2RSLA

Refinement of gamma delta resolvase reveals a strikingly flexible molecule
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
122
structure length
115
Chain Sequence
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refinement of gamma delta resolvase reveals a strikingly flexible molecule.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
molecule keywords GAMMA DELTA-RESOLVASE
total genus 42
structure length 115
sequence length 122
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2rslA00
2GM5A 5C35A 4BQQA 3UJ3X 1ZR4A 3BVPA 1GHTA 1HX7A 2RSLA 5C31A 2GM4A 5C32A 3LHFA 3ILXA 2MHCA 1ZR2A 3G13A 1GDTA 3PKZA 3GUVA 5C34B 3LHKA 2R0QC
chains in the Genus database with same CATH superfamily
1JA9A 3ROKA 1KDTA 2O20A 3AUTA 2DULA 4X3OA 621PA 1OXSC 3BGVA 4LECA 3QW4B 3BD7A 1G8JA 4IIJF 1GGEA 1GPNA 5E1DA 2Y99A 4BMXA 3A9VA 4MQFB 2REOA 2XT0A 3I5MA 1PQUA 1R6UA 3MGGA 2XA1A 3GFRA 1OE0A 3BH6A 3C16C 5EGNA 2H7YA 1WOMA 1A7JA 4PN3A 1WDTA 1Z37A 2ZWVA 5SYAA 4OJNA 1UMBB 2X40A 3KQPA 4FN4A 3R3HA 4M1ZA 1A0OA 4WFIA 4U2EA 3KUDA 3A31A 3PUVA 4RF3A 3P2OA 4B43A 2JAXA 4V24A 4TUYF 3WK9A 1UXOA 2SCUB 1UQUA 1AKEA 2JFZA 4I1IA 4L8YA 4JJZA 4GLBA 2YIJA 1C9EA 4G4SP 4Y0VA 1YU6A 2GPTA 1RCUA 1P31A 1BMDA 1U8UA 2ESRA 2WJYA 1GSOA 2G6BA 2GQ0A 3BCSA 5H7XA 1KY3A 2C3UA 3COWA 3A2LA 1OH6A 2DZDA 4NCNA 4ALMA 2CLCX 4E4RA 5KBYA 2HSJA 2ZBDA 4MQBA 4D9CA 1Z6QA 1AKRA 1Y4SA 3L43A 3P32A 3USES 1RXEA 5JSZB 4B1FA 4UTOA 1NWCA 3S3TA 3HB4X 2ZUBA 1DL5A 4YALA 5ITWA 4YAEA 5A06A 4KACA 4JYAB 5BN3B 3WO1A 2DKNA 2W6ID 2VTBA 2QVXX 2ZT6A 2CXSA 3STWA 2IYNA 2C4WA 2Z8XA 2GBLA 3DFMA 3NTXA 4BLUA 1VKZA 2FU5C 3QKWA 3SR4A 4ZK6A 1U8EA 3GZJA 2WF8A 2J9FB 4XDZA 5AVYA 2ZITA 2B3TA 2QTBA 4HRYA 4US2R 2N3ZA 4FHFA 1KZ6A 2HJVA 2RARA 2YFHA 2EKBA 4MA0A 4D7AA 2IDJA 1EJBA 2PR2A 4ZT4A 3S2GA 2PVCA 5BURA 2VPIA 5H9WA 4B8YA 4D57A 1WTAA 4KPFC 2LKDA 1XAJA 1I13A 3CYFA 3SY8A 3AW8A 2OV3A 1LDMA 1T8SA 4V02A 4LNUA 3BN3A 4LJSA 3FPSA 3VH1A 1JS1X 3E7WA 4G23A 3MQ2A 2X9GA 1GR0A 5HPYB 4KIGA 4RL6A 3N70A 1GTMA 1ONSA 1QVWA 3QEKA 1NVKA 1SIUA 2OQ2A 3DULA 2I2DA 3K1YA 4RH0A 1ORTA 5FOVA 5JG7A 3SLKA 2A58A 1KFBB 5IDXA 2CNBA 3N7TA 5CLGA 1G6OA 4Z3KA 3CNQS 1MC4A 4XSGA 3S8MA 3V7UA 3B1JA 1H6DA 1XXHA 2D0IA 4HFRA 2Z5GA 1GGHA 2R1ZA 5PNTA 4CBVA 1WU7A 5I47A 2KWIA 1RYNA 4WZBE 1C50A 4RVDA 2W93A 1LPNA 2QJWA 2XUQA 2Z58A 1AZTA 2YCLA 3HYSA 5L3ZA 2VSYA 2G09A 3I0NA 4JYMA 3WC4A 4CT0A 4P82A 4FFWA 4LDQA 1SB8A 3TNDA 4OKNA 3GGGA 4JLDA 1KC3A 4KODA 2GBGA 3EH2A 1T26A 1E3DA 1FUIA 4R1NA 5ECDA 1PR3A 1KYIA 1NF9A 2R6CA 3I8OA 4TQGA 3U49A 1M1YA 3IDOA 3KTFA 4IR7A 4S3MA 3THXA 1Z33A 5FT9A 3CW2A 1YZQA 4GPIB 1O0SA 1RLJA 3EZGA 1Y42X 2Z08A 1DEHA 3U7FB 2QN2A 1TA4A 2J3IA 3JATB 3GN2A 2ZW9A 2DQ4A 2PZGA 3ODPA 4II7A 3H2SA 3UJ8A 1FUUA 4V0RA 3WGQA 4BLTA 4WDQA 1YHNA 4S04A 3NWPA 4FDUA 1HV8A 1MQAA 2BR5A 4QM7A 5FBWB 4QA9A 5BO5A 3V1NA 3L9WA 4RABA 1BEZA 2WT8A 3FCEA 1IZYA 3PSHA 4NE2A 5H4HA 1YGYA 1ZH6A 1PJ4A 3MB8A 4LYJA 4NE7A 3K2QA 1G6KA 3BSSA 3QNWA 1IN4A 1USGA 3FETA 4ZV7A 4JXZA 3DAGA 4HS4A 1NW8A 2NTVA 1P1FA 2WTAA 3MWLA 4U9IS 3TBKA 3RIXA 1N75A 2PD4A 5BQXA 5KHOC 2ZIXA 4F3YA 3W5UA 2M6SA 1NSTA 4GXNA 5CNIA 2CLEB 3ACDA 1IJKA 4XD7D 3OPXA 5AI6A 5DRYA 1Q2XA 4R83A 4YO8A 3LQYA 2WJJA 4HNAA 4BJHB 5J4KA 1IPEA 5FWYA 2CJXA 4BQQA 1NG9A 3ZGVA 1X94A 4BRSA 5TEVA 4EFNA 2BKEA 3ISTA 3ITKA 4G36A 5G4KB 1QUFA 3B8HA 4PPQA 4RF5A 3LDHA 4UHEA 1EUYA 1Z56C 1IL0A 2VC2B 5KX5B 1E59A 2A2ZA 3O1LA 4DCSA 3DQQA 5CURA 3GFFA 2DPGA 1RJGA 2NYUA 3LWBA 3BWDD 3DBHB 1GL6A 1XCBA 2Y0PA 3GNLA 3VU9A 3FLAA 4P3YA 3FDJA 4XUGB 1JSCA 3RREA 2PAAA 2POQX 5FUQA 3STVA 4B40A 4ZDJA 1IWOA 4WK0B 1DRUA 2AQ8A 2WM3A 3SEZA 3HO1A 1RDFA 4JBXA 4NICA 4DIMA 1BVUA 3E7PA 3W5IA 3I9NA 1OC4A 4QGHA 4UCXA 3Q9LA 4KFSA 4MPJA 4DANA 2PT7A 1QPZA 5BVHB 2PQ0A 5E6SB 3E1SA 4INAA 4RNDB 3AR8A 5A7HA 2FXIA 4PBSA 5KI6A 3X3HA 5KNDD 3DTNA 4ITRC 4NENA 1SRQA 4H17A 1OZHA 4YXWA 4EL0A 1UM9A 1YIOA 1CULC 2YS7A 1W85B 2FLWA 3IESA 1KH1A 4W6ZA 1VQ1A 3ZHSA 1NONA 2XBLA 1KI6A 2XVXA 4IL5A 1E1NA 1VJ0A 3GT7A 4HX5A 5DWDA 3AF3A 2H0RA 3EY4A 1G6Q1 4L0QA 4E30A 1M67A 4EKYA 4RIEA 2Z8YM 1KBQA 1DJPA 5EZ6B 2AFRA 5F2EA 3RS8A 3OQIB 3B3AA 2FOXA 2G4CA 5AVSA 1O77A 3TRHA 3UMGA 1OWNA 2HGZA 3A2NA 2VG8A 1SXJD 4BFXA 3GRZA 3MT8A 5DNAA 4HDCA 4EFDA 4Z7QB 1XAHA 2GJAA 3LGXA 4MYTA 2OK7A 3RB8A 5JC8A 3Q5GA 5LXTF 3U3XA 1E1LA 1G8FA 3PRJA 1Y5RA 4B5KA 4D3FA 5A6SA 4MKZA 2A0FA 1JR2A 5AUOB 4KXYA 4DT1A 1Y6QA 1G2PA 2RAVA 3HB9A 3KQHA 3JD0A 4EY4A 2E0IA 4OYLA 2DX7A 2CNOA 2PMBA 2V97A 3S27A 4WN9B 4X6YA 4R8LA 1RP7A 3DT9A 2WUGA 2YQ4A 1JQBA 4Q7JB 1OASA 3MMNA 4ZRNA 4ZT7A 2PLNA 2F1HA 3KB1A 4ESOA 2I6UA 1ZIPA 3K72B 3M70A 4HMQA 2P41A 3EGDA 4ODIA 4Y0NA 2VBIA 4JBWA 1C1YA 4MCIA 1A9QA 4YMVA 1ORIA 5CNKA 4BLQA 2QBYB 4URHA 1SU8A 2GHTA 3QUCA 3UNXA 5MGNA 1S9DA 2VUUA 2FWIA 5I01A 3TFOA 3O47A 1XFAA 3OLXA 5LP6C 4PNEA 4ZDKA 3LM8A 2OCIA 4D9EA 5IKPA 3L4JA 1OXXK 3D4BA 2FFBA 4PS1A 1ZU5A 4AY6A 4IQ0A 5JLJA 3AVTA 1GTL1 4PFKA 5JYBA 1DEOA 4PTLA 4AUKA 2CT8A 4W82A 2Z30A 3UUGA 3HVIA 3DTYA 3RS4A 1MQ9A 2QR5A 3K2BA 1V7CA 2AR9A 4RK0A 1TZCA 2Z3VA 3M5WA 4FHZA 4HXFB 4UDOA 3IQEA 1I24A 1D9XA 