2RSQA

Copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
GTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper chaperone for superoxide dismutase
publication title Copper(I) loaded form of the first domain of the human copper chaperone for SOD1, CCS
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rsqA00
2K2PA 2N7YA 2XMTA 1IUJA 2GGPB 4NPOA 2QLXA 3HDSA 2OD6A 1CPZA 3KNGA 4A47A 2N4DA 2FIUA 4Y2MA 3BF4A 1Q53A 2OP5A 4Y2KA 1FVQA 4FNIA 1AFIA 1Y0HA 1P6TA 2EW9A 3MCSA 3MZIA 1YJUA 2OD4A 4DL0C 2AJ0A 2QYCA 2ZDPA 5B0AA 2GO8A 5F0WA 4YEAA 2PD1A 4HH1A 2ROPA 1AW0A 3FMBA 2XMKA 2RMLA 1ULRA 4HI2A 1K0VA 5IXUA 4ZA1A 1X0PA 2ZDOA 2QLWA 2XMWA 3IWLA 1FVSA 3UDCA 3LGMA 2HLTA 1CC7A 3BN7A 2KT2A 3LGNA 1SQEA 1Y9OA 2ROEA 2GA7A 3HHLA 2K7JA 3CJKB 1Y3KA 1N5TA 2CRLA 3BGUA 3TNVA 1TUVA 1SB6A 2IYIA 1TZ0A 2QIFA 1Q8LA 1GXTA 1XBWA 2K1RA 1AFJA 1OPZA 1P8GA 2JDJA 3DCAA 2RILA 2LQ9A 2KT3A 3HF5A 4EFAC 2PGCA 1KVIA 2AJ1A 2OAUA 2GV1A 1N5SA 1V3ZA 1YJRA 2AP6A 1MWZA 1OSDA 1W2IA 3I9ZA 4OJ3A 1OQ3A 4A46A 2KKHA 4Y2IA 5T7LB 3HFKA 5B0EA 3BDEA 1Q8BA 3BB5A 2XMVA 2ROGA 5A6WA 2OFGX 4OJHA 1WD6A 3DXSX 4HL9A 4OIXA 1S6UA 2GCFA 2GGPA 1KVJA 4HI1A 5B0BA 2FHMA 1FE0A 2BUNA 2W4DA 4OJGA 2FB0A 3VTIA 5B0DA 3KKFA 2IYGA 5K9FA 1Q4RA 3FRYA 1TL5A 1TR0A 2VV5A 3TRGA 2BJDA 3GZ7A 1QUPA 5B09A 1KQKA 4A48A 1LQ9A 2K7KA 3FGVA 3LO3A 4U9RA 1RJJA 1YJTA 4Q2MA 3QGPA 2LXFA 3E8OA 2VH7A 2RU9A 3BM7A 2Q3PA 1JWWA 2LDIA 1VQYA 2W4CA 1GXUA 1YJVA 3TOQA 4Q2LA 2XMUA 2HQIA 1N5QA 2FTRA 2W4PA 1X8DA 2ASYA 4NL5A 2XMMA 2OFHX 1SI9A 3BR8A 1S6OA 3QMQA 1URRA 3IWXA 2LQBA 2L3MA 1FEEA 2N4CA 2XMJA 1FD8A 1U7LA 4OJ1A 3HHLB 1N5VA 1MWYA 1YRXA 4DN9A 5A6PA 3CJKA 2GFFA 5B0CA 3KG0A 3HHLC 1JK9B 2BYCA 2IFXA 2HIQA 2K1RB 2KYZA 2HLUA 5B08A 3K7RA 3WDOA 1Y3JA 4HH0A 1FESA 3T9NA 1YG0A 3HX9A 2BBEA 1OQ6A 1TL4A 2ACYA 4A4JA 1FE4A 4ZOSA 1CC8A 4YDXA 4FNHA 4F67A 2BJEA 2HFOA 2OMOA 5KAKA 1APSA 5B0GA 2OKQA 2RSQA 2G9OA 2AW0A 3F44A 5B0FA 2HFNA 4QOTA 3HHLD 5F0UA 3KG1A 5T7LA 1R6YA 1X7VA 1VQSA 4DPOA
chains in the Genus database with same CATH superfamily
2BA9A 4ZS6A 1T9VA 3ZTSA 5E3QA 1IKWA 2F9JA 3J81Y 2CG4A 4K4WA 2C3OA 4F04B 5DQIA 1A7GE 2NCKL 3HD2A 1HQEB 3DOMA 2DPIA 2OPRA 3PW0A 2Q6BA 4YR3A 2IVYA 1LW0B 1ZTTA 2OAUA 2VONA 1U24A 3I9ZA 1CLFA 2A3JA 9RUBA 3TAMB 2L08A 4CLFA 2IBKA 2GGPA 1U1KA 2E66A 5KFEA 3R7BB 3QJLA 4A48A 2K7KA 4RUCA 2VJVA 1VR6A 2OIHA 2NZCA 4K4XA 2W4PA 4CTAB 3TEGA 1RADB 4P10A 2P9GA 2J0WA 2VICA 4DV6F 3MMCB 3MPYA 1UCNA 2B6AB 4ZOSA 1S9EB 3CC2S 1VC5A 3UVJA 5LMNJ 4RNNA 3B8HA 3HFZB 4OHWA 1J5OA 2D3UA 4IR1A 4QJVA 3WIVA 4AL5A 3NMRA 1CJVB 1N5YB 3PX6A 2M7SA 2MQLA 2UUCJ 4HACA 4LQ9A 3OR1A 4I68A 2K7JA 2QMUB 1NJWA 2J6UA 4CM0A 1HA1A 3D0HE 1T03A 1FNMA 4QPTA 2HZCA 4ECTA 2ZZMA 1RQ0A 2OEMA 2YX1A 1G6BA 3JYTA 3QIPA 2J9EA 3I96A 2Q6CA 3B82A 4ZITA 6AT1B 3W60A 2YPYA 3GYNA 2DIVA 1ZBTA 3FBBA 2LXIA 2VA2A 4YS2A 4Q43A 3RGIA 3C19A 1FX4A 2BEFA 1V5IB 1XMOF 2C2EA 4KSEB 4I2PA 2H5IB 2P2CB 3K89A 3IR6B 4NLXA 1T11A 1O6XA 3CJQA 4LREA 3OSPA 2NXUA 1RYRA 3A8JA 2NQPA 2WONA 1L3SA 3KNGA 2KZZA 3HD1A 1V3RA 2DGVA 1YKWA 2ATCB 1S1VB 3R6GB 4WFNQ 2RKIA 2KYXA 4CT8A 2XBPA 1NKCA 3Q8RB 3LQVA 1WHVA 3MUTP 2Y0BB 4P2SA 2CQGA 4LRDA 3OL9A 1B0PA 5GADU 1D1UA 3J7Z5 1DURA 3EZOA 1IKXA 4WFZA 4DL5A 4M5KA 5CH7B 3MPWA 2C3MA 3VZHA 2MQOA 1QVGR 2YKAA 3FCVA 4DX7A 4F26A 2FTRA 2MZTA 4F0HA 5HQLA 2OFHX 2LCWA 1RT7A 4KGKA 1CG2A 2B0GA 2WOMA 4XAKA 2KJWA 2GIRA 3GYGA 4GVBB 5A8WB 2X3DA 4U8VA 1IVZA 1RAEB 3TX8A 3CJ2A 2Y8WA 3CD7A 3OL7A 3OVBA 2R2SA 1NK8A 4G1QA 2EG2A 4WJBA 4J9UE 5MAOA 2QX0A 2IJNA 4P7TA 2CQ3A 2XG8A 3R5AA 4USHA 3ITHA 1RHQB 4ECRA 4P2MA 1LWXA 1HNXJ 1PC5A 4LF9F 3RZAA 2UUWA 5T7LB 4C8LA 1RT4A 2AJQA 1TFYA 2MQ8A 3NEKA 3NGRA 4CDIA 5KFOA 2JEFA 2ZFHA 3V6DB 3AT1B 2HVDA 4BLGA 4ES2A 3D68A 3VF0B 4KB7A 1NDPA 2RAQA 4AYBD 2RRNA 1EB0A 3SDEB 3H2VE 3W2VB 3HT0A 3K8VA 1VQ9S 2IA6A 4GVLA 3HX9A 1OPIA 3Q24A 5B0GA 1KLNA 3CW2C 1LK7A 4L74A 5L9NA 3HHNB 1RWUA 3T6JA 4QYZK 4IFYB 1SH3A 1WOSA 4TY9A 4Y2KA 1V5VA 5BYSA 3M9OB 2IBOA 4P75A 2L9DA 2EKYA 3CJ8A 3W65A 1GK8A 4JOUA 1R0AA 1VCTA 3CCQS 4DX6A 3GILA 3AB4B 2CYYA 4TY8B 3ISND 2P5VA 1MN9A 5J2PA 1IJFB 2JZ5A 1KQFB 3VAGA 4F2RA 4ECVA 2WBRA 1OO0B 1W7WA 2CPJA 4DN0A 5CD4A 2VG6A 1GQEA 4TYAA 1LFWA 3ENWA 3OT9A 2XGPA 1GXUA 3NAIA 1Q1KA 1MG7A 3K5PA 3SCLE 2Q1LA 4QYZJ 4K5SA 2DH9A 3W9HA 2G1DA 4RO0A 3TX0A 4ZPDA 4P6QA 1U6FA 1YTYA 3WDOA 4N76A 1KTQA 2BV3A 5EX3A 2WVEA 1REGX 2NXCA 5D4PA 2G2YA 4LF7F 1NZ8A 4L76A 3TO8A 1CJUA 2V5HG 2ALZA 1KQSR 4ELUA 4PYDA 3PKMA 1LK5A 3QNWB 3PW7A 4LUBA 3SV4A 3H8YA 4FPRA 1TK8A 3W2WB 2F4FA 1QAYA 2G0CA 5LSOA 3QO9A 2AMCB 4Y65A 3HVTA 4PPZA 1O0PA 3LGNA 1VHIA 2JX2A 5KG0A 1TL3A 2HBQB 5RUBA 4RW9B 5KG7A 4OJ3A 4MMOA 1PJ7A 3X3UA 2V4QA 4LSZB 4PG7A 5I4MA 2EFVA 1PILA 4OV1A 2PMHA 2QJ3A 2W9AA 2DKOB 2F65A 4LR9A 2Q3PA 3EXCX 4OFZA 1JWWA 1RT3B 1T7PA 4OI2A 4LF8J 2QA2A 3HT3A 2ZHBA 3KXDA 1T3NA 1VBXA 3FQLA 2FJEB 4OYIA 4NXMJ 1R8AA 1HW8A 3V5RA 3MECA 3G8TA 1RWWB 3TANA 1RT1B 1RWXB 3ZZUA 5IS2A 1S0OA 2W8KA 4KHPF 5EX0A 3CMQA 2ZH7A 1U1RA 2FC9A 3NY0A 3BSOA 1JLFA 3JB9k 1S4FA 1NBEB 2QG9B 2E44A 5IT9U 5GAGU 4DR3J 2JSXA 1NK7A 1S1WA 2J8SA 