2RSQA

Copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
GTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper chaperone for superoxide dismutase
publication title Copper(I) loaded form of the first domain of the human copper chaperone for SOD1, CCS
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rsqA00
2RILA 1OQ3A 2OP5A 2GV1A 1X7VA 3MCSA 1N5QA 2OD4A 1IUJA 4HL9A 2XMMA 4OJHA 1SB6A 1Q8BA 1X0PA 2W4DA 3IWXA 4HI2A 3HF5A 3BN7A 1OQ6A 5B0CA 2AP6A 2ROEA 4A48A 2XMTA 2QIFA 2HFOA 5B09A 4YDXA 2OD6A 3MZIA 2BJEA 4FNIA 2AJ0A 1TZ0A 2FB0A 1YG0A 1RJJA 4OJGA 2N7YA 3E8OA 1URRA 1YJUA 3HX9A 3QGPA 4Y2KA 2GCFA 3LO3A 2K1RA 3IWLA 5KAKA 3BGUA 2ZDPA 5B0BA 2QLWA 2OFHX 1S6UA 3F44A 1LQ9A 1Y9OA 3CJKB 2LQBA 1Y3KA 2XMVA 4Q2LA 2KYZA 3KNGA 2N4DA 2HFNA 2BBEA 2BYCA 1CC8A 2L3MA 2W4PA 3HHLA 1AFJA 1KVIA 2RSQA 2HIQA 5B0DA 1Q53A 1MWZA 2K7KA 1GXUA 2Q3PA 4OJ3A 5B08A 2GA7A 5F0UA 1FE0A 1VQYA 2AJ1A 1XBWA 2BUNA 1JWWA 3HHLC 3TOQA 1YJVA 2XMWA 3LGMA 3I9ZA 2IYIA 4A4JA 1KQKA 3TNVA 5A6WA 2AW0A 2OKQA 1FESA 2GGPA 5A6PA 3HDSA 2ROGA 4OJ1A 1N5VA 1OSDA 2K7JA 1Y3JA 5T7LB 1AW0A 3HHLD 1V3ZA 2OFGX 2QLXA 1FD8A 4NL5A 3VTIA 4FNHA 2OAUA 3BF4A 2XMJA 3BM7A 1WD6A 1N5TA 4OIXA 5B0EA 3LGNA 4U9RA 1K0VA 2VV5A 4ZA1A 2LXFA 3FRYA 1P8GA 3K7RA 2VH7A 1OPZA 1AFIA 1U7LA 1YJRA 2XMUA 3HFKA 2LDIA 2LQ9A 3UDCA 2IFXA 3FMBA 3FGVA 1VQSA 2HQIA 2QYCA 1GXTA 2FHMA 3KG1A 1YRXA 1SI9A 1FEEA 2N4CA 3GZ7A 1TL4A 4NPOA 3CJKA 5IXUA 4Y2MA 3WDOA 4EFAC 4DPOA 1CPZA 4A46A 1Q8LA 2XMKA 1FVSA 1P6TA 1X8DA 2IYGA 2JDJA 2K1RB 2K2PA 2W4CA 2G9OA 3BDEA 5B0FA 1R6YA 4HH0A 3KG0A 1QUPA 1APSA 4HI1A 1YJTA 2KT2A 2GO8A 2RU9A 4YEAA 3QMQA 1SQEA 5K9FA 4Y2IA 2KKHA 2GFFA 3T9NA 2RMLA 2FTRA 1TL5A 3HHLB 1JK9B 2EW9A 4DL0C 3BB5A 2OMOA 1FE4A 1Q4RA 2ASYA 3DCAA 1TR0A 2KT3A 2BJDA 5B0AA 2HLTA 1MWYA 2ROPA 4A47A 1CC7A 4Q2MA 3TRGA 1KVJA 1Y0HA 2CRLA 4QOTA 4HH1A 5B0GA 2ZDOA 1W2IA 4DN9A 4F67A 2HLUA 2ACYA 2FIUA 1ULRA 3DXSX 5F0WA 1S6OA 3KKFA 1FVQA 5T7LA 2PD1A 4ZOSA 1N5SA 3BR8A 1TUVA 2GGPB 2PGCA
chains in the Genus database with same CATH superfamily
5KFVA 1N5QA 5THWA 4XIUA 1WHYA 4PQAA 4NA3A 2KB2A 2VFUA 3KUEA 2R9LA 2AJ0A 3I6PA 4ECRA 3DHWC 1RT2B 3SSRA 3TAMA 1Z2ZA 2DNKA 2DVIA 3LA0A 2DPJA 3W2VB 2B0GA 2L08A 4USUA 4DV4J 4D3GA 1YJ7A 3PW7A 3HK2A 3WIVA 4AL7A 3SQGB 4CI0B 3JSRA 3TOQA 1LXNA 4PWDB 4KY3A 2CQ4A 3GV5B 4E8UA 2KT5A 2P9GA 3PYDA 3GYNA 2G2YA 3OXFA 3EDQB 4P2MA 3PDNA 4WCEQ 3NOGA 1VIXA 5DQIA 1S4FA 4HTJA 2ZBQA 3KG0A 2AGQA 4DV5F 1QSSA 2HSEB 4P72A 1KFDA 3NP5A 4USMA 2HWIA 3CULA 1SQGA 4C0BA 1HW9A 2R7RA 1QLNA 4K4WA 1XIQA 2HQCA 2KRBA 4UW2A 2K3KA 4N77A 3Q8PB 3DLHA 4KHPJ 5E3AA 2R8HA 2ZOFA 2W1BA 1H74A 3JS9A 2EG2A 2MSSA 2DXEA 2VDHA 2JZ5A 3PO4A 4CH7A 3I0RA 5J2PA 3DOMB 4I4BA 4DMZA 4I69A 2RAQA 4ANDA 2B43A 3QGHA 2ZWOA 4KR0B 5I3UB 4FDFA 3UCZP 3LPYA 4ZVOB 4BC7A 4JI6F 2FHMA 2XI2A 1FXLA 4FVCA 3GR0A 1M0SA 3OBIA 2AZ3A 