5LLSA 1U99A 5BPFA 1H0SA 3OAAD 2ZRCA 2J5BA 1NVDA 4O1MA 1SOUA 4IKEA 4ZQEA 3SG0A 3EAQA 3OE4A 4CV2A 4CMHA 2FJUA 4QUJA 2QRHA 2H06A 4I9HA 3B5IA 1Z75A 4YJKA 2R68A 5IZCA 1KDPA 2ST1A 2WAOA 3WLFA 1K5PA 3GRUA 2JFWA 1PWEA 4DLBA 4RYLA 2Y9MB 5DK4A 1J49A 1RZRA 3QHAA 3TKLA 2NP7A 2RHMA 1UZUA 1KI6B 1H23A 1DLIA 2ZRHA 3OP4A 1C8BA 2PZEA 3LC2O 3RAPR 3ZNNA 5ALJA 3OJWA 3TW8A 4YUVA 1BWSA 1PK9A 1WUJS 2AUMA 1EHCA 2VVTA 1WTCA 2OBXA 4NMMA 5KOHA 1OWOA 1C8KA 1INLA 1VFNA 4PBTA 4JLMA 4HWGA 1NNUA 4NQZA 1Z3IX 1RYZA 3UPDA 4KXXA 3T41A 3T95A 4HBZA 1ZD2P 2ZJ3A 4D0LB 3H17A 2WW8A 4LHZA 2HV8A 3ZDYB 3ZWQA 1J21A 1TM2A 5A04A 2GCNA 1IB0A 4MDYA 3CR7A 3IJPA 2OQVA 3VDQA 1R6BX 1Y9EA 2ADOA 4M1QA 2EP7A 4Y7CA 2ZREA 3HXTA 3PITA 5FULA 1NXPA 3M5DA 5C8XA 2XXAB 1R9GA 4H6WA 2V7PA 1GN9A 1PTJA 1Y8QA 5EJGA 2CUZA 3F9CA 4O8ZA 1YZGA 4Q1VA 2MMGA 5B1DA 4Z51A 2NVWA 2X8BA 5FTLA 4HDSA 2H8KA 1E63A 1TAGA 2P8SA 1QVZA 2YZGA 2ZJBA 3L40A 1CVRA 2GCEA 2ZEJA 3QMMA 4D41A 1QK4A 4YMTA 1KVQA 4XJVA 4X6LA 2PKQO 4ZOEA 4MITA 2HTFA 3LPCA 1A27A 4HXEB 5JDIA 2H9IA 1SVWA 2JVIA 1USUA 3PC3A 1O9HA 4DMCA 2ZSJA 4YRKA 5CD9A 2A5JA 1EUZA 4G0OA 4H4CA 2IH2A 2YIVX 2VDPB 2OO5C 3CLHA 2RGNA 1LV8A 4HK4A 1V9LA 1R8XA 2PD6A 1A71A 1W25A 3QITA 3DDOA 4OTZA 5IFKA 1WP9A 1RFGE 4IZOA 4JI8B 1QV6A 4FZVA 5ILGA 1J8MF 2DUJA 4E6EA 1N92A 1I36A 3A3PA 5BW4A 1A4UA 4JP2A 5LWQA 3U9LA 3E3MA 2B3DA 4CNQA 1Q5PA 4YQZA 1E18A 2CDRA 4R2MA 1LPOA 1DOAA 5CDFA 4OU4A 3FJ1A 1Q57A 2GN0A 4L0DA 3DKRA 3TBFA 3U3OA 4QVIA 3RCBA 3RV3A 4XZ3A 3Q41A 1HE5A 4NX2A 2YS6A 1O97D 4OMFG 3OP1A 4DIKA 4EG7A 1CW2B 3DZ8A 1Y6FA 4FEGA 2HK9A 1P2FA 1PZMA 3BIJA 2GM4A 1UC4B 4Q93A 4C7OA 1U8AA 1PRYA 3TGLA 4GI7A 1EWQA 4J9UE 1DNPA 1ZAKA 3KC2A 3QIVA 3K6SB 1WF6A 2XLCA 1Z45A 5D1NA 1OWPA 1YDWA 1CZKA 1R10A 2WU0A 2ZAIA 3GLHE 4CQLA 4D3ZA 5CB0A 1Y33E 4O4HF 3H99A 2LIPA 1WV1A 4WGFA 4BUZA 3Q6MA 4RTJA 3GA5A 3COVA 1FSGA 4Q9IA 3EOBI 2ECQA 3PWKA 1NUTA 2WMNB 1QGOA 1XA3A 3DBRB 2TMKA 2IY8A 2JBAB 3O1JC 3SR3A 1X9GA 3LBYA 1ZN2A 2IS2A 4URWR 1UM9B 1Y3FE 3GPIA 1EDBA 3MS7A 3RBAA 3IJEB 1VKJA 4ZCQA 3TTXA 4A5OA 4B2PA 5AKGA 4NBVA 1WPXA 3RK4A 1OV4A 3E84A 5JFTA 1XO1A 3QV2A 3DZBA 3DNMA 4JELA 2VP4A 1ADGA 1NXWA 1NVMB 2WKWA 3HCBA 2P65A 2FVYA 1HRKA 4R9RA 4DR1B 4NH0A 1SXIA 1VJTA 3DEFA 1FFXB 4BCBA 2HXYA 2R0QC 4TRNA 1IEWA 2NT3A 1ZP6A 1EA7A 4C3OB 1ZM9A 5CFRA 1Y1QA 2BGUA 1UKEA 2HJRA 5BR7A 3A4IA 1IPFA 2VR1A 3ONEA 7MDHA 3DHVA 4FEAA 5LMZA 5LQKA 2W71A 5T3UA 5WRFA 3JWEA 1OU4A 3H2ZA 5G4KA 4EENA 2QRUA 2ZPUA 3OKAA 3PQDA 1OREA 4ZT6A 1W6UA 4UMDA 3D8SA 4AJ9A 1A7KA 2A1UB 3BWCA 5G3ZA 1ZMOA 2FWNA 1R4NB 5AH0A 4B80A 3LY7A 1W94A 1XTRA 4Q21A 1KQNA 1B0PA 4NOKA 3RV4A 3O8CA 3AXTA 4IICA 3QOXA 2QTZA 2GJ4A 3K5HA 2GCIA 4NABA 1VHLA 5LBIA 2O8NA 1W4BA 4RLFA 5ESDA 2QNIA 2X4LA 3H5VA 3QXXA 3LPMA 3H2JA 1KJJA 1M33A 1VLZA 2RAUA 3MPOA 5ALPA 4BASA 4N03A 4A03A 1SXPA 1W4RA 4G1BA 4NEGA 4M3NA 2QX4A 4WKGA 2ODEA 2ONYA 1GQRA 3FA2A 3TL2A 3K0FA 4J2TA 4D8XA 1K2VN 3QMPA 3AVXA 3RDPA 1PNOA 1IBSA 3CE9A 4Q4JB 2ZWPA 5DTQA 3U2QA 1XTQA 4NATA 4MGYR 4DVJA 4Z49A 1Z2NX 2EKDA 4N8EA 3BRQA 1RLUA 1K92A 2FN3A 1XVLA 5DN9A 3DZKA 4A6DA 1MGOA 1MENA 3CRW1 3K71B 1LB1B 4FFPA 1EE1A 3EARA 1YBAA 2AV6A 3F6YA 3DOJA 4ZVPA 3VC2A 2I1VB 1XAIA 2JIMA 4OHOA 3FTDA 3L05A 4N76A 1SOAA 4PC2A 2WJ4A 4ND2A 5GZ6A 4H31A 3SQNA 1OX4B 3AOEA 1PIWA 2A33A 1HTWA 1CNEA 3KDAA 2BEUB 5EP2A 4AUNA 1EFKA 2PYDA 1CDDA 2B1RA 3I30X 4NFLA 1WEKA 1JJFA 1E64A 1N0WA 1M34A 4Q05A 3RAEC 3BA1A 4DZTA 5TS3A 1WVGA 1JHOA 4BQEA 3F96A 2RE8A 2B8TA 4LVOA 1QS0B 3Q72A 3PJEA 5B2EA 5C81A 3A4LA 2XUZA 1DQRA 1VSVA 1ZH2A 4YX9A 8OHMA 4RXUA 4FEEA 3JS5A 3KQQA 1I1QB 2PYIA 2JFHA 4KQFA 4YPVA 2LW7A 3KWJA 5FBZA 4LK2A 1JILA 2HXSA 4FD2A 5I9BA 1J33A 1G3MA 1QHHA 2FPIA 3IP1A 4JP3A 4UREA 4ZOLB 1CBUA 2CJYA 4RQAA 3H3JA 3U40A 1VJ5A 4NYIR 3TI7A 1IYZA 2WAMA 3PDWA 1NQVA 2WQZA 2WU3A 3O2JA 4ITUA 4PIMA 4DYVA 1RKBA 3OX3A 5BSTA 1GPDG 4YRFA 5G41A 2WTEA 3HU1A 4AFNA 4E3ZA 1Q0LA 2JCXA 3R9WA 1PLKA 2L82A 4G25A 4DDVA 4FB4A 2ERCA 2NWQA 2QRMA 1DWUA 3M6AA 3UJDA 4EVIA 3R0VA 4V39A 1OD6A 1UL1X 3HKCB 1G17A 4KXLA 3CC8A 4IXMA 1HMPA 5M5BA 4D4JA 2J6CA 3N8GA 2Y67A 3WL7A 2VF4X 4PZYA 3RSHA 1K2WA 4JLPA 2VF5X 2AL7A 4HP8A 4NAUA 2XHZA 4RY2A 5AK5A 3K70D 3OBBA 1VA4A 1O7JA 1KEVA 1WLYA 3SGLA 4Z4IA 3BRWA 2Z1DA 3SBEA 1U1FA 3D0RA 2VP6A 1S5PA 3CCBA 1JKJA 1N2XA 5AKYA 1I2DA 1TZMA 1VYUA 3ASYA 3AUYA 5K3BA 2BZGA 2DP4E 4AQDA 2JJ8A 5KYWB 1H3EA 1SG0A 2R1TA 2ZI9A 2MWMA 5HOQA 1S2DA 2HWKA 1Z7GA 3UFXB 2AD1A 4RORA 4WIAA 5AW1A 4KV7A 1K75A 4P2GA 1TADA 2G83A 2VPPA 4W5HA 1XZPA 4YRJA 3GT4A 5ALNA 3FHCB 3RNLA 1CP3A 3DDNA 5M3BA 3VO1A 1F3LA 1N6LA 1XJ0A 3H5IA 4MLPA 2SCUA 2QB5A 4NWIA 1KY4A 5FWAA 1OAKA 1KYQA 5DBGA 3ZVLA 4AURA 1IN1A 5T4HA 1KEUA 1CZRA 3A10A 3BZBA 3DDCA 3SSAA 3WKBA 4IFBA 2IZOA 4JY7A 2OG1A 5ADUS 1QZZA 1E1YA 1U4NA 2XWBF 4ZHQF 1RPZA 4I1SA 2J3LA 2YX1A 1NN1A 5DMHA 2WG1A 3EA4A 4ZYWA 3AF6A 3SEFA 3TFQA 4BNNA 1P3Y1 1KYWA 5EPUA 3ROFA 2IQIA 1PFVA 1U4SA 1ZD8A 4F7WA 5K45A 3GLIB 3TLZA 2HQSA 2RJ3A 3PBKA 1NHWA 4KAAA 3CZ5A 2ECPA 3JYPA 3N6RA 3TF5A 2O2IA 2J3QA 4MVCA 3HPQA 3TH5A 1DSSG 4HNTA 3TRFA 2G1UA 4AJ2A 4RV5A 2X8LA 2OQIA 1VP9A 1IOZA 1L5QA 1SKQA 2EKLA 2R6R1 