3CDUA 1AFJA 1LWEB 1U47A 5J1EB 5CYMA 3OLBA 2E5LJ 3D1QA 3ETOA 1WF0A 1MROA 1X4GA 3DLHA 4C7QA 3EZ5A 2F7VA 3A8KA 2IAJA 1BC6A 1KSPA 3TRGA 5IOLA 5K20B 2HFVA 1R6VA 2A0FB 3BREA 1FJEB 1NKEA 2IVFB 4URQU 2JEGA 1MSWD 4OZNA 2XSFA 4LF4F 5ITHA 1RGVA 2MJUA 3I6PA 1WEZA 2ZHOA 1F2GA 3AD7C 5EDWA 3GMGA 4CLWA 3Q8PB 2Z56B 3MMBA 3FMWA 5HANA 1QSLA 1UVJA 2QA4G 3AB2B 2Z2MA 2M0GB 2YKNA 2ZJPQ 1D8ZA 3QPIA 3VAFA 4OI6A 1FDBA 1W2IA 3KHLA 5KT7A 3F0NA 1XN9A 1NPKA 1AZSB 1KOHA 1A0OB 5MLCV 3BO2A 3RR8A 2ZWPA 2HFSA 2ZZTA 4USWA 1DLOA 2CJ9A 2CFXA 3ICLA 3CJTA 1MWYA 4LRAA 2LXUA 4ZVUB 3SQGB 4PPDA 3EYZA 4PG5A 2V8PA 4MK7A 2MZQA 4QWAA 4B9TA 2ZEJA 4QOTA 3POTA 4I7FB 5ETMA 3IBFB 2E5JA 4KFBB 4I56A 1Q5VA 5E2QA 3BSCA 2EWHA 4KV8B 1Q78A 4ECWA 4HTJA 5U47A 3DRSA 5IXUA 4GRSA 1IBLJ 2Z30B 1NM2A 2AYMA 2HNYB 2YX4A 1X4EA 2K3KA 1S9GB 4A8FA 3G2XA 4LMZA 1V3ZA 3MFHA 3LGHA 3H4DA 3AOBA 2XMVA 1JXVA 2H1YA 4LQ3A 2PA8D 2XI3A 4AUKA 1DRZA 2FQQB 2YQ3A 4OI4A 5B0DA 1U4BA 4CZCA 4RNOA 1J5EF 1S1TB 4FP9A 2E1CA 4WTYA 3BH7B 2MLZA 2GMHA 1TUGB 4NI2B 2F8MA 4H4KC 4JI6F 3T1YJ 2YX7A 1G3OA 2IDEA 3HHLB 3H5XA 3CJKA 1O5JA 2XSJB 2W2OP 4M63A 1H2VZ 4L3KA 2AKWB 3M30B 4LVNP 4NA3A 1HNVB 4ED8A 5E3AA 4WFXA 2V4RA 2QLFB 2V8GA 1M1KT 1TUWA 3EX7B 1RTHB 4LF9J 5J1NA 1MU2B 5KFSA 1Y00A 3R1LA 2H3EB 3FC9A 4J37A 2R8HA 4ZPBA 1CC7A 1N36F 3I87A 2YNIB 2H4WB 5I42B 1UVLA 1HBUA 3T1HF 4DQPA 2Z2YB 4PXBA 1HWKA 2V4JB 2VKRA 2HG4A 5E3PA 4F8RA 1F5AA 3DYAA 1N0UA 5KFCA 2DHAA 3KKFA 5KG2A 2G2ZA 1IKWB 3HCXA 2HWHA 2R7SA 2XMUA 3DOMB 1U1NA 2OPRB 3RR7A 1Y4ZB 3TJ8A 1KEKA 2NR0A 2R7QA 4U95A 2WVCA 3VGTA 2ZNZA 3UN3A 1HQUA 4IO9Q 1NEEA 1WTBA 2G9OA 2OELA 3RW6A 2R8GA 1GXLA 2RD5C 4MKAA 4C48A 2GGPB 1S10A 2HS4A 2DNGA 1S12A 2VFRA 3H98A 2CNKB 2R42A 1X0PA 2VC1A 2CJAA 2MPUA 5DDQC 1FX2A 4QU6A 2E1AA 2EFQA 5HVFA 2RDJA 4KKOA 4KY3A 1KKHA 2LEBA 3KTQA 2PFFB 1FJCA 1PO6A 2DGUA 3UVJB 3B54A 5F41A 1U49A 3SIPB 3KOAA 2DCLA 1N8RT 1J5OB 1VRUA 4WFBQ 4ALZA 3QAUA 1JKHA 1R0CB 1FTCA 3CDBA 2DNLA 2CQHA 3C16A 1NDKA 5HROA 1ZM4A 4HACB 4EU0A 1MMNA 4H54A 3BPSP 4NYOA 2KRBA 4UUWA 4AE5A 3NGKA 1F9FA 3IXQA 1T03B 3N5BA 4FNHA 2LA4A 4B3RJ 4DFMA 4QW9A 4MTPA 3JYTB 1NH7A 3QIPB 2DGOA 1UZDA 3GV5B 2HK3A 2Z57B 3PR4A 4DV5F 1RAIB 2XHWA 1H2UX 2AIRB 4ERDA 4DR7J 2VBXA 4F7VA 1KLMB 3QT5A 1C0TB 4ZCLA 3J80Y 4I2PB 2R7TA 1RLCL 1D09B 1V3SA 3O1LA 3KNAA 4UUXA 3VGVA 2WONB 5K8OA 1NK4A 3QGGA 4XIUA 2FZGB 4WK1A 1LEOA 3NBPA 2V2QA 4KE5A 1MW7A 4I0WA 1P9QC 1F9HA 1ZZNA 4CT9A 4DXLA 3KUHA 2VOOA 3KLIA 1Q5YA 2RKIB 1RYSA 2GAHC 5M2UA 4IOBA 1CULA 5B08A 3FDSA 3N79A 3ILJA 1BWVA 3R6LB 4F2SA 3BSNA 1IKXB 1S77D 5B0FA 1SH2A 1TFWA 3VAHA 2EFGA 1YRUA 3W3SA 1YDLA 2KXNB 5I3UA 2CQPA 2HNDA 2AJFE 2AGOA 1Y0HA 5KFYA 2DH7A 1UPPA 5HQ8A 1SKWA 3BBFA 4IQMA 3NWRA 4C8ZA 3EVOA 4KJIA 3H5UA 1PAEX 3R2DJ 2HLTA 1RT7B 1GH8A 3MPUB 4NLWA 3KLVA 1Q8LA 2LYVA 2WOMB 4MIAA 5BXIA 2AP6A 4DL2A 1UEVA 1IM6A 5KFDA 2W01A 5K5MA 4RL1A 4R5PA 2J76E 1SJ4P 4DLEA 4IH6A 4F3MA 3D6FB 3RYLA 3G8SA 2ADBA 1RTDA 3DGVA 4L75A 2YWGA 3QT7A 4G1QB 4EUVA 3OVAA 1P1LA 3IGVA 2IRUA 2KVIA 2CPXA 5GAEI 3W63A 1Q16B 4KIAA 4FF2A 5T41A 2Z4PA 3ITHB 3GCXP 2V94A 1RT4B 1HR0J 2XB2D 2RS8A 1T95A 2RDIA 1SL2A 4DPUA 7AT1B 3GG0A 4RW4A 4W90B 2G13A 1M5SA 1YJUA 1JLQA 2GO8A 2CJKA 3PHEA 4UT4A 4MFBA 3CDWA 2WBMA 3CEDA 3NOCA 3TA1A 1QAXA 1N33F 4OYOA 3NRBA 4DWIA 2NPFA 5ETVA 5LXRA 3D66A 2XMAA 1GX6A 5KFFA 4HT5A 1JIHA 2FJAB 1F3FA 8ATCB 2UXDF 2F8HA 2CJBA 2WSFC 4Y28C 3ULHA 1FFGB 4N8OA 4EO8A 3SSSA 3BGOP 2BJ7A 4DPTA 2I5JA 2W4CA 3TOQA 1Z2ZA 2RQMA 1R0AB 2H54B 2NZ4A 3OBIA 5ETSA 2CPZA 1U7LA 4N8NA 4OHZA 5KG4A 4ED2A 5A6PA 3AA8A 5J2PB 1W26A 1HKAA 3PR5B 4HH0A 3EE3A 4WXOA 1OQ6A 2BJEA 5AXNA 3UCGA 2L48A 2FHKA 3KLHA 1JJ2R 2R8IA 5IC6B 1W25A 2C2RA 5DQHA 2VG6B 2HPUA 5FJ4A 1RHMB 3QJJA 1RI7A 2EW9A 1J2VA 3ISNC 2OGUA 3N5FA 4Q44A 3V6KA 3CCZA 3FNNA 3OFEA 4JB8B 2DXFA 3BN7A 4J7CA 5D3GA 4GKKJ 1J5EJ 4YUDA 5GAHI 3NCQA 1NH8A 4XPCA 4B9SA 2M8HA 1U0SA 2RRBA 3FFIA 3FK4A 2EI5A 3CULA 3M9MB 3CF5Q 3ZC4A 2QMWA 2MLYA 5CZXA 2LP4A 3GE9A 1N48A 2VPWB 2DHHA 4NL5A 3NCRA 3HVTB 3QMQA 1RCXB 2DO4A 4F36A 3MD3A 1TL3B 3MTJA 2RU3A 1CC8A 4RNHA 1OMSA 1KNZA 5CD4H 4PCQA 1UW4A 4M1KA 1MWZA 4ZN3A 1TMMA 4F0MA 5KFJA 1KTVA 3AXMA 4HT7A 2MLXA 4FNIA 3M2UA 4RPFA 2HHHF 4I2QA 3TI0A 5SZTA 4EEYA 2P6SA 1RAFB 2FJXA 4EZ9A 4KYZA 4FXWA 4X4UA 4QCLA 1RUSA 4BS2A 2MJNA 5C25A 3TUPA 5CHCB 3MECB 4XDCA 5GMKa 4HEA9 2KB2A 4WKRA 2VPZB 1S7IA 4L72B 3A12A 4OQJA 3NAHA 2BUNA 2DNKA 2B5JA 2ZH9A 1HLWA 3RRGA 4X2BA 4M5JA 5D0EA 2JOQA 4KGZB 2HK2A 2OSRA 2HGMA 3HMJG 2XTJP 1TVRA 1WOPA 2PC6A 2FC8A 1S1WB 3KK3A 1JK9B 4OYMA 3NGSA 4KC5A 1KFDA 2PFDA 4PR6A 1Y11A 5CYMB 2I38A 4X4QA 1R89A 4CWBA 2E5IA 1F1BB 2VUGA 3L7PA 1KHVA 2ZKUA 4LRFA 2IAJB 2N4DA 1KDNA 1WF2A 3P45B 2HRYA 3OVSA 4F4AA 3DNCA 2CWXA 4EI2A 2CPEA 3MAHA 4MKYA 1OYEA 1FRLA 1X4FA 1RLDA 1NHKL 2IYIA 2IIHA 3MHYA 3OFFA 4JBCA 1SJQA 2AJ1A 3OTBA 3NCPA 3G82A 1GFWB 1RT6A 4NASA 2LU1A 4A8WA 4G1PA 5F9NA 2LMIA 1N34F 1RKJA 4KHMA 4URSA 2RNEA 1YI2S 2RE1A 4ECZA 2XLIA 1WC4A 3MMBB 2V68A 1OWXA 1HMVA 2W2NP 1FKPA 3NG8A 4KRWA 4ZPTR 2VL1A 2YKNB 4NLPA 2BE7D 1SXLA 3SZ2A 2DNHA 1T05A 2DNOA 4DV5J 4ZJLA 1DBDA 1I51B 5K8MA 