1PBAA 4DU7A 1V3RA 2IYGA 1VRQC 4FN5A 3Q8QB 3Q8UA 4CYUB 4QIFA 1UL3A 1YJTA 2Y0SD 4URSA 3AB4B 4ZLNA 2H1YA 3Q89A 2J76E 2O5DA 1TVRB 2UXCF 4AXIA 3KMQA 3GJSB 1FXRA 1X4DA 2BQUA 3N5FA 1Y4ZB 2DGWA 4X4TA 4WU2A 4Y00A 2Q6BA 3J81U 2BJEA 3W5ZA 4EGLA 4TN2A 1WI6A 3AXMA 2RH3A 4J9QA 4UT4A 1HNZJ 4I6WA 1U2RA 1GEHA 1YSJA 3AJ1A 3RR7A 3TUPA 3TZXA 3ZTSA 2GJIA 1IR1A 4B17A 1Y7PA 2EXUA 3HZGA 1S77D 3M8YA 2VH7A 4NRTA 4C48A 3CCES 1UFKA 3K57A 3CMQA 1RDRA 3ENWA 5I3QA 4JI7J 3EGVA 3CF5Q 5A8RB 2XTJP 3CJTA 1SJFA 4M94A 1TL5A 1FTRA 4FZVA 4QW8A 4R0JA 2H9ZA 1FE4A 2OMOA 1NEEA 3ZZOA 1FRHA 2DGUA 2ZH9A 2WZ1A 4WIIA 3MCSA 2YX4A 3HT0A 2YNIA 4QZVB 2JC0A 1NH7A 1NK0A 3HX9A 1KOOA 2JL9A 1RCOB 3OLBA 4EK2A 2RS2A 1Q8IA 4LSNB 1HNIA 4CQ1A 1CLFA 2UV8G 4DSJA 2XLKA 2DNYA 4OZ3A 2KRRA 3AB2B 4B3TJ 3U1LA 4NLSA 3VGUA 4ZCMA 5E33A 2IRYA 2ZJPQ 3RB3A 5A8WB 4ZHRA 2XWYA 3T1YJ 1UAWA 5DLFA 3VZHA 1QAXA 2HPUA 2FLPA 5IQQA 5CAAA 2FHJD 4DSFA 3DDNA 3QJLA 1RU1A 4DPWA 4IOAQ 2NS1B 1IM6A 2UUWA 3KK2B 2RUGA 2KM8B 5DDPC 1YZ7A 4DV2F 1IKYB 4FXVA 1APSA 1LW2B 2AQ4A 3NCQA 5CYMB 3MM7B 2EC2A 2QFJA 3BQ0A 5E7OB 3NWGA 2YKAA 3CGIA 1ZOTA 4JV5J 5F9NA 4F25A 3UFCX 3R5JB 2Q79A 4X64F 3OFHA 4J9VA 2C2DA 5IFMA 1B0VA 2KI2A 2DHSA 3MM6A 2VG6B 5E0OA 1HIYA 3MECA 1XC9A 2ASLA 4O4RA 4I1TA 1DJ0A 4YB6A 2GVZB 1Q0NA 3WHIA 2W4PA 2CADA 1JLEB 2GMLA 4DL7A 3LH2S 1TKXB 2G1HA 1HWJA 1C1BB 1FWPA 1VS3A 3DRRB 1RP5A 1KWMA 2QA4G 4OX7A 1VC5A 3H5SA 3ILJA 4JV1A 4Q0BB 5D0GA 2WONA 1FO1A 3QIPB 4NLOA 3A8EA 4USIA 3ET6B 4RL1A 2JJ4D 3OVBA 3F0NA 3D6HB 2NXJA 3M9MB 2YKMB 1O6XA 3CD5A 2BE7D 1WOSA 1TK0A 4NLTA 5F9LA 1FHTA 2RQ4A 2KFYA 4B9LA 3UW1A 1X4FA 2ALZA 3DI6A 1A7GE 1U47A 4XDCA 6FD1A 2DO4A 4I64A 5GAEI 4KAIA 4OHVA 4DV7F 3IWXA 2GHWA 4TLRA 2VBXA 1R0BG 5IS2A 5HQMA 1WG5A 1KFSA 2F8EX 3BREA 4QYZK 2W9BA 3CJ4A 1F5AA 3G8SA 3DRSB 1XERA 3PJWA 5C2GA 4HT7A 1RHQB 4QPXA 1HQ2A 3JTNA 3OR1A 3V4IA 4N41A 4MKVA 5GMEA 5HP1B 2DRBA 3F56A 3EYZA 5SZTA 3UDCA 1KC8T 4TY8B 2JWNA 1OYEA 1FVSA 1P6TA 3I56S 3PX0A 5CCLA 2W9CA 4M8LA 2ASJA 4NLDA 2OGUA 1E6YB 1T9UA 4DQSA 4O0NA 2IC3B 4I68A 1VRUB 2R7TA 3UE2A 1RADB 1RB0A 4X66J 2LLZA 1PIEA 3HP6A 4A48A 2E9ZA 4TKTA 1GFWB 3CCLS 2BOAA 3H5XA 3DM2B 4LQ9A 2F7VA 2CQ3A 2QT7A 1LW0B 4N5SA 1JLFB 1ZTWA 3GJRB 2OKQA 4TQSA 4LFCJ 5IC6B 5IV4A 1RAOA 3MXHP 2R2TA 1AZSB 5L38A 3BF4A 5LT5A 2FQQB 3TZZA 2XMUA 4MK8A 3HKWA 3CMES 2Z4PA 3GIRA 4WE1A 4A8SA 3P45B 1RAAB 4MIWA 4ZJLA 3SBMA 1WJ9A 4DL2A 5MLCV 2P2CB 1P9QC 4CO4A 4DSLA 5KG3A 1T03B 1CVJA 3T5HA 2QTWA 2E5JA 2NUHA 4OX6A 4CLUA 4JI8F 4UZCA 1VR6A 1BQNA 3IBCB 2P6TA 3N9UC 2XMMA 2RIJA 3B8HA 1WEYA 1FRJA 3BV8A 4C4WA 1JMTA 2XNQA 2OH2A 2FHJA 3QGPA 2HAFA 3MFHA 2UVRA 3H90A 2VJVA 1P1TA 3QRQA 2NYIA 5KG0A 3FEYB 1IKVA 3HHLA 1CQMA 1SH2A 1LWCA 2V63A 5DETA 1RAHB 2HGMA 1RWWB 4C8YA 1CS4B 3IG1B 5A6WA 1CJTB 1U26A 2AKWB 4OI4A 1J5OA 1PJ7A 2XMJA 4J9RA 1N5TA 1RWKB 3ZZUA 2XEXA 3MAHA 3M8PB 2F5GA 2AV5A 