LLSA 4DIOA 1LS6A 3F6PA 4R4JA 4ZOCA 3MHTA 5B12A 1U7HA 5IUKC 1GA6A 1GZ7A 1HT3A 1UWLA 1ZNXA 3MJCA 4F3YA 1JH9A 3RUDA 1XZQA 4JU9A 4LDJA 4ABYA 4ZP1A 3P96A 2GJ9A 3CLHA 4RHFA 1FVOA 2A1UA 5JEEA 3GH3A 3SYMA 4NU5A 4XRGA 1IY8A 4P93A 4E2YA 3FJYA 4DUZB 1DKOA 4RIGA 4D3XA 4RKQA 1N3YA 2DH6A 2VUTA 4IQGA 1IZ0A 3L79A 4YHBA 1KMCA 1JVBA 2WMYA 3LHDA 5LIPA 5BR7A 1J07A 2DVMA 2H63A 3NAQA 4EF5A 3IXLA 5HX7A 3S81A 1KMHA 2C3UA 2ZFUA 3I4LA 1CUJA 1TEVA 3W90A 4HN2A 4OJMX 1EK0A 4LV8B 3NRBA 2FSSA 2CJFA 4TLBA 3SHWA 1NUPA 3VGJA 4BYGA 4NV1A 3BIXA 3KHTA 1PS0A 2PJUA 3L77A 4B7ZA 2FZ5A 2MWMA 1TB4A 4N3NA 3GLFE 1VLZA 1LBIA 2CLFB 3IMCA 3ILSA 2F3RA 1A95A 1PDOA 4G1UC 2J08A 1RWXA 3CCCA 3ZY5A 3SZUA 1JZQA 3N58A 2PZJA 4N40A 3EQ9A 3LP5A 3UM9A 4E2ZA 3JQAB 3RNLA 2H1HA 4FDTA 5F7XA 1CK4A 4H1TA 4YCCA 2CFOA 1DC5A 3WLKX 1DKPA 1VL0A 4GPTA 2VAVA 4ZHSA 2HQRA 2VHQA 1ABFA 4ATNA 2JEZA 2QRGA 4XGKA 2D1SA 4XCVA 5D1HA 1ENYA 1IBRA 1RMQA 4HVCA 2WF6A 3TUIC 1PR3A 3DWEX 3O4GA 2PS1A 2WPNA 4JKOA 4JYMA 2XOXA 3EFEA 5CG2A 1ZL2A 1LGYA 4JROA 1C9MA 1OFIA 4H2DA 3D1VA 5BORA 1W0KA 3NTOA 4DA7A 2IUFA 3D4LA 1YRHA 4MYDA 4EYKA 1G41A 4LBWA 2VH1A 3CRMA 1PHRA 4HF7A 1LTKA 2CHEA 2CKMA 2HADA 2NTYC 1I0LA 3DMTC 4MW1A 5T6MA 1BVRA 3QMVA 2ZJ1A 3SF0A 1YB7A 1YRWA 2Q7OE 3Q5GA 3COPA 2WOOA 2PLFA 4LWPA 4D9BA 4ZJYA 4J29A 2PBZA 1CU1A 1YI0A 1VZ2A 3PC8C 3EIUA 3HBFA 4MQMA 3DA8A 2YX1A 5KNBD 1QOPB 3GK3A 1G9XA 2ZBVA 3M7IA 4KV7A 4PZDA 3W3AH 1XJQA 4PGMA 3VX3A 3RV3A 4ZU1X 4ZV7A 2XCUA 3QU5A 4TLCA 1MF7A 1BQ3A 1AQLA 4OIMA 3AMVA 3QUTA 1A5BB 3PWKA 3CB2A 4MUHA 1YE3A 3GNQA 4Y0VA 1EAMA 1EFPA 4G84A 1L5KA 2J9YB 4ZHQF 5CCDA 1CETA 1MQ8B 2AKAB 1O6FA 1O4WA 5F9MA 1BHO1 2TMDA 5CDHA 5JD4A 1DFIA 1I3NA 4JLUA 3WWCA 2Q4BA 4TKVA 2CFRA 4L73A 2H1SA 2O3TA 1U5AA 1M7HA 3QJGA 1N92A 1SURA 4CIWA 4P33A 3AC0A 5CFNA 2SCUB 1EIZA 3AYXB 5DBIA 2XUFA 3D2AA 4A03A 2FQYA 3OFSA 3LDHA 3SHTA 4EX6A 1H8HA 1SD2A 1J2JA 4X7PA 2SICE 3P9QA 4C4ZA 4OHWA 3USCS 4BNDA 2FQ1A 2PD4A 3E53A 2O5EA 3GJ8A 3ZWDA 4YGYA 5JNRA 2ZSAA 1KU6A 2WJGA 5IANA 5C8YB 2PH7A 4ILEA 3QLJA 1S3IA 1U0FA 1WTAA 4YHHB 2CF5A 2MT9A 3RK0A 5DWVA 1Q11A 4BEBA 5AUNB 4U7HA 3TO5A 3UMCA 1ZI6A 3ETNA 5FFMA 1TJNA 2DR3A 3T7DA 1C29B 1YHYA 2CJWB 3C8ZA 4RBNA 4YMSA 3D7LA 1I01A 1RPTA 3G8AA 1VXOA 3OO0A 4I36A 4L0DA 4MW4A 1Y98A 3AKEA 4AFNA 4BB6A 4D6PA 4ER7A 1EK1A 3FHTA 3UA3A 2XE8A 2YCLA 4UULA 4W9RA 4B3FX 4N41A 1MAVA 1MMFB 2Y27A 4L75A 4R68A 4C4OA 1QV9A 2OAGA 3GFOA 3HYCA 2UVDA 1KYIA 1VGQA 3KJQA 4JJIA 1ILWA 3ENNA 1MX5A 1PZFA 1U2SA 2C94A 2H00A 1CUGA 2ORYA 1S02A 1YU6A 2I4TA 3O21A 3OQBA 4OA8A 5CNJA 1PV1A 3DXZA 3AVWA 2P5UA 3GZNA 4X62B 2PZKA 3G7SA 2B2NA 3ZWMA 3F5SA 3MQ4A 3GBVA 1PIWA 1AKVA 4IS2A 4NG4A 3BJZA 5CT9A 3WB2A 3C97A 1RAFA 2WNSA 4CDGA 3HNOA 4FTWA 4BC1A 3D31A 5TGDA 3BIFA 2PGNA 5KEIA 2VBGA 4FBLA 4OATA 1RAEA 1RJDA 2BEVB 2QP9X 3OZ7A 4AF8A 2VLIA 4JL6A 1B8OA 3R6TA 5BRJA 4Y6LA 1K5DA 1MO6A 1R8XA 4GKKB 3TQFA 3Q2KA 2W4QA 3BDAA 2PUGA 1TA4A 2BL4A 4QASA 5B55A 4W1SA 5BSEA 1OB5A 1R5BA 2HU8A 3T5CA 2ZJ0A 1KP3A 1IY0A 1OMOA 1SD5A 3C24A 3WDLA 3MJSA 3UJ3X 