3NS7B 4AQYF 1XWLA 5AE2A 2XS2A 4U67Q 5H1SV 2MZRA 2K2PA 4E8UA 1RAGB 3R2CJ 2EFOA 1VS3A 1HW9A 4NRTA 4GKJJ 2CKWA 2DR8A 1RAJA 3CMES 4WFYA 1DLOB 3BSAA 5A2QY 2EK6A 3PJWA 1UWBA 3DRYA 4RNFA 2HVEA 1T9TA 3US5A 4BBYA 1YJ7A 2VDIA 4B3TJ 3POTB 3CMAS 1Y5LB 3PO4A 3ILIA 3UO0A 4W4MA 3TEHB 5E33A 4LSLB 3CUNA 1TL7A 1WDTA 1FTRA 3A3NB 5HBMA 4QZVB 3DRSB 3NKYA 3DLKB 2B56A 1O51A 1FJGF 4DSIA 1QAIA 5LT5A 1TMJA 2EG1A 4ZP8A 1XTZA 2M4MA 4M5DA 1B64A 4C97A 4ZVFA 4ED0A 3J7ZT 5F3ZA 3S6EA 1K1QA 4PUOA 2N7YA 3ZNJ1 1HL6A 4DL6A 3C66A 1FVQA 3GJQB 2D9PA 1OY8A 1RWNB 4IG3A 1M5VC 2HYIB 3LP1B 1D8YA 2Y1LB 3LUYA 3EGVA 2XMWA 3HSDA 1LWCA 3V6HA 1IKVA 3CJKB 1BQMA 4DLGA 4DHVA 5EHHA 2C2NA 4DU7A 5KG1A 2BABA 5CCLA 3KK1A 4QYRA 2KM8B 4X84A 2BRLA 1ZYQA 1WC5A 2AZ1A 2BMBA 2FVPA 4KPYA 3W9IA 5K14A 4DQQA 3K57A 2KU7A 4C11A 3GPAA 3EXYA 4EYIB 2QA1A 3R1HA 2ZZNA 1NDLA 2C22A 1HBUB 1WC0A 2JEJA 1ZAVA 4TNOA 1WEXA 1TL4A 1SIWB 3IS9A 4RW6A 4DR1J 2HRTA 3F44A 1N33J 4X62J 1GNKA 3M8RA 5D77A 2DR6A 1RWKB 3DYAB 4Z2XA 3W8PA 4EMDA 1WC1A 3OJSA 2MZ1A 1P6TA 2D41A 1CQMA 4M5NA 1EAYC 2E1MC 4O3PA 2WW4A 4O0IA 3OHBA 2XS5A 1OJ4A 1IR0A 1VJWA 4JI4J 2UXDJ 2ZKTA 3HI9A 5L1JA 2QIFA 5IT0A 2W2MP 1F6TA 1X5PA 2RB7A 4Y3CA 4NYPA 4CIOA 4LFCF 5J2NA 1S1VA 5CQGA 5IZHA 1QD1A 1LKZA 3O2IA 4ED3A 1B7YB 3S8SA 5FD1A 2F40A 2PIIA 4M5GA 2X1BA 4IO1A 1WG4A 4LFAJ 2HFZA 4UOGA 4KKOB 2B7BB 1WTFA 2HIQA 3RRHA 3I5AA 3ILLA 1GTHA 3QT8A 1U1OA 4C3KA 2UUBJ 3MOJB 4KH1B 2MY7A 1R6YA 2N7CA 1RHJB 3HDSA 1OY6A 4X4VA 4QR1A 1VRUB 1WF1A 3ENQA 2NYIA 3ZTRA 2CNLB 1JKHB 1ULRA 3C16B 2KDOA 5D0RA 3MCNA 5HROB 2MKSA 2AJ2A 4DUTA 3UDCA 5A8WA 1SQEA 3PX4A 3K2YA 3DDIA 5BR8F 5C7PA 3NXZA 3G87A 4C3MA 4MH8A 2GZOA 3CJ3A 1FHTA 2KKHA 1FDDA 3PW5A 3KJNB 1PCAA 1RKIA 4X4TA 2X51A 4N5SA 3WIUA 1X0FA 4K4ZA 3OFGA 2MHNA 4ID5A 4U9RA 5F8MA 1RJJA 5DO2A 2HQIA 5K8NA 3EGZA 3GFXA 2V6AA 4BWMA 4DN9A 2G1HA 5DDOC 1JJCB 3VWSA 1AA1B 4YY3J 1DAXA 2D3OR 2I0XA 4DFKA 3PJXA 3R7SB 1SUQA 1TKXA 3BF4A 3GIIA 2GMLA 2QL7B 3NBPB 4AFFA 3MCSA 1VYAA 2ZDPA 3IG1A 1RWVB 4JI1F 4K8RA 5E3RA 4OX9F 4JV5J 3KLIB 2AX1A 5DQGA 2KT5A 4DS5A 4B08A 1IR2A 3MPVA 4YMEA 3W5YA 3HM9A 4ZLLA 1CULB 4RBTA 3J81j 1BMQB 1OPZA 3CC7S 4CQ1A 5EUHA 2ZH1A 3FZBA 1UWAA 3MF5A 1RU2A 3EDQB 4BDPA 2R2RA 4ZK7M 2GCFA 3T41A 3GFZA 2DNNA 4QIWD 5I3UB 2HNDB 4TQSA 4ZHRA 2YVSA 2A6OA 4CO5A 4O23A 1TQLA 2QZ8A 4LFBF 3ZTOA 3DOLA 1QSSA 2ZH8A 4P9SA 1ZTWA 1X9SA 4IUFA 3HHDA 4O4RA 1R8HA 4I69A 2JFDA 1WSVA 5B0CA 5DJBA 1GX5A 3DDKA 3HP6A 4TYBA 4Q5VA 4X4SA 3ENVA 3EWGA 3MUVP 2HMIA 3IR7B 3VAMA 5L1IA 1S1UA 4FXVA 4JP8A 4R5PB 1U1PA 4I64A 3DRPA 4A47A 4J5OA 5F8HA 4B9UA 1DTTA 2FVQA 1S97A 3HLUA 4DR6J 1H6KX 1WI6A 3RU0A 2N3OA 3MAAA 1RTDB 3J7YI 4ZA1A 3TUZC 2QLWA 2GQCA 4ZJQA 4DU8A 4KR0B 2IRYA 3JSYA 2JVRA 3DCAA 4RUHA 3UNGC 1KVIA 3MMAA 2IMWP 3M05A 1Q0NA 3W2WA 1VQ4S 4LSNA 4DF4A 4I67A 1HD0A 2UV8G 2FJVA 4RW4B 2FDNA 2VFSA 4JYAF 1RT5A 1RHUB 2I1RA 2NSCA 3RBDA 1JLQB 2VZ9A 2YBVA 2J5AA 2IVMA 4MFBB 3OTCA 3V81A 3VQTA 2WTFA 2N3LA 5F3TA 1T94A 2B9EA 1DARA 4OI3A 2EPIA 4EBEA 4DOZA 2BBEA 1X4DA 1BQNA 2KL8A 3FRZA 1TV6A 2P8IA 2NPIA 3AD8C 2MSTA 4ILRA 2I8EA 4Y0FA 3W9JA 4Y2MA 3DLGA 4WYWA 1PYSB 3U7JA 2W7AA 4NCGA 1NK6A 3K59A 2BVZA 2KH9A 3DLLQ 4LT6A 2UXBF 2H9ZA 4DV7F 4CO1A 3BYRA 3LF0A 2ZH5A 1RZMA 4A8XA 5DS7A 2MTLA 1VQLS 1FFWB 2X7IA 4XTTA 1WHWA 3KLHB 3IP0A 2QL9B 3JXOA 2MKIA 5KFAA 2XY5A 3GWCA 4NLOA 2CVIA 4ZMMA 2O66A 2ZM6J 2DY1A 1Q7LB 4A8SA 1H73A 2GJIA 5JMNA 2L9NA 5D3GB 3KJQB 5AJ3J 1KD1T 3DHXA 2YH0A 3T5KA 5GMEA 3R7NB 5F8GA 3FFIB 5D6GA 2DNRA 5KFBA 3QRQA 4GO7X 1TELA 4K0KF 2UUAF 2B43A 2MKCA 4OL8A 3TVKA 3LANA 2ADCA 4KBIA 2YKMA 3UCUP 4CLZA 3B4MA 2MDAA 5EWEA 2KT2A 2GA7A 2RH3A 2RF2A 3I82A 1E6VA 4NXNF 1X5TA 1SB6A 2FYXA 2XNRA 2VBWA 1VQKS 3N9UC 3K58A 1RDRA 4C98A 2BKNA 3HKZD 1XMBA 2RQ4A 4IKAA 1KVJA 4TXSA 2W4DA 3M8PB 3W62A 3VVTA 3M2UB 4QR2A 3FGVA 4I2QB 1VJQA 1U45A 4C8MA 2W7PA 4DV1J 3CWJA 2RJZA 2DK2A 5HL7Q 3NGDA 5C25B 3N6NA 1SKUB 3LAMA 4DMZA 1SH0A 3W5ZA 1WG5A 5HN0A 1G4CA 2XI2A 2D7SA 2NXEA 5KAKA 4PRFA 3FZ2A 2LQ5A 3IAM9 5IT4A 3N01A 3RAQA 2COLA 3TQ1A 3F56A 3TZXA 4QBUA 2B5JB 5HMYA 1U8WA 3SQGA 1D9AA 1Q53A 4WKYA 3VQSA 4F4XA 4LFCJ 4YEAA 1U6BA 3H2LA 1Q8IA 3F41A 4G1IA 2OLWA 4DV2J 2LQJA 2R2UA 2KZMA 1LWFA 2BJ8A 1TVRB 2MGZA 4CLYA 1U2CA 2VKZG 5CA5A 3PW2A 2DTJA 1AUDA 2HRUA 4J9LA 4GC7A 2M52A 3EPGA 4O3RA 3CIMA 2OH2A 4XK8C 5KG5A 3PXGa 3JAMU 4HL9A 1UA0A 1FERA 3C8YA 3KHHA 2ZBCA 1KS2A 1R8PA 4D3HA 2VQFJ 2YQ1A 3TVZA 3C46A 5HI7A 3CO0P 3BM7A 4FVCA 1KVKA 2BRKA 3CVKA 5KOXA 5DDRC 3BN4A 1O8BA 2M88A 3QZ8A 3CJSA 3Q2TC 3OUYA 4DJBA 3DXBA 1S1TA 3ZO7A 3R5GA 3M1VA 4B3MF 3G82B 1RT6B 3EICA 2JH3A 2RT3A 4OYPA 4C2MA 2ZNYA 4ZVPB 4WU2A 4FYVB 3RBEA 1YITS 4LR7A 4QWBA 4HKQA 1N56A 1RTZA 1VISA 3ET6A 3M30A 4ITSA 3Q8UA 1HMVB 2IA0A 1Y5NB 2DY9A 4LF6J 1FKPB 4DI6A 5DGBA 5L39A 2UXCF 1T05B 2KG1A 4RUAA 5KFKA 1M0SA 5FLXY 4WZQA 4ZPCA 3MR3A 1HNZF 1NU4A 2CDQA 1KRPA 2HURA 1PYTA 3M9NB 3GFYA 2OFGX 1X60A 4WFAQ 1SVDA 2FZKB 5DZ6A 3M8SA 2GHVC 5K9FA 5B09A 1UFKA 4PWDB 2JNJA 4PXDA 5HP1A 2B8QA 2ZOFA 5D8HB 4DV4J 1UWBB 4ETZA 3KDOA 3BPDA 2NSBA 4UTGA 1RBOB 1M5HA 4PKDB 3H90A 1HWIA 2HW3A 2O3DA 3G6YA 2VODA 2XO7A 