2ZZMA 3P6YC 3ISNC 3BZQA 1TK5A 1FF2A 2K1RB 4ECTA 3WX8A 1R6YA 1QUPA 5L9XA 3NEKA 4G1QA 4C8OA 5DRKA 2W9AA 4USJC 2FJEB 1VFJA 3FSYA 1S1WA 5KOXA 2AGOA 1KVJA 1Y0HA 2OEJA 4LT6A 2M8HA 4ZVFA 4O3QA 4QW9A 2H5JB 3BR8A 5C42A 1Y00A 2XWXA 2ZH3A 1Q16B 4LSZB 3EM1A 3I4PA 2AEMA 3SQOP 4HHUA 3TARA 1SCJB 2HFOA 4ILRA 4FNIA 1ZBTA 4L72B 4P73A 2VBZA 3SV3A 4DFJA 3FBCA 3EPGA 3DLKA 4NI2A 1LK5A 4DL5A 3V6DA 3MPWA 4RO0A 5FDLB 3QZ8A 4U7UK 5KOWA 3FZ2A 4P7TA 1T9TA 3M8SA 2D7SA 5K8PA 4M1KA 3HDSA 2IRXA 4L6V3 2C3MA 3SMZA 4DV4F 5EDWA 4CO2A 1NJIT 1XR5A 4IOBA 2IVFB 5IQ6A 3C6UB 2QZ8A 2N4CA 5EX3A 1YK9A 4MIBA 4EFAC 3H2UB 2IVMA 5HVFA 2XMKA 4HEA9 3M8QB 1W25A 4RZRA 2V8VA 5ETPA 3C2PA 3W63A 5EHHA 3OR2A 1L3TA 4X4VA 1CSJA 5B0AA 4V19X 1MWQA 4YN3B 4K4VA 3L3CA 4MMOA 4M5GA 4O3PA 1TAUA 3DDKA 2BDPA 1N34J 1NDCA 3BGLA 4EMDA 2OEKA 1GMWD 5D0EA 1WF0A 4DFKA 2MMYA 3GYGA 3OVSA 1OS5A 3GPAA 4ETZA 3LP1A 2MSTA 2AYBA 1KP6A 1T02A 1MMDA 1CEZA 1HBMA 3QNWB 4JP8A 3TUJC 4ZN3A 1N6QA 4KHPF 1HPZA 2HBQB 2X51A 1RT5B 1S12A 4LQ3A 3VAHA 2G13A 1U6FA 2QLXA 1WD6A 2AZ1A 2R8KA 4Q8EA 1RK8A 2HNDA 4USTA 2KFZA 2J0WA 4JV0A 4IG3A 1YBUA 4KH1B 1YBTA 2ZH4A 2Z56B 4WBFA 3R27A 1DZ5A 3M9NB 1WKJA 1HWIA 1WG1A 3ISZA 3T3FA 2E29A 3DCAA 3H25A 4ZP8A 2BJDA 3MMBA 3LP0B 2XYPB 3T6JA 3GLJA 3M2UA 3PRDA 4ZVUB 3BBBA 1Q79A 2VIHA 3R5CA 4YP3A 5HJXA 2RDDA 3Q2TC 3NXZA 4LF2A 2OPPB 3RAXA 4G65A 4OI2A 2V68A 2H54B 3AD8C 2ILZA 3PTWA 4KGMA 2WOMA 4O4GA 3HHEA 2ASDA 1ZPWX 1X0FA 1U0HB 1D09B 1UVKA 1IBLJ 5HN0A 3ULHA 5LJ3Y 1V3ZA 1M5SA 1HNZF 3X1LB 1K0VA 2POKA 3GG0A 4OLPA 2A1BA 2H3EB 1GTEA 1IM4A 3AJDA 2WSCC 2CJAA 1ZA1B 3M2RA 4C0HA 3H98A 2YNGB 3GFHA 5J2NB 3RB4A 5A8KB 3GR1A 4M5MA 3U1NA 3LUYA 2PD1A 1N5SA 1NK8A 2IM3A 4JI7F 2KTQA 2Y8YA 3B6BA 3M05A 3TJ8A 3FC9A 3K8VA 4PWUA 2B4UA 1VJWA 4F4WA 2GAGC 5AXKA 3HLUA 1F2GA 5DM6Q 5KFBA 1WKLA 2MKIA 2YWKA 3LAMA 4KGXB 2HQDA 2DGXA 5B0DA 3W64A 3IFEA 3MAAB 2MXYA 5DDRC 3W2VA 3R8YA 2QFIA 1C0UA 2NXCA 3THPA 2EFPA 5KFCA 4B3OB 4FNHA 2UU9J 3H59A 2HVEA 1VK3A 3CCRS 4B9VA 5AXNA 2E1PA 2FGOA 2QMUB 4Y34A 4B3TF 4LVNP 1ZA2B 3M1VB 1D8YA 5BJRA 1R8PA 5KFRA 3T1YF 2CQIA 5CZVA 2VQEJ 1NK9A 3D0HE 2HBYB 4K0KJ 1OO0B 3DRPB 4H4KC 5AXLA 1XK8A 1UVNA 1CC7A 3NG8A 4I2QA 4H4OA 4ILLA 2AD9A 4CLZA 2HRUA 3DLBA 1UWBA 3BN7A 1FKOB 3W2WB 3LOUA 2AF6A 3OJSA 5KG6A 1WSVA 4DL6A 2HWTA 2E5HA 1RTDB 6AT1B 3ZZYA 1PO6A 2HFNA 4ICLB 3NNHA 4YMEA 3OL9A 1MWZA 4LIRA 1FJGJ 1FE0A 3ZZTA 3GFYA 3VAKA 2DISA 2GVDB 3TO8A 1O0PA 4F4YA 2HURA 3HHKA 3C14A 5B0EA 2FLOA 4DLGA 4TLQA 2BRLA 2FYXA 1U45A 4P6QA 2PA3A 3EGZA 3W66A 4KJIA 4ZK7M 4EEYA 4UQGA 5IXUA 2K8GA 4CCHA 1A9NB 2ZUGA 4OHYA 2CQHA 3LWMA 4FKXA 2FZCB 1TKZB 4J7CA 2KT2A 3PYFA 5D4NA 4ZPAA 1NPRA 1TAQA 1R0AB 2XULA 1PJ6A 3FBFA 2MKKA 1N8RT 2CRLA 4UUWA 1BHNA 5F41A 2AT1B 4C11B 4NX9A 4WYLA 5D77A 3S01A 4A8XA 1C0TA 1TL7A 2J9EA 1FDDA 3N0VA 5AXMA 3WZ0A 3RAQA 1YG0A 3FEZA 1MU2B 1IBKJ 3KHHA 2XC9A 3KK1B 