2RSLA

Refinement of gamma delta resolvase reveals a strikingly flexible molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
115
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA DELTA-RESOLVASE
publication title Refinement of gamma delta resolvase reveals a strikingly flexible molecule.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
total genus 42
structure length 115
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rslA00
5C32A 3LHFA 5C34B 5C31A 2GM5A 2GM4A 3ILXA 1ZR4A 5C35A 3UJ3X 2RSLA 3BVPA 2R0QC 2MHCA 1ZR2A 1HX7A 3GUVA 3PKZA 3LHKA 1GDTA 3G13A 4BQQA 1GHTA
chains in the Genus database with same CATH superfamily
1HYEA 3HCOA 3TTVA 2OA0A 1PN3A 3IB3A 4TLDA 3ZGNA 4N0DA 3LPCA 3JQCA 4HDNA 1PQWA 2BH9A 3GLUA 4DSOA 1FDTA 5A3SA 5CDUA 5A5GA 2GPTA 5CFPA 3LL7A 2ATEA 1FVHA 1ZUHA 4K03A 4EELA 4ZMBA 1IOVA 3AP1A 2YNMD 9MHTA 5DLDA 1PFVA 3U7QB 3VPFA 1UMKA 3UHJA 1N1GA 3OT5A 2J48A 1KY3A 2IYWA 5J40A 3ZU3A 1E3LA 5ESDA 4KK4A 1RNLA 4UNPA 3LY7A 3I62A 2O14A 1QQBA 4CLXA 3FFBA 1W9MA 2WF7A 2GXAA 2ZRQA 3LDHA 4N3CA 3EQ9A 3QTBA 1LEHA 4Q4JA 3R44A 1XJ5A 4IKPA 5EMHA 5C7OO 1K2WA 5I4BA 3RTGA 1D6MA 1AKMA 3K6SB 3ZV7A 1M6VA 1RHQA 1L1QA 2QLFA 3G79A 2DFPA 3AETA 3KLBA 3L84A 3QOXA 2ID8A 5C3MA 5E1DA 4AZWA 5KYYA 3W5AA 4GMXA 4K9RA 4A5SA 5JD3A 1C0EA 1K3TA 3FOZA 1BU5A 1CY7A 1NLYA 2GKSA 2JF0A 3OCJA 4UU0A 2GD6A 3W2TA 2I8CA 3DBHA 3H99A 4AYWA 2V1UA 3QUCA 1DPFA 1DIGA 3TD6A 3WIUA 2ZYTX 2QRVA 1Q3KA 3EODA 3O91A 4BFWA 2FPMA 3LOUA 1TVKB 2JGIA 1HX7A 1CUJA 1I4TD 4NPHA 4PLVA 3CLVA 3DKVA 4GHWA 4DQ0A 1WX1A 1O0BA 1QP8A 3EPLA 4I50A 1VOTA 4D99A 2HUPA 2VK4A 2AW3A 1GTL1 1SU7A 5F4ZA 2FUNB 1II8A 1MAWA 4E22A 3HK2A 1AK1A 1SJ9A 4G89A 1VL2A 4ZGBA 3SEAA 5JO0A 4DQVA 1UJ4A 1Z39A 1ZRSA 3OBIA 5CDHA 1CJUC 4PZ0A 3KYCB 2O50A 3AHIA 4K26A 1JMYA 1AX9A 2NVOA 2P0YA 3H7IA 4PZYA 4ARSA 1RTKA 2C2XA 1IFXA 4PBTA 3VI3B 1NN3A 1KEKA 3O4VA 1WXEA 2JD1A 2G5GX 1NJ1A 1SCIA 1C9DB 1ZCFA 4DJTA 4BNKA 3HZRA 5KJ6A 3VH3A 1W9HA 1EDZA 2JJ1D 4HP8A 4INAA 3VSDA 4NK4A 2ZT7A 1NBWB 2BISA 4EI9A 4ETMA 4EW6A 3CHYA 1SKYB 2E87A 1YS9A 4DA9A 3MOGA 2COKA 1GNQA 4BXOB 3WGOA 2BR4A 1C30B 2HJVA 1BS9A 4FMPA 4TXLA 3HVIA 2I33A 4Q01A 4GZLA 3L0BA 2FLWA 1OYOA 1VYTA 2WK1A 1M5UA 2YY7A 1KBZA 1MEJA 3LX8A 3QEMA 3ZWPA 5EWMA 4AF7A 4B7XA 1E3IA 4UXHA 3A36A 3PD0A 3FGZA 3PGLA 1SK9A 1GZUA 1RBMA 2Q1TA 3N8KA 5KI6A 1YZLA 2EX1A 1ZW6A 4NCIA 2R62A 4RQBA 2B4KA 1OJ7A 4FZ3A 5JSYA 4DXAA 1NVGA 4NR0A 2IYQA 3U7RA 4DG8A 2VAMA 5I7VA 3FG9A 4U2BA 1DWOA 5EJ5A 1NUQA 2J3JA 4Y1RB 2TMDA 3KZCA 5E6RB 4LF8B 3H1PA 4LRSB 2FHSA 3IEXA 3CEMA 2ORED 4MA4A 4B6QA 2FCAA 5AHXA 5EC8A 4MYUA 1ODCA 1M1UA 3AX6A 1S2OA 5ADHA 2J0EA 3PHJA 2GA9A 2ZE7A 4YT4A 2I22A 2NPIA 5FXMA 4CEHB 1BMDA 1D1SA 3AYXB 3L4KA 2RGWA 3D43A 3I8XA 1X2EA 1ODSA 1DDIA 4UCQA 1JXMA 1HO3A 4PNPA 1IY8A 2CVHA 3CEPB 1U3VA 2V59A 1S2LA 2HMVA 2YINC 2LKCA 3Q5EA 4IO1A 3TW8A 4JJ4A 4TV9A 1PJZA 4MIKA 4Z7QB 2PD6A 3AY0A 5KTSA 4JI8B 1CE8B 3T0GA 2OXEA 3A6FA 1CT9A 5HXAA 2YUIA 3EPHA 1T4DA 1IBLB 1H93A 1I4WA 4HFRA 3REQA 3K9NA 2QMEA 4BNWA 1AGNA 1Y6ZA 4JCCA 3AILA 4Q1CA 3M6XA 4Y2GA 5FJIA 4BQOA 2X6QA 4Z7NB 1AOXA 1T4GA 2F43B 4OLAA 1NDHA 4G5XA 4CF4A 3VYWA 4QKQA 3GDFA 3OU7A 1L5YA 1THZA 4IQ8A 2Z8YA 4KREA 4KX5A 4XASA 4O2AB 2DP4E 3SZGA 1EP9A 3W3AD 4QUDA 4WN3A 2HIAA 4QUBA 1R0BA 3RI3A 3OOSA 4BGDA 4CEIA 1XYGA 4ED9A 2OORA 5KKAA 5TPWA 1WF3A 4QQKA 5DSXA 4OQMA 5EMNA 4QYTA 3AMVA 1JDBC 3T5GA 4NZZA 1ZK1A 3WQRA 1PZMA 2OLKA 1PV4A 2GMWA 1Q1AA 3FOEC 4ES6A 3PSHA 3PEFA 3JPYA 3RYHA 4B3GA 1HLDA 2BUAA 2W2OA 3V2GA 5LKRA 1ZD8A 1RFGE 4L0DA 1DJOA 2V7TA 4WX2B 1S2GA 1PL0A 3OZEA 4MVJH 4KOEC 3RK4A 3BWYA 1OWLA 4G5OA 3VAYA 1KQFA 5IABA 2K6GA 2WTBA 2NO5A 5JDIC 1K97A 4UJ5A 1WNTA 3EEOA 2OFOA 4L4ZA 2P9TA 1RVDA 1D1TA 2MSEB 2PSFA 4D4LA 1T5DX 3AY3A 4A03A 4BFLA 2P27A 3MTQA 2VPZA 3K8YA 1PQYA 3MINA 4RQAA 4AB1A 1USUA 2ZREA 4NENB 5KWEA 4WLVA 2I8AA 3RVLA 4WFJA 4BMSA 4YUVA 3ETCA 3EIOA 3DEKA 4YRJA 1N7HA 4EKDA 1DRUA 4WOBA 1UMBB 2IYVA 3IMCA 1FTNA 4IEIA 2BGGA 2B4QA 3PB3A 3JQRA 3L4SO 3MGKA 1YZ3A 3K2QA 4LKRA 5EIBC 1PKEA 1CWUA 1XTQA 2P90A 3K1YA 4DUGD 2V0GA 1D2HA 3ANMA 2QD4A 1U9YA 4WZ6A 4EKIA 3QZUA 4UKDA 3NV9A 2C3OA 1NVMB 2Q3JA 1GEGA 2OZVA 1OW3B 3TOZA 2ATVA 4B6FA 2HMWA 5CLHA 4TTPA 2XHZA 4S2UA 4KVFA 3IIMA 5GOTA 4YRKA 4NMLA 2QE7D 1NVEA 3OUZA 3QU5A 1U2TA 1VL5A 1FJGB 3QSYA 1N8TA 4BTEA 2Y1WA 3DEYX 5K0TA 1D2EA 3NAMA 1O94A 1OFUA 2AKYA 3ZCQA 3O4RA 1T5LA 4RD6A 1PR6A 2P4SA 2RAVA 3FDJA 4OOFA 4R9VA 3ORFA 4KB5A 4GX1A 4RVFA 1IEWA 1O6GA 1VPVA 4X95A 5G3YA 5K3BA 4C89A 5I47A 2MSKA 4GDFA 3LBNA 4E5VA 4MUYA 4U00A 5HDBB 1FQWA 2EIHA 2MIIA 1CY4A 3D8SA 3MAJA 5EGSA 4I1VA 4IZIA 1IY0A 1SZDA 2D3TA 2RG1A 2VK1A 5E4FA 4EMTA 2F4VB 1ONNA 4GS5A 5P8WA 4F8EA 1NQWA 3QBEA 4EF5A 3D1LA 1KVQA 3HWX1 4YLEA 1EK2A 2C9YA 4UHEA 1QV7A 1GNRA 5BMVA 3AF6A 2H65A 3H05A 4PGMA 5ANRB 2ABWA 4EPRA 3QLTA 5J4YA 3FTCA 1ZJ6A 1DTWA 3I5UA 1Z4JA 1TYDE 5I51A 4LHVA 1VBNA 4A91A 1T2UA 2Z4RA 4TLAA 3RNLA 1CUWA 2CNLA 3KLNA 4G07A 4FBLA 4X0EA 4YDQA 2J67A 2QRQA 2ZUDA 2ZQ5A 3OTHA 2FSIA 5IKMA 1AXEA 2JJ2D 2IXGA 2Y9PB 3L8GA 4Y0VA 2DX7A 4E4TA 1SUPA 3KJIA 4CR8A 1SIWA 2O3TA 3O4GA 