2HVHA 2QA4S 4U8YA 1TTHB 2CQ1A 1IQZA 3CCVS 3VAKA 1TL7B 5HBMB 1R27B 1FKAF 4HH1A 1QE1A 1F0XA 1H72C 2RMLA 2OPQA 1S48A 2W24A 3K5OA 1JX4A 1B4SA 1SL0A 3I32A 2FHJA 2YY3A 1SCJB 2MQPA 2PDAA 4JI8F 3W66A 1GEHA 4K4SA 3I0SA 3NLCA 4CM2A 2AZ3A 4ID8A 4M5DB 2PGCA 2VU5A 2F63A 3RAXA 3CCWA 4PUOB 2YXLA 4RUBA 3GLJA 1U25A 4OJGA 2VG7A 5K8PA 3CB4A 4B02A 3MEDB 4IG3B 2PI4A 3VVUA 3TUJC 1LWCB 2BXJA 3CDEA 1IKVB 1BQMB 1XEZA 4CI0B 1UFLA 1UZHA 3LAKA 2WZ1A 3KJVA 1XNQF 1WDDA 4YDXA 2LECA 1YRTA 1IBKF 1WI8A 3H42A 1RWMB 4LBHA 2I6WA 3KK1B 3R8YA 2CNNB 1EP4A 5HVHA 5KFVA 3SQOP 4ED6A 5K14B 1QDUB 1GMWD 4KPCA 1H0HB 1NAQA 4C11B 2C1EB 1K9MT 3TJ9A 3SXLA 4H4KA 2FJDB 1K0VA 3EZUA 2RQKA 1RTIA 3BR9A 1JLEA 4CRJA 2BW2A 5JXSA 3V4IA 3SV3A 4URGA 1HNIA 1X9WA 1JMTA 1EETB 3L3CA 1ELOA 2B4UA 1P8GA 2K8GA 3GFHA 2MSSA 3IS9B 4NEZA 2X1GA 2W7OA 4RW6B 2MB0B 4Y2IA 1CEZA 3M8QA 3NMAA 4USVA 4OJHA 3FQKA 4DR2F 4X64J 4LF5F 1KLMA 3E01A 1C0TA 2FUG9 4DCPB 1NJXA 4DV3F 3BKTA 5AXMA 4CLLA 1BHNA 2RU9A 3AH6A 3SFGA 3LWLA 4ILMA 1QLNA 4J9PA 2F5GA 3BR8A 4HLBA 1I94F 2JL9A 2C2DA 5CZVA 2O5DA 1HI1A 4JI5F 1Z2LA 1MLAA 3MM6A 3HSZA 2GVZB 3MDFA 1V6HA 4UOCA 5J2NB 5F8LA 1VQNS 4DV7J 5I3PA 5F8JA 2EKNA 3SBMA 4RW8A 3CCJS 2OEJA 2IJFA 3BGFA 2ROPA 2CZ4A 3I0RA 3HJVA 4HI2A 4DUZJ 5AXKA 2ZDOA 4DX8H 2V50A 4GMKA 3LGMA 4IFVA 1H98A 1IWAA 3OTOF 2EFPA 3MI7X 4DCJB 1TUVA 4F02A 1NNDA 2MQNA 2OPSA 4YHHF 1RCOB 1JNZB 5E41A 4YQWA 3P96A 1P9YA 3FKBA 2DISA 5CXTA 2LEAA 4X65J 3QSIA 3TAQA 1REVA 4RLEA 2J7WA 3EMTA 4K4UA 2XZWA 5JVHQ 1ROFA 4CO2A 3TZWA 1FA0A 2CQ0A 2ILYA 4RR5A 2V9KA 4K0KJ 1IKYA 3CD6S 4OMFG 3GJTB 2YKPA 3PFOA 4L73A 1EQMA 4CLUA 4EYHB 1HHTP 2OTLS 3CJ0A 1JLGA 4YFUA 4N47A 3GSIA 1KR4A 3OPKA 4DV0F 5J1PA 4JI0F 1F3VA 3R3TA 3N4WA 3QBCA 4ID5B 4HTIA 1Q95G 4YB6A 1S4EA 3FUYA 3ENAA 2VF3A 5GAEU 3C14A 3NOGA 4B3OB 2VC0A 4ZVTB 1C1CA 3HULA 1X4AA 4ZLNA 2BM0A 4MKVA 7FD1A 2Z58B 5HMXA 7FDRA 5IV3A 2BANA 2LLZA 2B4OA 1HI8A 1SV5A 3AOCA 1SUQB 1TKXB 2BE9B 3DLEB 4ED7A 2C3PA 3IG1B 1U1LA 4HHHA 4YP3A 2I9SA 3MGJA 3R97A 4ZLPA 1KHWA 1SJ3P 3H7HB 4J9KA 3EUNA 1SPBP 2LQBA 4E2FB 2H5JB 1VBZA 2GC8A 2V67A 4PYAA 3UR3C 5KT4A 4JV2A 2CZVC 3HSJA 2OKQA 4KQZA 3PZPA 2V69A 3TVYA 3CCLS 4KHRA 4V19J 3VAJA 2IMOA 4ZHRB 2E9RX 3L09A 2HHSA 3THTA 2FVSA 5KT3A 3UDEA 3DOLB 3G6XA 1RU1A 1QTMA 1HI0P 4USIA 1JLCA 4OI1A 1PBUA 4IDKA 5IWAF 2K3IA 3W7BA 4P7VA 2RILA 3SCKE 4RZRA 4Q7AA 4QU7A 3LALA 3MUMP 3D6TB 5D15A 2HMIB 3MM7A 4M5LA 2BE2A 3DRXA 1F2HA 1S1UB 3DRPB 1CVJA 1DTTB 4QIEA 2IYGA 3T9ZA 2ZH2A 5KFWA 3WC2A 2GIQA 4B3MJ 3PRDA 3QGPA 3RG6A 1GAOA 4IOAQ 3MAAB 3G96A 1Q7YT 3GTYX 2NYHA 2QLJB 4C3LA 5CCMA 3PIPQ 3R9LA 4X66J 5GAHU 2BDPA 4K59A 3MCOA 5LJ3Y 5EWGA 3MMAB 3I5CA 4LSNB 4JI2J 3AQOA 3CSKA 4NLQA 2J8AA 2XZTB 2PE8A 1RT5B 4Y34A 3E51A 1U26A 1L5UA 1HNZJ 2AT1B 5G0RA 4DS4A 4NZ0A 3V81B 3PYEA 4F25A 4DR4J 2NUHA 2XC9A 3CXCR 3UR0A 3D4JA 3D1HA 4M8LA 3EM1A 1BQNB 4CO0A 1TV6B 3ZZTA 4EO6A 3JSMA 2OUGA 3DI6B 1SKSA 1WNEA 2DXEA 1ZETA 1I3OB 2E5GA 5LMNF 3QLHA 4XO0A 3DLGB 1YVFA 2DB1A 1JNRB 4DL4A 3IN5A 1AROP 3BKFA 4NCGB 3PYGA 2VH7A 1VMBA 1WHXA 3H5YA 1YQHA 2UUCF 4R0JA 1CJKA 4E0DA 2B4VA 3I56S 4ZCMA 4H4MA 4G65A 3AJ1A 3GP9A 2C3UA 4WF9Q 3T5HA 5IC4B 4J91A 4ZVRB 4CNYA 3R27A 4JI8J 2OI2A 4DG1A 2J7KA 2ABYA 5ADZA 2HIYA 1RAOA 2ZJRQ 2FVCA 3D7SB 5KOWA 2ILZA 1WKKA 2H65B 2YTCA 3Q2SC 3BQ1A 4M94A 4DV6J 1XBWA 1VRQC 1WACA 5HSPA 4HDGA 1UJ4A 2D3ZA 2IDLA 3HFVA 2KTQA 4A8YA 2GHPA 2YQ0A 1ZM3A 2O67A 1SKRA 1D9FA 2APOA 4ELTA 1NO8A 5DG7A 3AAWB 3W1YC 2YKMB 3UFCX 4F3OA 2ASYA 1V9OA 2L3MA 4ER8A 1YJWS 2G2OA 2HNZA 3ZZRA 2RF2B 1E6VB 1WUUA 3VZIA 1VQ5S 5ETPA 4QWEA 2KN4A 2A10A 5IT9Y 3HHLD 2DR5A 3MCMA 2YWEA 1K47A 3M8ZA 1IBCB 4DR5F 2QYGA 2FVRA 2ASJA 2IRXA 1A6LA 4U6PA 3B4DA 4ZPAA 4K2XA 2DXDA 1XMOJ 2DPJA 4LF5J 4KGVB 3BBBA 4B17A 4DV3J 3H5SA 3HZGA 3LPEA 4CLKA 2DO0A 4J9NA 2GJFA 2JHEA 4DPWA 2XLKA 1L3KA 2QC3A 2VJUA 4OI0A 1MNEA 2C3YA 5DZ7A 4UW2A 4AL7A 1TK5A 3DFEA 4ANEA 5KFUA 4ZPVR 4ECYA 4RU2A 3QSYB 1LWFB 2MGZB 3KYLA 2YH1A 4LSLA 5KFMA 3NL0A 2E7XA 2ZBIA 1KWMA 2AU0A 4ES1A 4DUYF 1BUXA 3DLKA 2HFNA 3MOZA 5L38A 1HNXF 4I6YA 2R4FA 1TAQA 3TW0A 3KLFB 1L3UA 4OYXA 1SJFA 1OSCA 1KOOA 4NLRA 1K1SA 4TVAB 1NMEB 4O3NA 2XZDB 3OUYB 2UVVA 4Y00A 3M1VB 5KFIA 1KP6A 2HZAA 2KFYA 1EX8A 3LP1A 1SBRA 2QSFA 2LKZA 2PEBA 3MM9A 4ICLA 3Q86A 2DGSA 1M5KC 3K5NA 2HHQA 1I6JA 2Z0GA 1Y7PA 4MT1A 4NCAA 4HR2A 4X4RA 4PEOA 4FF4A 4F3QA 1ZZFA 3Q8QB 5IM0A 4IQXA 3ET6B 4DCOB 3KHRA 4DV0J 1TP7A 4P71A 4NZ7A 2FLPA 2VD3A 1IR1A 2DEJA 4R8UB 1L3TA 4FPIA 1RA6A 1XR6A 2AW0A 2IM2A 3OXGA 1OS5A 2OD6A 2HSEB 2EBEA 2F1FA 4ZCIA 3JSRA 4OZLA 3GB0A 5HP1B 1SC4B 4EK2A 1IWGA 5THWA 5DETA 1H3DA 1IXKA 3PV8A 1WKLA 4NZ6A 4I6WA 1T9YA 3O6QA 4P73A 1H2TZ 3SSRA 3OR2A 4QR0A 1RT2A 3W64A 4Z7CA 4UZCA 4ETXA 5KFNA 2JC0A 4PQAA 2CG8A 3J81U 1MN7A 1TK0A 2IC3A 2F3JA 4ECUA 2POKA 4CH0S 5ETRA 1DQ9A 4JUZA 1TL5A 2Y1IA 1U2RA 3BQ0A 1QE1B 1YJTA 3MR7A 1X4CA 3NGTA 2OPQB 5HK4A 2VFTA 3THPA 2AEFA 3ZFVA 1S1XB 3I0SB 3BJYA 4ELVA 2V2VA 4CLPA 2BM1A 4H4OA 1T02A 4KGMA 1XMQF 2CPFA 4I6AA 5LOQA 4NLYA 3MZIA 1VQSA 2HZVA 1Z1ZA 3E2EA 5HQMA 3QWPA 1XIQA 1RAAB 2IM0A 2VG7B 5E7OB 1AFIA 1ZPVA 5DDPC 3D0IE 5JUMA 2CQDA 