2M2BA 4DBQA 1Y3KA 3CJ2A 4L76A 2H51B 4XDDA 5CYQB 2BKNA 1WC5A 3CD6S 4NZ0A 1F2HA 3BBCA 2ZOGA 4DWIA 4RW6B 4DL3A 4UY85 1T05B 2CJYB 1JLQB 5FD1A 2R2UA 4ES1A 5KG5A 1RTHA 4CTAA 3MMAB 5LMUJ 1KR4A 2PEHA 5HO4A 4EZ6A 4YEAA 2AMCB 1RT1B 2GIRA 2BJ1A 2FY1A 1VC0A 3OUYB 1U1RA 2ZDOA 3R7BB 1IR0A 2VPWB 3R5GA 2KHDA 4DR1J 3DGVA 3GILA 1KHVA 2CNOB 1QDUB 4WP9A 3OV7A 4B9SA 1S1XB 3NCRA 4NWBA 3CCWA 2MZJA 5B7WA 1AROP 1CC8A 2JSXA 4PUOB 4N56A 3T1AA 4CNZA 4X66F 4K4UA 2VC1A 4F2SA 4M5DA 3B4DA 1Q81T 2WVBA 3RB6A 4LSNA 1CULB 5F3TA 2CPYA 4O3RA 5HSPA 1M5KC 1YLXA 1P8GA 2LEPA 2ATLA 2LQ9A 2XYHB 5F8LA 3MDFA 1OYDA 1Z2LA 5DGBA 1OMSA 2I6WA 4MKBA 3SFUA 2CQBA 3SDEA 4WP8A 2FJVA 5SUHA 1SC4B 3IS9B 4GKKJ 3MOZA 2CA9A 2KJWA 2PMHA 1UJ4A 4ZVSB 3NAHA 4DN9A 1GX6A 3MURP 1IKYA 3TWZA 3DXSX 1RXOB 4EU0A 4JI4F 5CYMA 3UWTA 2ZBRA 1NK5A 3ETMA 2PMZD 3UN2A 1SJ1A 1G6BA 4UUXA 5AE1A 2DNQA 4Y28C 2PE8A 4Q2LA 3AQPA 1N5YB 1ACMB 1F9EB 2VG6A 4DXLA 3W7BA 1T0TV 1RZMA 3OFEA 3LGMA 2XB2D 4OZ2A 4A4JA 4DUZJ 5F3ZA 5LMNF 4B9MA 3GFXA 2MZSA 4M5JA 1JLCB 2V94A 5KFSA 1TKXA 1VMBA 3KUGA 2XMAA 1S9GB 4FF3A 2R7XA 4DPUA 3DRRA 1S0OA 2J9DA 3NGKA 4LF9J 4ENOA 4NMXA 1XR6A 3QIPA 4KV8A 4Y2IA 3OTDA 1PYOB 2FUG9 2M88A 2VFRA 2O66A 1YX2A 2JFDA 1WHVA 1KVKA 2CPHA 2QO3A 4ANEA 1VRTA 3FZBA 3ELHA 4O3NA 1JJ4A 2YKMA 3UD3P 2E7XA 3HULA 4PXBA 5ETKA 2I1RA 4QQBA 3ZTPA 2GS8A 2ZZTA 4FYVB 1NPPA 2LQJA 1KLMA 5CD4H 3D3CJ 3MUMP 2MY7A 4YR3A 4ECWA 4RU2A 5BYRA 2ZH5A 1OY8A 5J2MA 3Q24A 4JB8B 4FYYB 5ITHA 2YX7A 2J0QD 3DHXA 2V4RA 2IPOB 2VG5A 2PT0A 4HLBA 4RW7B 3ZO7A 3DRSA 1FX4A 1T9YA 2NSBA 5F8IA 4CDIA 1IJEB 4R5PA 5C24A 2MZQA 4QU7A 2J7WA 3LP2A 4FBUA 2HWHA 3I0RB 2JVOA 4ZJOA 4TY8A 3PEHA 3VQTA 3J80Y 2MY8A 3FQKA 4YY3F 4RR5A 2MTLA 3OD2A 2IAJA 5F0WA 2D3UA 2E5LJ 3DLJA 3NMAA 1S79A 4TXSA 4HACA 3DLLQ 1HKAA 2D3OR 2HVDA 3QWPA 1SQFA 2F3JA 2EBEA 1X4EA 5HROA 5LM7E 2HFZA 1IN0A 3Q22A 3PW4A 2YX1A 1HD1A 2DHHA 4LVOP 1X4CA 2ZE2B 1FI4A 3KFWX 3WX4A 1G1XA 4OHXA 4BS2A 3SI8A 3BEGB 1R3NA 3DM2A 1JKHA 2P5VA 1EAYC 2F1FA 2ZM6J 2XS2A 3JYTA 2LDIA 3BO2A 2GHVC 4ZVQB 1QUVA 1U2FA 1DARA 1VYAA 4F2RA 4ZCKA 2CNNB 2IM2A 4CRJA 2WVEA 1SL0A 2DIVA 1VQ8S 1YKWA 3MHYA 2F8HA 1UEKA 3V81B 1BLUA 4Y2AA 2QA4S 3HHDA 2KT3A 3FSIA 2R7WA 1UPMB 5EGYA 2EBGA 3IR5B 1HD0A 3RW7A 5MAOA 3RB0A 2MZTA 4NXMF 4CNYA 2F9DA 3OL8A 3C16A 2HHVA 3T1HF 3MTKA 2OTJS 2UXBJ 3TAPA 3BKTA 3L7OA 1S6PA 4QIGA 2DK2A 5F8MA 3AA8A 3R2CJ 5F8GA 1P1LA 2QE5A 2V2KA 3QT5A 2OAUA 2RQKA 3N4WA 3ZC4A 3M9OB 1HBUA 4HHHA 3FMBA 4UY8T 5IT9U 1HQEA 3IG1A 3PW2A 4LRFA 1MG7A 4NLWA 2XCAA 1IBLF 1JJ2R 2DNRA 5C5JA 4DR2J 1NBEB 2GIFA 1HNIB 1S0MA 1NK7A 2VUGA 3BGRA 1Q4RA 5ETTA 5H1SV 4JBCA 3BJYA 1UZDA 3CCTA 4X4NA 2KDOA 2RILA 5ETQA 5GMKa 5EN1A 3GYXB 3C66A 4C7QA 4ZHRB 4QR2A 3PW0A 2DO0A 2MLZA 2VPXB 3SCLE 1YDLA 5KFTA 3KLEA 2DR7A 1S59A 2IA0A 4KB7A 4NYZA 3E2EA 4KGKA 1Q8KA 1XTZA 1RT4A 3O5TB 1UCNA 3BGFA 2YPYA 2UP1A 5HMZA 2QA1A 1GT8A 