4HFMA 1W8IA 3GEMA 2QTMA 4L9WA 4LRYA 1DINA 1HEYA 2FETA 4Q6WA 5JTUA 3GFOA 2NUAB 3E2IA 3BXHA 3MJDA 1BE6A 4H08A 1PHPA 2J4CA 5FORA 3L8CA 5AK4A 3SX0A 1IDOA 2JHAA 3NI2A 2QLNA 3TLEA 4CLHA 2PTGA 4E33A 1SEVA 1HTBA 4WUTA 3OVMA 3VHQA 4DUZB 1AHHA 4BGUA 1Q19A 4YUWA 3AUAA 2X86A 3N5CA 4K0KB 1TEZA 4GZ5A 2WWVD 4CL8A 4NFSA 4FTWA 3BGIA 2XKKA 2WV9A 3PDJA 1T4DA 1E8NA 1ZK1A 3EN0A 3F90A 2C5GA 4D6YA 1J9EA 2X1HA 2ZBPA 5EJMA 3V80A 2XUDA 3C1AA 4PG8A 2R5WA 1U7WA 4J7UA 4FYXA 3OCCA 5T6BA 3GUCA 5BUZA 5CFLA 1JLRA 2EJCA 1WG8A 3ZQ6A 2HMWA 1R9MA 4UEJA 3GLGB 2FWRA 3QHPA 1DJMA 2BVNA 3KB6A 1P0CA 3NEPX 2E7ZA 1S6YA 3KZNA 5EUMA 3AEQB 3WBBA 2X2PA 5ICGA 1LDGA 2ONCA 3A7EA 4E7OA 2ZYRA 1Z5GA 1LVUA 5EUCA 4HT3B 1PR5A 1BE1A 3D6MA 4UU0A 1RZ3A 1AT1A 2JVJA 3F1KA 5D2CA 4DTIA 3KSAC 1Y3DE 4XPIA 1RRCA 1LLFA 3OO0A 4G2NA 3ILVA 4RIHA 4ENRA 3G2IA 1T5BA 5HJEA 1KNQA 4XDYA 1ACJA 3QU4A 2J5QA 2IEIA 2R6HA 3FROA 4UEOA 1B8PA 3ZHUA 2FSUA 2DRIA 3WLNA 1PZXA 5ALLA 1TTPB 3RU2A 1ECGA 3L7LA 1V1JA 4X1IA 4YLGA 1GA4A 3ICEA 1YOVA 4L6IA 2JD0A 2IP2A 3UB4A 1DCKA 1N57A 2AOTA 3QBDA 3X1ZA 4DGSA 4BECA 1WY5A 5LUAA 3RYCB 4DAEA 3S0JA 2V6IA 4OK5A 5TQ0B 1Z6XA 3HZOA 4DLKA 4K7JA 3GLFE 1KAOA 4QELA 1PBTA 2NO4A 5LL6P 3QEAZ 2NU7A 1U8FO 4KP7A 4QNMA 2VF8A 4QYXA 4E2ZA 1QYCA 2FWAA 1NMSA 2IUSA 1YGPA 3OIDA 1VHJA 3RSGA 2O19A 2BFPA 4O4LB 1QQ6A 4EBFA 1JEJA 4QX6A 4AJOA 1E7WA 1A9YA 4BL5A 4CNBA 3IPXA 4QVKA 1L5NA 1QLWA 4X20A 3QEMA 5DSXA 5JFGA 3FKSA 4AP9A 3MWDA 1R0KA 6AT1A 5IBPA 1YU9A 2FFJA 4IIUA 4N18A 1O87A 3RAFC 1GWNA 1G21B 3L6DA 3TZQA 4ZAYA 3OEWA 2GK7A 3S2UA 3INYA 3SQDA 1T2UA 1TFRA 3EZXA 2GZHA 2X9LA 5HIAA 1ZGHA 3ZDAA 2VAMA 4QT4A 2C3OA 4P3PA 4MO2A 5F21A 1K5HA 1GTSA 1ZJYA 3LTEA 2HA2A 3TL3A 4DLAA 1EUDB 4ZGGA 5CAEA 2H2GA 2QRKA 3T5DA 2C8JA 3ZHVA 1IZ8A 1B8UA 1NU8A 3R6LA 3GPDG 5FPSA 1D09A 3BJRA 1CY0A 4LDNA 1KARA 2QRPA 2BRUC 2L19A 3D43A 5AW6A 5HHTA 1QTNA 4O0LA 5SYMA 3DL0A 1KRXA 2PGLA 4W8GA 3BWXA 4X1IB 2Y8EA 5FNVB 4YMGA 4WCVA 1Y5NA 1T36B 1BDBA 1AO3A 5LZ8A 3RANA 1GZHB 4NU0A 1EVQA 4MPTA 3TQSA 4BVLA 1WMEA 5DGHA 2HWXA 4EA8A 3LQRA 4HGPA 2DM6A 5ED4A 4U9HS 2CLKB 3CF0A 3DH0A 5IU6A 2ASVA 3GH1A 3OFNA 2QN8A 1XMXA 3N5KA 2AOVA 4H3VA 2PU7A 4R81A 2WICA 1OI4A 4AJKA 1OXBB 3R3XA 4M60A 3BCRA 1CS0B 4ZO8A 4YP6A 5IUJC 4AMZA 4I50F 3MINB 1THGA 5J3JA 3A9TA 2JD1A 4ZCRA 2YY5A 2YZKA 2XPCA 4FHCA 1X1EA 1CJCA 3EVNA 4IG4A 1DAGA 1H2RS 4O4LF 4BATA 3H5NA 5HZGA 2GFQA 5ER6A 2DFLA 2JRLA 2VK2A 3BRWD 3DMFA 1BXRA 4FJ0A 5E8JA 5EZYA 4DY6A 4U2KA 4A0SA 3IT2A 4EEZA 1KP3A 1V16A 4JP5A 4MQUA 1HL3A 4ZANA 1GDDA 2XWQA 5ITZB 1XKQA 4QPZA 2YNMC 4BKOA 1SZPA 2N75A 2G80A 3OSUA 3LKZA 1FMLA 1XSEA 3RFCA 4EX7A 1FTYA 1RC1A 4L4SA 2D06A 4G6ZA 4M9XA 1XA4A 4ZQHA 1BH6A 2JI7A 4QWMA 2KX7A 1JDTA 4E2WA 4LF7B 3LO8A 3Q3EA 2RC5A 4BTVA 1HNWB 3R40A 3PDUA 2YYZA 3PPIA 1V6AA 1UK9A 2EJVA 2FX2A 2PQ2A 3LYHA 1BS2A 2IOFK 3KKNA 1U5AA 2OESA 1YACA 4IWXA 4QHSA 1RYEA 3QIAA 4UPDA 5JCJA 3T0GA 3WGOA 5L3QA 4DTCA 4DC9A 1P4GA 1YE5A 3EWSA 4FOLA 1L8LA 3MRSA 3WGGA 2VUIB 4EJ0A 2J31A 3KT6A 1YS6A 3IRVA 1AY0A 1A3CA 2VPWA 2YOFA 3A27A 1RQRA 5LMCA 5I7RA 3ORRA 1XCMA 4R1LA 2PLAA 1UH5A 3T7TA 4C7MA 2FZGA 2F1JA 2G9RA 1J20A 3N05A 2I54A 4BKMA 4OF4A 1EM8A 5DN6D 1UFQA 1JKIA 4OI0A 3GLIA 2GZ2A 1CE8A 4UUOA 3I5AA 4LHSA 4UUMA 1EBBA 1I4DD 2QM7A 2XVZA 3QX3A 5DZSA 3W06A 2HF9A 3ZHBA 3OURA 3U5ZB 3U26A 3Q6NA 3ICQB 2PSEA 1F6BA 2C00A 3DLIA 3G5TA 5DU2A 3GRRA 4F56A 3WP1B 2YICA 1R4MA 4ABYA 5LZ4A 4BQPA 2BTQB 1QHSA 2MMCA 2AMJA 3T5TA 2QMQA 2ODTX 5BV8A 1BXGB 2I3BA 2E9SA 4TYWA 4EQ6B 3EG9A 2F1KA 1PDOA 2ERYA 4JEMA 4EB6A 2GYWA 1B6TA 1MVLA 4JASB 4P5PA 4B3BA 2WNHA 3GJYA 4EKEA 3ITDA 4ZHQA 3O8QA 1LH0A 3AR3A 1WBDA 3IQXA 1UF9A 3K70B 3DOIA 1MZPA 2COKA 3DPUA 5EG5A 3WTBA 1M8FA 3EGWA 1LLCA 3HGMA 4G5RA 3TS1A 3JRNA 4QGGA 2TRSB 5EN4A 5F35A 2D2XA 5F7JA 2QLFA 4H9GA 2ABWA 1QQ5A 4Y2VA 1S96A 4DBZA 2R5NA 4Z7OB 1T1GA 3EOAI 3FAKA 1CUIA 4AK9A 1DG9A 2V6JA 2HOQA 1KQOA 3DC2A 2XCQA 4PX9A 4FT2A 4YBZA 5EFOA 4YP9A 1TU0A 3RFXA 1RACA 1GDHA 1XNHA 5KYTA 2BJVA 3KLPX 5I9SA 3DO6A 4UCWA 3AMVA 1QIEA 3Q8MA 1YZTA 3WGYA 1VECA 2NVOA 1XEXB 4G9EA 3VVLA 2A86A 3SXUB 1EIZA 2AOXA 4KQ1A 4OUDB 1SUDA 2FZ5A 2GTPA 2R85A 1E69A 3MJ4A 2FSHA 2OAQ1 3R9XA 2OORA 3B82A 2AUTA 2Q07A 2OT3B 3SU8A 1CS0A 2FDRA 4Q02A 1IONA 2RONA 1W75A 1E7RA 2RH8A 3M6FA 5K5EA 4HZUA 3FPKA 3LQQA 5LUBA 4CLDA 1F2UB 4C7BA 5JAUA 3BRCA 3C6YA 1TYEB 1ZXXA 2CUNA 2I4LA 2ZYWX 1Z6PA 3DNPA 1ORRA 2Q41A 2AD5A 2P4SA 3CG0A 4L76A 2GCOB 4MRRA 4R9NA 2JFGA 3HXOA 2F8TA 4DG8A 3LBNA 1G21A 1T8UA 3DP9A 4PC3A 4OYYA 5FBKA 4XGRA 1BWPA 5DGXA 2QUJA 3EGVA 2IYZA 4N5NA 2FLKA 5JJLA 2HM7A 3R5TA 4HLDA 5E7MA 3JY6A 2CYAA 1JE0A 3SJAA 1SKMA 1MO4A 4XE5A 4DHEA 3SZLA 3L7KA 2DCUA 4TMVA 3UJAA 1F4VA 1WMSA 3EA5A 4LJLA 4RD4A 1WAMA 1FDRA 1NL3A 2CFCA 5BR4A 1TMKA 3ZYCA 4JC8A 1SCJA 2W98A 3L0CA 2MSNA 2CHUA 5JVDB 5LVAA 2PX3A 2XTAA 4IX9A 1WMBA 4IUBS 2JI4A 3MM4A 4MYRA 1IIRA 1QF6A 2I7DA 3AZQA 4GPD1 2AIRA 5EINA 1B8OA 3ZU4A 2NQTA 4LJ7A 2WYUA 5JEDA 4C5BA 1XA0A 4LJ4A 1GT91 4JLUA 1QRUA 1B6SA 2QSZA 5EWLA 1XU4A 3TFWA 5FA6A 1TQ6A 2NO1A 1RJWA 5F23A 4MWTA 4MW0A 1USIA 3IHTA 2Q1UA 5DHRA 5B3AA 3RS3A 1QFJA 3OH8A 1QK5A 4LRWA 2P2LA 