3ZBTA 1F3LA 3AF0A 3R23A 4C06A 4F04A 1J8YF 2W6PA 4A2WA 3OEEA 5TMPA 1G2IA 1Y33E 1GUAA 2H52A 2VSQA 4BJ1A 4G8CA 3QA9A 1BEZA 4ACBA 5KTKA 3ZWCA 2EZ8A 4CNQA 2QROA 3UMBA 1U4SA 4GR9A 3BA6A 3IAS6 5FUMA 1M10A 2AW5A 4JVLA 4KSYA 3IP6A 3KQKA 1FTSA 1TB4A 1HBJA 4PLHA 3WRXC 4C5AA 3R7WB 1E2LA 3KEFA 1YFJA 4DNOA 4Q3DA 2WSSD 1WM1A 3DWGA 4HEHA 2J5KA 2VJPA 1AN0A 3BZBA 5ALRA 4BGIA 5H81A 1SOUA 3WR5A 4NICA 4D02A 1KMMA 2JJ8A 2K87A 3GEEA 1E1DA 4FHCA 1MX5A 4NYJR 4RFSA 5JPCA 5GM1A 3RC8A 2V98A 3IIEA 4J9UE 5B3KA 4F8YA 2CLEB 3KZOA 4WASA 4MKZA 2KWIA 3P0RA 4M0EA 5LU8A 1L5ZA 4PQYA 5FFNA 4Z9BA 2D5BA 3DEJA 4C3UA 1G18A 1VKHA 5BQ5A 4JKYA 4PLFA 2RAPA 3BTSA 3KL2A 3SC3A 3V34A 4ALJA 3VR2A 3WGUA 1XZPA 2C59A 2R0QC 4L78A 5TIIA 5CVVA 3TPFA 1GQSA 2H07A 1CULC 4QARA 1Y6QA 1HUQA 1X7WB 2QMQA 2OP0A 3NQ41 1FQOA 1C3LA 4KEAA 4RX1A 1QU3A 3MWGA 5AVYA 4N82A 3BGIA 3QVJA 2E7ZA 3ZXUB 4BMVA 2W58A 4RDCA 4FC7A 3U31A 4CM4A 3ZBPA 1ZICA 1J1UA 1EA5A 3E9ZA 4CV0A 1NSFA 1QK5A 2BEWA 2NUTA 1WVMA 4N7RA 2OO5A 2TSYB 2JAXA 2YXEA 1AXGA 3DBLA 3UCXA 1I4EB 1M0TA 1TCVA 1SQGA 3K9FC 2JFYA 2QZSA 4RSHA 1K1EA 4ZEXA 3UMYA 2WJZB 1VRWA 1NRIA 2C83A 2O2DA 1UZLA 1E63A 2QG6A 2ZI7A 5DM2A 4KQJA 1MG0A 3F90A 4CMIB 1L5WA 2PTHA 4X1KA 2FZCA 2WTAA 2CFCA 3RYCB 4TTSA 2V5VA 3E8XA 3GGGA 2I78A 3A27A 1GXSA 4EB6B 5ALWA 5TC4A 2GAJA 2H5EA 4C7OA 3AB3A 3AESA 3R77A 4WCFA 4NKRA 1HA3A 4L4UA 5FOQA 2C7OA 2X4LA 1SOAA 3JZFA 4GH5A 4CLOA 2ERXA 1UZUA 3GZJA 2YN0A 3UA4A 3R0XA 3LDUA 4K1LA 1E20A 2IZ6A 4L76A 4KQ6A 4B87A 4DRXB 4DYVA 5HZMA 4DV4B 3L77A 1A7AA 3OETA 4JVSB 5BWLA 2HLDD 3L6BA 1HF3A 2TMKA 5F9MA 3P0IA 1KMHA 1ZSVA 4NFYA 2IYAA 3FE2A 3RODA 3M5CA 3P9PA 4PC3A 1WUJS 1QJCA 3AIOA 4GYWA 3QWHA 3AG5A 3CNOA 3P2IA 1NN1A 2H5LA 2C4KA 2OZPA 1MJGM 2V6FA 5K99A 3K16A 4R7TA 4MKXA 5KTOA 4JENA 1QHNA 4RYDA 1MV8A 1ZN9A 4DWWA 5JJ5A 3EASA 1VLHA 2Q3FA 4AF6A 5L4NA 2V3WA 4JLPA 4MW6A 1U3TA 5JUWA 3GI1A 1E2QA 3WA7A 5H4HA 4MVJP 4WKNA 1GU1A 3D2BA 1P81A 3RVJA 1FJHA 2NU7B 2VYND 3G02A 4N0MA 3DVLA 4Q19A 4HYYA 3CURA 5KVSA 1IOWA 2Q1YA 4IXWA 4BO7A 1U7XA 1XROA 2UVDA 2J32A 3CX6A 3HI4A 1NL3A 4YS6A 4C22A 3DOEA 1UAYA 1DHRA 1UEIA 5E0OA 3VXKA 4XQEA 4TMFA 3ZI7A 2ZIUB 4ZRMA 1E1QA 5MN6A 4Q4HA 3LP5A 2GEFA 2RHMA 8AT1A 2HA7A 2XADA 2VQEB 3UAYA 4N3NA 3WLLA 1T4CB 3GEIA 1QKIA 3N1UA 3QFHA 4IUDS 1PS0A 1P7WA 2CYBA 1XXLA 3JAWA 3OIYA 4KSBA 4RXMA 4UAGA 3B2QA 1ONBA 4UM7A 1G291 2G70A 4L2IB 1H69A 3AY7A 1WVIA 3G0CA 4LZPA 3W2GA 4D6XA 4BKMA 1YHYA 5C1DA 1CNEA 5FADA 1LLQA 2IPXA 2V8BA 5J9FA 3EY4A 4LPKA 1BVHA 3AONB 2CZCA 1JQDA 1QE5A 2QORA 3IBYA 4KX3A 4MWTA 3NOXA 5BQFA 2PWAA 3C6XA 3IPXA 4YV2A 3RG8A 3EPJA 4UBNA 2BMWA 3IMKA 4LSZA 4FKBA 1CQPA 1QANA 1P9WA 3A6EA 3WX0A 4AG5A 5DTIA 4DPMA 5IT9A 2WVHA 2QZPA 4DYDA 3AJAA 2UXBB 1L6IA 2FSHA 2PKQO 3EBLA 5FPSA 5LYYA 3DB1A 4ND4A 4RESA 1R8JA 1N9GA 3PXCX 4H35A 1T9DA 4RVNA 5DTQA 1P5RA 4OU4A 4M7WA 1OX4A 2P65A 1P91A 3FUTA 5TQ0A 3S27A 5HHTA 2JLRA 3SXUB 1ML4A 3W06A 4D1YA 4M9QA 3B7PA 4EW3A 5JYBA 2BFWA 1B3RA 3GJYA 5ABPA 2WNIA 3FPEA 3Q8LA 1RZRD 1KI1A 1QH1B 2EYUA 2ZYGA 1SKBA 1YRWA 4GFDA 1IU9A 4WZBB 5JVDA 2J5QA 2UVPA 2VDOB 3IT2A 4NAHA 4DDHA 4BP1A 2GN4A 2G25A 3C85A 3RIEA 3K72B 1KTIA 3L6OO 1DSSG 3ENWA 3GX1A 3TQRA 1LPAB 5GY7A 1USGA 2HN9A 4I3FA 2GUGA 2VJMA 2BE7A 1T8UA 4PVDA 2AR0A 5BQ3A 3GGPA 3T94A 3DV0A 2Q41A 3I9LA 4IXTA 2GSDA 4XDZA 4JSRA 3MD9A 4NU5A 2WP0A 1W4AA 3V33A 1L5VA 1XDWA 4DIUA 3EISA 1Z8FA 1EWKA 3KPJA 1Z2NX 1JAXA 3F1KA 3VHQA 1GNSA 4LWOA 3WLEA 2ZWIA 4AWXA 1VA4A 3ANSA 3IOMA 4IUBS 2AOTB 1M34E 3TLYA 4DJ5X 3I2HA 4INOA 3S2EA 1BCSB 1OBVA 4DA8A 3EGOA 3CCCA 3MVEA 2A30A 5G0SA 4C0JA 1LRKA 2H2DA 4BY9E 1QGUB 1AMOA 1VI5A 3PQDA 5K0FA 4CL2A 5HIMA 4I19A 3SC4A 4ZYTA 1XAHA 1KSHA 3MRVA 3CWQA 4DQUA 3A6PC 4NBKA 3DQPA 3CX8A 1MJ5A 2ZTSA 4YMIA 3T34A 3GRZA 3HBMA 3K9WA 2Q8PA 3ZZUA 3ZKWA 2H3EA 3HSYA 4IF4A 1EPUA 4XFDA 4E5SA 1Y8RA 2X2PA 4HGRA 1QZUA 4CFYA 2NPFA 1E8MA 1GGMA 1YTUA 5F98A 2FW1A 1MAHA 2QD2A 4JZYA 4GP6A 3X2SA 2J9GA 3H8VA 3MPOA 4S04A 1M73E 5KQLA 2GBLA 2QGNA 2B7CA 3CUWA 4KAXA 3X43A 1CHNA 2C84A 5JSHA 2PA0A 1QPGA 2QQFA 1QG6A 3INGA 4US2R 1PS9A 2WF5A 1XZKA 3FAKA 4UD2A 5IKPA 3S70A 4L1KA 3ZS8A 2QRPA 1I3NA 4G97A 3A58B 5FI1B 1PF7E 2HSGA 4DCJA 1CNFA 3RRFA 3KSRA 1XWIA 1KE1A 1OGYA 4O4HB 5B55A 2EATA 1FFCA 3BFJA 1J09A 4IGFA 2L2QA 2ZUUA 2BMAA 4DQLA 3TLKA 2NOAA 4MPJA 3IJEB 3TSWA 1AQNA 3CF6R 1DXQA 1UK7A 4NU0A 1UKCA 2P8SA 4NJMA 4ZHQA 2J6HA 3DHEA 1ZOSA 1RYEA 1CUDA 2FMKA 1XAJA 5CVDA 4C4SA 3DNMA 5HUJA 2ZUBA 4XR4A 5AI9A 3N86A 4C4XA 1D9XA 2JIMA 2A5YB 1C80A 3KV3O 3WIDA 1MIOA 3AF5A 3Q3IA 4URFA 4QYMA 4D8TA 2O06A 1I7QB 4UHHA 2ZB8A 5SY4A 2OPBA 2C7QA 2V4ZA 3HXLA 2CNDA 4PCUA 4OXQA 1DINA 2QPLA 3N8HA 1JECA 4INPA 4HAZA 1M2VA 1B15A 2WINI 1KOGA 1KU0A 1FY2A 3JAKA 4M0MA 5AM5A 1N33B 2EAUA 4DMFA 2ZBRA 1ZOOA 2FE4A 1V9LA 3QVSA 1J24A 3H5IA 2X58A 2FK7A 2BLLA 2L18A 2YMQA 1NQ5A 2FCRA 2HCBA 3N9IA 4QFMA 4V3CA 4AJEA 1DI0A 1BU8A 1NVUQ 4W9MC 4DB4A 4XJVA 3ZD7A 4TYWA 5HQTA 2GNPA 3QLUC 2VHXA 5E4JA 4OI2A 1Q74A 3L79A 4KW7A 5MN5A 1EM8B 3VVLA 3CW2A 3HBLA 2J0UB 4P92A 4QAJA 5FL3A 3RJTA 5AKHA 1U7OA 3KXPA 1XLTA 1GG8A 3DMTC 3H5NA 3KKLA 3WA6A 2X4GA 4OOEA 3WDLA 2PPVA 