2IXGA 2JRLA 1Z08A 3HEMA 4J2TA 2RKWA 3DO5A 1FIUA 2JJ1D 3H4TA 3SKXA 2OBXA 3CCBA 5CVEA 1WXWA 3EODA 2DB3A 3ASZA 2I91A 5GGYA 3A6HA 1G63A 3G88A 1WUJS 4H7EA 2QN8A 4PO3X 4WASA 5KOJB 5EMNA 4KDFA 3TNYA 3AM3A 3QYJA 1CZRA 1JKJB 4PNPA 5ALHA 4QEZA 1CKEA 1O2DA 3KLMX 2YVUA 3WNZA 2V3VA 1IBLB 5JQGB 1EH5A 4IDFA 5B3AA 5F76A 2YRFA 4J7AA 1CQJA 1Y3HA 1GPNA 4L72A 1NUQA 1Q21A 4NU0A 1PFKA 3UKDA 5IN4A 1XNJA 4FGJA 5J4KA 4LZOA 3ETCA 2RGCA 4JHXA 4KWEA 5E1OA 3PC4A 4BV3A 1C3EA 2PL9A 3OU2A 3Q2OA 4A9AA 4Q16A 4RVCA 3M6WA 4Y2UA 5IXSA 1N5KA 1PUXA 2IUUA 2HA4A 4PQFA 5G02A 3W9YA 2QD3A 4YCMA 3IULA 2GJ4A 3T52A 1BRTA 1DT5A 3R4VA 1AV7A 4U7WA 4FZJA 4B6JA 1TW3A 2V5UA 1PHPA 3EVNA 1VLVA 3Q40A 2HSDA 1ZHHA 4KXUA 3L93A 4N6NA 2H59A 2VSOA 3L04A 4LJ9A 5F3DA 1EVJA 2I55A 1T0IA 5K9ZA 2VA8A 1VYTA 4P34A 3DHVA 1W36B 3P4YA 3KC2A 4ZCTA 1Z8NA 3K9GA 2BBSA 3ZCQA 3RFXA 2OG1A 3RV4A 2JHAA 2Z57A 3Q10A 1KVQA 4IBOA 1AKRA 1E9DA 2BUCA 4N9WA 3FXAA 2WE8A 2GJSA 1U3FA 3IDSA 4B6RA 3GV0A 1ZINA 2CVFA 1LA2A 2P8SA 5E6SA 4YUWA 5K0GA 3SDZA 1ZU5A 4H08A 4P35A 4X1KB 3WGLA 1JLLB 2TMYA 4RTKA 2PDAA 4DDTA 1IAVA 4MRAA 4EL5A 5MGBA 3F3KA 3N1UA 4PINA 1F60A 1XHEA 4RPIA 4P9NA 4YAFA 5ERXA 2AR0A 1UBFA 5LYJB 1HFWA 4JB8A 4QJBA 3KQUA 3J7TA 4A1FA 2O8EB 3HC7A 4M54A 4BO0A 4N0DA 4RE5A 3TQOA 3CVJA 4F12A 1PZNA 3KWJA 3LQQA 4B7AA 2ZSUA 4FR5A 4LPKA 4W99A 4DXDA 1CLEA 1FL9A 4YK7A 5AW4A 2OFXA 1M10A 1P6XA 4LOIA 3TI7A 4YAUA 3NT4A 1TTTA 4ZVSA 1G6Q1 3GLKA 4G25A 4P54A 5IVHA 5A4AA 4ZVOA 3NCTA 3K16A 3WLIA 1QHHB 4ZU3A 4B34A 2QU8A 3STWA 2ODWA 2BHTA 2O06A 1E32A 2VAWA 4CG3A 3FB1A 1Y5IA 4KE9A 3TB4A 3W7BA 2JHCA 2ZJAA 2YZMA 2PX5A 2XNDD 4D9IA 4CKYA 1XZLA 4TTPA 2H5EA 3WWOA 3ZXSA 3KO8A 4BLWA 2GCEA 2FB9A 2NAFA 3U4IA 4D9HA 4B8WA 3PQ7A 2BFFA 2O1XA 4P80A 5E6UB 1JR3D 2BAGA 3UC9A 4H35A 5FTJA 3SVZA 1L5ZA 3AG6A 5JD5A 3DF7A 4RLQA 1ADYA 3OM9A 4EY7A 3IOBA 3V42A 4Y9TA 3A3OA 4YI3A 1ZW1A 4F04A 3C5HA 4ZA2A 4DIBA 1UBKS 1RYZA 4MDEA 4JEUA 3RFFA 3SSNA 1PTKA 4FVTA 2HW8A 2HH9A 4AU1A 1Y6QA 4MV8A 3KQOA 3S0JA 3T94A 1U11A 1P1FA 1RBYA 1WXEA 1KYQA 1PP4A 3DQPA 3H86A 4IQ8A 3QBEA 4KYUA 1H93A 1ZD5A 2FU5C 3NALA 4R1QA 1U0LA 3MS4A 1GXSA 1TKAA 3ER6A 3DZKA 4ZVNA 2DQZA 3FUVA 1E4YA 2QAGC 4ILKA 5J23A 2RI6A 3UW3A 1KPHA 1TLFA 4Q3DA 4F3TA 4ZALA 2VYQA 3WICA 2IOFK 4XWTA 2JD0A 2YQZA 3L5KA 3T34A 2YCBA 3L0IB 3LWNA 1K8ZB 1JYSA 1J0DA 2CLHB 3K6SA 1ZRMA 4CEIA 1Y5RA 4G8JA 2W8BB 1Y1PA 2IOHA 1HDZA 1Y1LA 4HEQA 4TKZA 4N47A 3JQ7B 1D0SA 1P29A 1I3CA 2G7ZA 2X0KA 5JAZA 2PGJA 4WRRA 4L5JA 3FPLA 2I29A 2WSSA 4F91B 3L6CA 5CIWA 3TF5A 4PSUA 5HIKA 2AJTA 3FLAA 3HQ4O 2C8KA 4MSUA 5FCDA 2CNDA 2QPOA 2I3AA 5CB0A 4LFBB 3M33A 1YL5A 1IH8A 2BW0A 2R8EA 1OXVA 4JHLA 1AHIA 1DUSA 4R83A 1WZIA 1XLTC 3QEMB 2ROQA 5ALIA 1ONOA 1QP4A 2V74B 3JWIA 3D6UA 2WAAA 2E89A 1JIUA 3V1TC 5CVCA 4IXMA 4ERXA 2JF0A 4R2HA 5IW8A 3IUJA 5K3OA 3NP7A 4Q66C 5FUVA 1GGEA 4UCFA 2A5JA 4H4CA 3VR4A 1Z3IX 4BBAA 2ZYWX 3PWSA 2XGMA 1D2GA 5TF0A 5IC5A 1PJ8A 5FBHA 4KXVA 1Z2DA 3AI2A 5G3YA 3ZD8A 4DCOA 3T7JA 3UBMA 3W1WA 2QRQA 4MNTA 1P44A 3CZPA 4YJFA 1DBPA 2VF5X 2CN1A 3RC9A 