3MM5A 3G6VA 1FCAA 1UVNA 1XERA 3PEHA 4IRCA 2CJYB 3IRXA 1CJTA 2B51A 4QQBA 3UE2A 4MJKA 4LF8F 3DGPA 2F8EX 3TNVA 2D69A 5FDLB 2C2KB 3T19A 3KJVB 4OX8A 4OZJA 3T6BA 1S79A 4LF7J 2GV1A 2SXLA 4NXMF 4USTA 1I1GA 1EP4B 1SC1B 1C1BA 1YZ7A 4FVMA 1LQ9A 3KK2A 3LO3A 3BEGB 1R7IA 2XY6A 5KT2A 2HQ3A 1RTIB 2HBZB 5CYQA 1JLEB 5HAOA 2JJ4D 2N4CA 3V4IB 4F4YA 1HNIB 4P74A 4RKUC 3PRBA 1TKTA 1VI7A 2CIMA 4DR3F 1I5OB 3T9NA 2CZ9A 1UVMA 3QJPA 3ZZPA 5AE3A 1FEHA 2A18A 2ZUAA 3M8QB 3F73A 4NRUA 2LVWA 2LDYA 2QLBB 4BC9A 5H9EK 2XMTA 4A8QA 2E5LF 4C0OC 1X5SA 3E01B 1X5OA 3R5BA 1G1XA 3PM9A 3HKWA 4C8KA 1S0MA 2VOPA 5A8KB 4J9VA 4J90A 1U09A 1UMJA 4UY85 3Q0AA 5KFXA 1Q82T 2NXNA 1P1TA 2AF6A 3D54A 1JJ4A 1FT8A 3MM6B 4B9NA 3C6TB 5IV4A 1TKDA 6FD1A 2IPOB 3A4TA 2FLLA 4CO3A 4KHPJ 3RTVA 3D5MA 4HI1A 4RW8B 3JQKA 2G4BA 2GVDA 5ETTA 3AHPA 4YB7A 3PDNA 4PXCA 3G71S 2HAIA 4TQRA 3I0RB 3UQSA 3U1MA 4ECQA 2HHWA 2JLEA 5H9EJ 2ATLA 1G2EA 4IFVB 2DNPA 5D0GA 1S6PB 2Q43A 2IFXA 2OPSB 1HBMA 1WG1A 1JQGA 1FE4A 1NHUA 1HBOA 4WP3A 3D9BA 2NXJA 3BYPA 1U48A 1X7VA 2XULA 2QEXS 2HAFA 4C0HA 1KN6A 3JTNA 2J0SD 1REVB 1R31A 2Z8QA 2KXHA 4J9SA 1VLOA 1QJHA 8AT1B 2DRDA 1RHKB 1RISA 4NYZA 3HO1A 3C6UA 3CCSS 2OPPA 5G4DA 4NLTA 1IKYB 3S01A 3ZZOA 3OV7A 1DHMA 4LF4J 2HEKA 3LH2S 3DMJB 1JLGB 1HWJA 4JI7F 2IJRA 1H7XA 1Q8BA 3DXSX 3Q8SB 2DNMA 2NUUG 3FBEA 4FF3A 2RQCA 3D3CJ 4YB1P 3J7YU 3VALA 5CYJA 4Q2MA 2Y1JA 3MR2A 3ADAC 1FNOA 2A6MA 3L7UA 1FO1A 1RHRB 3C14B 1K73T 2UVUA 1SIZA 2DBBA 4DR5J 1IBLF 5KFGA 1C1CB 3AA9A 1XNRF 2Z2ZA 1RABB 2DD8S 1YG0A 2ACYA 1S59A 3H59A 2BANB 3M6UA 2E29A 4F50A 2CJXB 1SV5B 2BR0A 4ZLJA 4PQUA 3HHEA 2Y9HA 5JJBA 5F0WA 2IM3A 4O4GA 5DGAA 1D0EA 1WHYA 2WVBA 4CYUA 2DGWA 2V9WA 4PXEA 3T1YF 1DJ0A 1GT8A 2Z2LA 4WK3A 3D1OA 2DYAA 5BYRA 5C42A 3PHTA 4TKTA 1NZAA 2IHR1 3O44A 4FYDA 5ETKA 1IN0A 4Q8EA 3SI8A 3MD1A 4ZVHA 4R25A 4DZDA 4B9MA 2BOAA 1QUPA 5E0OA 4DUYJ 2LDIA 4J9QA 2M2BA 3H0PA 3PJ9A 4A8KA 3GQCA 1JLCB 4IH5A 4RU9A 4FKXA 2J6SA 1R0BG 4IDKB 1U1QA 1FESA 4K50A 2HFOA 1HHQA 2JC1A 2WAQD 3MM7B 2BE2B 3TWZA 1RE1B 2ZITA 3FVYA 2YNHA 2MXYA 1FRHA 2IM1A 1S0VA 3GIRA 5LMUF 1YBAA 4JI6J 4K4TA 1SQGA 3RB6A 1J27A 3ILOA 2GQ2A 4IR9A 3P49B 1RP5A 4FS2A 2DH8A 4AXJA 4KTQA 3A3PB 3DHWC 2XYHB 4A46A 1FK9A 2V8DA 3ETMA 1SL1A 2UP1A 1U6ZA 1FE0A 5T14A 2KHDA 3IBWA 2BZ2A 2MYFA 2VV5A 3CCMS 5ETQA 2BJ9A 2VB6A 5G0RB 2DGTA 2E1PA 5CABA 2ZWOA 4X4OA 4B3SF 1N36J 4G6VB 4K4VA 3TA2A 1VC0A 3M8PA 3T1HJ 3I4PA 1H38A 5L46A 2KYZA 2QGFB 3DRRA 4L3NA 4ZP6A 1OYDA 2JVOA 2GX8A 2Y3YA 3FSYA 1YJNS 3JSMB 1PSDA 2UV8A 2HQFA 1QUVA 1Z4UA 2V2ZA 4UZBA 1Y5IB 3QLHB 4UOHA 5I3QA 2FGCA 4IG0B 3I31A 4DQSA 2QYCA 2R7WA 1AUSL 1HNWF 3TQEA 2YWHA 3UDVA 1CJKB 1VBKA 1M5OC 3MFIA 2KFNA 2K1RA 4H4MB 2Q66A 3HF5A 2CNOB 5KG3A 3BS9A 3K5MA 1YHQS 1BXNA 4ANCA 1BGXT 2DGXA 4B3RF 3I4HX 2RVJA 4M5IA 2CPIA 4WBFA 3WZ0A 3AJ2A 4DG1B 1VLYA 3TUIC 1UFWA 1N54B 1NSPA 1XMQJ 5HMWA 3DU6A 4YOEA 2U1AA 3LP0A 2XMMA 3IWXA 1QVFR 4DR7F 3G86A 1DFDA 1ZM2A 1FRIA 3UDLA 3AXKA 3DOKA 4TLQA 4O3OA 3IWNC 1U0HA 2HGLA 2UUTA 2X1FA 5D0HA 1W2BR 4DL7A 5DM7Q 3ZTQA 1BD6A 4EGLA 4ZVGA 4RNMA 4O3SA 5JVGQ 1TKZA 4FKYA 2FY1A 1RA7A 3S1TA 3RBZA 3EJMA 2HNZB 4P72A 1MWQA 1N6QA 2EBGA 1YJRA 1HPZA 5DLGA 1YIJS 2N82B 4NLUA 5D4NA 3RB0A 4LRCA 2R3VA 4ZVSB 3BGLA 3FRYA 5B7WA 3G8QA 1KQKA 1NUEA 1WWHA 1T9WA 3ZTPA 3PG9A 2WSEC 2PA3A 3JTPA 1X8DA 1FD8A 1UW9A 2BW7A 3UCZP 2OJ3A 4EBDA 3HHLC 2VFUA 3C2PA 3LOUA 5LM7E 1MMLA 4ZVEA 4PWDA 4A4JA 2QV6A 4E98A 2O1PA 3FEXB 3KLEA 4ZKAA 4D3GA 3D3BJ 4DSKA 1RK8A 4ATNA 3SSQA 3ELHA 3LP2A 2DITA 2PMZD 2ZE2B 3HVWA 4TU7A 1A9NB 4MKBA 2ALYB 8RUCA 3KFWX 1RWOB 4PAAA 1GMUA 1UAWA 3X1LB 2DEIA 2CA9A 1R43A 1RBLA 4WE1A 5E3CA 2ASDA 1ZS6A 2GNKA 3DM2A 2PEHA 3PRVA 2ZBRA 3Q23A 2BQUA 1HR0F 2MQMA 4PWWA 4ZJOA 3CCRS 1WJ9A 2CJQA 1FI4A 2ZBPA 4WPAA 3QWUA 1XJWB 2W2PP 2AD9A 2DGQA 3D0GE 2MHEA 4DFJA 3PNIA 3R5JB 3BO3A 5HLFA 5L1LA 3OL8A 1TL1B 3MEDA 2W9BA 2FJBB 2MEWA 2OMOA 3MAQA 4DQRA 3DLJA 3MM9B 4ICLB 2QRRA 3N28A 3TJAA 2FIUA 5EGYA 3RUBL 2GMJA 4CP5A 3QFWA 5D4OA 1YSJA 2XEXA 5IM0B 4JI7J 3P6YC 2RUSA 1FRXA 3M32A 1M90T 5IQ6A 1ZA2B 5KFLA 3IM9A 1Q86T 1FXLA 4IYQA 1ZOTA 4K7QA 5HJYA 4KO0A 1OQ3A 3UD3P 5KFTA 5C5JA 4Y2CA 2R7XA 4MAKA 3CCUS 3RRKA 1XNRJ 4N7TA 2F4VF 1EETA 4OZ0A 1VQ8S 2VPYB 2AJ4A 2FPHX 1P27B 2W9CA 2YNGA 2NS1B 3EGWB 3HSGA 3FBFA 3W8GA 1YK9A 3A1YG 1S6QA 4XPEA 4C8OA 3MWBA 4GKKF 1VBYA 1JJHA 2QO3A 3OR2B 1RT2B 4DZ6A 1NDCA 2ZOMA 2XWYA 1R8CA 2IC3B 3SCJE 2DNYA 4RW7A 4V19X 3KG4A 2GVZA 1OIAA 1XC9A 2C42A 3SFUA 5L1KA 2CQ4A 4ES3A 4USJC 1JB0C 5J2QA 1SJRA 2HBRB 1MMDA 1Y3KA 2V8VA 1HBNA 2R7RA 3P8BB 2HQGA 3CPWR 1WOOA 1D3WA 1U1MA 5DLFA 5HATA 4H4OB 1YBUA 5DG9A 3TZYA 4YDDB 3FCWA 3IA0A 5C2CA 5KFQA 2RRAA 1HYSA 4P52A 2LXFA 3D6HB 3MM5B 3OTDA 3LWMA 4NCBA 2GW8A 5DG8A 3IRXB 1CJTB 3DGPB 3MMJA 1VQ6S 2V0NA 5LMUJ 3OJUA 4P2FA 1XR5A 4F67A 5ETOA 1F5CA 1KQGB 3IR5B 3BV8A 3L9ZA 1C2PA 4I4BA 2D1CA 2VQEF 1C1BB 2ZH6A 3VGUA 1EKRA 2HKEA 1LW2A 3KK2B 3V6JA 4WCEQ 4AD6A 2LQ8A 2XWXA 5CYQB 1NPPA 2ZC3A 4AT1B 1VRTA 3GIJA 4CH7A 1TKTB 4L6V3 2HHUA 3TARA 2JDJA 3FSXA 4B3SJ 1N52B 2YNFA 2ZC4A 3HFKA 1GTEA 4B3OA 1IBMF 2HHHJ 3EGNA 1HWLA 2BJDA 3RB3A 3J80U 3T3FA 1JLAA 