2XKJE 2O7RA 3ZGVA 2UYGA 1OZ0A 1E3SA 4XM0A 4QG7A 4UTXA 5D2CA 3TNYA 5JMPA 4PO9A 2CY0A 1E89A 1RLUA 2F2TA 4QA9A 3VJRA 3KTFA 1KGDA 2VHUA 2OPHA 4NZOA 1E2FA 2EGGA 2YFHA 4G0VA 2QX7A 3F6YA 2ZEJA 4M1OA 2GN6A 4OHKA 2WYVA 4UAUA 3CWCA 1GN9A 3C97A 1X7XB 3KM0A 3LY5A 2DR3A 4M9ZA 4WK4B 4PM4A 5DIFA 3SC2B 1XQ1A 5DLEA 1QBKC 4U5QA 2GHIA 5T8KA 1XUOA 1JYEA 1KY5A 3NDJA 3V8BA 4DT1B 4UM5A 5AVJA 5HK8A 2J45A 3L9WA 4UDOA 1YZUA 3IQZA 4KJXA 4MUAA 5ALNA 4WNIA 1XQWA 3UQZA 3U44A 2NYUA 1NI3A 1ZZGA 1Y5IA 2UZ3A 3P97A 4IXDA 4RQTA 4WHMA 2Q1SA 4XYMA 4B0PA 2GZAA 4GD3Q 1XQ6A 4F2HA 5LKAA 5C4MA 1BWPA 1EVQA 2XCRB 3OJCA 3HU1A 4X54A 4M76B 1N75A 5M29A 5MHTA 4TV8A 1Z0UA 3IIIA 1PFWA 5EUQB 4W5TA 3A4VA 3THXB 2JBWA 1WXIA 1XNHA 2NTEA 2HOQA 5DHFA 1JEAA 5EMJA 1TEVA 1RXUA 2COEA 1SUEA 5AWFC 1P5FA 4YAIA 4I2VA 3MJVA 4OG2A 3AF2A 2QVXX 3TGWA 4DDTA 4U7HA 2XMPA 5HIKA 2W93A 1Z63A 3TW4A 2R84A 4CI9A 5CW2A 2O1EA 4LDRA 5EG5A 4LC1A 1M2EA 1HDOA 5FBKA 3CUYA 3P20A 2REOA 2FMTA 1RWWA 4MR8B 4U6QA 4CR7A 3QEJA 4C0HA 1F17A 4EBBA 1F51E 2SICE 3QM1A 1UKYA 1UM9B 1QOPB 4Q48A 1QAMA 2V7PA 1U0HC 3FF4A 4JYCA 3BT7A 3AY6A 4CL0A 1XMOB 2CKMA 1XZIA 2PT7A 3KPUA 3VO2A 1MZPA 5C52B 2BZ0A 2HBRA 2X9VA 1V7CA 2PMEA 3V80A 4DXHA 1P9NA 5IJXA 2ISCA 1HDZA 2OK7A 2R8ZA 2B6NA 4O25A 3AR5A 5D01A 2ZUFA 4XVHA 5JD4A 4UC0A 3U7IA 2HRRA 2XIJA 4OUDA 3GEBA 1D1PA 2CJWA 5FAKA 1SUBA 3Q7EA 3WHKA 3ZHTA 2IKSA 5BV8A 1FFSA 3BFVA 2CL7X 2ODTX 4QHTA 5CD9A 5IJ0A 2AG0A 3DZ8A 3M1LA 4F5YA 4DW8A 4EP1A 3UGJA 3UJ6A 5JNWA 1MG5A 2XTZA 3QE2A 1YA8A 1RYYA 3OF2A 3MGAA 4Q9DA 3QHAA 3MQ4A 1Z45A 1YR6A 4WADA 1YAHA 4JU8A 2PFGA 4XD7D 5EWJB 5EPOA 1YO6A 2WUEA 3RD5A 5FPQA 3AKDA 4U9HS 4BMPB 1H1DA 4D9BA 1ZJ4A 2ZTVA 4HN2A 4UZSA 1XC7A 2X0EA 3MF4A 3ERCA 2VH2A 3GHHA 3AG6A 1WPQA 1F8UA 4O1HA 3T52A 2JHPA 4QICA 5C5CA 2IXBA 3J81A 1PUXA 1RPJA 2PU7A 4LSWA 1R8QA 1D6NA 3CGWA 1O54A 1F6WA 3D2LA 3DF7A 4DMCA 4A23A 1I80A 3HM2A 4MA0A 1CZUA 4AMVA 3CR3C 1PVDA 3EE6A 4NDAA 5CJ2A 5ERXA 3COZA 4R81A 1TFRA 3DAHA 3ZR4B 5KNBD 1SKYE 1JEOA 4ZI5A 3G8BA 4Q12A 1ORTA 3IULA 1TZCA 3F78A 3ENQA 1I9CA 5LP6C 3H2KA 3ZLVA 1ZN7A 1M6HA 3KXDA 1HOXA 1LBTA 2GTPA 1CSEE 1CZRA 2Y6UA 3ICCA 3MWDB 4HB3A 4RTOA 2OXFA 1W7AA 2XNDA 2RGRA 2FF7A 4MHOA 1BVYF 2CDNA 2PJUA 4PFKA 3K0AA 4R1NA 5I9NA 1RT9A 3EGXB 4UD6A 3WXBA 3U6BA 5JCXA 2C5AA 5J2UB 3WHIA 2H0QA 1KZ6A 4YN3A 4BO4A 3QX8A 3QOFA 3ASYA 4S0ZA 3LUAA 4D4IA 3KQUA 2D0IA 4IJUA 2GILA 3IEPA 1KI6B 4J49A 3LUFA 3VKUA 1ZD5A 3P2YA 3DAGA 1E4EA 2UZAA 5H59A 3WAGA 4XLLA 3RBAA 3WGZA 2R00A 4GICA 1CU1A 2DWUA 2XE4A 3K9GA 1T2EA 4P2GA 5AW2A 4FE4A 3I9V6 5SZIA 2O48X 3GJ4A 4CIDA 2QW0X 3IO5A 5C34B 4YJ2A 1T2NA 1EQ2A 1COZA 4DCUA 5BSTA 3M4ZA 1SXGA 4FSXA 1P7ZA 2MDTA 4EATA 3S2YA 3DZHA 1BVUA 1I8TA 3JYQA 3QBDA 4YAFA 2RHHA 5F4BA 5C8YB 2NO0A 1JEQA 4AG6A 4JGBA 1Z6ZA 3CWZA 1JLLA 2JFPA 3T3GA 1RRCA 2WLSA 2IYSA 1ZNYA 5A3RA 3A9VA 4TXNA 1RAAA 3M6LA 2RH4A 2X7XA 5E3HA 2ZRHA 4DJEC 2IUSA 4GX5A 2IW3A 2C9DA 4QXPA 3PHGA 4LBWA 5FO0A 1R12A 3UBMA 1QPZA 3TNFA 2O2SA 4PTYA 5JD5A 4BC0A 1OC2A 2CCKA 3HJAA 4IYRA 4J94A 4ZK2A 3CFYA 2CNWD 2JRLA 2Q21A 3Q1LA 3BD8A 3KOUA 4N03A 4NP6A 1W88B 4RMNA 5G2OA 2F3UA 3F6CA 3SQMA 4ARIA 5JAHA 2BSXA 2WUWE 3GDGA 3O3NB 1IHOA 4GWKA 1LRJA 2I6FA 4EA7A 1K7FB 4F06A 1BHQ1 3J7AC 1DBSA 3HDTA 4RA9B 4P54A 1DQYA 5EE5B 2XQJA 4F9EA 1JR3A 2ZJ1A 2FEXA 3DUFA 4QECA 4I9FA 1CLEA 4FOTA 3V2UA 4DWOA 3PLAE 3LOQA 5K8LA 4FYHA 4OSPA 1CXZA 1R88A 1IXSB 4EB0A 4D9EA 3BH0A 1MRNA 3P0JA 4L6CA 4XJSA 4XQGA 2R68A 2O2HA 3TF5A 3HKDB 4PRZA 3AEKB 4G0WA 2P1RA 3V1TC 4YLYA 1DAHA 4CDRA 1E1CB 3SZUA 1YBMA 3N87A 1P2SA 1E62A 1FJXA 3FTEA 3DZIA 3RVSA 5JHGB 3RIGA 5KTMA 1R6AA 4P3YA 3E4CA 3G7UA 2R1TA 1R16A 3BWVA 3LX6A 4JAVC 5B7NA 3A05A 2PG3A 3DWIA 2IU4A 5EGNA 4D2IA 2W8BA 4W82A 4R05A 1CJBA 3SXPA 2AMVA 3OZGA 4DLPA 3NV7A 1WA5A 4YCAA 5TRTA 3F8TA 3OPNA 4KMSA 4JJZA 1ZNXA 2YJNA 3HA2A 2VYQA 1OBCA 4IHJA 1O58A 4P6VF 2HU5A 1EP1B 4UDYX 4D3XA 5BR8B 3FPAA 1FRZA 3OE4A 3TOSA 2VTBA 1PR1A 4GRDA 2O7SA 2ZUSA 3FB1A 4NS1A 4EVRA 4LHZA 1IEQA 1JZQA 2HI0A 4BVEA 1W29A 4YMVA 1GG5A 1XZ8A 2PZGA 3OKFA 4XRRA 3G68A 3IAFA 5IH7A 3A6KA 2VJYA 4OLHA 4CV3A 1E9FA 3EDMA 1SQ6A 1Y6RA 2W90A 4Q24A 3IV6A 2AH5A 2JIRA 3DA8A 4HWSA 3TLBA 3IELA 1CW2B 1NQUA 4HOYA 4X8MA 1HQYE 2C5HA 1HRDA 2HV8A 2OHOA 1RC1A 4JUFA 3HCCA 4B46A 5CYFA 3H87A 4LXYA 1VL1A 2ZRLA 4FW8A 1OGJA 2OV6A 1NG9A 3KAPA 3VDRA 2J3QA 3CS3A 4BO6A 1JGTA 3GVPA 1L7XA 1ND6A 2VXOA 3LFUA 4BRWA 3NC4A 3MJEA 4R1OA 4O4LF 3U0BA 2GPAA 1A2QA 3O8OB 5ALXA 1JZSA 2WU8A 3QW2A 2QNBA 2H92A 2HW8A 4Z54A 3F9IA 4ENTA 1B0ZA 4F9GA 1D2CA 3G17A 3HA5A 1OFIA 1W4BA 3K09C 3WWYA 5KWIA 4M0CA 5KVVA 4IO0A 721PA 2VQ6A 4N40A 3ELUA 1E2EA 2OCKA 1GV1A 3OPQA 5HRAA 1QHHB 5B1DA 3RC2A 5L51A 1L9XA 1YUBA 2GZ3A 2IRWA 2QTBA 3H75A 4PX9A 1RKVA 1P5ZB 1PZHA 4IWXA 4ARVA 4W5NA 3DVSX 4HEQA 4K6FA 1IOLA 4KVAA 2PQ0A 4BHTA 1M9NA 1RWKA 1ZC4A 1TLTA 1LBEA 3C3AA 4NCHA 3UK6A 1NSYA 3U4QB 4II2A 3GLIB 1RKUA 1Z17A 3OQ6A 4XLTA 3RYIA 1N8NA 1XIVA 3UUFA 3AUAA 4YXFA 2AJBA 1DX6A 5CPFA 3VHXA 1LQTA 3E23A 2CF5A 2NN3C 2Y9MB 2IHZA 2I1WA 4EPXA 4RMJA 4YACA 3I04A 3VOTA 3HMKA 4Z4GA 2Q3EA 1PFKA 1J21A 1Y5LA 2WHPB 1R27A 3IKLA 4RNDB 1Y3CE 