8MHTA 1IJEA 3JWHA 4NH0A 4NCIA 2FVXA 5HF8A 4L22A 2ECQA 3FVWA 1Z0KA 2I6GA 2X3UA 4FEAA 2P9CA 4OHKA 1XALA 1K92A 4IHJF 2ZUEA 4BYMA 1XQVA 4E94A 2N46A 1QB7A 4CLEA 4QYWA 4ZC8A 3F5FA 1X3SA 3RBZA 1K68A 3DDNA 2OV8A 3GG9A 1EFHA 2IYLD 1X7XB 1G42A 1NVMB 1E1MA 1CUCA 2HJGA 3WX0A 5TPZA 4Z3OA 3H17A 3QQ5A 2JBAB 4OYLA 1HG0A 1Q2XA 2D4HA 2EXXA 1ODJA 4AW9A 4CG1A 4OAPA 2QZJA 5GINE 2XMQA 1A4RA 2OESA 2ZE5A 1VB3A 3BXPA 3PWZA 4U2FA 4B4VA 3E4CA 4P08A 2GZ2A 1PJQA 2QE7A 1F0PA 1XRSB 3J7AC 4Y6SA 4WZAA 3EGXA 4JI4B 4E70A 1G1AA 4O4JF 4TLMB 3SAJA 2HV8A 3HRHA 1ZH2A 2VRNA 2PPVA 3V32A 4KRYA 5KCZA 1MBZA 4QM7A 2FEMA 1KKUA 1JGTA 2JLBA 4FPXA 3W5VA 2ACWA 2OZKA 3G02A 3W1VA 1U6KA 4BVGA 2R1TA 1X7GA 4UU7A 1OD6A 2AF4C 2DHEA 1MB4A 3FBTA 4KCGA 4WTOA 5C35A 1MHTA 4EB8A 4CG2A 3A3NA 3KKPA 3DEYX 4W9NC 2WWFA 3MXOA 3FKJA 3HKEB 4ZYTA 4Z4CA 3ZLJA 2D8MA 2G9ZA 3PYLA 4MI1A 1HEYA 2MMCA 4BNKA 2BMJA 2Z04A 2A88A 2XCRB 7MHTA 1TAGA 3EJ6A 2J6BA 3GT7A 5CVUA 5AI6A 4I6JA 5KPDA 3STVA 1G55A 1YB4A 3WLNA 1PFUA 3PJGA 4MUKA 2XAUA 5DMXA 5EE3A 4IGKA 4YCLA 3GQBB 4RXMA 2O3SA 2IPOA 4WL0A 3TLEA 5A9SB 4DY6A 1SBNE 3R9WA 4O8ZA 2YZ7A 5F7JA 1DOZA 5KJEA 4F06A 3KV1A 1IYZA 5CYGA 2WIFA 4OBWA 1MV5A 4X1YB 3CMMA 5JVDF 1NVUQ 1UDAA 3IP1A 3TFWA 3WLPA 2FJ0A 4DJ5X 1ZN2A 1ZVMA 4QGAA 1A9SA 5DM1A 1M6VA 1NKSA 2H29A 4UUBA 1AKNA 4ZT7A 4RX1A 1GPYA 3EQ8A 3EMKA 4HFNA 1O6BA 3DAYA 5FWAA 4MLDA 1ZMRA 1WOMA 3P5SA 2G17A 1XU4A 3UH0A 1SIBE 3AUSA 3W8FA 1WPQA 2CVPA 4M60A 3WAGA 1M1XB 4FE7A 1W8DA 1PJ2A 1VYUA 1C2YA 2PZLA 3KBBA 4R8MA 3UAYA 2IUYA 3FDFA 4WCFC 4FMPA 4OL0A 4AWXA 2PH3A 1J8FA 4N0MA 3OIDA 3NORA 1QG6A 5EVCA 1D2NA 1VMEA 5EJMA 4BO4A 2DQSA 2GPJA 2ZRJA 3NYQA 4MRPA 3Q88A 4PYNA 4Y6GB 2I4MA 4BN4A 4BAGA 3TN7A 4M76B 3DBIA 3E7DA 2WWVD 1OTYA 3LECA 3M8KA 2W00A 2B2XA 4NBWA 4MGYR 4QBFA 5IZ4A 1J0EA 2E37A 2O20A 2QW8A 1Q0SA 2A30A 4HXYA 3VAZA 2WF8A 2QRHA 3GY0A 1XZIA 2GARA 2OHXA 2J48A 3HKCA 4UNIA 1J06A 2EZ4A 2ORIA 4BNGA 5ISMA 1YHZA 2OYRA 4KGDA 1XTRA 1Z56C 2B61A 1A5AB 4ADSG 3AM4A 5FOXA 3NQ41 1F5SA 4JUIA 1K2VN 1S01A 2QJOA 4UDNA 4WLEA 1WULS 4HNGA 5EXDA 4C5BA 1OH7A 1JDJA 1GZSA 1QQTA 5FNVF 3HVHA 3FWZA 1SQGA 4F56A 4HWPA 3WYGA 4FI3C 1O95A 1R64A 3IALA 4RAOA 1KFCB 2ZI3A 3DD1A 3R7BA 1DG1G 1Y8RA 4HDSA 5DLDA 4G9EA 2H1RA 2OBLA 2YJ6A 4IIEA 1N9ZA 2FWAA 2GCPA 1DIAA 3LFTA 5CYPA 2Y6VA 4RDHA 2H06A 4YR9A 1N33B 1I3KA 5AXDA 3U1TA 1E1CA 2QTTA 4IIHA 4ND8B 3E8MA 5LOVF 3QF4A 4GX5A 1V5WA 4KQGA 3I04M 2RH9B 3WYEA 2OXRA 4C5CA 4NEGA 3NBMA 4BQOA 4PO8A 4MHSA 5HKAA 2J46A 4GE0A 4OJQA 3LO5A 3IR7A 4I1RA 1JPVA 1G6OA 1JYEA 4J9VA 3BMNA 2I87A 4FS8A 4G4IA 3P9NA 3Q72A 1QM5A 1O9BA 2JPDA 2EV9A 4W5HA 3EEYA 1V8ZA 1DX9A 2H2IA 1RTTA 1WMEA 2YXNA 3A9CA 3MA0A 3KT0A 421PA 5KJFA 1U8TA 3ZDAA 5FOWA 4WFJA 4K9KA 3VYSB 1DIGA 1Y9JA 5IDXA 3DWIA 1R5JA 4LDZA 1SHLA 4AJEA 4LHWA 2QNBA 1O7JA 4FFDA 4C7OA 2YJGA 4CQMB 1RE0A 2XNKA 3R7FA 2HLHA 5FUBA 3UNXA 3FRJA 1MQAA 3ZX5A 4X0EA 3UMMA 1WCXA 2BEWB 2F6RA 3LX5A 4LZWA 1PQWA 4OHMA 1WY5A 1F9EA 1BROA 4FHDA 1H5UA 1SBTA 2R97A 4G5RA 4Q3OA 5KVVA 4Q7KA 3T6KA 1E79A 2ZK7A 3UFXB 