5FIIA 1TU0B 4LRBA 4EWTA 2EXUA 4LBPA 1WEYA 3K0JA 2MKKA 2GJ2A 2JRSA 4ANDA 1UPMB 4OLPA 3TYTA 2GO9A 3KG0A 3DLEA 3R5CA 1PJ6A 4UQTA 2HHPA 3EVWA 2QFIA 2OSQA 3LPYA 1HNWJ 1NB7A 4CO4A 1VHFA 2CQCA 2XCPA 4P2XA 5C24A 3OR1B 3OSNA 2IY5B 2GVDB 1NB2A 4N41A 4DL0C 3P5BP 3QGIA 2W8LA 3FMBA 2ZUGA 3GG1A 1HARA 2GS8A 3N6LA 1UP1A 3BZQA 1BY9A 2XHCA 4S0MA 3Q8YA 2XQCA 2L9WA 1HBMB 1NPRA 4FYXB 2UVRA 1HBOB 4ZVOB 2D74B 2A2DA 2CQBA 4YB5A 3S7RA 1T3OA 1PIEA 3G6ES 2BX6A 3UNYA 3AODA 5IQQA 1VGYA 1HHSA 1EKSA 3E8OA 1NSKL 4GKJF 3NS5A 2LA6A 3KMSA 3CJRA 5LSRA 2MZJA 3C6UB 3IBCB 4Y6IA 2OPPB 2WHOA 4M5HA 2KHCA 1CS4A 2GHWA 2E9TA 3ZZZA 3VAIA 1UTAA 3QAEA 5GADI 3BQ2A 1N34J 3ZNUA 4NLVA 4B3TF 4ZVQB 2M3DA 3L4BC 2XYPB 3KHGA 2G0IA 4JV0A 4WIQA 2OD4A 2AJ0A 3CD0A 2R7OA 1S76D 2WCXA 2PI5A 3WX8A 4DPYA 3BGRA 2EC0A 4HDHA 4C8NA 4OYAA 3AFGA 2HFUA 3PCOB 3G9CA 4USMA 3J7AN 2JLGA 2EEYA 5A0YA 4AQYJ 3N6MA 4WP9A 3CCES 3BO4A 1ICEB 2QN6B 2UVWA 3MM8A 3R5DA 4WZMA 2XM3A 1JLBA 1UVIA 4PQUB 2M70A 3BDPA 5D78A 3WX4A 4F4KA 2XGQA 4UQGA 2QMXA 4O4GB 3D67A 3DI6A 2J9DA 2J0QD 4CYUB 5AT1B 1M1HA 2R8JA 3PEJA 3MEEA 3NWGA 3KWMA 4K2JA 3Q22A 2HLUA 3KJFB 5C42B 5KFZA 1EZZB 2HS3A 1NK9A 3HPOA 2AWZA 1NSQA 4C0BA 2U2FA 4WU3A 3PW4A 3KG1A 2KRRA 4YR0A 4ZIVA 3UPFA 1ZAXA 2E5HA 4J9MA 2JWNA 2VASA 2E1RA 3M2VA 1N88A 1X4HA 5B0AA 5GVQA 4WTOB 1FJGJ 4NE9C 1S0NA 5AXLA 2KI2A 2R7VA 4ILLA 1NJYA 1FWPA 3UD4P 3FJ2A 3KMQA 5KT6A 3MR6A 5KFHA 1JXLA 4NMLA 2CXEA 1DZ5A 2EVZA 2D9OA 3NS6A 3GIMA 4DR1F 4BCAA 3ZZYA 4X62F 2YNHB 3P5TL 3MXHP 3IM8A 1YJ9S 2UZAA 1Y10A 2FLOA 2VDHA 2VFVA 1WKJA 1FRJA 4JI3F 1S6OA 4DL3A 1URNA 1YRXA 2MMYA 3Q89A 2J6TA 2OTJS 4NEYA 4ENOA 1PYOB 4JI4F 3UI3A 2K06A 1VK3A 1B0TA 2LEPA 1S5ZA 4U7UK 3PTWA 2W25A 1FK9B 2VG5A 2ZD1A 4MYUA 4HHUA 3KDNA 4A8OA 1RXOB 1S49A 4LIRA 2M8DB 1LNQA 2DIUA 3PY8A 3MEGA 2V2KA 3ONQA 2H4YB 3QZ7A 3T5JA 3MTKA 2WVFA 2F4VJ 4LFAF 2XNQA 3DRRB 3OFHA 2M9KA 2OMLA 2HVIA 3V4MA 4OZ5A 3WC0A 3M2RA 2UUBF 3GU0A 2LFVA 2CPDA 1S6UA 3E3XA 4FBUA 1VQPS 5SUHA 3VV2B 3WHIA 2R9LA 3UW1A 1N5QA 3Q8VA 1QY7A 1CJUB 1Q8KA 5HO4A 5L9XA 5BYQA 2OEKA 2K1RB 2CAJA 5A8RA 4C6AA 3OTEA 2M5YA 4ED4A 1SC6A 3QO9B 2ZVIA 3K5LA 2DVIA 4NPOA 3SMZA 4PWUA 1CBKA 4N77A 2QFJA 3M4XA 1ZH5A 2KG0A 4QWDA 2QE5A 5E5NA 3M8YA 3IFEA 2J7UA 3CCTA 1XK8A 3LP0B 2RDDA 2CVEA 2DJWA 1FWKA 1K8AT 3BGUA 3KLFA 2AGPA 3DOKB 2AQ4A 5LXYA 2KT3A 4RBVA 1U0HB 5KG6A 1OY9A 1C0UA 1VK8A 2YWWA 1VOMA 3DLBA 5C2GA 4ZPWR 3BDEA 4DF8A 1WD6A 4M95A 3CE8A 4O44A 4YY3F 5KFPA 4QIVA 1UETA 3DDNA 4OZ3A 1VFJA 3GJSB 3D28A 3P4UB 2FGOA 1CQNA 4PG4A 1TKZB 2V34A 2WRMA 2VQEJ 4JV5F 3D6MB 1N5VA 4LF2A 5BR8J 1FDAA 3NNHA 1NJIT 1N6QB 5GAGI 2DT9A 5HVGA 3FSIA 2P9CA 3GV7B 1JLFB 4AL6A 1U8SA 1HPZB 1RTJA 1S57A 4LBIA 3IO1A 3TR5A 3B78A 3WQPA 4R8UA 4DDFA 4LR8A 3KLGA 4HVZA 2E7VA 2CQIA 4W92B 3GSDA 3JAMY 2G0JA 3O8WA 1IBMJ 1MROB 3TZZA 2A1BA 4USKA 3CD5A 1F60B 2E9ZA 5L8RC 1NRKA 5KTQA 2BQRA 1XQIA 4XDDA 2RHQB 2NREA 4KH0B 4Z7YA 3KLEB 2ZHAA 4X4PA 3DN9A 2R7UA 1FRKA 3CIZA 2KM8C 3M7VA 3MPDA 5A2QU 4JI1J 3SEOA 2CUYA 2UU9F 3LP2B 1GMVA 2DRAA 4BHQA 2D3O1 2AEMA 4OX9J 1ZAWA 1AYEA 4TN2A 1E6YA 4DR6F 3GJRB 3C15A 2JEIA 4N56A 6FDRA 4OV6A 4UY8T 2C2ZB 2BJ3A 2NLWA 1SJ1A 3VGSA 4WE1B 5ETLA 3QFHA 1HWUA 3DM2B 1S1XA 1NHVA 4UOFA 5D4LA 4Q0BA 2CWKA 4CLSA 1FKOA 1BLUA 1IJEB 2BOPA 5J2MA 1ZPWX 4LFBJ 5HMZA 3BBCA 3VHQA 1DTQA 9ATCB 3CC4S 3H25A 1Y9OA 3H2UB 5HLFB 4DSJA 2XLJA 3IMQJ 3T5LA 2W9BB 2Y1RI 1TAUA 1FDNA 5B0EA 4IRDA 1H7WA 4ECSA 1M5PC 2DRBA 2FB0A 5FDLA 2AGQA 1Q4RA 3MR5A 1L3VA 5LSLA 1YZ6A 1VQMS 1VIOA 1LV5A 3MEKA 1HQEA 4OHXA 2XMJA 3CO9A 3LW5C 3M32B 3JQMA 2Q79A 2FD2A 1LFPA 2BYCA 3RW7A 1LW0A 1KFSA 4KO0B 3TAPA 2HHTA 1ZA1B 3PYFA 5F0UA 3TAMA 1UVKA 5ETNA 4KAIA 4JYAJ 1CPZA 3JTOA 1B7FA 2YWKA 1FXRA 2WB4A 1PAUB 2CQ2A 1NKBA 3THVA 2RIJA 2W9CB 2YNGB 2ZM6F 4CTAA 4X4NA 4WIIA 3D2WA 5HJXA 3W61A 2CDRB 1S6QB 3OD2A 4DX5A 1FD2A 3HZEA 1SQFA 1N32F 5AJ3F 1AB8A 2AEJA 3MMCA 3O5TB 2B6AA 3B6BA 1S9EA 2VA3A 1DQ8A 5A8KA 2WVDA 4DPXA 1KC8T 1VQ7S 2GQQA 1X4BA 1D9DA 1LOUA 4DFPA 2DR9A 4MK8A 1R3NA 2YKOA 4ZIWA 2XY7A 1TR0A 4RW7B 3C6TA 2HWIA 3QIDA 1N5YA 1CJVA 1LXJA 4A8MP 3MURP 4C9DA 2R2TA 1AXQA 1ZM9A 1HD1A 2GAGC 2MKHA 5J2QB 3CTRA 3M6WA 2UXBJ 4RWWA 4NA1A 1FEEA 3FBCA 4B9LA 5KFRA 1HBNB 3M6XA 4LF1A 3K7RA 2MZSA 2AHOB 2H5EA 3QQCD 2BKPA 3K8WA 1HIYA 4PABA 1S6PA 2AYBA 2YKQA 1IUJA 2JFKA 3BH6B 4FDFA 4USUA 4U7CA 4R0EA 1HYSB 3A8EA 2BACA 4QIFA 4OHVA 5KT5A 1B70B 2EC2A 3EVMA 3HJFA 4NWBA 4O3QA 1X9MA 3CT9A 4DV1F 2PN6A 1PGZA 2BQ3A 1VC6A 3A3OB 1TZ0A 3GCWP 3P3DA 2FY8A 2LQ9A 3RB4A 4JI3J 2VBYA 4NLDA 4AXIA 5DRKA 1F9EB 2QT7A 2UUAJ 3VTIA 3W5XA 2CPYA 2PMWA 3TA0A 3GZ7A 1LW2B 4RX6A 4FBTA 4OHYA 1NCLA 1HQUB 3DMJA 4DQIA 3RBXA 4DV2F 4NXNJ 1JXEA 2EK1A 3EPIA 1VRTB 4HHJA 4ED5A 1K44A 1NLKL 4MIBA 2YNFB 1DY3A 1APSA 1T0TV 2LU2A 1PJ5A 3DC2A 4DPOA 3OXLA 2AV5A 2I2YA 3A13A 1RWPB 1G7CB 2XYGB 1JLAB 2VQFF 5EWFA 5BJRA 3LA0A 1UJ5A 1CSJA 3PO5A 4LVOP 3IC1A 1N5TA 4U7UD 2FZCB 3U02A 3BKUA 1GXTA 4O0NA 3TP2A 2QSWA 3PKYA 2VBZA 1N5SA 1GMWA 3U1LA 2C2OB 2VPXB 4GVBA 1EJ7L 4LIWA 5C24B 3H20A 3FEYB 4F4WA 1PG5B 3EDRB 4HYKA 1B0VA 1NJZA 4FS1A 2QL5B 2AYGA 1XR7A 2ACMA 4M5MA 2KO1A 2FHOB 