4CM8B 2OFPA 1RXIA 2WBLC 5E2IA 4WL0A 3RWOA 2PQMA 1UPFA 3ZWOA 3N2KB 5EYPA 3H5OA 1B8UA 1DKLA 2BM8A 4X94A 5GONF 1NURA 5JSUA 4CZ2A 1WF6A 4EHIA 2Z6UA 1MGPA 4D57A 2XODA 4MV0A 3UJ7A 2FUEA 3AOEC 1JW9B 1F4PA 3OCWA 3L5KA 5CM2Z 4H6XA 1QQAA 2X6RA 3KD3A 3HJGA 1XAIA 5CFZA 521PA 4AP9A 1XPOA 5FOUA 3CZRA 2E4UA 3HEAA 4C76A 1T24A 2A0YA 2D7CA 5LB2A 4AUNA 5GIPE 4N48A 1D2AA 5KVCA 4KQIA 2I9KA 4EG4A 1X15A 1EXDA 3LSYA 3PRKE 1QOQB 2B0JA 4RWZA 2AI3A 3B1FA 3NBFA 3OY2A 3MFYA 2IEDA 5KX5A 4JUBA 3O2JA 2KM1A 1CUGA 4IJMA 2P2DA 4LXXA 2PGXA 1J25A 4L5BA 3RIXA 1E7MA 5DMXA 3H0EA 4W1QA 3MWLA 3DL2A 3C16C 3L43A 4XTCS 5BSMA 3ZY4A 5HJ7A 1C5KA 1N3LA 1Y3HA 2EW1A 1B23P 2AD5A 3EGDA 3CCBA 1QPBA 3H42B 3II6X 3N2NA 5HZGA 1QU2A 4RHFA 3NAGA 5DU2A 1N4DA 2Q4OA 2FOLA 1IG3A 3IVGA 4AJ1A 4CR6A 1VSVA 1XELA 3DE4X 3PFNA 1EX1A 4BOYA 5G40A 3FYUB 4X20A 2H48A 5DH9A 3ZHZA 4GQBA 2PJZA 3I76A 1FFHA 4YDRA 2XI4A 5DNEA 1NRXA 3RTCA 3TDNA 2OY0A 1M2GA 5K8VA 2CLSA 3RRNA 1XHLA 4DV1B 3QVOA 2X8AA 2DPXA 1OV4A 1V48A 4M8NE 4BPRA 3OTWA 1NE2A 1EVZA 1YOVB 3A1UA 4F84A 1JKIA 2A59A 3ZOZA 5ES4B 2QTVB 3CLUD 1Z3IX 1GZ4A 3O8QB 3HFGA 4M0UA 3QYJA 4U63A 4X65B 5CITA 3C8UA 5K45A 3TGPA 1NQTA 1Y63A 2X5JO 1IQUA 3C8ZA 3AEQA 1RQPA 2YQ4A 1G5TA 3AB8A 3GWGA 3G2HA 1IBSA 3KVVA 3OFVA 3H6KA 4EFLA 1TADA 1WSAA 5DK4A 1V5IA 4ME6A 1OHHD 2W2NA 5BXYA 5ALZA 4LGVA 1UXKA 1CRPA 1S2NA 1G9XA 1Q11A 1SC6A 1IPHA 1OGIA 4HS4A 5B58C 1JLSA 2GPBA 5JO9A 4MOWA 5BN3B 4ZAWA 3I5YA 3CG4A 4CEJB 2G77B 4M1ZA 1RS0A 2AHOA 3Q0IA 4MCIA 5LQUA 3O47A 2QM3A 4P8RA 4D3YA 2SKCA 4YRBA 2QVZX 1GQ2A 1KEEB 1QHSA 4JLAA 4GI7A 4YMLA 3FN4A 3O82A 4RHYA 5I8WA 4KI7A 4CKEB 1REQB 1Y3AA 2GJKA 4IS2A 1CLUA 3TRFA 1V3TA 2I91A 3ABQB 3SZ3A 3FNQA 3E7PA 3O92A 2CDBA 1O57A 1FC0A 4NU8X 3S68A 4GBJA 4RVDA 3LBHA 3RDPA 1XVTA 1OKKD 3EQ6A 3OJFA 4DC0A 4TTQA 5CBKA 2G08A 2WTUA 2BPOA 1P1KA 3NXKA 3VNRA 2CUKA 3GRRA 4OM7A 5ALIA 4UMDA 2R79A 4LK3A 4QBKA 1KC1A 2QPOA 3GLGB 2GBCA 4Z1MD 2AR7A 1SRRA 4NMHA 4UU8A 5KHAA 3AI3A 2VSNA 1MO5A 3AHDA 3TVYA 1NNSA 1C7JA 4PX5A 1N2XA 4YCDA 3SHTA 4D9GA 1E98A 2FZGA 1E3QA 2G17A 4TKLA 5DI9A 3E1KA 3JQGA 2JGFA 3G1UA 3OZRA 4JHXA 1JIVA 4L7QA 1L8QA 4MW1A 2AF3C 1DBPA 5ALSA 5F2OA 1FE8A 3LS2A 5FTMA 2UZ4A 5ERGB 1LF0A 1IRXA 1I3KA 1UJMA 2GYVA 2I4IA 3BREA 4C0XA 3QPUA 4B7UA 4FMBB 4ZYZA 3CB2A 2JGLA 1NF9A 4XKJA 4JUAA 4HTFA 2CL6X 3IMEA 5AUQA 3H84A 5IM4F 1YS1X 3GG9A 4RXUA 1CV2A 2C4WA 5AXAA 4F6RB 1CY1A 4R2MA 4PO1A 5DBIA 3RRMA 1ECJA 2B61A 2OVBA 3AB7A 3B7WA 3BICA 1T6ZA 2FR1A 2A4KA 2D59A 4LJYA 1EEXB 1IOZA 7REQB 3R5SA 1R74A 4PZUA 4M0KA 3WDMA 3HADA 4B1FA 1P0PA 4EAAA 3IP1A 3DZKA 4DR2B 4EH1A 4PSAA 3QFSA 2AZDA 1GAWA 3IR5A 1CQIA 4K86A 1A8SA 4XCXA 2QNRA 4LCBA 4YJ3F 1U7PA 3OPYB 5A6VA 1CQWA 3CKMA 3GFRA 3L7AA 3RJZA 5LYJF 2E2WA 4EGSA 5BT8A 2WJIA 4DV2B 4L15A 2EZTA 1QDEA 1E5TA 2B94A 5CR9A 2Y1LA 3GU3A 5I7EA 3RVBA 1E1KA 1Z0JA 1IATA 2EL9A 3FCOA 2FAXA 1TAGA 2AG6A 5A5VA 3BD9A 1IJKA 3QHQA 1IBRA 2E89A 2IXDA 5A4IS 2R5NA 2P4EA 4Y6QA 2IL1A 1T3HA 4BQIA 4EKNB 2F62A 3DMGA 2OOKA 1J90A 1QM5A 2EJWA 1LDMA 2EL7A 2G71A 4FJ2A 2EP7A 4UFNA 3ZWYA 2BHLA 4A8JC 4DZTA 3GYGA 2NIPA 3LDFA 2IHJA 3OEHA 8OHMA 2YS6A 5ED0A 4EHHA 3HGQA 2PSJA 1V16A 2PS3A 1ZBDA 1OA1A 2VP4A 5IK2D 3TSYA 4W7HA 2GT1A 5G53C 4WZBE 5IT4A 1Y3FE 2ODEA 2P9GA 2VJCA 3E22B 3FLEA 1KJNA 4HDSA 4LUCA 1YDHA 3ZEIA 3ET4A 3PT5A 4JLBA 1MN6A 1Y9ZA 4ZTBA 5F51A 1L5QA 4RAQA 2VP2A 1MX3A 2VSXA 3EARA 5JS1A 3I58A 1ZMOA 1BE8A 1C0KA 4OYYA 4B9EA 1Q1EA 3N8NA 5LM3A 3IA7A 2FFJA 4WFQA 1VA5A 1LF5A 2I6GA 4Z7JA 3T7SA 2G9QA 1I5OA 1C2TA 2JFQA 4ITUA 4BZZA 4G0OA 2HCRA 2NV6A 2BEJA 3L6CA 1C7RA 4JJ7A 3T0FA 2OMKA 4UEQA 4JASB 2H3HA 1QIGA 3MRXA 3JRXA 3QOYA 3U39A 2FPXA 2Q6IA 4WZAA 4BNLA 1KDTA 1S3FA 5JDIA 1YE5A 1Z5GA 1RYMA 3NC0C 5ISMA 1PT6A 3IDFA 1VL6A 3U16A 2VBGA 1YUNA 2QTTA 1UPTA 4HVTA 1AGXA 3FR8A 4P7JA 5F2KA 5LQCA 4PZDA 4MXDA 2Y92A 3F74A 4HF7A 4U39A 3NASA 5I9IA 1E2BA 3ONEA 5IMBA 3SK0A 1SULA 3GLKA 3DF9A 1KWKA 2I2DA 1YB2A 1D3AA 4M1TA 4QFBA 4XARA 2CLCX 2PT9A 3CVJA 3G49A 3E6AA 3G2LA 4R3WA 4MLPA 1MX9A 3R6DA 4XQ0A 1T4BA 5AJHA 3G0IA 5FDFA 4A73A 4NC9A 4IHAA 5HDQA 3NALA 4OAQA 3ZEAA 2CJYA 2JB9A 4UE2A 2IOQA 1EHYA 1UIRA 5EHIA 1DEHA 3HZHA 4Y2YA 4V2IA 1DQZA 3EFOB 1V11B 3I6YA 2QHXA 2PBFA 3ZWWA 4BKOA 1YUMA 1KYVA 2VPWA 2O8FA 4FKMA 1RWXA 4CJXA 3GW8A 2AGVA 5LR6A 3VR5D 1P9LA 3WBJA 5TS2A 1NDUA 3PBKA 4UNIA 1I9GA 3KAQA 4Z2YA 2CC2A 1KH1A 4RZIA 1XDBA 4YP6A 1JFFA 2FW6A 4O6VA 4GL4A 1Q44A 2WUGA 5GAJA 5ALFA 4BLSA 1XU7A 1EFLA 5CX1B 5FOTA 3SI7A 2JIOA 1QGZA 1T8PA 4C7MA 1BZYA 5DI3A 4TPKA 5DSTA 1KEWA 3GFGA 5AXDA 1Q7EA 3L0YA 3TW0A 3S2SA 3PKIA 4WUTA 2W2KB 4LDAA 4KXVA 1DBVO 4GSYA 4XWWA 3MLAA 2QGZA 3RB8A 1OAKA 1NMQA 2CUTA 3BQ9A 3LKZA 4MCHA 4EB3A 4JI4B 1ZSYA 1P62B 1TTTA 2E4WA 2PCLA 3E5HA 4I6EA 2JHGA 2PXXA 1T29A 4R1MA 4CDMA 2JLAA 2FQYA 2IUEA 1TQ8A 1C9EA 3B8EA 2A33A 2QX4A 3IUJA 3PGJA 1BG6A 2V96A 3FZEA 4JLSA 1XVIA 2PKEA 3MTIA 4TKUB 4XWYA 5E8JA 3BD7A 1R37A 2PV0A 2JAHA 1KJZA 2HUNA 1KY2A 2OM6A 2YHBA 3F0TA 4M98A 4Q9JA 5TB5A 4BLVA 4DLRA 4PQFA 4Y2TA 3FMOB 1O95C 5ITVA 1G0NA 4N5LA 4Q6WA 2GCNA 1IBCA 1YRBA 1SCAA 3HN2A 4MTCA 1HI9A 1D6JA 3IDOA 3FGPA 5BQOA 2CT8A 4FLFA 