5JANA 2F3TA 4CKEA 2FFBA 2GD6A 4G0OA 3CM0A 4BKRA 4AY4A 3ITNA 5KVAA 1GARA 3LI2A 3V8EA 3FKQA 1YRYE 4MZDA 2DPYA 1KSHA 3DV2A 1ZC3A 2VUIB 3IUMA 5TVGA 3TFOA 3OZWA 2G4LA 4EKEA 1G8SA 1GYQA 2WQZA 2ZJYA 1SXJD 5T3YA 3E5HA 5JXWA 1U3CA 2C0CA 1CUSA 4QYSA 4I1SA 3NBUA 4TYNA 1VIDA 5DGDA 4RV9A 3ZE9A 5ILOA 4OBEA 1A71A 2EBUA 1IHOA 3CX3A 4DADA 1LNQA 3TX6A 2BJHA 4OEHA 4YO7A 5LZ7A 5LKAA 4QJ5A 9LDBA 3GLGE 4HG2A 2JNWA 2EDCA 3U62A 4GP6A 3AR7A 2PKRA 3GLFA 1GSHA 3OH8A 4CL3A 4ZODA 3MWGA 1ZU4A 2VL7A 3DWGA 4J90A 4CM6A 3U37A 2FR1A 1L7NA 1O94D 2C92A 4CM1A 1B2LA 1E5XA 2GZHA 1LKZA 1E4EA 3AESB 1WCIB 3FCYA 4C0QC 5HTOA 3R3VA 1KK0A 4BE4A 3KJNA 3NRJA 4I5GA 5JAHA 3R5KA 2Q2NA 2JFGA 5TXGA 2X0FA 2DLCX 3Q9UA 4BGEA 3DEAA 3Q3IA 4XB1A 2F9MA 3H9QA 4G5OA 4HFJA 4LZPA 1OFUX 1YK1A 1N6OA 2ST1A 4E1BA 1I5EA 1L1EA 2VWPA 5KNCA 1W581 3PEYA 5CEEA 2CLSA 1ZVQA 2E4WA 2OC9A 4FOTA 1QE5A 1DMSA 1SKYE 4LZAA 2D3TA 4NE2A 1ZJ6A 4UMDA 4ZZ1A 2VKQA 3HA5A 4JC5A 2C4WA 2VYNA 3B3QA 1F51E 3FDXA 2ZR9A 4TWBA 5EIHA 1N8NA 2BKEA 4HH3C 2CBXA 1G4HA 4A0SA 4DTIA 4ZEVA 2IZ1A 1U0RA 3NVAA 3UCEA 4HYQA 1Z6TA 2OQIA 2FI1A 3NOXA 5EJ7A 2F8LA 4F2WA 3GW8A 3PD7A 1WL8A 1DTWA 3ND5A 3ROEA 3UWPA 3KQKA 3EEIA 1N5RA 4WX2B 3PFKA 3HJGA 4AUKA 3M6UA 1X6VA 4Q4JA 1QGED 4UCQA 2J3JA 4B6SA 2BUAA 1ZQ9A 4M53A 4L5IA 1GZ5A 5E4FA 5E7QA 3BILA 3ISVA 5DSXA 4E14A 4UM9B 3I0MA 4J07A 5IKOA 3NETA 4AO8A 4NCNA 2VTBA 5ALLA 1CRZA 4E32A 1KOGA 1QXSA 1HDOA 3R3SA 3USZA 2JFYA 4J0KA 1ZNZA 4ACAA 2J30A 2E5WA 4DJJA 1S1MA 1Y7TA 2IHZA 3VC7A 1E6WA 1QC5A 3EN0A 4P92A 3FPEA 2GNAA 4X61A 3EUEA 3FVQA 2SHKA 3M4YA 4JBGA 3RUIA 2G83A 2NZVG 2OAP1 3V1LA 3O1LA 1QONA 4FEYA 3YASA 2PU7A 4HKTA 4PYJA 2QVLA 2UZ0A 4TXMA 4V0RA 2PG3A 1JS1X 3FM9A 4LJ5A 4Q1BA 1NVFA 4Q9DA 3TZ6A 3DM9B 1Y81A 5ECWA 2ECKA 3EZGA 3X1JA 2JFWA 1ZKMA 4IXTA 3RAGA 2EARA 4DF3A 3DE2X 4Q7JB 3USES 4DGQA 3BA6A 3CTPA 4XTRA 1Q7EA 1AZWA 1C7FA 1U8FO 1VHTA 3PCRB 4YJ3F 4LF8B 1VJRA 1JDNA 2M2IA 2NYRA 3HN6A 3WG9A 3X1ZA 2GDZA 4K6OA 2BGNA 2R1VA 4R1OA 2ZROA 3NBZC 4MJ3A 2I03A 2O8DA 3WRXA 3CUEF 1K3TA 4D3SA 4XUCA 4DA0A 4DMKA 5KYUB 2Q3CA 4BMYA 4TS3A 4JBHA 4C1BA 4FK8A 1UT6A 3GJYA 1JKIA 1H6AA 4JAVC 1CX9B 4X85A 4P6VF 1GAQA 2EERA 5DYTA 4F92B 4WFKA 2Q27A 3IFSA 2ATVA 4MI9A 2GBLA 4MICA 4FKZA 4GKJB 3V8RA 4YRMA 1FJXA 5FO0A 4C05A 1C1DB 1JEDA 9ATCA 1NYLA 2GZ3A 5KDLA 2A9PA 4FE4A 3ZVKA 1Q0UA 2RBKA 4TXLA 4OHOA 2AFRA 4I5FA 3ZWAA 3WMEA 1LS1A 1ACJA 1KK1A 1W52X 1PWXA 4QXOA 2HRZA 3HMQA 2RC6A 2VHYA 5JH7A 2QR5A 1OREA 2GBGA 2HZBA 3EXIA 5TQ2B 1BE8A 1PR9A 3B9PA 3CE6A 2Z56A 1QVWA 2C9CA 2FDRA 1XXHA 3GVIA 3DBOB 1N6NA 3H5WA 1YA4A 3HXLA 1X80A 3KQMA 4Q24A 5F9FA 1F7VA 1YQGA 1X1BA 4BNUA 4FMCB 1G5PA 1XZPA 2W98A 3BK7A 4KK3A 4OHBA 4WW0A 1V8BA 4B8YA 5IK2D 2GN1A 3AIIA 1PJTA 2OXFA 3HBLA 4N6OA 5F23A 5FUYA 3AF1A 1PDVA 1SOWA 2DBYA 3F3YA 3VR1A 4ACBA 4X93A 4A5OA 2P2ZA 3PHCA 4MYSA 1OLUB 3HV0A 3B3GA 1C0KA 1P1IA 1NJ6A 2V7TA 3B3JA 4WVFA 3RPEA 2C7RA 1L5HB 2GRUA 2IL1A 2JIZD 2ODPA 1BG6A 3ND6A 3NNNA 3VPFA 2YDXA 2C42A 2IA5A 3RBXA 1JKXA 2HWKA 4BNNA 1JJIA 4QHTA 2Y8EA 4OYRA 4B3HA 