4FVMA 2HW3A 3VGVA 2E9RX 1KQFB 4E2FB 1F9FA 3G6XA 3BR9A 3VTIA 4RBVA 5KT6A 4LF5J 3NBPA 4EI2A 4YR2A 3PJXA 1A6LA 1S1TB 2O1PA 3MM6B 1URNA 4QWEA 1RGVA 4ER8A 1VHFA 3MECB 2RVJA 6FDRA 1YITS 2HBRB 1FJ7A 3HXMA 3DN9A 1HI0P 1FWLA 1FRIA 4OFZA 3I31A 2PI5A 2UU9F 3C6UA 4AT1B 3CCJS 1DURA 1K1SA 2E7WA 4NASA 3ZZZA 1V5VA 2G0CA 2ZBPA 4LRBA 2R7SA 2HHUA 2Y1IA 4F4AA 3M2VB 2L9DA 2Q6CA 4OQJA 1FD2A 2XCPA 4HL9A 3AXKA 4TY9A 3PR5B 4B3RJ 2VQEF 2J0SD 2WONB 4K0KF 2PIIA 5LXRA 2CVIA 1Y9OA 5BXIA 1HW8A 5CABA 5M2RA 2DIUA 2HS0A 2OO4A 2LDYA 4MK9A 4AUKA 3A3NB 4J9OA 1TKDA 1UZHA 1AT1B 2GGPA 3H0PA 4GC7A 1NKCA 5BYSA 1F3VA 4OYMA 1GK8A 4K4TA 2CJ9A 3JQMA 1GMVA 2NREA 5HVHA 4LIWA 3UNGC 4G3IA 4Z7CA 4NMLA 3UDLA 2QYGA 2MKCA 4CIOA 3K89A 2FC8A 3EVOA 5BYQA 3O2IA 2NR0A 3V2UC 2W9BB 3CC4S 2CZ9A 1S6QB 2LU1A 4ITSA 1RHMB 3C46A 2HGNA 2VKRA 5FIIA 2JEIA 2DNLA 5C2CA 3GQCA 4I7FB 1RAGB 3OR1B 3V4IB 3EZOA 5E41A 4RUHA 2YH1A 1VQOS 3H40A 4UOFA 4YDXA 3R5AA 2UUBF 1HR0J 1FFGB 3I4HX 3ILLA 1S6UA 5K8NA 2DR6A 2CQPA 5KFZA 4BWMA 4NLGA 2NSCA 2MGZA 1HQUA 3R7NB 3KXDA 3DMJA 4IKAA 4ZPVR 2WSFC 3CDEA 2V4QA 4ELTA 3TEGA 1F5CA 2ZOMA 5D0HA 4A8QA 3CT9A 1KQSR 4JI0J 4ECQA 4KRWA 4IRDA 3KOAA 4WKYA 1REVB 1U0HA 4K4SA 3VAMA 3OSNA 4YUDA 4F04B 4ANCA 1IBCB 3BO3A 2M7SA 2NLWA 4CO1A 3IN5A 1YRUA 2KHCA 4MKYA 1F9HA 3IO1A 1Z4UA 2GX8A 1M1HA 2CUYA 4FP9A 3D6MB 2VD3A 4Y0FA 3MEDA 1RTIB 3RGIA 1RT3A 4B3SJ 2XYGB 4ELUA 4RNHA 1FRLA 4IFVA 4U8VA 4PG6A 3SXLA 3BYPA 3GSDA 1L3SA 4RPFA 5J2NA 2DXDA 2OD6A 2RHSB 3VAJA 4LFBF 5L9NA 1NMEB 3VWSA 2ZDPA 3SFGA 5F8NA 5JJBA 4WE1B 2LEBA 4JYAF 3G9CA 1ZS6A 1NDPA 2QMWA 3PY8A 2G4BA 1DLOA 5E3CA 4WFBQ 5DQHA 3IGNA 4G1IA 1MW7A 3PCOB 5KFAA 1R6VA 3Q8VA 2VDIA 1U0SA 4DV3J 2VZ9A 2RD5C 3QATA 4A8MP 1X5PA 1HNVA 3OQ2A 4FS2A 3W62A 4PG8A 5AJ3J 1IKVB 3HHLB 4H4MA 2X1GA 2ZHOA 1R0CB 4LR9A 1R8CA 3NY0A 1X7VA 4KKOA 3UCUP 3DRPA 5DJBA 4WFYA 2E66A 3THVA 3DOKA 4AXJA 4IOCQ 1LXJA 1VQMS 4PG5A 9ATCB 1R8AA 4LF8J 2BX6A 3FCVA 4YB7A 3UNYA 3D66A 4MT1A 4U67Q 2H48B 5KFYA 3D0GE 2XGQA 1WTBA 5CXTA 3I5BA 3GSIA 1S1WB 3K5NA 2MQLA 2FVCA 4LJMA 4RUCA 2YTCA 1S4EA 2WHOA 3I82A 2DY9A 4ICLA 5C42B 2HHPA 3GIIA 1D3WA 1IWAA 1X5TA 3GONA 3JXOA 2EWHA 2A2DA 4ECZA 1FCAA 2GNKA 1RYRA 1Q8LA 3WC0A 4DUZF 3D5MA 2XM3A 2OELA 2GO8A 3DLKB 5M2UA 3AH6A 2D1CA 3V6DB 3OJUA 1OJ4A 2VB6A 1BQMA 1CJKA 3A3OB 1BC6A 2HNYA 3SCKE 3MF5A 1RT7A 3HT3A 1N56A 4GKJJ 1KN6A 3RR8A 2LECA 3M30B 4WPAA 4LF9F 5GADU 1VDHA 4URGA 3MM5B 1HMVA 4XTTA 1R0AA 4PXDA 2B56A 4TNOA 4GC6A 3RRGA 1UPPA 3AFGA 1UEVA 2PFDA 7FDRA 2VG7B 2IMWP 4C11A 1RISA 1NAQA 1BWVA 1MSWD 1UTAA 4DJBA 1RHUB 2C3UA 1NZ8A 3UDEA 1HHSA 1U1PA 4DS5A 3OR2B 3GIKA 2XMWA 2AYEA 2CQ1A 4OI6A 2XHWA 4ZN1A 3KK1A 2Z8QA 2VFVA 1WDDA 5KFPA 2KXNB 3PIOQ 2YNFB 2ZD1B 2AHOB 3ZNJ1 3UQSA 3NGRA 4DR3J 1EARA 2YKPA 1B4SA 2QV6A 5DO2A 3UPFA 4LMZA 3MR3A 2KVIA 2F4FA 1D1UA 1EIYB 2R7QA 1HBMB 3BH7B 2J8SA 1J5EJ 1N6QB 2A6OA 3JSMA 