2XADA 3DE5X 3QPVA 4KJZA 1JG1A 3AK4A 3ZGXA 4BXOA 3AGPA 2P40A 1JR3E 1MTZA 2FN8A 2WTXA 3LLSA 4EA6A 3DHEA 3DXFA 2QQEA 1FU4A 1TA9A 2TSYB 4M6WA 5A05A 3IUQA 1GA1A 2V0GA 2GNPA 2QROA 5TDHA 4IHAA 5B57C 1ZK0A 4FQ8A 4DR2B 2GM9A 2ZVDA 4S24A 1W76A 2AB0A 1L4FA 3BQ9A 4G5HA 3ZJ4A 4EUKA 4BGDA 5DWVA 3DXXA 1T9CA 1JBKA 1PG0A 3SYRA 3ZCXA 1V5GA 1XV5A 2ILVA 3G1UA 4OXNA 4RJLA 5MFZA 1FRQA 2NUTB 4RVHA 1UK7A 1JZSA 1ZG3A 2GDJA 4L6CA 4CXMA 1CZHA 2HA3A 3DG9A 3FX2A 1WXWA 3A2MA 5DBOA 3D0QA 1JVBA 4OXQA 1N6NA 3VAZA 3Q2OA 3EIXA 1FDTA 2FHSA 4LJ6A 1E4OA 4TV8A 5DBHX 3OLZA 3ZQ4A 1TL7C 4HB0A 1M74A 2XQIA 1RKVA 3RBZA 3FOCA 4QPJC 3EWNA 3TB6A 1XL0A 2VWPA 3W7AA 8GPBA 1HTTA 2ZWIA 3L04A 4EZIA 1LC3A 3O0DA 1ETHA 4U2CA 2ONKA 1YV9A 1MA0A 2EP5A 3MERA 4AIRA 3AKDA 2QRQA 3NXSA 4B3TB 2B94A 5JCXA 1WRBA 4F06A 4PEVA 2VDWB 3Q11A 3ZBPA 1RPJA 3FGOA 4CIXA 3BSWA 1FF9A 2V7BA 1JEYA 1CQJB 3M2TA 3OU6A 2PWBA 4U2GA 4FHDA 3ZWDA 2VL7A 1TJYA 2AYYA 2ORYA 3OLQA 5DIFA 4AECA 4F8EA 4FT4A 5A4KA 2V7XA 3OU2A 3SZUA 5G2OA 1BE0A 3ZKAA 1TYDE 3F71A 4YV7A 4QRIA 4D25A 1ZNYA 2FEKA 2AK2A 3ECCA 3MOIA 3J7AC 2HK7A 2ORIA 3WADA 1K9SA 4OAQA 5JISA 1PT7A 3MCZA 4DV4B 5FBLB 1KIMA 3KL2A 1ADBA 1BJTA 2EL7A 5AVOA 2ZYUX 1R6TA 2Q5FA 3SKXA 5SZJA 3ZD6A 2WZCA 1Z5UA 5KJFA 1NW3A 5DFAA 1BJRE 1Y3CE 2BKAA 3EA0A 3T1OA 2BBSA 1KKMA 2V3CC 4WEOA 4X41A 4M53A 3AP2A 4EAQA 5H5JA 2REQB 1J2JA 3T3MB 4HRVA 5KTTA 4E11A 2HL6A 1V6SA 3UWKA 3FSRA 5KYXA 1SKAA 5FNVF 3B2QA 6ADHA 2K7FA 4PG4A 2FG5A 4OSOA 1IQPA 2C57A 5HRAA 2A1TS 4M0KA 4WAUA 4TROA 5ALEA 4BN4A 1WZNA 3I9MA 3NDRA 3WJ2A 3DV0B 1P7ZA 3MELA 5CCDA 2EBUA 3RS2A 3E8MA 4RVOA 4YGYA 2YC4C 1PT5A 5K1ZA 2WOJA 4KQHA 3TJRA 4BNWA 4KG7A 4DA0A 1B00A 3VPDA 5K0FA 2BBOA 1RXUA 1ZJ6A 1A8PA 2ORED 4RFSB 3V1KA 1P9NA 4X1KB 3ZGNA 3OTOB 2XIQA 4IIFA 4O2AA 1PJBA 1ZAYA 1E79A 1BU5A 1QLJA 1RM4A 3I2GA 4YAGA 3ZCUA 1MC5A 1I4LD 2DLNA 2UYHA 3ELBA 2GRJA 5ECWA 1GG5A 3M6MD 3OQVA 4ME6A 2I8AA 4LV5B 3CPJB 1WCWA 4CE6A 3ZY3A 4ND8B 5GADl 5A0FA 2AK3A 4GMKA 4XIJA 4ZVMA 3OZUA 4G0XA 2QZZA 1PFWA 3HR4A 5GIPE 4AZ3B 2FUCA 3F67A 3TOVA 4Z0PA 4RCZA 3UM9A 1CUWA 2VJKA 4BNLA 3GCWA 1R8SA 2ZAMA 5KU1A 2M6LA 5AD1A 5LBTA 3UB2A 5JZVA 1B43A 3BZWA 1NG1A 2OXFA 1NP3A 2B6HA 2HI0A 5JJBA 5J63A 1SXGA 5CEFA 4Q15A 5FUXA 1XU9A 4C3VA 4P0QB 3NP7A 2B98A 2DFVA 4ABTA 1GHTA 3BDIA 1J1IA 2PXAA 1Z0DA 3GL9A 3TK1A 3NAMA 2PTHA 4TS9A 1Z47A 1JHRA 3E9ZA 3THWB 3RO7A 4CQMB 2IHJA 3LRPA 4P0TA 5EHIA 1XTKA 4QFDA 2BSAA 2D62A 2QTTA 3SJZA 1ZK4A 3SZ3A 1O54A 4BMDA 4CM8B 5DWQA 1DT3A 5DHPA 3JXEA 1EWKA 2Z4TA 3TZKA 3I73A 2B25A 4WX2B 3MUNA 4PIPA 2JBHA 4ZP1A 4DE5A 3M34A 3Q3CA 2B4QA 3KKQA 3HCCA 2XYPA 4HZIA 4UXHA 4EG6A 5LWHA 2BGGA 2X8WA 1PWYE 2ZR8A 1NVGA 5DTMA 4TQ9A 1NP7A 1NQTA 2AJ8A 2GVDC 3EXFA 2ZR7A 3O9VA 4PYIA 2ZTUA 4OUDA 1P6XA 3VXKA 4QL3A 4CCYB 4LTMA 3ABQB 1SFRA 1M76A 2F90A 2YASA 1BCRB 1N4DA 3D3QA 4JMLA 2BHSA 2AFHB 1F20A 1M34B 1K7SN 3UTCA 1NLMA 5BV7A 1B3BA 2O50A 1GCIA 5I4KA 4ENWA 2X0FA 4PS0A 2AC2A 2ZE8A 4HEA1 4HS9A 2F8MA 2JHFA 4DRXB 5IJ0B 3AVPA 2ISSD 3R0JA 4PLFA 3V4FA 2QZJA 4PHCA 4C88A 5BN4B 4EGSA 1AH2A 3PT9A 4KNVA 2C5SA 4DMUB 5I7WA 3OM8A 5DN6A 4KRYA 3ZXXA 2P9QA 3EPKA 1G59A 3VC1A 1EWVA 4IY1A 3WWZA 1YULA 4BCDA 4DLUA 4DDMA 5JI2E 4ZYYA 4JEIA 5DTRA 1SQ6A 4OGKA 4P3XA 2QN1A 2A1UA 4BZQA 1MC1A 4WA7A 5DYNA 3ROGA 4RA6A 4RLSA 4KJXA 4QDXA 5LCXA 1JSZA 1FY2A 1UBCA 2HCTA 2HA6A 1LWOA 2O06A 2A1TR 3M2PA 1X42A 1ZN8A 3L4SO 4IP0A 4Q9DA 1E2JA 4LJRA 5C7YA 1UBRS 4Y2RA 1MIOA 4W7IA 5ICMA 1R15A 3A06A 4YMLA 2SICE 4RTNA 1DU4A 2J9RA 4QNNA 4M8IA 4NPAA 3M3HA 1X8XA 4OJQA 4YUYA 1GG8A 5AIBA 1WW8A 1G21E 2G25A 4PNHA 4R7TA 2H1LA 3HP1A 3KJHA 2B82A 3P0EA 3RJTA 2EZTA 5K0BA 1JAXA 2LZ0A 4WXHA 3NATA 1CUYA 4JLKA 1SPBS 2IL1A 3OFVA 3OFND 1T34A 1D8TA 2BKUA 2B5VA 4CL3A 5B2FA 4KRGA 1XKLA 2B4YA 2EFDB 3B36A 3E9YA 3WV5A 4XJSA 3UFBA 1UZNA 4K81B 1TTHA 2HWUA 3HUUA 3G2LA 3UA3A 1TW3A 1PYOA 4AF8A 3FGPA 5CA0B 1JYFA 3E0QA 4IWNA 2GI4A 3PE6A 4NOMA 1BHSA 2QD5A 4K03A 4E5DA 5CXUA 1W44A 2AN3A 1CUAA 1HE2A 1VJGA 2WA2A 3QTBA 5A6VA 1AKTA 1K7CA 1UOQA 2GTHA 1NT4A 3QVGA 4JOBA 4V0LA 2Q0XA 3RC2A 3WB1A 1I33A 1KEWA 1WHTA 3BMQA 3WQRA 2O14A 2DFPA 2W6QA 3NT2A 5IX8A 1KVRA 2GAIA 1T91A 3NM5A 3QUBA 4R05A 2VDWA 1JYSA 1Q6YA 5FO0A 4ZN6A 2WNIA 4Q03A 1RRMA 3SKYA 1RABA 1R8YA 3T7RA 2CDBA 3FFXA 3BD8A 4OATA 3RR2A 4K26A 4CZ2A 5IS2A 5B12A 2I6TA 3OEEA 4JYZA 1YQQA 2H2WA 2Q8PA 1XN4A 3BAZA 3RTEA 3V8BA 4CCSA 5KTOA 5B3KA 5CFMA 4BBJA 1SCAA 4PC7A 2OOSA 4B4KA 1UDBA 3ES9A 3EVBA 1VG9B 4DV0B 2ROQA 4XIGS 3KB8A 4I3GA 1I2ZA 3WWOA 2LRHA 3X1JA 4A16A 4QLBA 4RFVA 2V74B 2DE0X 4BMCA 4ZCMA 1DJQA 1QF7A 1W93A 2HJHA 3AERB 4JOSA 3UHPA 4BY9E 1P0MA 3PCXA 3N1UA 3NDJA 4F92B 2C2MA 1UFOA 2PL5A 3HH8A 5BV0A 5IMSA 3KXLA 4DBVO 2O2XA 5AXBA 4QU5A 4FSHA 4H35A 2NOAA 4OAPA 2IHBA 1CJTC 2BUBA 4ITVA 1GKUB 3LXXA 4RTOA 4BDTA 3SC6A 1T2EA 3F5SA 4Z2AA 5FOWA 1QH9A 4G81A 4XOUA 4Z9AA 5A4FS 5AXAA 1PHRA 2CDAA 1SULA 5HDQA 1SVMA 1G55A 3WBFA 4D45A 1CR1A 1PEYA 3E1GA 3Q7RA 1X80A 2W58A 3JQ9C 4I5DA 2V5UA 5H81A 3V4VB 3ZCRA 1HXHA 1M8KA 2PL1A 3IAHA 3QU7A 3TO5A 3GG9A 2R86A 3OTIA 5CAEB 1E9EA 1VB3A 3I28A 4FLEA 4RF4A 4HQNA 4BB9A 1JQLB 4BU0A 1M1UA 2ZDQA 4QTYA 4TKZA 1H66A 