1JDUA 1I5OA 5AIBA 4UUAA 4DDWA 3HWSA 3UB2A 5CUQA 4MMXB 4DQVA 4MPDA 3O8OA 1REQA 2ORED 3KVVA 3HVKA 4MHTA 4EUKA 3RS7A 5BWLA 1II9A 2PCLA 4IHQA 4L8FA 4P53A 1ZEMA 2PJZA 1U7OA 2XDAA 4X3CA 4YH1A 3QUSA 4FD2A 1WM1A 4OHCA 5ITVA 5GIPE 1XHLA 2CZGA 1Z5WA 1TKBA 4IMPA 1EGQA 4Q9LA 3VNVA 4ERNA 1RNLA 1KI4A 1OI7A 3VNSA 3ZU6A 5DHSA 5G3ZA 1N1EA 2XDQB 4MKFA 1N2JA 1N0HA 3EXHC 1G17A 1W35A 2X3YA 1SCUB 3EH2A 2PZAA 3M5CA 1YFLA 1RLMA 1NV8A 4I2NA 1PL6A 3M6VA 1T26A 5KOHB 4K9PA 2R25B 5FL3A 3H97A 3EZFA 4MTCA 3WNCA 3NHMA 3VVBA 5AW3A 3EEOA 1V48A 1VKOA 2JDIA 2REOA 1E7MA 3LPDA 3OZIA 4D7AA 3IQWA 1EBFA 4PFJA 4QDXA 5G1OA 4RY9A 1JHDA 4N9QA 3A11A 3KJFA 1XZMA 3DM5A 1P73A 5LD2C 5DISB 4ABTA 5EE5B 5KC8A 3LT5A 1TVKB 2GYVA 2IU3A 4B44A 3N7AA 1XEXA 3DZDA 2A7XA 2ZPTX 3GA5A 3GFVA 4J43A 4RHCA 4TMKA 5FTMA 3VZQA 1A4XA 4WV3A 5K4HA 1H2HA 2HF9A 3NWPA 1T36B 1XLUA 1LBEA 4V3CA 5FL7A 2H1FA 2DFDA 1PK8A 4QL3A 2UZ4A 1X13A 2PAFA 4TV9F 1B93A 5AKIA 2I7TA 4N3GA 4MV4A 1XJCA 4R9SA 2FP3A 1W36C 2HJWA 2H08A 4KUHA 3DVQX 1Y33E 3I6QA 3N6XA 4RK1A 4ZVTA 4P4GA 4PIPA 1JFVA 1KMMA 1RHMA 2R6R1 1OU4A 2IYSA 3OQIA 5AIAA 2QTNA 1XNHA 4G81A 4JP5A 4EZEA 3TUJC 3G2PA 3UOAB 2OOKA 3BQMB 3VZCA 4HBGA 2FH5B 2EBFX 2IZOA 4QUEA 4RA6A 1JFRA 1U2ZA 3LFHA 5JO9A 4WINA 5E8JA 4A10A 1L4KA 4R1NA 1VJ5A 2WPDA 1P60A 5HKOA 5SZJA 2SKEA 4AYWA 3EXEB 5IYZF 1BYIA 2YVKA 4QEKA 3PNPA 1W5TA 2JLRA 3FE2A 1PGQA 1OHHD 2QT1A 3L0YA 4JBXA 5D5PA 4DCPA 4DREA 2PANA 5LVAA 1ZONA 1RZRD 4JUDX 4WXYB 3T7CA 3VU9B 1GG2A 4EGCB 3DD5A 1W1WA 4PRZA 4EMSA 1EUCA 1VP9A 3OQ6A 1NR7A 1XCLA 2G6TA 3AEZA 5SICE 3BL6A 1F14A 5JVDA 3E9RA 3I05A 2WVHA 3TLKA 4UVGA 4B3IA 2Y2UA 1I7LA 2PIDA 3ACCA 4HN9A 2FPIB 2RHCA 5F7OA 4H0CA 1PJAA 1IEXA 3BWBA 3OZEA 4JQSA 3U3DA 4RKEA 1OWNA 4JVMA 3ZLBA 2E5LB 1V5IA 4EYQA 1NBEA 4UMFA 1N2ZA 1PQUA 4FFOA 4ZZ0A 5CFOA 1KR5A 3U3RA 1CF9A 1T2UA 4J7CA 7MDHA 2VDJA 4Z5XA 1KBZA 3AHGA 4NZYA 4LC0A 4U7GA 4BGUA 3LVRE 4JMLA 3PGLA 4Y6PA 2C9DA 4GW3A 4YDHB 5AW8A 1LNSA 4ESVA 4IO0A 4RF2A 4PYLA 2P1ZA 1MQSA 1SBCA 4LS3A 3CIFA 1OYWA 1N1GA 3BG5A 4M9ZA 2DFKB 1UZMA 2JANA 5KWEA 3MTGA 5BSRA 3K0CC 1SU7A 2B4RO 1Z74A 1T2FA 4DT1A 4RVSA 3ODGA 4XQEA 4D0LB 4EG1A 1QGUB 1FUYB 4OHYA 2ZJ7A 4XLLA 2EC5A 4W7SA 1LTHR 4FCCA 2GAJA 2DUWA 1J24A 4IL5A 5H3CA 4R3NA 2XYGA 4E4TA 2E82A 5JZBA 2Y71A 3IOCA 4MV9A 4LFAB 1DJMA 3CH6A 1UM9A 3GJ4A 3NJ4A 2OO5C 1MUUA 2X86A 1E3SA 2XEXA 3GEMA 1JPNA 3GRFA 4JYBA 4L4ZA 4P3YA 4RADA 4MO2A 1M72A 4A5SA 4ZHQA 1OJLA 4D8WA 3OTQA 5J4HA 1X77A 3H1AA 1NW4A 2ZRQA 4AY6A 1H1TA 5FFNA 1RMYA 4AN4A 2NO9A 1U8ZA 2JGMA 4F2DA 5FNVA 2VBIA 4TT8A 4BVLA 4DKJA 1T5IA 3ESYA 3PDIA 4TZ0A 3DCYA 1JVNA 4BKQA 4DLUA 3NWOA 2H4ZA 3O0DA 1QO7A 5EN4A 2CLEB 1DZ3A 2Y99A 1RW4A 3MIIA 1NOIA 1E6CA 1BKDR 2BMVA 3BF7A 1NUSA 4TWJA 3X3HA 5JDIC 5GOZA 3T7SA 5CT8A 1GDTA 3EW9A 2QV7A 3KOMA 3P27A 1MAHA 1AX9A 3NTLA 1RHJA 1R4NB 2PYDA 5LOVA 2W6JA 3E1SA 3F90A 3RRMA 2WDZA 4L07A 4LXHA 4LMPA 3LCJA 3TSOA 4BBPA 3JWGA 5JROA 5BNTA 4LY3A 1IPFA 4YAIA 5DCWA 1NN3A 1TCBA 1EX9A 3O84A 1A98A 1LSSA 4J16C 3DBHB 5CCEA 4ZI7B 3DC2A 5IFKA 1JVSA 