4LF6F 1C4AA 3AD9C 3NNCA 3GR1A 4B9VA 1YGYA 4PG6A 1QTNB 2DHXA 5AE1A 2RHSB 5T7LA 3GV8B 1ITPA 4QIGA 4WWSA 3QRRA 1B99A 2QLXA 4F4ZA 4IOCQ 3O3LA 4ZCKA 5CAAA 3VR1A 4TU9A 2C28A 3V6DA 1B3TA 2PO4A 4EBCA 1AW0A 2X1AA 3H40A 2AYEA 3K17A 2C2MB 2R8KA 2AX0A 4PZVA 1S72S 2X3GA 3SDEA 4FXDA 5H9FK 4DV4F 3W2VA 4OZ2A 1CS4B 4G3IA 2H48B 2Y0SD 3PYDA 4CLTA 1KONA 2ROGA 3KUEA 4OIXA 4K4YA 1IQTA 3HK2A 1ACMB 1YLXA 3DU5A 4IFYA 3CJ4A 2DHGA 4CCHA 1BWEA 2Y8YA 4Z37A 2ZJQQ 3BGRB 3OLAA 1T9UA 1URRA 4TY8A 4OJ1A 3PIOQ 2B9XA 2XS7A 2ZBQA 2XCAA 2UXCJ 5DM6Q 3OHAA 1R8BA 5A0YB 3OW2R 2HGNA 2W2QP 5LL6d 2MKYA 1N4LA 1FF2A 5H9FJ 5F9LA 3MM8B 4Q45A 1JLBB 4DEZA 3NP5A 3OXFA 3JSBA 3I9V9 3NNAA 1N0VC 1U02A 1FVSA 4OZ1A 2F9DA 3OQ2A 5A76A 3MEEB 2UU9J 4QWCA 2CRLA 4IG0A 2CPHA 1UJ6A 2WB1D 1FRMA 3L95X 1UL3A 1EQ0A 5A6WA 5LJ5Y 3U27A 4TU8A 3CDAA 3M2VB 2RS2A 4RJVA 3KUGA 2FJWA 4ED1A 2B9WA 1YJVA 4Q2LA 2BJ1A 4OX6A 2RUGA 1U2FA 2H51B 1NK5A 3G4SS 3IAS9 3PVXA 1K0TA 1UA1A 4RW9A 2PT0A 2J9CA 1PKUA 3QGHA 1FWLA 1RB0A 2BKOA 3UD5A 4UF4A 4X64F 4NMXA 4TLRA 1AT1B 4U96A 4V1Ak 2XMKA 2WW8A 3RJMB 3AOAA 1RT3A 3LTOA 4LJMA 1QSYA 1WELA 3IWLA 3CNQP 2VIHA 4ZN1A 2ROEA 1RACB 1XNQJ 2KVQE 2W1BA 2E7WA 4FYYB 1PC4A 1IBKJ 4EFAC 1QM9A 4FN5A 4PG8A 4NX9A 1OSDA 1SC3B 2EFNA 2I5JB 1RT1A 4OYBA 2V8HA 4BWJA 2DHSA 2VG5B 2ZD1B 1HFEL 2B7CB 5B0BA 4IRKA 3IGNA 2OHDA 2B9YA 1FNXH 1YX2A 2ZH3A 2HVZA 3MEGB 1VQYA 1FJ7A 1NSAA 4DUZF 2CADA 2J0XA 1EIYB 3RAMA 2A2CA 2FLNA 4KT0C 5F8NA 1LWEA 1S99A 4YR2A 5J1EA 2DNQA 2J9DE 3H4BA 4CNZA 2RSQA 4IH7A 3M2RB 4DR2J 4K5RA 5M2RA 3GIKA 2WSCC 4GC6A 1FFSB 1N32J 5EN1A 1H74A 4Q8FA 4X65F 2HQCA 3AY0A 2KXFA 2DNZA 2HHVA 1I94J 3CGIA 2PSZA 4NA2A 3HVRA 2HS0A 3C3LA 1VDHA 3UN5A 4JI5J 4BC7A 3FCHA 4J9RA 4ECXA 2ZOGA 3CJ5A 5A8RB 2ZE2A 4YN3B 1EARA 3PFEA 5F8IA 3HVAA 4OX7A 4MK9A 3I5BA 3N0VA 3J7A1 2YPZA 3BB5A 2MY8A 2MKJA 2XO6A 4WXWA 1WSRA 1NXIA 2HHXA 2QTWA 2O01C 2DCUB 1Q79A 4FF1A 3M8WA 4I1TA 3OTOJ 4QW8A 2B8PA 1X31C 3L7OA 4GO5X 4YHHJ 3QATA 1EHWA 1PBAA 3Q83A 2P6TA 3UN2A 1C0UB 2FHJD 3GR0A 2L41A 3HHKA 3GONA 4ZP9A 1AZSA 4WP8A 4DSLA 4RWXA 4O44B 4MIWA 1TL1A 2OP5A 3AQPA 5M2PA 2PD1A 4NLSA 4DBQA 3SCIE 3FEZA 2KJVA 3JQJA 3QYYA 2OO4A 4Y2AA 4C4WA 1WC3A 4J9OA 3IRWP 1T9XA 3VCDA 4DSFA 1RSCA 1RTJB 4WYLA 4I7FA 1S9FA 4JI0J 2HQDA 4OYZA 4KFBA 4OLOA 2ZVSA 2FHMA 2B3TB 3DKDA 3PACA 3KK3B 1UEKA 5GMDA 3V2UC 4KV8A 3T1AA 4FYWB 3KLGB 5IFMA 1T8EA 1S7HA 4C8YA 5FLXU 3JS9A 1SI9A 2DR7A 2B4PA 2HNYA 1DQAA 1BE4A 2GFFA 3A8IA 1S9GA 3I55S 3ZXWA 1YBTA 4W98A 4NLGA 2WK4A 2MQQA 2JLFA 4CH1A 2VHGA 1RBAA 1UKUA 2V63A 3PX0A 1C4CA 1WORA 1HQ2A 1E6YB 3OL6A 1F5BA 1BQXA 1FXDA 4ZDNA 3GYXB 4NI2A 3C15B 3WBZA 1UEUA 4KGXB 3ISZA 2HBYB 3HHLA 3QT6A 2XSJA 4X66F 4OYWA 3NGUA 1VQOS 4QPXA 4JV1A 1RAHB 2ZH4A 3SYZA 3U1NA 4MYTA 4EZ6A 1HNVA 4Q0BB 4NOHA 1VIXA 4JI2F 3ZZ0A 1FKOB 1Q81T 1NK0A 2HWTA 4DSEA 5J2MB 3AJDA 2ERRA 4FZVA 1LXNA 1RTHA 1MU2A 3UWTA 2P9EA 2YWFA 1DTQB 3QRPA 2GIFA 1QAJA 4RBUA 3M6VA 1YWXA 2YNIA 5IWAJ 1WC6A 4DR4F 5I42A 1Y3JA 2KFZA 4F0KA 4ZP7A 1KBRA 2V4JA 1IM4A 2ASLA 1M1GA 3HXMA
chains in the Genus database with same CATH topology
2CQCA 2BA9A 2XCPA 3CSKA 2VUGA 3L7PA 4NLQA 1KHVA 5C24A 2J8AA 2ZKUA 3OR1B 4ZS6A 2IAJB 2N4DA 3OSNA 2PE8A 1RT5B 4Y34A 5E3QA 1WF2A 4N41A 1IKWA 3E51A 2HRYA 4DL0C 1U26A 1L5UA 2F9JA 3J81Y 3OVSA 2CG4A 3DNCA 3QGIA 3FMBA 2W8LA 5G0RA 4K4WA 2C3OA 4DS4A 2ZUGA 5DQIA 3GG1A 1HARA 2CPEA 4NZ0A 3MAHA 1A7GE 3V81B 3N6LA 4MKYA 1UP1A 1HQEB 3DOMA 2DPIA 3BZQA 1BY9A 4F25A 1FRLA 1X4FA 2OPRA 2NUHA 3PW0A 2Q6BA 2L9WA 4YR3A 2XC9A 3CXCR 2IVYA 2IYIA 3MHYA 1HBMB 1LW0B 3OFFA 3UR0A 3D1HA 4JBCA 1ZTTA 1SJQA 4M8LA 2AJ1A 2OAUA 2VONA 1BQNB 4CO0A 2UVRA 3OTBA 1TV6B 3ZZTA 3NCPA 1U24A 3I9ZA 4EO6A 1CLFA 1HBOB 1RT6A 2A3JA 3JSMA 3TAMB 3DI6B 2LU1A 1SKSA 4A8WA 2D74B 1WNEA 2L08A 4G1PA 2A2DA 2CQBA 1ZETA 2IBKA 2GGPA 2E5GA 5F9NA 2LMIA 5LMNF 1N34F 3QLHA 1RKJA 4KHMA 4YB5A 1U1KA 4URSA 2E66A 1T3OA 3S7RA 3DLGB 5KFEA 4XO0A 1YVFA 3G6ES 3QJLA 2DB1A 2RNEA 5IQQA 1YI2S 1VGYA 2RE1A 1HHSA 2K7KA 4A48A 2XLIA 4ECZA 1JNRB 4DL4A 3IN5A 1AROP 4NCGB 4RUCA 3MMBB 2OIHA 3E8OA 2VH7A 1VMBA 1WHXA 4K4XA 3H5YA 1OWXA 2W4PA 3NS5A 4GKJF 4CTAB 1HMVA 2LA6A 1YQHA 3KMSA 5LSRA 2UUCF 2MZJA 4R0JA 1FKPA 3C6UB 3NG8A 4Y6IA 2OPPB 4KRWA 4ZPTR 2VL1A 4E0DA 2WHOA 2KHCA 2B4VA 2YKNB 4NLPA 3I56S 4ZCMA 1SXLA 2GHWA 2P9GA 3SZ2A 4H4MA 2DNHA 2J0WA 4DV6F 1T05A 3MMCB 3MPYA 2B6AB 2DNOA 2E9TA 4ZOSA 3AJ1A 3ZZZA 1S9EB 3VAIA 3CC2S 2C3UA 1DBDA 3QAEA 4WF9Q 1VC5A 5K8MA 5GADI 3BQ2A 4AQYF 1XWLA 5AE2A 2XS2A 3T5HA 4U67Q 5H1SV 2MZRA 4RNNA 3B8HA 2K2PA 4NLVA 3R27A 4CNYA 4B3TF 2M3DA 4E8UA 3KHGA 4OHWA 4JV0A 2EFOA 1VS3A 1HW9A 4DG1A 1J5OA 2J7KA 2D3UA 4IR1A 2ABYA 4QJVA 4AL5A 2OD4A 4NRTA 3NMRA 2AJ0A 1N5YB 3PX6A 5ADZA 3CD0A 2ZJRQ 2R7OA 1S76D 2FVCA 2CKWA 2M7SA 2WCXA 2ILZA 5KOWA 2MQLA 2PI5A 2DR8A 2YTCA 1RAJA 3CMES 3BGRA 2EC0A 4HDHA 4WFYA 1DLOB 3Q2SC 3BSAA 3BQ1A 5A2QY 2EK6A 4LQ9A 3PJWA 1PGZA 4C8NA 1UWBA 3DRYA 4RNFA 3OR1A 4I68A 2K7JA 2F4VF 4M94A 1NJWA 2J6UA 1XBWA 3G9CA 1WACA 3US5A 1HA1A 3D0HE 4HDGA 1T03A 2JLGA 5A0YA 1UJ4A 2D3ZA 4BBYA 3N6MA 1FNMA 4QPTA 2HZCA 3POTB 3CCES 2KTQA 4ECTA 3CMAS 3BO4A 2ZZMA 1RQ0A 