3DAPA 4FZ3A 4MI9A 3RJ9A 3HL4A 1Q0SA 5T8KA 5A4DA 2QAIA 1CUBA 4DV3B 4JWKA 3FPEA 4HQRA 3CZ4A 4B7UA 3P2IA 2OZLA 1R0WA 3H86A 5ES3A 1ZUNB 2QTLA 2YV1A 3I39X 3PHJA 2GUGA 4LJAA 3PX7A 2AX4A 2QTGA 1YK0A 2PS0A 3AFGA 4PLCA 1PF7E 3NCHA 4J0QA 1M0SA 4WK6A 4YAWA 5JZMA 4K6KA 1ZKDA 4I46A 2PWZA 2KSQA 3H8VA 4F9EA 1E2MA 2RHOA 4ZODA 3VZPA 2OY0A 4F04A 1U3GA 2DUUA 2X9VA 1BVYF 2QK4A 5JVDA 4U7FA 4HWRA 3W8NA 3ICCA 5FBRB 1NFQA 5B7PA 4PN7A 3JATA 5EJ4A 2PX5A 3KJFA 1GR1A 4M9RA 1P2VA 4FB5A 4LDAA 4TLEA 2WU1A 9ABPA 1KH2A 3E3NA 1AKWA 3OEHA 2ODWA 2EL9A 1O94A 3TD9A 2Y77A 3X1MA 4FXPA 2E18A 3C1TA 2FRDA 3SVTA 1ECBA 4AS2A 4US0R 3QBTA 5K3DA 3JSAA 1WF3A 4IWYA 4F6RA 2PT5A 2QAGB 5G1NA 2A59A 4MVJH 1FU8A 2FUKA 3GHHA 5SY9A 3QLJA 5GTDA 4H7DA 1JHZA 3LUKA 4J4BA 2PUVA 1YJAA 3SQXA 2CYCA 5EMJA 1Z0JA 2A4KA 1DX4A 3VQTA 3LC7O 1X7YB 3AC0A 5GVSA 1QB7A 3PYMA 1J8VA 1TGYA 4Y2QA 3RUCA 3AERA 1YQXA 1GPBA 1JDVA 1KYZA 3DPIA 4D9FA 4JKOA 3QWHA 4M7OA 5E1OA 1EZ4A 2QSYA 5TVGA 3DMTC 2CEKA 5A0TA 1ZH8A 4LI3X 5FJJA 1IQRA 1D2AA 2Q1TA 4YN3A 1FLDA 1XKTA 2IUFA 2QD2A 1XQ1A 3HYCA 4P92A 3NM6B 5CIWA 1II0A 4S0XA 1ID1A 1L5RA 4CU2A 4D6XA 4F38A 5JQWA 2PRYA 3F74A 3HPRA 2V7QD 4KQCA 3OE7A 4LVUA 1YVEI 3RS7A 2GM3A 5IH3A 3GAZA 1L7BA 2DAPA 3Q6IA 4K2AA 2OV4A 2IEBA 5CLJA 4FHGA 1X8KA 3BPSA 1VIVA 2BHRA 2QXUA 1RKUA 1JAIA 1QIHA 1JQKA 1RADA 2IHTA 4ROSA 1E2HA 5JWRA 1M2NA 3CNBA 4C76A 1BEEA 5LP6B 2A9FA 4TL9A 1R4ZA 4X7PA 3EVFA 2YMQA 2ZJ7A 1E9BA 4RC9A 3PQEA 5CNMA 3C2QA 1JLMA 1M83A 1T0IA 5CFQA 2ZE5A 5COAA 3CX8A 1TD1A 3O8QB 4QSHA 3QENA 3VVMA 3ZHTA 4Q7MB 4BFLA 2YXNA 3AQ4A 5J2UF 4YIKA 1VPTA 3PIIA 3R5KA 5EZ5A 2YHIA 3D3KA 3H9GA 3CONA 2VHCA 4JIMA 4ZQCB 3I45A 3V4OA 1EFRD 2FPWA 4Q4CA 3O90A 3ORSA 3L93A 1J42A 5JSZA 1U28C 2MU1A 2PBLA 3GNSA 5A5VA 1M1XB 3QU5A 1E5LA 3A1SA 4RQUA 2DHDA 1VSTA 3SJBA 1AA9A 4C29A 2DOKA 1VBNA 1FYFA 1AGYA 3LUJA 4DSZA 4ARCA 2CBZA 3OJFA 4X8HA 1TYZA 3Q12A 4IF4A 5C34B 3T5AA 1PLJA 3CXUA 1NPTO 2R4UA 3BA6A 2UYOA 1A9XB 4NJOA 1LEHA 4LOIA 4MVJI 4X97A 4Z9XA 5JO0A 4N48A 3D8NA 4RGBA 3ZDCA 4N3NA 4NCHA 2C61A 1Q84A 4LDZA 4N6OA 5CA1B 1EFAA 1ZISA 4IX1A 5D7BA 1VIDA 1MW8X 4WOBA 3G5LA 3QTLA 1IEXA 2EP8A 4MVJP 4RZHA 4WFKA 3AF2A 5D51S 4D0SA 3W5BA 4ENSA 1MB2A 3ZWVA 4D96A 3BT7A 2WTMA 3IAXA 5BNWA 5IVDA 2XTZA 3GCDA 4D0NA 1XK6A 2JKVA 3EPRA 1JR3A 2OILA 3NNSA 4CGYA 4FFOA 4DC1A 3JQ8A 3N7UA 4CI0B 5L3QB 1DUSA 3IEKA 4N3BA 3ACBA 3MTEA 5COQA 2B7BA 3C41J 4P7GA 3M7IA 1NRJB 1ACLA 4E0BA 1BSVA 2QW1A 4ZQGA 3MPUA 1Z26A 2GAOA 4B3DA 3NFYA 5T41A 3OUUA 3LLCA 1IN7A 4ROTA 5FNZA 4EYGA 2GUWA 4AJPA 2JFYA 3BXEA 3ECSA 3I4LA 4HB3A 5FTMA 3VR5H 4C14A 3H5TA 4F2DA 5CDYA 1XTBA 2FHPA 2Z2XA 5KMGB 1PUJA 5DW3A 3GEPA 4UU7A 2VPQA 2WJ3A 2CHQA 4Q01A 3PTLA 4XR9A 2HD4A 2WYVA 1E3LA 3DFZA 2GBPA 4MA4A 5T7BA 4LVNA 2BFEA 4PAQA 3TPFA 4ZK2A 5KX5A 3GLTA 4GKAA 1RC0A 4NBSA 1KZHA 2BI4A 4GF5A 1Q0TA 1KETA 3F7OA 4JJ7A 4LC9A 4V2UA 4A8TA 1SG9A 4G0MA 4KO2S 1W0JD 1XBTA 2H18A 1SELA 4HNAB 3I52A 2RCYA 4RETA 5KHLB 3HY4A 1J0CA 4F84A 4X6XA 2HT1A 4MUBA 1RI3A 5EMKA 3HL0A 1MPXA 4HUQB 5DHAA 2RKWA 2C3YA 4OYRA 1DJOA 1MJGM 1UJBA 3U4QA 2PO7A 3EEQA 2CVHA 3TQOA 4CQMA 3JQ6A 4DCCA 5BUQA 5DNUA 4IVPA 1I5OA 1Z6AA 4N1AA 4RVCA 4CL0A 1XMVA 2L42A 2CFRA 4FU0A 4L08A 1ATIA 4GLOA 4OCZA 5FOUA 3W9BA 3AVOA 4Z5XA 1YZUA 2JK0A 3FVRA 2XCRB 1I7PA 5BUSA 4RQTA 2H51A 3CM0A 2JAWA 2IYSA 3HWWA 2I62A 4LJ8A 4DKJA 3P4YA 1IHYA 2NU9A 2O54A 4PPFA 2ZRNA 4RSRA 2OV2A 4LZNA 1DQYA 3KU4A 1IUPA 2ZYAA 3FSJX 5FTNA 3G7UA 2DT5A 1DZ3A 4HOYA 4PW0A 3ROPA 1N9ZA 1TIPA 3ANXA 1HYHA 4N40A 2BGJA 1OX4A 3MQ4A 1ZU4A 2WD8A 4RJ2A 4A1FA 3NH6A 1VE5A 3R24A 2ID4A 1SQSA 1YMVA 1YJBA 2W6PA 2K2WA 3QE3A 4TXLA 4WNAA 2C07A 3WRYA 1TXGA 2KHZA 4MW2A 4OOFA 2X1VA 4EW2A 2EKQA 2WSLA 2KE5A 1R6DA 4NEQA 1QV9A 4F2PA 1NRXA 1JLLB 5DCYA 2CE7A 2QORA 4GLFA 3HVHA 4PFQA 1E3JA 1IN8A 1IVYA 4Q4JA 3VKGA 4IYJA 2NNWB 1OA1A 4QUEA 1GD1O 5JS7A 2AMFA 4MR9A 1IATA 2H63A 4N5MA 2ZJ2A 3KM0A 2FCAA 4FMCB 4N39A 4U0KA 5DYYA 1AMOA 4POAA 4YRZA 1ENOA 3ESZA 4GE0A 1I0ZA 3U1BA 2I65A 4NCKA 5SV2A 4B7CA 5IABA 1B23P 2VNKA 4HD8A 1SHKA 4H3HB 4ENTA 5M2QA 2JLWA 3SEAA 3SC4A 2GGSA 2QMYA 1QE3A 1MP0A 4GZLA 4C4SA 3BVPA 2ZM5A 5GONB 1R27A 1ZOIA 3TYXA 3HKBB 721PA 4A0GA 3AEKA 4RM3A 1K06A 3GPLA 2BZ0A 4LNUB 2IZZA 1JDBB 4XA8A 2YOHA 3MT0A 4EHNA 3E9QA 4G1UC 1VE9A 3KEGA 4XYMA 3A1VA 1JSXA 2IKQA 2GPBA 5TARA 2IH5A 1BZYA 1NUPA 4ICIA 2PUTA 5DTIA 3EXIB 2Z2YA 5EJ9A 4PHGA 3H1BA 4C4YA 3N2KA 1PV4A 3RTGA 3NH9A 3QSYA 4B7XA 4A1OA 2NU8A 3JR7A 3NTQA 2XECA 2D4AA 4Z6KA 1J99A 2GN8A 5BNIA 1QDLB 1FDSA 4LMAA 4R8KA 4FXOA 3QVGB 2NTNA 3RIYA 3WIUA 3QFRA 3GDGA 4EG4A 5K0LA 1CU1A 3FWNA 4US1R 2H16A 2R62A 2ZXEA 5FPYA 1GYPA 1E0SA 1T2CA 2A8YA 2RHCA 1L4HA 2VHTA 3EIEA 3LCCA 3IEMA 3SN6A 2LNDA 2YHSA 3NIDB 2NSJA 3CCCA 4NHEA 4ND5A 3GJXC 2E6UX 1QRDA 4ECAA 3QXCA 2D3WA 4J0EA 1GILA 3K1AB 1JHQA 1L5YA 1U7TA 1WKVA 4YQEA 2A4MA 1QBKC 3B1KA 4XVRA 5MHTA 1JIQA 3BE8A 5F4BA 3RIMA 3V48A 5ALTA 3VFDA 2QY6A 2C78A 4JC0A 2E55A 2SKCA 2XAAA 1HNZB 1DTWA 2PDAA 3I9FA 4E4TA 1KTIA 1EFRA 2IC5A 3HXLA 1A5BB 4UAGA 3IBCA 1PW5A 3DW3X 3FCXA 3OF5A 5IT9A 1EVJA 1FSZA 3RTCA 3FKSD 3EFEA 3C5WP 3DOOA 3PE4A 5JXWA 1R6XA 2SBTA 2ZSDA 