1W2IA 4F67A 4AQYJ 1HPZB 1TL1A 2O67A 1SH0A 1VQLS 5KFXA 4OZNA 1T94A 1QE1B 4LBIA 3I96A 2MJUA 3PKYA 2HNDB 4Q7AA 5B0CA 4JI5F 2AJFE 4NA2A 3W5YA 4IG3B 2H4YB 3GV7B 1U1LA 4YS2A 4KGZB 4FF2A 2E5LF 1VQ9S 4BBYA 4OL8A 1GAOA 1WF1A 2LA4A 2HS3A 2NYHA 3MMBB 2B3TB 1PILA 3TA1A 5ETNA 3Q0AA 3GP9A 3M2UB 2R2SA 1FJCA 3TZWA 3JAMY 2NZCA 4W98A 2LXUA 2LXFA 1K9MT 1C2PA 4L74A 5HMWA 1IXKA 2WRMA 4C8NA 1QSYA 3R3TA 1N52B 2VF3A 1VBYA 4J9SA 3UO0A 3TX0A 2MYFA 4FYDA 4FS1A 2HFVA 1RHKB 4UOHA 4H4KA 2WOMB 3MTJA 4O4GB 3MMCA 4IYQA 5L46A 3WQPA 2ZM6F 2JRSA 2HLTA 3MR5A 3RBZA 3VV2B 3L4BC 1NXIA 4MH8A 2XNRA 2BJ3A 3IS9A 2J8AA 3U1MA 1K73T 2EFQA 2CJBA 3KDNA 3I5CA 5LSLA 2MQ8A 4DDFA 4QBUA 4DR6J 3CC7S 4G6VB 2FDNA 3G8QA 2DB1A 3M2RB 1X4HA 5F0UA 2CQ0A 2HZVA 1RUSA 2D9OA 1Y5NB 4CM2A 1C1CA 2CWKA 2CJQA 3P5BP 3VGSA 4Q8FA 5C7PA 3HFKA 1T3NA 4OX9J 4EYIB 1JLCA 3OFGA 2ZNYA 4DR5J 4NEYA 2DR9A 2WVFA 4E98A 3HKZD 3N6MA 3IR6B 4LF6J 1S9GA 1PKUA 3S7RA 3VAGA 4RBTA 2WCXA 2JEJA 4ZPWR 1JLBA 2JLFA 3LAKA 7AT1B 4MKAA 5D0RA 3CDBA 4OYIA 1VBKA 1C0UB 4PQUA 1UW4A 3HFVA 3MR2A 4DR2F 5IOLA 5JUMA 3B54A 1N0UA 4W90B 3B82A 4HTIA 2EKYA 2E44A 3Q8SB 4R8UA 3D6TB 3OTOJ 4OJ3A 5B08A 3CDWA 1SIWB 1S72S 1RT6A 2XSJA 2IYIA 2DITA 4PG7A 2FD2A 2ROGA 4I2QB 1HWUA 4H4OB 3ZTQA 4LSLA 3DGPA 1U1KA 2DY1A 3LTOA 3JQKA 1UWBB 1WACA 2MJNA 3W9IA 1RWNB 1UKUA 3VZIA 3TR5A 4IFYA 3E01A 3AQOA 3U02A 5KFOA 2HNZA 4RW7A 5M2PA 3OL7A 3G86A 5KFKA 1DQ8A 3MCNA 5IWAJ 4LF5F 3D1QA 1PAUB 1IQTA 3A1YG 3R1LA 2HLUA 2KU7A 1YI2S 1WTFA 3N01A 3MMJA 1X4BA 2FVSA 1IUJA 2OPQA 3C14B 2MZRA 2V2QA 2E1RA 3F44A 4X62J 4FF4A 1KQGB 4IO1A 1N36J 1EB0A 1FX2A 3SZ2A 5KG7A 2YQ0A 4NLQA 4CT8A 3RRHA 3TA2A 4BC9A 3BQ2A 4ZKAA 2ADBA 3G6VA 2D69A 1QM9A 3M32A 4EYHB 4CH0S 2AX1A 2CZVC 1QAIA 1S99A 2K7JA 3MGJA 2DH8A 3EXYA 1HWKA 2OLWA 1AA1B 2VV5A 3D1OA 4C2MA 1OIAA 2RJZA 2ZE2A 1C0TB 1TL7B 1U8WA 4MTPA 1WC3A 2V0NA 2W4CA 4AFFA 4Y3CA 1YTYA 3L09A 4O3OA 1U1QA 1H7XA 3PR4A 2BKPA 2AU0A 1EQ0A 1UVIA 2FPHX 2LYVA 3N6NA 2W2NP 4LF1A 1EP4A 1IKXB 4I2PA 4QR1A 3V81A 3MFIA 1PAEX 2IJRA 3CCZA 2XMTA 3HM9A 2XHCA 1RA6A 3Q23A 1RTHB 3CVKA 4CTAB 2IJNA 2YKOA 4QCLA 2XY5A 4OZJA 2FLNA 2V69A 2P9EA 3UI3A 3B78A 3JQJA 2HHSA 5HK4A 4AYBD 2CPIA 4ECUA 2IM0A 1RAIB 4XK8C 1RWUA 1U7LA 3OVAA 3CJKA 5IZHA 4ZS6A 2DNPA 3TJ9A 3WC2A 3L9ZA 5HL7Q 4DV5J 1SQEA 1FNMA 3D0IE 3PIPQ 1VGYA 3IAM9 1JK9B 4B08A 3TUIC 5LSOA 4OYWA 4ZVGA 2UUCJ 4CLFA 3GTYX 4P2SA 4M5DB 2ZVIA 2QC3A 3MEKA 4KTQA 1KKHA 3MM8B 4DEZA 3W9HA 3KYLA 3LANA 1I94F 2Q43A 4V1Ak 5I4MA 1SH3A 1SUQB 4B3SF 4DSIA 1GX5A 2N4DA 3ONQA 3SDEB 4Q45A 1FK9A 2ERRA 2KYXA 4QWDA 3A8JA 2AJ1A 5H9EJ 4QPTA 1NO8A 4IG0A 4ES3A 3J81Y 2WB1D 4RW4A 3HHLD 2V8DA 2OFGX 4UOCA 1X4GA 1UJ6A 2UUAJ 3FCHA 1DBDA 3GZ7A 1WDTA 1RBOB 2EFNA 3ZZ0A 3FBBA 1V3SA 4WFZA 4KO0A 4DF4A 1GQEA 4CO0A 3A8IA 1S1TA 1OSCA 4HHJA 3BN4A 3BS9A 2B9YA 2I38A 3NNCA 4DV3F 5LJ5Y 5CD4A 2E1AA 4M5IA 2IM1A 3O44A 5AJ3F 