2F00A 2QLTA 2Q8NA 3RVNA 4PYIA 2RGYA 4RA9B 3UV6A 1VJ1A 4XR9A 1NF8A 1LJUA 3RIGA 4EY4A 1HE1C 1V6CA 3D3JA 4HAYA 1ADGA 3SS7X 3WZMA 1LW6E 4MS1A 4JH0A 4NOLA 3FOZA 1WQ4A 2ZOSA 4I5IA 5ERYA 4CCSA 1EE1A 1OKKA 1HZZA 2D2XA 3I6IA 3IRVA 3P0JA 3ZKAA 2BGMA 4RTOA 1MO4A 2H2WA 2HN9A 4CKCB 5JCZA 3HWX1 3MWLA 3G8CA 2VO1A 2ERYA 2QK4A 1KERA 2C5GA 1OROA 5L45A 2QQ0A 3I23A 4E0BA 3O4VA 3VU3A 2GOYA 3SBEA 2EJVA 3NAGA 4CT0A 4CYMA 1BIFA 1ISFA 3B78A 4LJ6A 2YINC 3DBRA 3HG7A 1O6GA 4AMGA 1YBVA 4D6XA 1GAWA 4QG3A 3U4AA 1CR4A 2JGFA 2MU1A 1YRBA 1IVNA 2P2DA 3JYHA 3Q3JB 3WLSA 4D4HA 2WWYA 2WV9A 3KAJA 3IVXA 3OPMA 2KPOA 5CM9C 3WK4A 3OKAA 3G0CA 3UAXA 2UUAB 3S55A 4GOMD 4MVXA 5FBRB 3W7VA 1WCYA 3BGSA 3G9TA 4XI9A 4YP7A 2ZB7A 4BO9A 4KKVA 1Q95A 3PUXA 1H94A 1NXOA 4WUTA 4KUGA 2JK0A 3DJFA 1UXJA 1OXBB 4FB4A 2PLWA 3QKWA 8ATCA 5JMTA 1EGVB 3I2FA 4CCYA 3ESCA 3L4JA 2PX4A 5DNDA 5AVUA 5FH9A 2WSBA 1LBSA 1C3XA 4OJKA 5FHQA 4XPZA 2ZM6B 1DPFA 2C99A 4RULA 3KSUA 1RHUA 2Y77A 1KF0A 3GLVA 4XDYA 4DFDA 2Y1LA 1E3WA 3BRCA 2O0LA 3FUUA 1KH2A 1YL7A 2IT1A 4TTSA 2PUHA 3NIBA 2CUTA 3BORA 2G9NA 4BASA 3Q8MA 5IBRA 3IVCA 4P7GA 4UW9A 4Z4IA 3PHHA 2Z2JA 4D3DA 2FMFA 2Z1NA 2ZKIA 3DZFA 3H13A 2GEFA 3DDOA 1KI6B 1UPCA 5BWNA 2OWEA 3IV6A 5JWOA 2N47A 2GK7A 4B83A 3EXG2 1KO8A 3N6RA 1S9HA 1E58A 3A1FA 2XODA 5ADVA 3V3KA 1FYDA 4E88A 1C3OB 4H1UA 2B9VA 1ZD1A 2HFKA 4RVNA 2UYCA 3M4ZA 2ZU0C 4ZQEA 3PP8A 3JATA 3IJPA 2H4FA 3CU5A 2BH9A 5LQKA 1RAHA 2WJZB 3T1NA 1WDMA 2YWCA 5AXBA 4MRMB 4MJXA 4PSCA 3PEUA 5ALUA 3N59A 4YRKA 3IQIX 3LJKA 3BE8A 1LCIA 3IIMA 1QGYA 1UKCA 4WOCA 5HKBA 2IUEA 1E20A 3CLTD 4I3FA 4E5MA 4F8JA 1TUGA 4LOLA 4JJGA 4Q02A 1OCEA 1ECGA 3D43A 3FPSA 2XVYA 1JWLA 3BMCB 1AQYA 2A9KA 1Z33A 3CC8A 1XU9A 3OZRA 1KI1A 1N2BA 1OVMA 4Q01A 3TLCA 3CJQA 1A96A 9MHTA 2W6OA 2EEPA 3PJDA 3A32A 5AMXA 4OX9B 4BNFA 2PSFA 1IZ9A 1LDMA 3GWZA 4CMJA 3C85A 2P4SA 2H31A 3EC2A 3HRIA 3N87A 2DSNA 1JG6A 1BW9A 4J0IA 3UATA 2DFVA 4X1IB 3P4UA 5AVKA 2O8FA 4XM1A 5JOQA 2XNHA 2I54A 3H1BA 3JV7A 5FO1A 2C0QA 3OZAA 3KQPA 4BECA 1NLUA 5IAEA 1VLJA 2YDYA 3HFGA 3HN2A 4NX2A 2X1LA 5I7OA 2AWOA 4FT2A 3NAZA 2IBSA 1TW2A 4K81B 4OKSA 4XKJA 2GA9A 2ECFA 2DERA 3RIXA 4YJ3A 4LOAA 5J63A 5HF5A 2POCA 2LKCA 5FEMA 2V4ZA 3WLMA 4G6ZA 3FNGA 3AKYA 4UDOA 4KPFC 4KREA 1K1EA 5DHRA 1U4SA 3K5IA 3UQZA 2BM8A 5EZYF 5JCOA 4BWYA 1PR2A 1BN6A 3GOQA 4EY6A 4X5OA 3AHCA 4K0RA 2XUZA 2IHKA 4HWRA 3W2HA 5KSWB 4WOKA 4K1LA 3E9NA 3KQTA 4LJKA 5CDTA 2V1XA 2RJOA 2VT3A 3DSRA 3TBHA 1SK8A 5AKZA 4HNUA 1D4ZA 2ZJOA 1HNXB 1GKYA 3RANA 1Q91A 4LJRA 2RHJA 4RK6A 5DTEA 4P3PA 1W7AA 3IDAA 1ZYUA 1TRKA 4L15A 4CODB 1LDGA 2J32A 1IQRA 1UBTS 4MUIA 4Z2AA 1KBOA 2FSVC 2VTEA 4G41A 3W8RA 1E3TA 2WTAA 4CWAA 4HDNB 4RY8A 2L17A 2BP7A 1M2VB 2GZAA 1L9KA 2VRCA 1WMBA 2ZJ6A 2PIAA 1IXSB 3PFHA 2DBRA 1J7JA 2Z4SA 4YAEA 4UM5A 1T6NA 3EGWA 5ALYA 3ZTTA 2HWXA 3KTAB 1AGRA 4MIOA 1XX6A 5IJAA 3Q3CA 4UBOA 4N0QA 1XD2B 2H3EA 2J6IA 1U2DC 3OTHA 4ZO8A 1DEXA 5KAPA 5C80A 3OTGA 4OOFA 5EKTA 3LX8A 4DG8A 3CTMA 4TT3D 3ICCA 1Z5NA 4WESB 1H2EA 4AMZA 4F86A 9LDTA 5GADl 3S5JA 3HZRA 4XEHA 