1P1JA 4OLJA 1UMBA 2Y6UA 2G8LA 4XB6B 2JC3A 3TWOA 3E1KA 1VYTA 2BGRA 1GOTA 1GSHA 1IHXA 1V8FA 2XZTA 3GZTB 1G1MA 3DVAB 1N32B 1THMA 3H9JA 3HLTA 3VHXA 1PX2A 1RQXA 1ZIOA 2LDXA 2R7MA 3BG5A 3ITEA 3K0CA 2R8EA 4NYJR 3U4HA 4BIMA 5EHXA 1HO3A 2Q1YA 4MRNA 4B3FX 2F55A 4A73A 2O3UA 4C4OA 1NY5A 4KWTA 1XRMA 3DLTA 4QOHA 4EGFA 6ABPA 1SMKA 4P84A 1ISIA 1ULZA 4Q4AA 3QV1A 2QSJA 4Q9NA 4BJ6A 1E6UA 1KNXA 2VAPA 1IRXA 4V38A 1IBRA 2I3GA 4C6HA 1U7XA 2QZ4A 2PKEA 3NWOA 2BKVA 3I6BA 1T5TA 1XMQB 5HWSA 2RKBA 1ZMRA 4PU0A 3BM5A 1OFTA 2XDWA 4XWKA 3MHPA 2J45A 4PINA 1USVA 3EPPA 1N8NA 1QQTA 1WUYA 1Z0UA 2ZJ0A 5LZ5A 3P9ZA 1ZM3A 3HO8A 2YZ7A 3O8RA 3L7DA 4GEGA 3EFBA 5FX2A 4Q3AA 1DG3A 4UUNA 1M2VB 4AKEA 2H52A 5AMXA 5H0IA 5C4GB 3U7HB 3D8RA 3DE7X 4HTFB 1ZW1A 1J1ZA 4MP8A 3CUUA 3CVWA 2BDUA 3NHRA 2BEWB 1ITZA 1LWNA 1RBZA 3CLUC 4RK1A 4ETIA 5HTKA 1WE2A 3UPTA 1RYFA 1TUBB 2WAAA 1B0ZA 1V0JA 3IQFA 4QU8A 4E7PA 5J4HA 2C2YA 4TYMA 3ZNPA 2GCPA 1HDIA 1CVIA 4NEHB 1Q7RA 2ZJOA 3C0KA 1R0LA 1U2ZA 2VJDA 2DSNA 3TVDA 1DC5A 2FH5B 2H4HA 3KFLA 3C3MA 3FY4A 5AYVA 3U4QB 4H2DA 2YYYA 4BX2A 4O4HB 3SHWA 3ED1A 3DZFA 1ND6A 1YQEA 2JGIA 2KLHA 1EM6A 4TMYA 1DRJA 3K1TA 2R6JA 3DEYX 1GFIA 3EC2A 4ZOLA 1D1QA 2VYVA 1YCGA 3U7RA 1Z4KA 5AOAA 2NP6A 3DDSA 2G8NA 3SIRA 3CS3A 2PZAA 2FMUA 1GO2A 1KERA 2W43A 3BL8A 4G26A 4DCPA 5KYYB 1F9EA 4UW9A 5DYTA 1NX6A 2VQSA 3C3CA 5EIBC 5CDTA 2PT6A 1DCMA 3KZOA 2ZB8A 5PGMA 3IEVA 5DF1A 4ALLA 1XZDA 4GMXA 4AAYA 2WPDD 2P3QA 5T57A 1FUKA 1TMYA 1II8B 2X14A 2FZEA 3KK0A 3EY9A 3NBQA 2ONZA 5KNCH 3ZUGA 2NPIA 3VUFA 4B32A 2QNRA 4LXYA 2F59A 3KSDO 4U4AA 2ZATA 3HI6A 4XD7A 3URMA 4BVKA 4BX0A 1LPMA 1UJ5A 3WIOA 4TX1A 1CUXA 2GFHA 3GX1A 4DF3A 4QKQA 1NBIA 1SU7A 4LY0A 3U4GA 4UHBA 3DE2X 2REXB 3HWX1 3NKVA 1E92A 2QD1A 2RK6A 1NNI1 4PAOA 3LUBA 2IPNA 4MQ5A 4BNDB 2G76A 2RHTA 3GXOA 3MTAA 4K6OA 4OJKA 4TWJA 5IP5A 1BOFA 5MN4A 1U2SA 3R6GA 1F9AA 5H3CA 1T9GR 1GTVA 1Q0UA 1Y9DA 1GP2A 2WU8A 3QKSB 3GMSA 2PUCA 2C20A 2OHIA 3PFFA 2R6AA 5F76A 2HLPA 2IV3A 4A5SA 3EASA 3IAS1 4C01A 2QDKA 1COWD 3VR3D 1I7SB 1KJNA 1O94D 3CZPA 2OWDA 2O1XA 3PFNA 5KC9A 5H8WA 4LXIA 4RMGA 1U9IA 4L0CA 3TQFA 4AW9A 3STYA 1L5WA 2J08A 5K99A 3ZJVA 3EF0A 3NYQA 3BHMA 1QF9A 3N2GA 1P8JA 4G84A 1V26A 3CEPB 5FDFA 4YCJA 3UGQA 1IC6A 5JBIA 2V0CA 2GNOA 1Y3AA 4JSRA 5D1HA 3JYNA 1OB5A 4HNSA 1ULSA 3VOBA 4ZT3A 3UJPA 1YI1A 2Y3IA 3QXHA 5LA6F 3RRYA 3U1TA 5LDHA 1TCCA 4GPAA 4H59A 3JCZA 4BGEA 1LCIA 1XZBA 3AESA 4HFJA 1I10A 1L5MA 5E4FA 4ZVTA 3O8OA 3R77A 2BGMA 3IDQA 3NUZA 1RTTA 4NMXB 3SYLA 1H4SA 2Q5QA 1W36B 1GKKA 4HRAA 2NXNA 3HYTA 2FN4A 4JQSA 1XLUA 2OZPA 2ZP1A 3K0SA 2D3TA 2C5BA 3WMFA 4DQXA 1M6HA 4Q4HA 1IJBA 2B0JA 3N8KA 4G67A 4RVFA 3RF7A 3TRKA 2J7KA 3NASA 5HRUA 1DKQA 1IHUA 1M9NA 3C8UA 1E0AA 3NJ4A 4HGOA 3Q10A 3PC8A 1UBNA 2O8BB 2AE1A 1J07A 4LHYA 4QLOA 1QRRA 1E2FA 4EMTA 5BYKA 3I5UA 1XPUA 2YC2C 1BNCA 4O5OA 1U7DA 1WSDA 1ZSVA 4ZWNA 3E22B 3RFVA 3PQ3A 2OLJA 1XT6A 3K09A 4UJ5A 1FNDA 2QWXA 1USWA 5FUMA 3CURA 1L3CA 3VKWA 4DIDA 1YT5A 1BXRB 3BFVA 4QBIA 3I4FA 4KR0A 1GUZA 3MF4A 3OZTA 4PX3A 3I23A 3A4NA 2J0EA 1AQUA 3K9BA 1Y89A 4UE6A 4TYNA 1QH8A 2P4HX 4Y2UA 2WZDA 3U7JA 3H2BA 4WXPA 1YBHA 3F73A 2CKMA 2VH5R 2GLUA 3EZNA 1P77A 4GLLA 1E3WB 2C59A 2YVQA 4YA6A 1KZ1A 3GDHA 2VN8A 1E1CA 1TMGE 2IYFA 1H65A 4OKSA 4UNPA 4AY2A 2AZDA 4M1OA 1KK2A 1SUSA 4CQLB 3HS3A 3LT2A 1O57A 2VHUA 4RSMA 1SB9A 4B8WA 1HQDA 1TCAA 5DGCA 2GCGA 1TW2A 2XUKA 4KXFB 4CETA 4MXDA 1SCDA 3G5UA 4C7OB 1ZEJA 2EBFX 4C2TA 1HEIA 2OCLA 2I29A 2HLNA 1FPQA 3A9UA 2JLVA 4IILA 3F3KA 1RQGA 2Q9AA 1RT9A 4J0FA 5BT9A 3AFIA 3WB9A 2GYYA 3VR6D 3CX7A 1P80A 2AH5A 2HMTA 2FSVC 2D0DA 1LBQA 4ZDWA 1CJUC 1ZZEA 5EXPA 4IJQA 3UCFA 4AN0A 1IQUA 3BDAA 1DXOA 4MRMB 2H57A 4ZJYA 3PQCA 1JQAA 3O84A 2OMKA 4HDKB 2RI6A 1YQ9A 1GADO 1PJLA 4QECA 5JRDS 3ZVNA 1NVBA 5JWOA 5LXTB 1BX3A 2B1QA 2HBQA 4RKYA 3PENA 4AG3A 5KTPA 3C15C 4FR5A 4WLOA 1T9KA 2XCTB 3CGWA 4ZXPA 1MB3A 3CJTA 3WHKA 3F1LA 1VPVA 4MCHA 5EQFA 2CE2X 1AUVA 3PX2A 2WB2A 5FFMA 1QV7A 1U0HC 3UBMA 2UU9B 2FWBA 3KXIA 4FW9A 4XVCA 3SMQA 4BFWA 4LXTA 1BDJA 3SYKA 3QJYA 1DEAA 2BTOA 4M37A 3DD5A 3V8PA 1W36D 1DQZA 4JUFA 1JAYA 3L6BA 2X5XA 2D1FA 2FPKA 4P36A 5LOVF 2XE8A 5IFLA 3KV3O 5TJHA 2GPNA 3CVVA 2X76A 1DIGA 1Q44A 1T5DX 1Y4UA 2OWEA 3OT5A 4JX9A 1NDHA 3QM1A 5AM5A 4D9JA 1ODJA 1VYVA 3UMVA 4BVEA 3QX9A 4PZUA 4DVGA 5BMVB 3RRJA 4M1SA 3NFRA 2MYPA 5KNBD 2GBFA 1QFZA 1AKMA 5CYPA 5EKDA 5AW9A 1EBUA 2WF5A 2VYVD 4YR7A 4RIFA 2BL4A 1KL7A 4HPJB 2H2FA 5AESA 2H48A 421PA 4G37A 5HIMA 1OB2A 3NV9A 2ZTVA 3EBOA 1JVSA 2VZLA 4JOQA 2A30A 3ZW7A 1OI3A 4EG8A 3MAJA 3F49S 3MVEA 4OQFA 5B64A 2X2EA 4NJEB 1RE0A 5B7GA 4LBVA 1RTKA 2BMVA 5I4CA 1H6BA 5FPHA 4JR0A 3QWIA 2AG6A 3MS4A 3D59A 4YREA 2Y1DA 5KTKA 4QAJA 1Q0QA 1JZQA 1SIWA 5EHNA 1ZGBA 4E88A 3HBAA 3DFUA 3BWMA 1GNLA 3F3YA 4X61A 2FZVA 3NZEA 3FSGD 3WLMA 4D9HA 4EARA 1YVRA 2JJ2D 4HEQA 1WXDA 3T7CA 1CDOA 3FNEA 1LY1A 4IHKA 1QONA 2IXBA 3PUJA 2WYOA 2GN6A 1X0VA 3FMOB 4B45A 5EQTA 5DM2A 1GN8A 4ZT2A 3U4AA 3WICA 4KK3A 1Q91A 4IH1A 4E51A 2NU8B 3V4ZA 5CLFA 3MZ0A 1JNYA 1Y6ZA 4KQXA 3GQBA 2QBYA 2AXPA 3B6ZA 4MPPA 1XMIA 2GYVA 4YR9A 1CUUA 3JQBA 4ZJZA 4OBWA 1M6VB 1RXIA 3K0HA 3SHFA 3QUTA 4UBLA 4QT0A 