2KG1A 4QIEA 5D4PA 4ZITA 1U09A 4F50A 5HQ8A 2KN4A 3R1HA 1RKJA 1RLCL 1HLWA 3PYGA 3LO3A 3FSXA 3KHLA 4N8NA 3M2VA 4QIWD 4OYBA 4X2BA 1B0PA 4DFPA 1LEOA 1D0EA 4DF8A 2KYZA 2G2ZA 3RG6A 3M8ZA 3CCMS 4KV8B 1EETA 4WTOB 2M3DA 1K8AT 3RTVA 3QFHA 3KG4A 2ZH2A 4F8RA 5KFQA 3K59A 3TAQA 1TV6A 1VRTB 4LF8F 1AW0A 4PPZA 4C8MA 1PJ5A 2GZOA 2R3VA 3PFEA 2ATCB 2KO1A 3G87A 3GCXP 4NXNJ 2O01C 4DU8A 2DNHA 4CLWA 2G9OA 3CSKA 2YWEA 2V2ZA 1ITPA 3FQLA 1VQPS 1KLMB 2DD8S 2HVIA 5D15A 5J2MB 3JSBA 2R2RA 1HFEL 1T3OA 2B5JA 1S6QA 4IH6A 2VG5B 4BCAA 3NOCA 2DHXA 1KONA 2V5HG 1EKRA 2W01A 3OTEA 5A0YA 3I55S 3GJQB 1PYSB 1HHTP 4I7FA 2D3ZA 1ICEB 1NRKA 2AWZA 2OPRA 4R5PB 2CKWA 5C24B 2R42A 4NCGA 1HL6A 3KNGA 4M5KA 5KFMA 2ZITA 3LP2B 4C3MA 3D6FB 2BQ3A 1WUUA 4A8WA 3QGGA 3P96A 3OHAA 1U24A 3I87A 3CWJA 4RUAA 4P10A 3CJQA 2IAJB 3TJAA 4HACB 2B6AA 2J7KA 2QN6B 4ED1A 1CJUA 3FRYA 2R7UA 1Q78A 1UETA 3IRXA 1GXTA 2VFTA 2JVRA 2Z2ZA 1WOOA 2CPDA 5K8OA 5HMYA 5HROB 2MLYA 5BR8J 2XLJA 4DV2J 4DS4A 4OYZA 2Z30B 2FLLA 2HG4A 4DQQA 4FKYA 2LA6A 1REVA 2PC6A 3DLGB 2EW9A 2ASYA 3UVJB 3K5OA 1U02A 3R6LB 1DHMA 1D8ZA 4MK7A 1IKWA 1WEZA 2RRNA 2VJUA 1JKHB 2ABYA 1XNRF 4U95A 3D3BJ 3HO1A 3JYTB 4P74A 3PVXA 1RTIA 4ZIWA 1TZ0A 4OJGA 2ZJQQ 4DG1B 4DX5A 2NXUA 4QIVA 1LOUA 4K5SA 4X65J 2WB4A 2CXEA 2Y1JA 4MFBB 4IRCA 5AT1B 2FJWA 2FZGB 2EVZA 2ZH8A 3T41A 4Z7YA 4WFXA 2ZC4A 4OI3A 3RBEA 3PM9A 3QYYA 2QL7B 2BZ2A 1KS2A 4P52A 1NK6A 5T14A 5KFEA 1KBRA 3C16B 3EE3A 1MNEA 3FBEA 2IVYA 1FKPA 2FZKB 3M4XA 2A3JA 3I5AA 1S6PB 4USVA 4ZCIA 4DL4A 1UA1A 3PKMA 4JUZA 2QG9B 2RKIA 5J2QA 1P27B 1NSPA 3CTRA 1PSDA 1F3FA 2W7AA 4DQIA 2AP6A 2V67A 1HBUB 3N79A 1TUWA 4BLGA 1HQEB 3ITHA 2DGVA 5C25B 4OYAA 1NJZA 2IDEA 4J9KA 4ILMA 1WWHA 3CW2C 4RW9A 3BGRB 1NLKL 8RUCA 2A0FB 4PXCA 3P4UB 2DYAA 2J6UA 2J9CA 4A8YA 4DR6F 4U9RA 2DPIA 2ZHBA 2ZH6A 2OHDA 5KT5A 5K14A 2WW4A 4NCBA 3QT6A 3KLEB 2C22A 2G0JA 5CH7B 1RTZA 3W65A 3LPEA 4F4ZA 2Z2YB 2PEBA 5FLXU 1RT4B 1M5VC 2D41A 4LF7J 5D3GB 4JV2A 4DZ6A 2FIUA 1ULRA 1VQKS 2UVUA 1UWAA 3TVZA 4P2FA 3CIZA 1W26A 4DR5F 3NGUA 1SB6A 2M8DB 4ES2A 2MDAA 4MIAA 2ROEA 3NBPB 3BGOP 3M6XA 4D3HA 1UFLA 1O8BA 2CYYA 1NPKA 4LF6F 2RE1A 3MPUB 1YRTA 1Y5IB 3BPDA 4HKQA 3M30A 2QLWA 3EDRB 1UA0A 4ZDNA 3PJ9A 3MM5A 3L7UA 4TYAA 3V6HA 2X3GA 3CNQP 2HQGA 3CCSS 4C3KA 2Y1LB 1D9FA 1H2VZ 2HVHA 2A2CA 2VOOA 2VG7A 3DU5A 3NLCA 1UP1A 2AW0A 1TU0B 1S7IA 3DKDA 1B64A 2AJ4A 1VI7A 5L1LA 1VQNS 3G82B 3NRBA 4OI0A 4FXWA 4EBDA 1FRKA 5HAOA 1U1NA 1SJRA 4ZVEA 3MUVP 3ILIA 4TU8A 3OTOF 4YFUA 1FNXH 2OIHA 4NRUA 5JXSA 3HJFA 2MKYA 1HNWJ 2ZKTA 3FUYA 5CQGA 2OI2A 1U49A 1S7HA 2YNFA 2ZD1A 3CJ3A 3KK3B 4Q43A 3R9LA 3QO9A 4ZVHA 4J9PA 3EGNA 2C2NA 4QWCA 5CHCB 2FJAB 2V8PA 2L9NA 3UDVA 4OYOA 2PFFB 2GGPB 2W4DA 3TUZC 4NLPA 4Q44A 3IGVA 1NK4A 3QGIA 4WJBA 5IWAF 3KHRA 2AGPA 3W3SA 4B02A 4URQU 1QE1A 3BSAA 4UQTA 2CG8A 4HT5A 1Y10A 1L3VA 2Y1RI 5F8JA 2RQCA 2DXFA 2EKNA 1TKTA 3IM9A 2OPSB 