4KQXA 1WG8A 2IK8A 2Z4RA 2XQJA 5JXJA 2ZI9A 5SZHB 4QOHA 3KWFA 4ZRNA 5C5IA 3K35A 1ZW6A 2FA9A 5EC8A 1XD8A 4I4LA 4KQ2A 1TFRA 3BFVA 3B20A 4OA5A 5FWYB 1TZCA 2XYPA 4L85A 1E1KA 4G8CA 4DCNA 2Y93A 2G3YA 1Y5LA 3VBCA 4FW9A 5JSZB 2ZZMA 4JBYA 3HZZA 5K45A 4HTFB 2PUWA 4OQMA 4ZCRA 2XUQA 3I61A 5IWCA 2XDYA 3KHSA 3E1GA 4AICA 1Z63A 1F2UA 1L7RA 1LQUA 1UWCA 4EZBA 5SV2A 2IGTA 1GP2A 2NXEA 1GNSA 2VXBA 3SHVA 2CCKA 3PL1A 1LZKA 2FUNB 1L4UA 1H0SA 1EQAA 2I33A 2W2PA 4XB2A 4A91A 2O8NA 1JDTA 3THYB 4B6GA 4ICIA 1IUNA 1UBEA 1YCFA 4KN9S 2C8JA 1M2KA 3OCWA 3U39A 1OB2A 1QYIA 4M8LA 3HWRA 4IRMA 4ODIA 2I71A 5HRUA 1QHGA 4QPPA 4E21A 2J7KA 1O89A 3VYRB 1PJBA 3MOSA 4WLUA 2WSIA 4CF7A 1N75A 4GMHA 3PNVA 1NUTA 2YNMA 3U4CA 3TNLA 4NU8X 4CV0A 1ZD2P 1SB8A 3RSQA 1XLVA 3PBKA 3U60B 1CJKC 3PUJA 3R5XA 2I2FA 3LBHA 4NBTA 1CB0A 2PV7A 5EGNA 1YZHA 3QU9A 4KE8A 2ODNA 1SKAA 5LQMA 3FYHA 4OQNA 1G18A 1ZSYA 2YHIB 3A31A 4JYZA 4EHIA 4B3TB 2ZYGA 2X1MA 5K0ZA 2O8CB 1CCWA 1SUCA 3U7QA 3GHHA 1UFOA 2Q99A 3KD2A 3IBYA 5E7MA 4JN6B 3I9KA 3RB8A 2ORWA 2CFIA 4M9RA 4ZKEA 3NWEA 1YR1A 5TX7A 1A2KC 3PR3A 4B09A 5HK9A 2EL7A 3KKMA 4TV9A 4EAQA 4BO8A 2HDOA 1C4WA 4K6CA 4CEIB 1V3UA 1ZGZA 3K32A 3QKTA 4GNKA 1FFWA 3KSRA 4MVJP 2I4IA 3O8QB 2PMDA 3HU5A 1FDWA 4PHHA 1S2LA 2AF3C 5JXIA 5C8XA 2XIQA 2KX7A 1KFBB 3R0ZA 3PZRA 3A2NA 3HCEA 3SI7A 4CIXA 3NEAA 2WWHA 1CERA 1HX7A 3U4DA 1W0JA 2BDEA 4MKRA 2HA3A 3VSDA 5HBRA 1R4MA 3J80A 3SF8B 1GILA 4TRRA 5I3ZA 3FTEA 2H0AA 3O2JA 1FUKA 2W9XA 3OM1A 5BSUA 3WHKA 5CFPA 5HSGA 1IVSA 4FJ0A 2IBTA 5IYZA 1UOOA 3K30A 4DA6A 3IBSA 4HLNA 3OQHA 4JVSB 3P2YA 1TM3E 1DQRA 1Z6QA 2PRKA 4XSGA 3JXEA 1IRIA 3M6LA 1XWFA 3G2QA 1ECJA 2P3LA 4IXDA 4C5AA 1CRQA 4RENA 4S1TA 3VO1A 3I0ZA 4OJYA 1EX1A 1XTUA 3CEHA 4YN3A 4EEXA 3I2GA 3PZBA 4RQUA 3R7DA 1V9SA 4AK9A 4IIJF 4L6AA 4YV1A 4ND4A 3H4VA 2X22A 4UEWA 5LDDC 4DCSA 1KMIY 1T4CB 3E2IA 5TQJA 2FG5A 4EI9A 1BNCA 2IYYA 2OHGA 4K05A 2GUWA 4OIFA 3AIOA 2AOTB 2DTEA 4BUJA 1O97C 2UYHA 2IV7A 3WL3A 3AB8A 3HYNA 4OCZA 1K4MA 1QR2A 3RIEA 3SZGA 3WI7A 1G20A 4Y8VA 1IDN1 5EYPA 5BMVF 3CH7A 3WE7A 1AS2A 1NONA 4S2EA 2ALJA 2OBMA 3V33A 1VDMA 1V6SA 1GFSA 1X1RA 1XDSA 2QTGA 5DHAA 3WGTA 1BDJA 4BHTA 4NSNA 1CZNA 4HQ0A 1NRIA 1RXWA 2EYQA 3NHWA 2XJ4A 2YHBA 1P4RA 2JHGA 1FUEA 4UHKA 1EJBA 3CEAA 4RIIA 1AKEA 5ECYA 4XVHA 4JUAA 4F38A 2P0EA 4DL9A 3G7UA 3DULA 2WFZA 1Y80A 2ZJBA 3I3SR 1PG5A 2R6GA 1V9CA 2XOKA 1IY9A 1GNPA 2EFCB 4LVCA 3K05A 4E46A 1W5AA 5JW6A 2QRZA 2R1ZA 1OFHA 3JQ9C 1SPBS 3PQDA 4K26A 3NI2A 3K8OE 3QKRB 2A0KA 3BGVA 4EUEA 1RLOA 2Z4TA 4OKNA 4QYXA 1LRJA 3RG8A 4EHDA 4DLXA 5HXAA 3ECCA 1HBJA 1P74A 1WWKA 1GKLA 5EE9A 1E5QA 1IJKA 2Q5LA 3PE3A 5I8WA 3UF0A 1BCRB 3M9WA 3R0IA 1TE2A 3H1GA 1FXWF 1X2EA 3U26A 1J8VA 4XDGA 4Q9HA 1D6MA 5K8JB 2ZJZA 1P1CA 1GTL1 2X58A 1K0FA 1L5LA 2AJDA 4RLHA 5K3BA 1RLJA 3EG9A 3D4OA 3HSSA 4UUMA 2OLKA 1POWA 2YYZA 4YCDA 3C43A 2VUHB 2ZDQA 4R81A 5D3MB 2B69A 2QPAA 3EMVA 3VHXB 1ZSNA 3BRWD 3I92A 2EAUA 5FWXA 1SIOA 3KTFA 4N3CA 3DOJA 5PNTA 3SJCA 5HQTA 3S8EA 4IR7A 3U3OA 2C9BA 2VDLB 3A70A 3KR0A 1G8KA 1XZFA 2VP2A 4CBVA 3PLNA 