4K2HA 4ZALA 4F3NA 1N0HA 1O6BA 1XO1A 3V8NA 5AVUA 5JD6A 2QZJA 5A03A 5ALVA 1XQYA 2FSFA 2ECQA 3G8CA 3P8ZA 1M6YA 1CIPA 4EUFA 1MH9A 1IE3A 2DSTA 1YV9A 5BRAA 2WTNA 2G8LA 1E2HA 2IEBA 5FOVA 5B37A 2IHNA 3CRMA 3EW9A 4AMUA 4J0CA 1QVVA 3VISA 3H5LA 2ODPA 2V6MA 3WRXA 5BN5A 3G1TA 1T15A 5L4LA 1G4AE 1YA4A 1SD1A 2AJ8A 3F1LA 5A6SA 1WL8A 1IXYA 3PXEA 3TIXB 4R1QA 4ILKA 2H5IA 4F86A 3R6TA 3SS8A 1VSTA 2C2HA 4FGUA 2Y0DA 1HT0A 2BN4A 1N4AA 3S29A 1TYEB 4YREA 2E49A 2P9YA 1S96A 1Z0DA 2H54A 1RWMA 3PDUA 1J23A 5FUXA 3WGMA 2HBQA 4HSEA 3E70C 2OVFA 3O38A 4AMBA 3GD5A 4CUKA 3MTAA 1L4MA 5MN4A 2RSLA 2ZBVA 4OFWA 3TFOA 2VDWA 4MI9A 3JU3A 4UBMA 1N0VC 2XUKA 1C4WA 5EZ6B 3VPGA 1Y9EA 2NXCA 1C0LA 1DZ3A 2JCYA 5IHPA 1OZHA 1ISRA 2B7BA 3OKPA 3SJCA 3FKJA 3QQ5A 1MKYA 3AR3A 3M5PA 3PF8A 4F1JA 2A84A 5IC4A 2V6IA 2XUJA 1FCJA 5EWLB 1HETA 2ZAGA 1VMAA 1RXWA 1NQXA 4JLOA 4N65A 5HA5A 1UBLS 2FSUA 2HYIC 2X0KA 5JXGA 4RA6A 3R0JA 1U7TA 3ZXXA 2IU6A 2WMNB 2YVKA 5DLYA 4QVKA 4CG0A 2D06A 2CSXA 3OLQA 1BJTA 1NLZA 2A3NA 4X92A 4Z3KA 3GLFE 3C7KA 3IDSA 1BVRA 3VAAA 5KS2A 2IODA 1L5GB 2QVYX 1A7UA 2GCPA 2WWYA 3QV2A 1FU4A 1H0HA 1P6XA 4V0OA 2P8JA 1CNMA 3L0DA 4P4LA 1CQJA 1WY7A 4Q9IA 1CJCA 1NKSA 3AIIA 5FA6A 4B45A 3QIVA 2VDRB 4B80A 4WMLA 3C3CA 1QCZA 3K0CC 4G8JA 2JH9A 4DMGA 2EQAA 4M3NA 1LDBA 2YIMA 3O7WA 4YJFB 1H4TA 3CUKA 2AXQA 4TRJA 1ZJ5A 4F3KA 3HNPA 1X87A 4GVXA 1BDMA 1G20A 3BPSA 3IPCA 1DXOA 2YC2C 3KL4A 4MV9A 5DYGA 3RSCA 4W99A 3VTAA 2HBZA 1H8EA 1YC2A 1YR1A 1FPMA 4CM3A 1YCHA 5D3KA 4AUMA 4Q9KA 5IVDA 4EJSC 2Q0HA 2EZ4A 3PYMA 5G02A 2E5WA 3A6LA 4Q7QA 2FNAA 3JWPA 5ELXA 1BS2A 3IIJA 5B58T 3DGFC 3NO4A 4MVJI 4UTZA 1JH8A 2A5LA 1Y9DA 1Z2PX 2DC1A 2FSVC 4G5SA 1DDGA 3MS7A 2ZWMA 1Q6ZA 4GL2A 2PGJA 2W22A 3D0RA 3GNTA 1T1GA 3LXUX 2EG9A 4IS3A 1O96A 5T7BA 1BDHA 3H9GA 5EIHA 4O3MA 1ZAYA 4B74A 4J07A 1O1YA 1FLVA 3PDWA 2QLTA 3H5AA 3P2JA 4KXUA 4Q03A 4OB7A 4PAQA 4C2TA 1A7JA 2DBQA 2JH8A 1B16A 5DGXA 3V1LA 3RBXA 2YZ2A 1XNQB 5I4CA 2XAAA 2HXYA 1GL9B 3CXUA 3BWCA 3CPHA 4LTDA 3AUJB 3MSXA 1S7CA 4KZPA 5JADA 3CW9A 4MRAA 3MWEB 2AI1A 3N39C 5AM0A 1I2DA 5IUKC 5JC8A 1SM4A 3R5TA 4DV6B 2Y1KA 3BIJA 3BKWA 2OESA 1DELA 1E9VA 4FQ8A 2EKLA 4JT8A 5FBHA 1QUEA 3ONWA 4A5OA 3IS3A 2WP8J 3NKFA 3QXJA 1ZM4A 4INZA 3GGDA 1RCTE 4P7FA 3D8RA 1WDKA 2X1LA 2C5BA 2R6JA 4J1QA 1JTFA 1P2BA 2DQKA 4MQLA 5JJKA 2Z1DA 4ZOBA 2PUVA 3M2TA 2M2IA 4XX0A 1Z2OX 1Z6XA 2ZRDA 3L7JA 1YU6A 4DFDA 3ZJ4A 4E12A 1E0DA 5FYDA 2GJAA 3KD2A 4RY2A 1CRQA 1A9ZA 1VRVA 2ZJFA 3TRIA 4HNTA 2AJDA 3RHZA 1LCIA 1T0BA 2PUTA 3L7OA 2BKVA 4GGMX 3IGFA 3O8BA 3QTLA 3TQCA 4PCVA 2IPLA 3DZCA 1KKUA 1ZK3A 1H5UA 2FOXA 1QGDA 1W46A 3AUXA 4A27A 5F21A 4YYZA 3JCZA 2PGLA 1H4QA 3PFBA 4HWPA 4ZVUA 2JIZD 1KVSA 3UWMA 4WLUA 4UM8B 3WGVA 3H5WA 3GFQA 3UV3A 2HJ9A 3DDOA 1EQAA 4OREX 1Z5PA 1LBHA 1FYXA 3ETEA 3Q9SA 4W8GA 3R41A 2XT9A 1F2UA 4UTNA 1RPZA 1FQJA 1NULA 4H0FA 5AW5A 1XRLA 4UE3S 1U5CA 1NR5A 1BQEA 5I8ZA 1ISJA 4MUJA 4BASA 4CG3A 3BZWA 3IBFA 1O4WA 4MVCA 2CXPA 2XTJA 3PWKA 4IJVA 2C2ZA 4HXGA 2QWXA 1SCJA 1IONA 3SQNA 5E9JA 5FTLA 1NUHA 4HVAA 2QG4A 5AW1A 1O08A 2ORYA 3CRZA 2AVNA 2Q2VA 2YOHA 1BO6A 2VVTA 1CP2A 4E6PA 4Z99A 4HLCA 1EG2A 4MAAA 1AHPA 4ZOLB 1M3SA 3KAKA 4JP3A 4O02B 4KQ1A 3CTPA 3THOA 2H0AA 5DHAA 4BU1A 2WAOA 1F9EA 4J7XA 4LYFA 2WV7A 3CLKA 4E2XA 3MPUA 3BOSA 1T5OA 5KOIA 2W6OA 4KUHA 3I34X 1ZX1A 2QAJA 3DVRX 4OKIA 3IQIX 2HQSA 4FX5A 4JJFA 4RU1A 1ZZEA 4PICA 4AW9A 3L8CA 5AOVA 3IPYA 4IIGA 2WKWA 1M8JA 3PL5A 1K9VF 1TEXA 4CQJA 1SXJC 3KIPA 4CLRA 1K5PA 3GDHA 3F8SA 5DP2A 1IEXA 1ACJA 2DE0X 3BZUA 2OWDA 3DLIA 4Z0PA 1NC1A 2VWPA 2CVQA 3NBXX 1QYXA 2P9JA 3KUUA 4TT3A 3DL0A 4E33A 3UWDA 3QG1A 1OXXK 4MJ7A 1JS1X 4FFBB 3RHFA 1A4IA 3Q12A 2BEUB 3O1IC 3K6SA 2Y0EA 1XWWA 3D1VA 2V3VA 5BW8A 4FS3A 1F5NA 1W1WA 1LZLA 3C4QA 3S3TA 2PY6A 3BMOB 1Y3DE 2HCJB 3PQCA 3PNSA 4CKWB 2HIMA 3BG5A 1J8VA 4EVSA 5IAAA 4ZEMA 1BROA 3ZDFA 1FFBA 1PHPA 4BE9A 4LX0A 3AI7A 1VHJA 2VRCA 5JHHB 2W6ZA 3ZQUA 4UNSA 1EJBA 5IVPA 4M0FA 1DLIA 3PK0A 1HQDA 1NP3A 1QRDA 3A9SA 4J1TC 4LRQA 4ZT7A 5JV5A 1A9XA 1G16A 3EMKA 2FQXA 5HRUA 2RC6A 4NOJA 1SC4A 4GNRA 5F5XA 2DFNA 1ZRHA 3KKPA 1GFWA 3UKDA 1EH5A 4CI0B 1WWKA 2C00A 3DDCA 3W7BA 4D3DA 1Q17A 4MHSA 1KL7A 2JJQA 3FCCA 4QRDA 5AXBA 3FETA 1X80B 2RBKA 3HDJA 4QYXA 3RU3A 2OV1A 4YLGA 4J9VA 4IMPA 2DLCX 8ABPA 3WLTA 1JPJA 3A3YA 5HW0A 4KQHA 3QE3A 4TWJA 5AW0A 1GGJA 5JROA 3CRNA 2DU8A 2C31A 2ZSDA 3NNSA 1NKTA 4C2BA 4FM9A 4NLLA 4YP9A 3CKLA 3VR6A 5BWMA 3UHFA 2FEPA 3REOA 1Q0HA 1L4NA 2W83A 4NF2A 4G67A 3U0VA 4CIBA 3ENZA 4H9GA 4G1EB 3GEHA 1GRQA 1M33A 3DYIA 5FB3A 3TKYA 1PWHA 2AG5A 6REQB 4KITB 5AVSA 5AW4A 4EO9A 1SEVA 5CIYA 1I2AA 2VBCA 1ID1A 1T0PA 2RBGA 4GKVA 1N5MA 4RF4A 2FWBA 3B1WA 3SZLA 3UMGA 1NC3A 1C30A 3ZUPA 3EG5A 5LD2C 2JLVA 5TX7A 3B1YA 1G21B 1WD7A 3OLZA 4BBJA 4F3CA 3CE6A 3W1EA 4UAVA 3HJFA 1BXGA 3AUUA 3KKNA 5EEGA 2CXRA 1QFJA 4NABA 2CSUA 2G1AA 3WWOA 4JR2A 3KHTA 4K9MA 1W30A 3HCAA 4GPBA 3V55A 3C6YA 4PHFA 4O4IB 3H83A 3VZQA 3FWNA 1EVJA 2YIVX 1Z74A 3RTAA 3V7UA 1JQEA 2O8CB 4FJ1A 5LSAA 2Q5OA 3GRYA 5I7FA 3GLIE 3KC2A 3LL4A 4J3FA 5CIQA 4YPOA 4IIYA 1DTEA 4TLBA 3AJ9A 3UXYA 1AKRA 4B3IA 2XVMA 5K0BA 4OB8A 2Z83A 3QLUA 3WBKA 4RVGA 1ZKMA 