4ZYXA 1IUOA 1T2NA 4TOIA 2IF0A 2EGGA 2OD7A 3WGZA 1R7RA 1GZVA 1VLMA 3KU1A 4KWEA 4C89A 4J3NA 2QG9A 2IS1A 1PTKA 1IHOA 3EMBA 4OHBA 3I9JA 1GVHA 3QBEA 2DWUA 4QFCA 1ONNA 3IHKA 1GGKA 2ZKLA 3JD2A 1PR4A 2OBFA 4WVLA 1FFHA 1EFVB 2Y27A 2PPLA 3F8SA 2HB6A 4DIUA 3DZIA 4B71A 2EWWA 1TKCA 1M66A 3H0EA 4JB2A 5CM2Z 1THTA 2QZ9A 2WUEA 1ODTC 4BBPA 1BJKA 2WE7A 5H3LA 5JNUA 4TT3A 3ESCA 5AW2A 3OI7A 1P75A 4UARA 1T1RA 3X1YA 5TXGA 2VF7A 1WD7A 2E6KA 3NHAA 4NPCA 5JT1A 1EE2A 1HX7A 1X7WA 2G0NA 2YRXA 3EQZA 3M89A 3AF1A 4HC4A 3H8WA 2HZ7A 1HE8B 1OBFO 4Q9HA 3ZWPA 3JZFA 3GFTA 5JSHA 4DHWA 3QF7A 4R1QA 2C84A 1MW9X 2IDMA 4L4RA 3H5LA 3QEOA 4NZNA 1UZLA 1Q12A 5YASA 5JCOA 1AMNA 1ZLYA 4CM5A 1C4XA 1DWOA 3UK0A 1FSFA 4OXIA 1C41A 3G8CA 2PH1A 4GM1A 3T3PB 2AG5A 2Q1XA 1H94A 1MJGA 2O8VA 5CXQA 4WLVA 4PXSA 4HLQB 2XIJA 2J0QA 4O3FA 1EXMA 4CKEB 3KJGA 2BGTA 3DHNA 3MINA 1Z2AA 2I4IA 2O5RA 1PQYA 4PX5A 2G1JA 2R6DA 4LRSB 3OIGA 4O2BF 3EGIA 1CQIA 2NAFA 2WKSA 2Z4RA 2ZBUA 5ECGC 1X7ZB 5KYWA 3FVVA 4KWIA 1JKJB 1GU0A 2YWXA 5EPOA 4XX0A 5IJ0A 2IZ5A 4NU5A 2XMSA 5BYAA 4EVQA 2PUAA 3U3DA 3WSVA 1Q0RA 3Q98A 3ZWCA 4QASA 1X1AA 1H2AS 3E03A 2B34A 3E9EA 4X44A 3BB1A 1ZC3A 2W2MA 3H5RA 3GYBA 1Y9ZA 3QWAA 4JN6B 3VZRA 2XOKD 5FNVA 2O4CA 4R9SA 4LZOA 3ZD7A 4CMEA 3C3WA 3MOSA 4P4NA 1GGFA 2B9EA 4NENB 2PUGA 4F9FA 1XVUA 3V2IA 1LNZA 2LBPA 1EESA 2YFKA 3VRHA 1A88A 1EUDA 1O95A 3DMYA 2YN2A 1TAQA 1CZOA 1IDN1 4MB6A 2XODA 4WK4B 3RHFA 3UJCA 3T5BA 5GZ3A 4JLNA 4YASA 2BHNA 4ND6A 2E4XA 1JDNA 2GAJA 2CXNA 3SQOA 1N1GA 4OJMX 4CMIA 1N5RA 1PYDA 2RMKA 2YN0A 2XMDA 4OB7A 2ZGVA 5MDHA 4POOA 2ZIEA 3H8JA 4JHLA 1OBHA 4UBKA 5MN6A 3ML1A 3R9KA 1MJHA 4FC7A 4CF6A 1OJLA 4AF6A 2R00C 1NKVA 3A1NA 1TI7A 1F8YA 3M8KA 1KAEA 1ZCBA 3C5VA 4WOKA 4QUDA 3EZ2A 2BBTA 4ZEVA 3JD3A 3ELWA 5T8KC 4WZAB 1P3DA 2CSUA 2FEXA 4OB6A 4UVIA 4FGWA 1KSHA 4WN3A 4Z86A 4DG9A 1CUHA 4LXQA 1J23A 4INPA 4JSTA 4X3PA 3UMYA 1ABFA 1FRVA 4Y8VA 4OJYA 1YC5A 3I6QA 3OHMA 5AKZA 5KNCA 2Y2UA 2PL9A 2QLJA 4RMJA 4U8HA 4BQOA 821PA 3HTXA 2H1SA 3K35A 1IUKA 2BF7A 1X86B 3C7TA 3MGKA 5IAJA 1A72A 1RWVA 1BFKA 3SXJA 4BNMA 4RTMA 4EAAA 3EVDA 4PGAA 4EFLA 4NU6A 1R2QA 3W3AH 2IIBA 2C2KA 1VE1A 4LFBB 1SUCA 4OSEA 2NVBA 4H16A 3PQ4A 2XZDA 3UKDA 4EYOA 1P60A 2W2LD 3QFHA 1HDEA 4NZYA 3ET4A 3K0AB 4IUDS 1T2VA 2XQKA 1A69A 3RRFA 1QGUB 3CEAA 1Z0ZA 5IG2A 3VNVA 3HVRA 1YS9A 2QR2A 1YBVA 5GVRA 4DSOA 5C1PA 1SQ5A 3SFZA 1NNSA 2Y71A 1W30A 4I8XA 1LQ2A 4JX8A 5D3MA 3ZPXA 2PT9A 3QMVA 4HQLA 2GPJA 3DVLA 3X2EA 1JLSA 1NI5A 2CWWA 1T9GS 4GS5A 3R74A 4YIHA 4RD0A 4EOGA 4TZ0A 3U37A 4ISBA 3ESQA 4PGGA 1KQFA 1EZ1A 3BTOA 3GLQA 4HAIA 3VC7A 2J7PD 2WF7A 2XX3A 3NGXA 1AQJA 5CHEA 3LDGA 1M6VA 4TWBA 4CEIB 3L7YA 1FQKA 4MYCA 4LQ4A 2WWYA 5JD6A 2WNSA 2JIBA 3GMTA 4ZI2A 5GJWC 5JOQA 2ICAA 1OX5A 5IUKC 2IHVA 2O52A 3G49A 4AX8A 4IMJB 2HHLA 4UMVA 1GCOA 1TJ5A 1ST2A 5TSDA 1GTZA 3NXKA 4QPCA 2PJZA 2QUAA 4HNGA 1H5NA 2WPDA 1BX1A 5DBIA 3PXBA 5K3SA 1K89A 3H9UA 1RXYA 1E4VA 2HIMA 3PC6A 4PRKA 1NXQA 2CKDA 2QXYA 4PFJA 3F6RA 2OV6A 4R8RA 3HYNA 2G88A 3JQ7B 2ANCA 2H1HA 4KKVA 3IOEA 4A2CA 4M0PA 2VDJA 3I6MA 4XWGA 4BC1A 1UJCA 2VHQA 1FBTA 2BMFA 2IYPA 1J0EA 3TCKA 4J0DA 3WZLA 2UUCB 4R1MA 1T9DA 4KIWA 2P27A 1P1BA 3ZH2A 1OHHA 5EEHA 2X0EA 5LYJA 3P2YA 4CMAA 2AG8A 2YTZA 1JHYA 4J7XA 4KN6A 4E5MA 2V5AA 2C92A 2P77A 2Z2ZA 4U39A 2YFYA 3CIFA 5E3JA 1XZNA 4YDQA 3P5SA 4BWGA 3CRVA 4FKBA 1GGMA 4CMBA 1QO7A 1JYEA 2XITA 4K9PA 4V1CB 2ZVPX 1J09A 5BN3A 4GP6A 5L6MB 1VOTA 4HCJA 1M73E 2EFCB 3N2IA 4RK4A 2IS4A 1X1QA 3V4LA 2RI0A 2NZXA 4Q3BA 4E1BA 3FI0A 4TSRA 1O8BA 4CQNA 2EATA 1LD3A 3KDPA 4QC2A 1G7RA 4R0NA 5EJIA 2XEDA 3TSWA 1Z62A 4OM8A 2COEA 2PXXA 3CISA 1W59A 4JKIA 3NRCA 2OVFA 2Q0HA 1VPLA 3ZWOA 4C7JA 1ZI9A 1XOIA 1NW7A 1RAGA 4PF1A 2J3EA 2NX2A 1ZQ9A 5L4NA 3QWFA 5DHUA 1OVMA 3NALA 5DE3A 4LF9B 1I4OA 1ICIA 2H08A 2R1TB 2WINI 3OFKA 5JO9A 5KYKA 1L9XA 3NTVA 5DGTA 3JAMA 4OL0A 3CH5A 3C7DB 1YXMA 3JQGA 2CB0A 3D6HA 1Y5MA 2R2AA 4C0QC 4HATA 4DV6B 3KG2A 5JDIC 2L17A 3DUWA 2QUZA 5AJHA 4ZAWA 3ZU6A 4JLWA 1GNSA 4G65A 3DNFA 3ETNA 3T38A 5FWXB 1G1AA 5DPMA 5BW8A 4RWEA 4G0WA 1WUKS 4C7KA 1LLDA 1W4CA 3OLYA 3MXTA 4C5AA 1JUDA 3R41A 3RUPA 4CMGA 2VBFA 5I7UA 1FVHA 1G60A 3W2EA 3ZU3A 3BD6A 1Q0HA 1WSBA 5IAEA 1X8JA 4K05A 4B33A 3F5MA 5CCBA 4R1TA 2VYQA 1E1QA 1LVGA 3JRWA 1T0JB 4ED9A 3KDSE 5LDDC 1P1CA 1V4VA 2AT1A 4QFMA 2MSWA 1VHDA 4WDRA 2ZS9A 3M0EA 4O3MA 4QQRA 4M88A 5TMBA 4XGNA 3DXZA 1T13A 2R8OA 4LY6A 2Z0MA 3H42B 2XUJA 4OQMA 4JH0A 3R5FA 4UCFA 1IK6A 3VTKA 2G5CA 3LP8A 1DXHA 1DOHA 1J7JA 3AWIA 5BOSA 2FW1A 3H3FA 1YR2A 4WACA 1APBA 2P6NA 5TX7A 5FYDA 3MWFA 4CLRA 3P9YA 3UHAA 4CKZA 1FQOA 4KPUB 3G2KA 1YUNA 3RPEA 3O95A 2FSVA 1VE6A 3S2IA 3K6KA 4HFNA 5AKKA 4Q1BA 1BHO1 2I7CA 3GIDA 3QVUA 4BNYA 5KYXB 4GSKA 3KSMA 1UMKA 3BXFA 4TRMA 4KOEC 1PVOA 1G8HA 2W4IA 2GD1O 1HE1C 2CNDA 2ARKA 1P4HA 2RGEA 1G8MA 4QAQA 4RQBA 1BKYA 1Q95A 5HJ7A 5FUBA 5J4LA 4UUAA 3L8ZA 1H1DA 3E22A 5LKRA 2C4HA 3AUSA 3E9RA 3GRKA 3HUTA 4IXTA 5K0ZA 3PKZA 2XB6A 3ITNA 4O4JB 4M89A 1ZRMA 5AW0A 1QWSA 3UK6A 3BJEA 3UT5A 3H9BA 4BWYA 3MBKA 4AJIA 2AG0A 3D7NA 3FI9A 5ALXA 1SC6A 2C9MA 1WHTB 3DMRA 5DLQC 3HDHA 2QR3A 4GE3A 4EI7A 3CZ9A 1O5IA 4L50A 4ETNA 3VBCA 