1Y5LB 3PO4A 2YX1A 2UVWA 4A8YA 1G6BA 3JYTA 2GHPA 3MM8A 3R5DA 4WZMA 3QIPA 1JLBA 1UVIA 2J9EA 5E33A 4PQUB 3I96A 2Q6CA 4LSLB 2M70A 3B82A 3CUNA 1ZM3A 2O67A 3BDPA 1SKRA 1FTRA 5HBMA 5D78A 1D9FA 3WX4A 2APOA 3GYNA 4ELTA 2DIVA 1NO8A 4F4KA 1ZBTA 4QZVB 2XGQA 5DG7A 4UQGA 2QMXA 3AAWB 4O4GB 2YKMB 3DRSB 2LXIA 3UFCX 2VA2A 3NKYA 4Q43A 3DLKB 3DI6A 4F3OA 2ASYA 2J9DA 2J0QD 2B56A 1V9OA 1O51A 2L3MA 1YJWS 4DSIA 1FJGF 1QAIA 5LT5A 2HNZA 3ZZRA 2R8JA 2RF2B 3MEEA 3PEJA 1XMOF 3NWGA 1E6VB 3VZIA 3KWMA 2C2EA 3Q22A 1VQ5S 2EG1A 2HLUA 4KSEB 4I2PA 4ZP8A 1XTZA 5C42B 5KFZA 2M4MA 2HS3A 3IR6B 4M5DA 4QWEA 1NK9A 3HPOA 1B64A 2AWZA 4NLXA 4C97A 4ZVFA 4C0BA 4ED0A 2U2FA 3J7ZT 3OSPA 2NXUA 2KN4A 4WU3A 5F3ZA 2A10A 3PW4A 1RYRA 5IT9Y 3HHLD 3KG1A 3S6EA 1K1QA 2NQPA 2KRRA 4PUOA 2WONA 4YR0A 2DR5A 2N7YA 3UPFA 1HL6A 2YWEA 1L3SA 1ZAXA 2E5HA 3KNGA 4J9MA 4DR5F 4DL6A 2KZZA 2JWNA 2FVRA 2VASA 3C66A 1FVQA 1V3RA 2DGVA 2E1RA 3M2VA 1N88A 2D9PA 1X4HA 5B0AA 2IRXA 2ASJA 4IG3A 1A6LA 1M5VC 4U6PA 2HYIB 5GVQA 3LP1B 1D8YA 3B4DA 3LUYA 1S1VB 4ZPAA 4K2XA 2XMWA 4WFNQ 1S0NA 2RKIA 2KYXA 4CT8A 2DPJA 2XBPA 1NKCA 1LWCA 5AXLA 3LQVA 1WHVA 4B17A 1IKVA 2KI2A 3Q8RB 3V6HA 2R7VA 3MUTP 3CJKB 1BQMA 4ILLA 4DLGA 1NJYA 4DHVA 4P2SA 2CQGA 3UD4P 3FJ2A 5EHHA 3KMQA 5KT6A 3MR6A 3OL9A 3H5SA 3HZGA 2DO0A 1B0PA 5KFHA 5GADU 1D1UA 1JXLA 3J7Z5 1DURA 2BABA 4NMLA 5KG1A 1DZ5A 2EVZA 2D9OA 1IKXA 5CCLA 3NS6A 3KK1A 4J9NA 4WFZA 4QYRA 3GIMA 4DL5A 2KM8B 4X84A 5CH7B 3MPWA 4BCAA 4DR1F 3ZZYA 2BRLA 1ZYQA 4X62F 2YNHB 2C3MA 3P5TL 2JHEA 3VZHA 3MXHP 2XLKA 1L3KA 2FVPA 2MQOA 4KPYA 1QVGR 2YKAA 5K14A 4OI0A 1MNEA 2C3YA 4DQQA 3K57A 2KU7A 1TK5A 4UW2A 4AL7A 3DFEA 1YJ9S 4C11A 2UZAA 2FLOA 5KFUA 4ZPVR 4ECYA 2VFVA 4RU2A 4F26A 2FTRA 1FRJA 2MZTA 1LWFB 2OFHX 2LCWA 3EXYA 4EYIB 4JI3F 2QA1A 1S6OA 4DL3A 3R1HA 1URNA 1RT7A 4KGKA 2ZZNA 2MGZB 1YRXA 2MMYA 3KYLA 2J6TA 2YH1A 4LSLA 2OTJS 2C22A 1CG2A 5KFMA 3NL0A 4JI4F 2E7XA 3UI3A 1HBUB 2JEJA 1ZAVA 2ZBIA 1VK3A 1WEXA 4TNOA 1B0TA 2AU0A 2LEPA 2B0GA 1TL4A 2WOMA 1SIWB 3IS9A 4XAKA 4U7UK 4RW6A 2KJWA 4ES1A 4DUYF 2W25A 1FK9B 3F44A 3DLKA 2HFNA 3MOZA 5L38A 1GNKA 1HNXF 2VG5A 2ZD1A 2GIRA 4MYUA 3M8RA 5D77A 4I6YA 5A8WB 2R4FA 3DYAB 1TAQA 4A8OA 4Z2XA 1S49A 4LIRA 3OJSA 3TW0A 2M8DB 2MZ1A 3TX8A 3CJ2A 3CD7A 1P6TA 3OL7A 2D41A 2DIUA 3KLFB 1L3UA 3PY8A 1CQMA 1SJFA 3OVBA 1OSCA 1KOOA 3MEGA 4NLRA 2V2KA 1K1SA 2E1MC 2R2SA 1NK8A 4O3PA 4G1QA 4O0IA 3ONQA 3OHBA 2XS5A 2EG2A 4WJBA 3QZ7A 5MAOA 3T5JA 4O3NA 1IR0A 1VJWA 3MTKA 2ZKTA 2IJNA 4P7TA 3HI9A 2CQ3A 5L1JA 4LFAF 3OUYB 2XNQA 2XG8A 3R5AA 2UVVA 2QIFA 3DRRB 4USHA 5IT0A 4Y00A 3ITHA 1X5PA 3M1VB 4ECRA 5KFIA 2RB7A 3OFHA 2M9KA 4Y3CA 4NYPA 4CIOA 2OMLA 2HVIA 2KFYA 4LFCF 1PC5A 3V4MA 3LP1A 4OZ5A 3RZAA 5J2NA 4LF9F 1S1VA 1SBRA 2QSFA 2UUWA 5CQGA 3WC0A 3M2RA 5T7LB 1RT4A 2UUBF 4C8LA 2LKZA 2AJQA 3MM9A 4ICLA 1TFYA 2CPDA 2DGSA 1S6UA 5IZHA 3E3XA 1M5KC 1LKZA 3K5NA 2HHQA 1I6JA 4FBUA 5KFOA 3O2IA 4ED3A 1VQPS 2Z0GA 2JEFA 3S8SA 2ZFHA 1Y7PA 4NCAA 3V6DB 5SUHA 4X4RA 4FF4A 4F3QA 5FD1A 1ZZFA 2F40A 2PIIA 5IM0A 3Q8QB 4IQXA 4ES2A 3VF0B 2R9LA 4KB7A 3UW1A 1N5QA 2X1BA 3KHRA 4IO1A 1WG4A 4AYBD 1TP7A 1QY7A 4NZ7A 2RRNA 3SDEB 2FLPA 2HFZA 3H2VE 5HO4A 5L9XA 3W2VB 2VD3A 3K8VA 2B7BB 4KKOB 1WTFA 5BYQA 2HIQA 3RRHA 2K1RB 1VQ9S 3I5AA 5A8RA 1GTHA 4R8UB 1L3TA 2IA6A 1U1OA 3HX9A 4C3KA 1OPIA 3OTEA 2M5YA 3Q24A 3MOJB 1RA6A 5B0GA 1XR6A 2AW0A 1KLNA 2IM2A 1LK7A 3OXGA 2MY7A 1R6YA 1SC6A 1OS5A 2N7CA 3QO9B 5L9NA 3K5LA 3HHNB 2DVIA 4NPOA 1RWUA 3T6JA 3SMZA 4PWUA 3HDSA 2OD6A 4IFYB 4X4VA 2EBEA 2F1FA 4N77A 4QR1A 1SH3A 1VRUB 4TY9A 4Y2KA 1WF1A 2QFJA 4ZCIA 3ENQA 3JSRA 4OZLA 5BYSA 2NYIA 3GB0A 3M4XA 3M9OB 1ZH5A 1JKHB 2IBOA 2KG0A 4QWDA 2L9DA 1ULRA 2EKYA 5HP1B 2KDOA 2QE5A 5E5NA 3IFEA 2J7UA 4JOUA 3CCTA 1XK8A 5HROB 1R0AA 3LP0B 2MKSA 3CCQS 3GILA 5THWA 5DETA 2CVEA 3AB4B 3UDCA 5A8WA 1H3DA 1IXKA 2CYYA 3PV8A 4TY8B 2DJWA 3ISND 1SQEA 3PX4A 1K8AT 2P5VA 3K2YA 3BGUA 4NZ6A 5J2PA 4I6WA 1IJFB 5BR8F 2JZ5A 3O6QA 1KQFB 3KLFA 3VAGA 2AGPA 3DOKB 1H2TZ 5LXYA 2AQ4A 2KT3A 4RBVA 4MH8A 3SSRA 3OR2A 4C3MA 4F2RA 4QR0A 3CJ3A 5KG6A 1RT2A 1C0UA 1VK8A 5KFNA 4ECVA 4ETXA 1VOMA 2JC0A 3DLBA 4PQAA 1FHTA 2KKHA 1FDDA 2WBRA 1OO0B 2IC3A 3BDEA 4ZPWR 4DF8A 1TK0A 3PW5A 2F3JA 4ECUA 1WD6A 4M95A 2POKA 1RKIA 4X4TA 2X51A 2CPJA 4CH0S 4N5SA 3CE8A 1DQ9A 4O44A 4JUZA 4DN0A 4YY3F 5KFPA 1X0FA 2VG6A 4QIVA 1GQEA 1UETA 3DDNA 1TL5A 4K4ZA 4TYAA 1LFWA 3OFGA 2Y1IA 1U2RA 3BQ0A 3ENWA 1VFJA 2MHNA 4ID5A 4U9RA 3D28A 5F8MA 1RJJA 1QE1B 1YJTA 1X4CA 2XGPA 2FGOA 5DO2A 2OPQB 1GXUA 2VFTA 1CQNA 4PG4A 1TKZB 3THPA 2HQIA 3NAIA 5K8NA 1Q1KA 3ZFVA 3K5PA 1S1XB 2WRMA 3SCLE 2Q1LA 4QYZJ 4K5SA 2DH9A 3EGZA 4JV5F 3GFXA 1N5VA 2G1DA 4BWMA 4DN9A 1FDAA 4ZPDA 4P6QA 1U6FA 3I0SB 3NNHA 3BJYA 1YTYA 1NJIT 3WDOA 4ELVA 1N6QB 5DDOC 5GAGI 4N76A 1KTQA 2BM1A 2DT9A 2BV3A 4H4OA 5EX3A 1T02A 2P9CA 3FSIA 4KGMA 3VWSA 1XMQF 3GV7B 2CPFA 4I6AA 1JLFB 5D4PA 4NLYA 1U8SA 4AL6A 4LF7F 1HPZB 1RTJA 3TO8A 3MZIA 1VQSA 1Z1ZA 1DAXA 3E2EA 3IO1A 3QWPA 2D3OR 2V5HG 2I0XA 3TR5A 4DFKA 2ALZA 3B78A 3PJXA 1SUQA 1KQSR 1TKXA 2IM0A 3BF4A 2VG7B 4ELUA 3GIIA 5E7OB 2GMLA 4R8UA 3NBPB 1AFIA 4AFFA 3MCSA 4DDFA 1ZPVA 5DDPC