5ENDA 1GNVA 3KR0A 5FI3A 4OJNA 4QWWA 4DY4A 5JI3E 1EFVB 2IP2A 2PXAA 4KJZA 1QTRA 4BMDA 3FOFC 2POCA 3DMTA 5DCUA 1JU9A 1SQ0A 2VJLA 4QBHA 3FWKA 5BNZA 2IHBA 5L40A 1JX6A 3VR1A 4G4SO 1N57A 1YCGA 4ZDJA 2LKDA 5E2AA 4QSHA 1VL8A 3KKEA 3Q4GA 4GLLA 3CJTA 2V55B 2RD2A 4Z53A 1AUQA 3AFIA 4K0KB 1Q7RA 2IXFA 1USIA 2QM8A 2BMJA 3OX2A 4JLVA 1U7ZA 5IJWA 3SQXA 3P52A 4KQWA 5CFLA 1T0UA 2WM9B 2NPOA 2D2IA 3JZAA 4PIPA 1YZQA 3BDAA 5TF0A 3RTBA 1V6AA 3A70A 4OQLA 1CF2O 4KP7A 4J91A 1MX1A 3UK2A 3UKOA 1XMIA 5CYPA 2EF1A 4HNAB 4QBIA 4NJOA 4O2AA 2WG2A 4HGPA 1GSIA 3WP1B 2GZMA 2PX3A 3P5BA 3TM4A 2I67A 4LDZA 4EWLA 5AVRA 2WVGA 3IL2A 2QRHA 1Z5UA 1RPTA 2YV2A 4PXAA 3FTFA 1JKJA 1HXHA 3GLQA 2YFKA 3SF8B 1LJLA 1SHZA 1L4GA 1QMGA 3CLTC 4CQLA 4DJFC 2LGJA 3LH5A 5H7XA 3UFBA 4JXJA 4WXRA 1P2TA 2GUWA 4EUHA 4LJ8A 4C5BA 2PLRA 6LDHA 5CEEA 1UDBA 1JJBA 1UBSB 2C29D 3FF1A 3E3LA 1PEAA 5DP1A 5MFZA 3RS0A 1WSWA 1M2FA 1V9CA 4P3XA 1MU0A 1E1LA 4BV8A 4C1NA 3O93A 2PTGA 3VTKA 3UWKA 4UUMA 3BWBA 1W96A 2H1RA 2GFHA 4I55B 1P3Y1 1SIOA 4BB5A 3SF0A 3G0GA 1E96A 4IGIA 4NENA 1H6DA 2P5TB 2FUCA 3ZKAA 3BF8A 3P2EA 4IMJB 5EJ6A 4GKKB 5K0LA 1OT5A 3MQFA 3N53A 5FNVB 4R8SA 4GPEA 2HPVA 3CLHA 1UMBA 4QEDA 5FBZA 1XTIA 3ZZ1A 3DE5X 2QY9A 4FT4A 3SM9A 5CFRA 1ZN8A 3ETGA 2NU9A 4NFSA 5B1HA 1K7SN 3W3ZB 1GAEO 2QZ4A 3EGCA 5JSFA 5JRJA 3FTDA 1P73A 3I8OA 3AVUA 4EMBA 2IS6A 1N6IA 3MT8A 3QU9A 4FBGA 4GKBA 5DFAA 5K3AA 1V8BA 3TAHA 2WYOA 4M21A 2NM0A 2GYYA 2JCGA 2OO3A 3HL0A 3TD9A 1KAGA 3RG2A 1Z47A 3K96A 4K6MA 1WHSA 2EJCA 2BM9A 3MSCA 4S2EA 1KARA 5FUVA 4UOEA 3KXKA 3OWOA 5MFPA 3KCNA 3TUJC 1AUOA 4K28A 1PYOA 2OCLA 3IEKA 1OLUB 3FRIA 1YQEA 3AO0B 4G0YA 1NFQA 2C92A 4OQPA 4BP9A 5K8UA 2V8OA 1E9EA 1RKXA 3Q8MA 4J4BA 2ORVA 2OTCA 3LHKA 4RC9A 1QYCA 3ADOA 2QXYA 4US1R 1YZTA 2R8OA 2Z5FA 4MGHA 3WC4A 4QXRA 5AFSA 5JBIA 5JXJA 2HWKA 3EIUA 1ESNA 3VGPA 4PC6A 1PEKE 4JBWA 5BSVA 4YP0A 3GLGE 1Z68A 3IILA 4R8MA 3GUCA 3HYRA 4BGUA 5IN4A 2RGUA 5JR3A 1ESDA 3AM3A 4AJ4A 3T3MB 4UHFA 4O8ZA 4AIIA 2Y66A 3OE1A 2EQBA 3A9TA 4L5CA 4RXTA 1ODJA 3MHPA 4EZBA 4YAKA 5LP6A 3E3AA 3WQBA 3O95A 2IYRA 4OYRA 4Q1EA 1JIJA 3C8DA 3W5VA 4JA2A 3EZ6A 4FXOA 2WMOB 4ZAYA 3FM9A 1XZLA 3QYAA 1M2JA 1Z6TA 3I0NA 5CA0A 1SXHA 3LQ4A 3B2NA 3WLQA 3LNTA 2PD4A 4RIIA 3QFCA 1SCKA 3IIKA 5KCZA 2HTEA 4DREA 1RXCA 3L40A 1UADA 2I6SA 3C3DA 2YXLA 3EYWA 4NTZA 5HRCA 3M8KA 1POWA 4BAUA 1S4MA 4RENA 1E9RA 4JUCA 1YKGA 2UZ1A 3DXYA 2APJA 4IDQA 3Q2OA 1DDOA 3EZ7A 1GCAA 4MVXA 5A2QA 3H7AA 3JWEA 2AJTA 4HAXA 4LDNA 1QJ4A 5TGDA 1BW9A 3GIDA 5FTKA 2JGDB 2HRZA 4DHEA 4INJA 1W5SA 3AWIA 4IIFA 3V4FA 1Y80A 5BUCA 4FDTA 4JJ6A 4KE8A 1PCXA 2QR5A 1SVSA 3I6ZA 4H1UA 3RFVA 1CZHA 2AQHA 2HY7A 3COSA 4XIFA 1A0OA 1UJ6A 2ZIAA 4JNCA 3KJGA 1J4AA 3TNLA 2JI6A 4LXTA 4KO8A 5BNWA 3HVHA 1B1AA 1OYYA 1KO8A 1ZGCA 3OMWA 1H5QA 5B1YA 2Z08A 1UKZA 3BL8A 1G66A 3EMBA 4ZKDA 3EPRA 5LU9A 1HFEL 1DKRA 2V5UA 3PP8A 4WVLA 3JD2A 4OCZA 1NVVQ 1OBHA 1ULTA 2H2HA 2C9BA 3L0ZA 2B21A 1XEFA 5KHOC 3PSAA 4WESB 1QRAA 4JJIA 4I4TA 3HB1A 3L6DA 1KK2A 4E1AA 5E4TA 4N9WA 1YB1A 2PH1A 4D5EA 4POOA 3F6SA 3CVOA 3IMFA 1ISMA 1Y1QA 2ADFA 4OBXA 3WYBA 4BIIA 2VCHA 3HE3A 4NG4A 1KEUA 1FDOA 4MQUA 4X6LA 1I1NA 5CVTA 4UARA 1VL0A 2ASEA 4J3JA 1QHXA 1KI4A 2RONA 4MRSA 4PG5A 4WUVA 2H8GA 4ITRC 4Y18A 3QKWA 4IRMA 1YB6A 1QP7A 1LTKA 4FOOA 5T6BA 4JL5A 4ANFA 1WULS 2ZWPA 3D4OA 3H2YA 5HF8A 3K30A 4ZCMA 1E3DA 1PG5A 2K5UA 2GN8A 3N59A 4Q1AA 4LPSA 4B8YA 2JLBA 3ZCSA 3EQ8A 4NEGA 4E13A 1MT3A 3B12A 3M3DA 2HF8A 4HQKA 2HMAA 2IW1A 1P0CA 1ZGHA 2ZJ7A 1WU7A 3N7UA 3N8GA 4YCCA 1GZSA 1ZG3A 3C3YA 3E9DA 2F8TA 4JFRA 3UKJA 2FWRA 1QGED 2GAFA 3M9LA 4DLLA 3KSAC 3RSHA 4FZVA 4YP5A 2BR5A 3IP9A 2AX3A 4PYQA 1ITZA 3TCNA 3VO8A 4O4HF 4EB6A 2JGAA 3RCBA 5I7UA 4DYHA 4JXZA 2CBZA 1JG1A 1NU6A 2MYPA 1SR8A 2OGSA 3HRIA 2X2FA 3G23A 2XD4A 3F71A 3M6WA 2C8KA 3OLYA 2R8YA 4L4XA 4YASA 5JDCC 4MP6A 5IXYA 2R11A 3WKAA 2KB0A 1RBQA 1F14A 1Y1PA 2Y1GA 4B81A 5ITSA 3LUHA 4KE9A 1XJCA 5JEEA 2YNMC 4QYIB 1B4DA 2XQVA 3SHQA 1F7UA 2I34A 3O31A 1G5QA 1JI0A 3WQQA 1N1DA 2MMGA 2GF9A 2DM6A 1V3VA 3PEVA 3ULKA 3VC1A 1NJGA 3W5JA 4DJJA 3IUBA 1V6SA 4WXYB 4DA0A 4TKVB 4N76A 1A5SB 4ODIA 1JLMA 1AQYA 1VQ1A 1DEXA 3AC0A 3BTUA 3OVMA 2Z8YM 3KWJA 5BQPA 5BYBA 4OHPA 2H00A 3NCTA 4Z0TA 4E31A 2DPGA 4DWVA 3U1TA 3PFGA 5E9AA 1K0FA 1RQ2A 5EJ4A 3UAGA 1VG0B 1A97A 5F76A 1J56A 1DIRA 1QDUA 1AE1A 4MWSA 2QX6A 3OLWA 2CVOA 2PHZA 5LZ5A 4HV4A 4PBRA 4RD0A 1CY6A 1Z8HA 2PPLA 3G2JA 4G4GA 1VG8A 3BIFA 1ZINA 3T7EA 1KZ4A 3NYQA 4CMGA 1E1YA 3V2HA 3K09A 4MPPA 1CR1A 3GRCA 3O2SB 2FWIA 2I71A 1N2BA 3N2YA 1Y5NA 4S12A 1F8YA 4HGQA 1IXKA 2PL3A 2ADMA 2G6BA 2ZDQA 3FPKA 2XW6A 1D6SA 4NK5A 1WB5A 3DZDA 5IAOA 5J1TB 3ESAA 1KQPA 1ZR2A 4KXLA 2IHTA 2A5FA 4ZAFA 3VV2A 1IXRC 1ZRNA 1KYYA 2YJGA 3G9TA 4IV0A 3SG0A 4B40A 3PVSA 1DEKA 4TOIA 3FHTA 3NG1A 1X8KA 4KR3A 2O8DB 3VOSA 4BNVA 2JIPA 3OX3A 4YHHB 2F3RA 1DL5A 1TU3A 4N4AA 1DXHA 3Q3VA 5B4VA 1N5LA 1H42A 4I1RA 4IVQA 4O2RA 5LQDA 3AVPA 4ND1A 3E61A 3VPBA 4RHCA 4GGOA 5BORA 3AR8A 2HHAA 4KZKA 3ZHSA 2PLFA 2YWDA 4X6UA 1IJFA 4UMFA 1WETA 3OEWA 1U8EA 2IXAA 1D0IA 3BJMA 4GM4A 4O2BB 3CNBA 1MB0A 1S7GA 3RJMA 4DLYA 2IU3A 5IDYA 1JHMA 1Z26A 2WF6A 3L7IA 4IBOA 