1G16A 1M1NA 4NJMB 5JQGB 2CEAA 1Z5VA 5AQEA 2H65A 3N7AA 4KV9A 3QPDA 1S2LA 3RJMA 1G7TA 3OMLA 4GR4A 4AKSA 1NZDA 3JAWB 3C24A 3ZLUA 4CW7A 1FJHA 4R1OA 2Y4NA 2C54A 3DHYA 3QU9A 2H8GA 5AO9A 3PPXA 3NHMA 1DC7A 2IEAA 4L15A 4O8CA 3AZOA 2E4VA 4WY5A 1NJFA 1GL7A 4U2BA 1EP1B 4UXJA 4BO3A 4QJBA 1NUUA 1JR3D 3BTSA 3U7GA 5FPKA 5F5XA 2DPLA 1TF7A 5AUPB 1CY8A 1Z4MA 3T9DA 3MD9A 3RG2A 3UWPA 1R5JA 1T2DA 3RGGA 3N2GB 3JRXA 3L7OA 4IS3A 5ALOA 3QYFA 5KQMA 1U2QA 2CXUA 5J1TB 2WIKA 2Y1WA 4O08A 3KLBA 2WMYA 4URVR 2QVGA 2DQKA 4BBZA 1TEXA 2GO1A 4MWDA 2EQBA 4XAQA 4DCTA 3RU7A 3VKFA 3LRTA 3TIXB 2DHCA 2EV9A 1LI7A 1WPRA 4PYLA 5EIFA 2JPDA 1VGRA 4GZMA 5EA2A 4DLRA 4HV4A 3P2EA 1FVOA 1GQQA 3LXMA 1GTJ1 1H2ZA 2R1VB 5ALZA 4AVYA 4WBNF 1GZUA 2J6BA 4LC0A 2F8LA 2WA1A 4KGVA 1R18A 1NUAA 1SHUX 3A25A 3NOQA 4PX2A 1RJEA 4QJ5A 3UOWA 1N2SA 1AURA 4QOGA 1ABBA 2P91A 3IELA 3EXHB 4K9MA 2GBCA 3AUXA 2QUIA 2JATA 1I2AA 1H6CA 2AEMA 3GU3A 4FR2A 1IXRC 1AKNA 1SUIA 2Q0QA 2IU4A 2WJPA 1U3TA 2PLFA 4C4TA 3K3PA 1T1IA 3FSGA 2C7RA 4MEJA 1QUEA 5K3EA 1JHMA 3ZC3A 1U63A 3FVTA 5EP4A 5GOZA 2Y0EA 3DOCA 5BVHA 2J85A 2YW2A 4Y67A 1KMCA 4GUDA 3LKBA 5EKTA 3U60B 1GIAA 1D2RA 5AI0A 1KZ4A 1FTWA 3H2YA 2YVKA 4PGHA 5E7QA 3RS0A 4MVJF 2WI8A 2HIAA 4IBOA 1XQ6A 3HGQA 1K27A 3R2JA 4DNFA 3LP5A 4CM1A 1G9SA 2V7GA 3GJQA 1ISSA 2N47A 3KT8A 2LCFA 2JFUA 2Z5FA 3L1JA 4QTXA 1FPMA 1D4FA 2CFTA 4EMSA 1KO5A 3O7MA 1YBMA 5FADA 3N2LA 1G8KA 1C8LA 3IP3A 4R7ZA 2FFRA 3P27A 1L5HB 3JVEA 4ZI7A 5TMPA 5DULA 3Q3HA 4RHYA 3TPZA 4CQJA 4Z4EA 2JAPA 1YIDA 4FBGA 3LUDA 3H7IA 3M33A 2H7VA 4G3XA 3FNRA 3EB9A 1TC2A 4P22A 3VJKA 1M0WA 1I9GA 2PEYA 3ID6C 1DV1A 3JWHA 4FX5A 3SIWA 4WH0A 4EW1A 2O8DA 2NNLD 3GGSA 1CVLA 1M5TA 2VPZA 5B6PA 2JCSA 2ZE6A 3HM9A 1Q20A 4CIBA 1OGIA 1RE1A 2B9VA 4GR9A 1QGED 1L7PA 3DMNA 1W1WA 3T61A 1TA0A 5TMDA 2WP8J 2CMHA 1B4DA 1F4LA 1A76A 4NH4A 4IKPA 3ZXYA 3A3NA 4HTFA 4KPYA 4P86A 4QUKA 2EU8A 4ZYTA 3GCXA 2GZ1A 4L16A 5CB4F 3QFSA 4KTVE 5KWEA 4P7BA 5GONF 3FBGA 2YWDA 4YRAA 3W2FA 5HYVA 5HZHA 1OUMA 3ESBA 2IXGA 3I2KA 1LQTA 3NJRA 1RVDA 5EMNA 2O2ZA 3FYTA 3N0WA 4OAOA 1C7ZA 1XK7A 2GZAA 1RJ9B 1KYXA 3IBYA 4G1CA 5D5QA 3RHSA 4N82A 1UKAA 1C80A 3EJ6A 4PHHA 4GXQA 4X1YA 3HXQA 1WP4A 2WVHA 2O05A 2WPNA 3I04M 1V45E 2CDNA 2XYQA 3F4KA 3OQJA 4H0FA 4RPCA 4WI1A 4KB5A 2WUFA 4AZTA 4U7DA 1ZNZA 4XQ9A 3ECAA 2V7UA 1KIAA 3LJKA 4LGMA 4ZREA 1X1BA 3OQMA 5EHZA 3RTAA 1CUZA 2Q4EA 4BO5A 4F7DA 1S2OA 4BNFA 3HA5A 2QX6A 2Z5VA 3IEIA 3QRWA 3RIGA 4F11A 5CT4A 2WABA 2ZSEA 3OZGA 5JIBA 3LQ2A 2DWOA 1IE3A 2YYAA 3GMIA 3MT7A 1H1LB 1ULTA 3EFOA 4MDEA 1QVRA 4HUJA 5EIAA 3HCAA 5ALSA 2AXNA 2MINA 1RPAA 2EZ9A 1FYEA 1Z0AA 2AW3A 2VHJA 4IF6A 4DILA 3TQRA 1QYXA 4C0LA 1MAWA 3AO0B 2X6QA 2QTVA 1A77A 1VCOA 3LGAA 3NYWA 4ASUA 3OM1A 2V5VA 2C0CA 1PE0A 3EUWA 2OFFA 4CTKA 1JWAB 5KPDA 3CVYA 5K7SA 1UPCA 3MSXA 2DTDA 4L3OA 1L7RA 2VSQA 5C53B 3BXPA 4DA7A 1CHNA 4EG5A 1IZ7A 3O0TA 2HC9A 3ZHOA 1Z5ZA 2GWRA 2QGNA 3KALA 3AGQA 5CLLA 1YOVB 2IUEA 4JGBA 4CCAA 2H5IA 4WUVA 3ZK9A 1P72A 2XR1A 3G2JA 2RHLA 2F9FA 2RBGA 3MJHA 1ECLA 1C5KA 5EZYF 4AWAA 1J5XA 2VDLB 1RMTA 3PUXA 4S12A 2E1RA 2QIOA 3ZV4A 1G0NA 4XWWA 2E4YA 2OEPA 3L6CA 2PUJA 1BXZA 3X1XA 1E5XA 5IJZA 3PNLA 1ZXLA 2CXTA 1U0SY 4F9GA 1KWGA 2H4ZA 3TD6A 3W1VA 3ESAA 1ILEA 1TD9A 3F9RA 3BH0A 1M2GA 3AU8A 1ZI8A 1VCIA 2FX3A 1CSEE 3KCNA 4PZPA 4AY5A 3IDAA 1Q6ZA 3GR6A 4PG7A 4Z9BA 2OE2A 1CY1A 2QMZA 4FMDF 3IVXA 1EK5A 2I8CA 1EVIA 2EG9A 2L2QA 1SXJB 3LVRE 1IHDA 2R7LA 1UZMA 2TMGA 2HLDD 1FOEB 2NSHA 3M6LA 4YTEA 5E1MA 5EIBD 4DCNA 5BVGA 2C7OA 3OZVA 2FFQA 3OOYA 5G0UA 1C4OA 2FW6A 4IGEA 2QL7A 2GEKA 4DOMA 3S70A 3FFBA 1DTEA 3LX5A 1T5HX 4YP0A 1TZKA 5BV2P 2IS6A 1HDCA 4PTZA 4ZPJA 3I0ZA 4RTLA 5IK2D 4KAFA 4P35A 221PA 2Q28A 3GI1A 5ESXA 5HF9A 5J59A 1KK1A 1SWWA 4H1VA 1BE8A 1FS5A 3DBLA 4GRIA 1A1SA 1UDAA 3CPEA 5GPBA 1T3TA 1ZMXA 1LZKA 1SQ0A 3PGVA 1KSJA 3U13A 1H69A 4FP9A 3ZHXA 3PE3A 3FCCA 4EB8A 5AM2A 1V47A 3O03A 3I8XA 4J6EA 1EB9A 2JNWA 4CT4B 4MVYA 4RULA 3WAGA 3HNPA 2IYTA 3G59A 3C6ZA 3LFHA 4DNOA 3I72A 3N8NA 3LA6A 1ULHA 3M9WA 4NDNE 1PD1A 2B30A 1Z82A 4WW0A 1EINA 4XOIA 1X1TA 3T9AA 5B55A 1WA5A 2JIRA 4ZIRA 4DLYA 5EWJA 2C9BA 1L7OA 2AN1A 2YBEA 4Q1EA 3UC5A 4B4WA 4B09A 1EGMB 3NBZC 4EJSA 4OHCA 2JIQA 4UUPA 1OU0A 1M6WA 1YKSA 3AKYA 4W8HA 3T34A 1OGJA 3ADOA 5DCUA 4BYMA 4D4LA 4NZOA 3NBXX 4ZKDA 2Q5JA 2V45A 2VF2A 2IY9A 3W5DA 2QUKA 3H97A 3VSAA 2VLIA 4WNAB 2XKJE 4ARUA 1XELA 1P2SA 3IULA 2NO7A 5JAPA 3NPAA 5BNFA 1OH7A 1G9TA 1EFCA 3KOOA 2C97A 1UPBA 2YCBA 4NAVA 1L1RA 2P9EA 3IUYA 4NYMR 5K8JB 2DH5A 1LGYA 4QHYA 1FFYA 2Q4BA 1YRQA 4B3IA 4MV0A 3ND6A 2CLOB 2IYXA 4TPKA 5JPIA 1R9JA 2FDCA 2PZJA 3A6LA 4PQEA 4OYHA 3MUEA 1FFCA 3G88A 3CNOA 4UTPA 1QYVA 4H7EA 3W5HA 2RGXA 2FPPB 1YQDA 4Y9DA 2C7VA 3F5FA 3IOMA 4L2IA 5JR3A 1WMDA 1B8NA 1RYDA 4KN9S 1RW4A 4C7VA 5A71A 4N9WA 2DT8A 4F5YA 2XTJA 4XQCA 1JT2A 4ZMSA 2GM5A 5HDBB 2ZRPA 3NR2A 5GAJA 3OZRA 5ESWA 1W48A 4XXHA 4AB1A 2P9TA 3MIIA 2IQ5A 3L4BA 1NMQA 1TPZA 2ZT5A 3QNMA 4FIDA 3K9WA 4FWBA 1GXSA 4LMRA 4LV8B 2BH9A 3S2ZA 5LIPA 2Z09A 4EH1A 4KBFA 1NMYA 1GSAA 3K0EA 4UNNA 1W52X 3WX0A 5C31A 4B3XA 4JUDX 3UXMA 2YFQA 2VOEA 1W5FA 1NF8A 4ZD6A 4B6QA 2BFFB 2M1ZA 3NW9A 3DLHA 3I92A