4TMFA 4QE3A 1P45A 1CDDA 1KK3A 1GZ6A 4IVRA 1A7JA 4N48A 3KKQA 4BCCA 2JCGA 4FE3A 3V80A 1B23P 1DIHA 1DQNA 3M1YA 4GFDA 5HNKA 3DS8A 2H2GA 3ASUA 4NG5A 1G8MA 3R3JA 4TMWA 4WJLA 4HYTA 3MUOA 3BCSA 5GZ1A 4IIVA 4PHTA 1N8TA 2DPHA 1CHDA 1FTNA 3OFKA 4RVHA 4WKCA 3GUVA 4WZBA 1H8HD 2C2YA 2QMZA 4UPDA 3BXEA 1VG8A 3DUFA 2WJ4A 3C3YA 3PRHA 2E4VA 2FX5A 3AV3A 1GZHB 3I9V6 5C34B 1E2IA 2WJYA 3VZBA 1JIXA 3CNEA 3CBQA 5IMSA 3TIXB 3U7FB 1MVOA 5BPFA 2J5QA 1DKQA 2FW7A 4TXHA 1NE2A 2ILTA 5JXGA 2LPMA 1T3HA 1ZP6A 2GEVA 2JCBA 3BZBA 5HIMA 1XTVA 2XCOA 4AJHA 4AQYB 4LRWA 2B3TA 4D0GA 1XAJA 3RLIA 1E2GA 4N76A 4QDZA 4TV8F 1NVAA 1SG0A 5CPFA 1KO1A 3ORHA 3HZHA 3V1NA 2KWIA 2C82A 3C5EA 3IAHA 3N76A 1FMFA 1EFCA 2Q6IA 1XL1A 2X7JA 3LT4A 1R8JA 4XWKA 4QD3A 2H5LA 3QY9A 4RVGA 1AO0A 1GLNA 4Y98A 5TDHA 2IXDA 2H1OA 1PLJA 1TUBB 4L9WA 3SC6A 4ZMSA 1RYMA 3OPNA 1WNFA 4JGIA 3BFXA 2NSYA 5KWIA 2ZIWB 4BC0A 5J59A 4H9GA 3PUWA 3RSFA 1M6YA 5EVJA 4CEHB 1OQAA 3OE5A 4UBJA 2DWQA 3GEDA 4XLTA 5JS6A 3AVQA 4OGWA 2PNFA 3JCZA 5JJCA 4CMBA 3GFPA 4BDSA 4F4JA 1QHFA 1KJYA 5K99A 2VNHA 3F5MA 1KOJA 2C7VA 4IDNA 4UASA 5KQMA 4KAXA 1Z2NX 4E6PA 1AQ6A 1WO8A 1GZVA 4BZPA 4GXQA 1NVWQ 1U5BB 2V59A 3LGSA 4PV7A 4RFVA 2JLXA 4BIIA 5AXAA 4K6GA 2BMFA 3B8EA 1SQFA 2A35A 2H1IA 5EWLA 5AHRA 1T0PA 1U6JA 1WEKA 3E3NA 1JJ7A 1OX4B 2FHPA 2UYQA 2X9GA 4M8SA 2A9OA 3G8BA 1S6YA 2Q5FA 1OY1A 2WTXA 3AJ8A 4KFCA 3UO8B 3UWDA 1KZ7B 2ZCJA 1ABEA 4YT4A 3GVPA 1DCKA 5NULA 4IFBA 3BD9A 3JARB 3IKLA 1I4TD 1ZMXA 4ZICA 4FFBA 3DEIA 4MEAA 2JD1A 5BYKA 2BC9A 4JL5A 4MR7B 4P5EA 3BD8A 2ODAA 1SVIA 3KB8A 4P2BA 5F2KA 3ZIDA 4DDMA 5JFOA 3R6WA 1EEXB 5DM70 1E7YA 1E18A 1FRZA 5U4QA 4ZCMA 1KEEA 2JJQA 3BD6A 3LCRA 3K9FC 3T3DA 1LB1B 1P17A 3E3MA 3ESRA 4YPVA 5JR3A 1M8KA 1CEYA 4E4YA 5BN5A 4EEZA 1VJTA 3NKFA 1BXGB 1DJPA 2ACVA 4II3A 1XU7A 2CLKB 2ON6A 4FFWA 4CPDA 1UDCA 2YJ3A 1A8PA 3LLMA 1TC2A 2WM8A 5DHUA 5C8ZA 5IJWA 1JEYB 1FDVA 1WKCA 2OORA 2YOFA 1T1GA 1QVRA 3O3MB 3UBTA 5DHTA 2IS2A 2EFEB 4PC7A 5KYWB 1VRWA 2RGEA 4HAUA 2NO6A 5ILQA 4O2RA 5FBVB 3WYNA 5ALWA 5F51A 1PAUA 4BMXA 3BTUA 5EPOA 3KALA 2UVQA 3GEIA 2EW2A 1P9WA 4M1EA 3GLGB 2FE1A 3QLUA 3KHUA 4WDRA 2W83A 3GJ0A 3NKLA 1QWSA 1ZM3A 1VPVA 3G8YA 4KO8A 1DT3A 1XF1A 2Z1MA 5ICEA 4L76A 5JNWA 1FEZA 2FOIA 3HKDB 1C9JA 2QWXA 2W4IA 4M0KA 4M1MA 3THRA 4C7VA 5JLAA 1NM5A 2HK9A 3CNBA 2CXOA 2VXYA 5HP4A 5A0TA 2ZRFA 5JWHA 3AF6A 3FH0A 5CXQA 3UA4A 1PL7A 4U2DA 1JKMA 1P0MA 4Y6OA 2XYHA 3ZHQA 1Z45A 2CVOA 3JVVA 1P1RA 3VI3B 2WP0A 4AMUA 2LGJA 2QTVB 2BE9A 4C7BA 1NI5A 4ARAA 3HGQA 5ITZA 1A7KA 3HI6A 4GM1A 4MWBA 3PUKA 4WEOA 3EWAA 3FB4A 4HUQA 5BSKA 4K1XA 2A9FA 3OWOA 1T5TA 5A3JA 3HCAA 4EYEA 4RHEA 3TTWA 2XB4A 1EK5A 1KP2A 3QP9A 4CEJA 1L5FA 4R8KA 1NDQA 5BOSB 3SK0A 5K6AC 2NO4A 5B2FA 4NR0A 3ZHVA 3WIOA 2PLAA 1QHIA 3P9ZA 2IDJA 3IXMA 3RUAA 3JALB 4ITUA 4D02A 2XKKA 1YK0A 3EQ2A 4LIPD 1HMYA 1O6ZA 3WIVA 1EUYA 4NXNB 1K98A 3BGDA 8LDHA 1QCYA 2FSHA 3RFTA 4XW2A 5I7WA 4C0LA 2FR0A 2GGSA 2YV2A 1BEZA 2WTMA 5FBLB 4DUGA 3D5QA 3CVYA 4V0NA 4HGPA 4LVOA 4YLEA 3EIQA 2G1KA 1D1PA 3KDAA 2OAEA 3QPUA 1WLSA