4B6GA 1ADGA 3OJLA 4XXHA 2AZMA 1H9BA 3WK9A 1CUHA 1I5RA 2XH8A 5LPNA 2Q99A 5EY5B 5FTNA 1JEDA 4F9TA 5L7TA 2CFTA 4COOA 5JSZA 2O20A 3AOEA 5LJLA 2EDAA 4D81A 2D8MA 5FCDA 1WPXA 3PR1A 5B6JA 3CZ9A 2YR0A 1NMYA 2DXIA 1N5DA 2EZ9A 4UUNA 2FZKA 2XY4A 2D62A 3CH6A 5CB0A 3DLHA 3L7MA 4DMHA 4NJEB 1JT9A 2WD7B 2ZIFA 1GPDG 2G09A 3PC2A 4HGOA 4PX3A 1DWQA 2B35A 4Y6OA 3ZY6A 4BYGA 3TQSA 4YRIA 3UY4A 4R68A 5AOBA 2F8LA 1WXGA 4LV8B 2NGRA 2ZM5A 1GGHA 1FXUA 5T64A 2AOUA 4WCDA 4X91A 4IJWA 5E6UB 4B33A 3DBIA 4YFYA 4YMUA 5ECGC 4Q7JB 5LA6B 5FWDA 3E7FA 3WYFA 1YZYA 2Y4NA 3CF4G 4ENRA 4DF3A 3SJ7A 4J0EA 1VHDA 5GINE 4O3FA 3UFXB 2P0AA 2V4MA 4IVPA 1DP4A 3RFFA 2IYPA 1Z82A 4S24A 1C1XB 1J2JA 3IHLA 4JKIA 1SBZA 4OXNA 1MEEA 4C4AA 3CVWA 1WQ3A 4KK3A 1NQAO 5DISB 1H2YA 3V8EA 1JA0A 4RKWA 4R2KA 2M1ZA 5DNYB 4JBHA 2BTQA 3RIYA 2HDOA 1PKXA 2PRZA 3JSAA 4AXBA 5C7LO 1V2GA 4J6EA 2AOTA 3KZXA 3BTVA 3E53A 3KFVA 5M5BA 3R7DA 5CYOA 3B9PA 1BCSA 3MWFA 2EV9A 1X7DA 1M1YB 5KSPA 3KLPX 1PR3A 3Q40A 1PYGA 2IXEA 3HCNA 5ITZA 4S1PA 1A76A 1G60A 2QE6A 2P67A 1PV2A 2FSSA 1XA0A 3UOAB 4Y3UA 2LD4A 3STVA 2BEVA 2HMYB 2X1VA 2NZXA 1NOJA 2EKDA 2Q2WA 2BGMA 4WOPA 4RHUA 1DJPA 3QBVA 4FMDB 4WDQA 4EO4A 2ERYA 3ZY3A 4WOJA 5BVGB 4AMZA 5LZ2A 5I9BA 3V9AA 2NP7A 4BJ5A 4WVFA 3V4PB 4UFPA 4IWYA 2HA2A 1EI9A 2AYZA 3F9RA 1B73A 3FI0A 2GK3A 1W36D 3VBEA 2MU1A 4MW5A 4G36A 3ZWDA 5J4LA 1B6TA 1G8GA 4CMEC 4HZGA 5BUSA 3UENA 2K2QB 2VUHB 3G2IA 4ZANA 1C3EA 3ONNA 2EOAA 3H6HA 4Y9TA 4ZVKA 4HATA 4M55A 1TAUA 4EPVA 4EI2A 3T3PB 4F4FA 1LNQA 1ADJA 5DM0A 2QLBA 1Q7BA 1Y3IA 5FL7D 5SY9A 2NO4A 2XDAA 1L8XA 3L7YA 3S8MA 2GF2A 3BILA 3K35A 4OK3A 4CQMA 5JALA 5J2UF 4OTZA 1LC3A 2W2QA 3VDXA 3RV3A 4GPIB 1H5NA 1QO0A 1XAGA 2C97A 3LVRE 3OEED 3RYTC 4CE6A 3LT5A 4G1VA 2BJHA 3ZV6A 2OV4A 2VBIA 1JHZA 3EOAI 3EW7A 1CERA 3WJ2A 3C7CB 1A8IA 4ZO9A 1MQSA 4L75A 2XQKA 4RVHA 2OYCA 2GO1A 3GUUA 4R9SA 3E18A 4A0HA 1K4MA 3P0HA 4LA4A 4ARZB 1L4HA 5B7GA 4URYR 2HU7A 4JLUA 4ZTZB 1PD1A 4BDTA 3WVNA 3DCYA 3GMIA 2ECPA 3GUVA 1UDWA 4LXUA 2FETA 4TL8A 4U7PB 4BQQA 1II9A 4H17A 3IAEA 3FGNA 4DHWA 1RLIA 2VUSA 1T0HB 1Q84A 2JRCA 1PBNA 3DAFA 4IPTA 1Z0FA 3GLTA 5LZ4A 3RUFA 3PFIA 5KYUA 4Y6LA 1I7PA 4WJZA 3DOUA 1KKLA 1RJDA 4Y8VA 1MC4A 1M2KA 1EDOA 3C0KA 3GRFA 4FSHA 4RV9A 4TUYB 5FUQA 5H5JA 5L6MB 2ZSIA 1IN4A 2X3UA 3EEFA 3Q0TA 4D80A 5CEJA 2AKAB 1M5RA 4P81A 4DR6B 2A9OA 3ROFA 4JN6B 1B2RA 4NCJA 3MJ4A 2QRJA 4ZEVA 4FT2A 4HGYA 5AD1A 2R4QA 3VR2D 4CU2A 1DLJA 1RJEA 2D7DA 4XB6B 3BKXA 1F0NA 3B5JA 4JMLA 5KCMA 4WEOA 3V8PA 4URWR 3U9LA 4P2BA 3RQSA 3CKYA 2G72A 3RSQA 3N8DA 1HC7A 1MJHA 3FYTA 1SO8A 1PK9A 4JBXA 2QK4A 1OC4A 2QSUA 3ML1A 3DOOA 3NRJA 1AM4D 1JMVA 3NIGB 5IXSA 1U3UA 1G19A 2JKVA 1E69A 1KAHA 1LZKA 2EWWA 3ESQA 5F77A 2B6HA 3RGGA 1Z5WA 4R2IA 3H2IA 1LXCA 3ZDYB 4U7JA 2P7IA 4KHZA 3PXGA 1D2MA 4PPQA 1C3OB 2BFDB 2NNLD 3GA5A 2A1UA 2AX4A 3LFTA 3LQ2A 8ATCA 1EFUA 1MQ9A 3WHLA 5B3JC 2DQSA 2JBAA 1CUIA 3ODGA 4IGAA 1P6UA 1R7RA 4FYPA 3LLSA 4JWTA 4KDCA 3DBVO 3NAZA 4UATA 5FTJA 5AVZA 2JLXA 3R9XB 1LU9A 2X23A 2IZ5A 1X1AA 3GRKA 4LDQA 3WGJA 1DWUA 3KZ1E 3NBMA 4CTJA 4L3OA 1JEYA 1M2HA 1CUEA 2H4WA 3N2EA 3OQ1A 3S4YA 2IH5A 1F2TB 4Y7CA 1RC0A 1QV9A 2PKXA 5BSRA 4XFKA 3G9QA 4JC8A 4D82A 3S5JA 1U5BB 4RD2A 3I5AA 4Z2AA 5JH7B 2Z1NA 3G82C 5L6LB 3NWPA 4MKFA 5LB4A 1VIDA 4Q3AA 1ZHOA 2UXCB 1PJ3A 1OXSC 2B34A 4JX8A 4YAOA 1T26A 1OROA 3VR4D 1YB4A 2A4MA 1HMPA 4NBSA 3R4CA 4MAFA 4XGRA 4Y6SA 5B6PA 2XWQA 3PLRA 2XXAB 3I12A 1AVTA 1S2MA 1ZQ9A 3KWLA 3ND7A 4JH0A 4LJKA 4PIMA 1E6CA 4WN9A 3MRTA 3O4IA 3BULA 3QFRA 5F3RA 4BN0A 5C1PA 3P2OA 1EWVA 2AK2A 1HTTA 2G4LA 1QSGA 1G6OA 3LPAA 4B6RA 4DABA 2XRZA 1IHXA 3H1GA 3VU9A 4BNZA 3VX3A 3KUDA 2FP3A 2XF8A 1UM9A 5HK9A 2GJSA 4QU9A 4GQAA 6YASA 2DY1A 3NHSA 4HUQA 3X2FA 3RLIA 1MNAA 1FNCA 2VBFA 2V6GA 3ZDCA 1T3LA 5DTJA 4D4KA 3F6EX 1QG0A 1U0GA 2OCAA 2XMZA 4OQNA 2JEYA 1U1DA 5TJ9A 4D9IA 1S01A 1T6NA 2EF0A 3PC4A 1ODFA 4WD3A 1L7OA 3OWXA 1KEZA 3K6RA 1LK7A 4ER3A 5BNIA 3PJGA 1IMJA 4CM9A 1E1QD 3D7LA 3D8TA 3KPWA 3QE4A 4S1OA 2J7PA 3H18A 4BN4A 4BUJA 3NETA 1DAKA 3CCFA 4D3SA 2G7ZA 3THYA 2QQ0A 4TTRA 2QM7A 5EE1A 1K5DA 2PX0A 3U26A 1XEWY 3FNEA 4TVSA 4B35A 2BUCA 2WJAA 5LL6P 1Z4MA 4EJ6A 1LWOA 3RROA 4UHBA 1YJQA 4MW9A 5KWJA 3MMXA 5EVJA 2DHDA 4OHOA 2CHQA 3GZTB 5BOVA 1UDAA 5JIBA 1TEZA 5K3SA 3H11A 2I3BA 4EB8A 2QTHA 4BNUA 1TCAA 2VJQA 2VA8A 2ZBUA 2D1RA 2X77A 3AUKA 1JTVA 3Q9UA 5AK3A 1HY3A 4C08A 5A2GA 1UBNA 1ZSNA 3DYVA 3EVDA 3GK3A 4ZV9A 1EJ6A 1YQXA 2GJ9A 2XOKA 3K0EA 4ZI7A 1J2YA 5ES3A 2N1BA 3EC2A 4G6ZA 2QXTA 4B7AA 2VHQA 1KR2A 3RUEA 4G4JA 3AL3A 4PAMA 3NONA 5CA1B 1CVRA 1LDGA 3E9YA 3PXDA 5T4FA 4LVUA 1XXHB 2GRAA 2B5OA 5F1PA 2FPLA 3MWDA 4J7AA 4C1BA 1G21E 3PGXA 4DAOA 1PVOA 1Z2CA 4QNMA 1NW3A 3LUBA 4FFLA 3V4VB 2QV0A 4ZCPA 2NACA 4Y30A 3PA8A 4ZARA 1P77A 2V9ZA 1LK0A 2CZQA 1BA2A 5A02A 1CR6A 4TRMA 3WMEA 2BW0A 3K5WA 3T7JA 3WMRA 4G4IA 4GYYA 4C4YA 3FFTA 1EE1A 5DPMA 4GOOD 3BXXA 3TE7A 1RM5A 1O95A 1UQRA 2ZTMA 5IXJA 4CIXA 5U9CA 3AW9A 2IZ7A 1HT3A 4AJIA 1V0JA 4BVGA 1KP3A 2I1QA 4LNHA 4R5HA 3VBCA 4Z9YA 3VUFA 4GPD1 4PFQA 1IULA 4F11A 4HC4A 1TMGE 5E3IA 3N2GA 2J3EA 5DYIA 1KFKB 1NG1A 3UPDA 1TW2A 1C7QA 1J2RA 2NV0A 3RC9A 3EHDA 3RSGA 5C8YA 4C2UA 2XLCA 1E3TA 3CM0A 4HADA 2GK6A 4UEKA 2REQA 2IGBA 3SQWA 4WOKA 3PNPA 1SZPA 4MP3A 5JZOA 2OCYC 2WQ7A 2Y1EA 2YZKA 4UU7A 1SRQA 3TZCA 3VGJA 4B17A 1MT0A 1TKRA 1JHQA 4FZRA 4TTTS 5FA5A 3VPXA 4BLRA 3DTVA 3O03A 4AAYA 1PTKA 5FI5A 5L4SA 4MEJA 2X7JA 5K3OA 2WG0A 4ISCA 1RD4A 1U0JA 4YMSA 5FV4A 5B12A 1AC5A 1R6TA 1UK8A 1VE6A 4PRYA 3SR4A 3HBJA 4D98A 5JZMA 3PCRB 4EGJA 1DC7A 4U3JA 4C0KA 3DTYA 5DW3A 4HFJA 1NI5A 4LWQA 3UXHA 1XL1A 4RA9A 4LOKA 2VLIA 2FLKA 2HO5A 5IS2A 3FNFA 5JNRA 3U5ZB 1UXJA 2R97A 3C3WA 4JEHA 4C0BA 5EIEA 4RANA 4NBRA 1MB4A 1P8AA 1DG1G 1O2DA 2P4QA 1UEJA 5FWYA 2JLUA 1JU4A 4QC2A 2IEIA 1C1DB 4HEA1 3V8QA 5FWNA 4ER0A 3KOXA 5BOSA 4UCFA 1M1NA 3FRHA 2ZS7A 4YRTA 1RRFA 4AN4A 1OLSA 4BNIA 4CFZA 1F3OA 2AHRA 2YMPA 3I32A 3TK1A 1I6KA 1T36B 1KIMA 1WZEA 2JFZA 2J9ZB 1LW6E 2WJPA 4QDZA 1NWHA 2IV3A 3RSLA 2EFEB 2VF2A 3WO1A 5LOVF 1T43A 1L5HB 1WY5A 3HKEB 4P4SB 4U2EA 1XCMA 1Q0LA 2XCIA 4HZUB 4IDGA 5E6SB 2JASA 5TDHA 1TEHA 3PEEA 3QWIA 5H70A 5DLQC 4DBZA 4TZTA 1PQUA 3ORYA 4M8KA 4BNHA 3ZE2B 2VHYA 3RTEA 3SX0A 3ZGYA 1X42A 1VE1A 1W34A 3I2FA 4EF6A 4KQGA 3ND6A 1U4NA 4WXMA 5D84A 4CU5A 2D5CA 4RIFA 5SYMA 1ICIA 3RC7A 4CHTA 4DDKA 5B3LA 1GZ6A 1K7CA 2ZI6A 4UBLA 2QRGA 3V6LA 3NTLA 4MV1A 4QATA 3U3KA 3K0CA 3A0UA 1GZDA 3DJFA 4Y9SA 1BWSA 4KDRA 2VZ8A 1QVAA 2CBGA 3T4PA 5CGQB 3VDNB 2QAGC 2B7LA 1VSQA 1AB5A 3SWWA 1O89A 3QVGB 4RIHA 2IZOA 3GEPA 1GFZA 1JG7A 2PLNA 3C6ZA 4ZXFA 2M6RA 5HCNA 4EJSA 5GIOE 4DV0B 5PNTA 3N28A 2TYSB 4WFKA 1QRSA 5FR1A 2Y68A 4PYOA 2DQZA 3V1UA 3RM3A 1E66A 1YK1A 4IAOA 821PA 3BRWA 3E5MA 4U2DA 2FSVA 5LDDC 3GJQA 1I4LD 5AKLA 2ZE6A 5AO9A 1L7PA 2WV9A 4JDUA 2Z9CA 1MNQA 1SNYA 3DE1X 4HQNA 4P5EA 4RZHA 4R5MA 4Z9XA 1XPUA 3AJ8A 4ZT2A 5A1JA 5CEFA 2HCFA 4YAJA 4AECA 3GBPA 1NOIA 3VKGA 4P32A 2FPGB 2PUFA 4A0QA 3H9CA 1TRKA 3OCZA 1XF9A 3EN0A 3ICEA 2UV8A 4PANA 3H4MA 4NOMA 4AQDA 1KYQA 1LDYA 3UB3A 2I8LA 3KVOA 3JD3A 3D6UA 4EG5A 4PNHA 4DRZA 2DTDA 5EUBA 4K6KA 3J80A 2BI7A 1J22A 2EW2A 3AERA 4P83A 3WSTA 4BFVA 1OYWA 1EB9A 3E4DA 4N6GA 1V1RB 2C3MA 1YJ5A 3OU2A 2PVCA 1U94A 5TQJA 1MA0A 2GO7A 1U8YA 3O9ZA 4JIMA 1ELOA 4LZAA 2ZB7A 1U7WA 4NEHB 5CHYA 2HDHA 4QXQA 2YV1A 4JB8A 1E8DA 4OHFA 1PJ2A 2H1SA 1YZNA 1U8ZA 1XKXA 2A92A 2V1XA 3ACCA 4BX3A 4XTRA 4AIRA 1Q2UA 2ZPAA 4HDKB 4GVLA 4MLCA 4PQGA 5IDWA 1UOQA 1AT1A 2VLBA 4JL6A 2GPWA 4KCGA 1MIHA 5TEWA 4D42A 4RTPA 2ZYUX 3P19A 4O4JA 4HH4A 5G4KB 2IJGX 3NTVA 1BWRA 3ECAA 3KJXA 5AQEA 4QXOA 4N3GA 3U4GA 4CL8A 1QCYA 5TPZA 3NTQA 5HQJA 3WIVA 1K98A 3WE7A 4YMHA 1I2CA 2YV4A 4PCAA 4PW0A 5FJJA 2PK3A 2GBIA 1SUAA 4D7AA 3EEIA 5DNDA 2R5FA 5F2EA 2RHTA 4XE5A 5EZSA 4BB9A 5L45A 1G6HA 1LV8A 3I61A 3Q10A 1KHHA 3G2PA 1AKWA 3MUNA 3UUEA 3ZDQA 2M9MA 3KJFA 2WIJA 2QRZA 3HDQA 5B1EA 4UULA 5K3CA 5K03A 1NASA 4M8SA 1CS4C 4RH3A 1J2EA 2FB9A 3RVDA 1E2PA 1O8CA 1YL5A 3EXFA 2QT9A 2WKQA 3IUEA 3R7BA 3HUUA 3FCUB 3P9SA 4LV5B 1MABA 1ML3A 3QLEA 3B13B 3FMVA 3WLOA 4W6ZA 4WTOA 3K5HA 4RF5A 3OQJA 4DQDA 2JZOA 3IV9A 1QFSA 1QYWA 3V6MA 2VXYA 3A9WA 1EWQA 4G5YA 1HQCA 2P9QA 3OQIB 2F67A 2OCXA 2BJVA 2TMYA 1C3JA 3FB4A 3MIIA 4HX2A 3LC1O 4V1CB 4IMIB 2ZK7A 3AEYA 2IV7A 4D46A 3LM8A 4EYKA 3U4IA 4ARBA 4G37A 3WMWA 4CMCA 1Y6GA 4QLAA 4C6SA 5DHRA 1JFRA 3O94A 3D4BA 5EZYA 2HLHA 2OHHA 3EUEA 4L6IA 4LEIA 3NEYA 2AZ4A 1MB3A 3AXTA 1R66A 4TRRA 5JWOA 5JAQA 2PD3A 1TOAA 1UFOA 1X7YA 4GOKA 3SKYA 1SXJA 5ESXA 1YS4A 1MW8X 4CT4B 5E7QA 3EA5A 4Z51A 2H51A 3MOSA 2X1MA 3HCRA 1VFNA 2XYRA 5GQSA 1UP7A 2WSMA 4K87A 2B30A 1HNXB 1YL6A 1P2GA 2GM9A 2XB8A 1LUAA 4G0PA 4FGWA 1BKSB 1NONA 3D81A 1T8SA 2Q1UA 3GZ4A 1RHUA 1Z25A 3HXOA 2XUIA 3X1XA 1SC1A 2O3QA 3L1IA 4NQZA 5KAPA 3T1OA 3GLVA 3R9KA 5IPFA 3S28A 3UAWA 4EG1A 2XA9A 4DA6A 1WXFA 1ZU4A 4LTMA 2FWNA 3DOIA 5B1SA 4GOJA 4D41A 1JAHA 1I7DA 4TM8A 4QPCA 5EE0A 4RGYA 3KPYA 4CIYA 3R76A 4J1TA 1U0TA 2I03A 3G89A 4X9XA 3M1IA 4WKBA 3SNKA 3NHBA 4G5RA 2B1QA 4JXKA 4BV9A 2L69A 2I0FA 4PLWA 4ZZ1A 2CJPA 4P53A 1GU7A 3U81A 3FCSB 1PUIA 4G9EA 4BU0A 2WPNA 1NMXA 2MYNA 1B26A 3B2EA 2H59A 3AZQA 3GB9A 1KQGA 2JG3A 1ZCAA 2ANBA 3H1FA 1CTQA 4KRYA 5CB6A 3FHJA 2QPTA 3QITA 1P4HA 4AL4A 5CG1A 4OHVA 1AQJA 2ODAA 1AHNA 4L4YA 1OPRA 3F5SA 3JXEA 2P68A 2P6UA 1F8XA 1L2TA 4G9BA 1L3BA 4QO7A 3ZZMA 3Q2IA 2PIAA 4M1EA 4GW3A 4UZEA 2JHCA 5K0SA 1LI5A 1HE2A 3UTCA 3ZWQA 2V7QA 4YJHB 2SBTA 1MO3A 2FX2A 3NPMA 2NP6A 4F2WA 2AWOA 1QP0A 3V3TA 2FUG1 2XF2A 1A8UA 6PFKA 3FIUA 3QRWA 1RQXA 1PYDA 3PJDA 4AJNA 2AOXA 1L5MA 3FOWA 5CK5A 4F97A 1IBMB 1QVZA 1WMAA 1DKMA 1NTRA 4ROSA 3L8HA 3UHOA 1R5BA 1KP9A 2P1DA 3M1AA 3BERA 4FWIB 2IHYA 4GUDA 2XQGA 4YJGA 5EJ8A 2PL5A 3WZMA 3FKQA 1JPVA 3AKYA 3MN1A 4UQPA 2C7BA 1UPCA 3NVKI 1HQKA 3B7GA 3GJXC 3I01A 4QG3A 2HRDA 4JBIA 5E0KB 1YAJA 1GGFA 4U5XA 1IQPA 1JR3D 1NFRA 2HA6A 3PZRA 1A9RA 1J97A 1NJ2A 4JJ8A 1U81A 4P08A 3VKHA 3QY0A 3PFFA 2XT6A 4HG2A 2XITA 3DWFA 4TRNA 4OUKX 2MJLA 1MOZA 2A88A 2QA5A 1VP9A 5DDIP 1FNBA 3O75A 3TQIA 2GVZC 4IY1A 4OL9A 3F3MA 3D0OA 1KJ8A 2F48A 3OT1B 4GBMA 1NBEA 2ZSBA 4X45A 2ZRKA 4OH1A 2EFGA 4R9NA 4E4RA 1BRMA 3L93A 1K66A 1H9AA 5LDHA 3OIWA 4OAPA 4RTSA 2DKNA 1EUDB 5EFOA 1ZH4A 3LGXA 1IK6A 2YUTA 3ICVA 4A0GA 5D7NA 1BGXT 1LPBB 2LR0A 1MTZA 1T0IA 4LOLA 1L7EA