3MEGA 1WC6A 2WVDA 4X62F 4AE5A 1N36F 1S1UA 1Q7LB 3KLVA 2FJDB 2J7UA 1VIOA 3G2XA 2C28A 4ZPCA 1TK8A 1SIZA 2RDIA 1RAJA 2W8LA 2MGZB 2B7CB 1HQUB 4KFBB 3US5A 2FJXA 2E5GA 2HK3A 3DMJB 5HLFB 1S1VA 2WVCA 1WEXA 3BB5A 2JLEA 1MWYA 2ROPA 2CZ4A 2BJ8A 3QT7A 2APOA 2HQ3A 3IXQA 1U25A 5J1PA 3RYLA 1VQ6S 4J9UE 2QEXS 4DZDA 3SIPB 3MEEA 5IM0A 3G4SS 3RU0A 4HDHA 2W24A 5I42A 2VU5A 2BXJA 4XPEA 5HBMA 1TQLA 5D4OA 5KT2A 2QSFA 2DRDA 4LRAA 3NS7B 3PX6A 3AOCA 3HSZA 1DTQA 2VONA 3MEDB 4ZIVA 3R5BA 1RT3B 3CD0A 4OLOA 4NLYA 2XQCA 3CIMA 4ED4A 1XR7A 4CH1A 4IFVB 2MKHA 3OSPA 4EUVA 4IH7A 3K7RA 2V8HA 4GVBB 2GJFA 2Y9HA 1DTTA 1BUXA 5KT3A 4YQWA 2BV3A 2EI5A 5K5MA 4ID5A 1JLGB 3QLHA 3ZZPA 5CA5A 1HARA 3T9ZA 1UVLA 2FTRA 2KVQE 1DLOB 5L8RC 2YNHA 1S6OA 4WP3A 1PC4A 1IVZA 2E9TA 3SYZA 2IBKA 4Y6IA 3DRYA 5B09A 2MQQA 4ATNA 3DXBA 1H2TZ 2P9CA 2NXEA 3M8RA 1QJHA 2UUCF 2RNEA 4FYWB 1HNVB 2V9KA 3PHEA 3J7Z5 4CLPA 2KM8C 1EZZB 1K44A 2F65A 3QRRA 2CIMA 2HMIB 4H4MB 2PSZA 2KJVA 2V9WA 1DY3A 4GRSA 3TNVA 4DLEA 1SC6A 1YVFA 3N6LA 1OSDA 3DLEA 3A3PB 3BM7A 4KKOB 1AFIA 4U6PA 3OT9A 1SV5A 1CBKA 3RBDA 4I56A 3DOKB 1MMLA 1S49A 4DSEA 3BDEA 2XY6A 5GMDA 4PCQA 1M90T 1VQ5S 2BW2A 2EFOA 3C8YA 1NHUA 2UUAF 3HVTA 2OJ3A 1TTHB 1N54B 5AE3A 2X7IA 1CQNA 4KBIA 4LF4J 4JV5F 4C8LA 4QYRA 4EO8A 1JLAA 1NB7A 4CP5A 3C15A 2DTJA 2CDQA 1LQ9A 3K17A 2RDJA 2UV8A 2MB0B 5E3RA 2A10A 1KVIA 1NSQA 4IRKA 1F1BB 1BQMB 1CJKB 2HNYB 4G1PA 3LALA 1RT7B 4WXWA 4YHHJ 5DM7Q 4J9LA 2YVSA 3MM9B 1N5VA 1SJ3P 2RB7A 5G0RA 3L7PA 3G8TA 3N28A 4ZA1A 1HMVB 1R31A 4JI2J 3QJJA 1LWXA 3M8WA 1G2EA 1N33J 5JMNA 2Z2MA 1LWFB 3PRBA 1K1QA 3QPIA 3P3DA 5DGAA 2EFVA 2D3O1 1TMJA 5E3QA 2QL5B 3BDPA 2I5JA 5DLGA 3MD3A 4NXNF 2HZCA 4L3NA 4I6AA 4NOHA 3ZZRA 4FPRA 1H73A 3QAUA 2IBOA 4HI2A 1MN7A 2BM1A 1WORA 4V19J 4P9SA 4U96A 5CZXA 5EWEA 8ATCB 2BMBA 4LRCA 2R8IA 5K20B 1VJQA 2LQBA 1IKXA 4AL5A 9RUBA 2K3IA 1Q82T 2PA8D 2L3MA 3OXLA 2D9PA 4PKDB 4CZCA 2BANA 3ILOA 2KG0A 1VBXA 1GXLA 3SEOA 5ADZA 3JSMB 1BY9A 1TL1B 1E6VA 1ZM2A 2HIYA 1BXNA 2B51A 2RU3A 3WBZA 1R43A 4USKA 4P7VA 3KJQB 2JLGA 3UN3A 2DGQA 2U1AA 5B0FA 1QD1A 4YOEA 5K8MA 2C2MB 3OW2R 3R5DA 1VHIA 1JJHA 3LW5C 1B99A 5T7LA 4H54A 1XN9A 1IBMJ 2D74B 5BR8F 2KFNA 2ZH7A 3W8GA 5J1EA 2LKZA 4OJHA 2YKNB 4ZP7A 2HVZA 4DCOB 2QMXA 4NE9C 1JX4A 2Z0GA 1RLDA 2CDRB 3OTBA 4NEZA 3MM8A 2DCUB 1DQAA 1YJ9S 2BYCA 3AHPA 2KXHA 1EKSA 4DI6A 3MMCB 2B9WA 1GXUA 4M95A 2EPIA 3DFEA 1TL3A 1WELA 1SUQA 2JEGA 3DDIA 2W2PP 5KFDA 4LFCF 3DU6A 3H7HB 4F26A 4WIQA 3EGWB 3D28A 3EVWA 1Y5LB 1C4CA 4X65F 4U7CA 2HBZB 2HQIA 5GADI 3S8SA 4DR7J 1CPZA 5EWFA 4O0IA 4KHRA 1RTJA 1LWEA 4C9DA 1RHRB 4DR4J 4IR9A 4ZP6A 4OI1A 1U48A 1TR0A 1V5IB 3RJMB 4JI3J 2RRAA 1X60A 3GFZA 2OMLA 2MHNA 4O44A 1D9DA 2ADCA 1C1CB 1HYSA 2OD4A 2YBVA 2C2KB 4FF1A 3VVUA 1ZETA 5KG1A 2ZZNA 5B0BA 1VISA 3VAIA 3KTQA 4WU3A 2SXLA 4KIAA 1T8EA 3E51A 3QZ7A 1S0VA 4ZLJA 4RUBA 1JXLA 3JB9k 5GAHU 1JLBB 4ZPTR 3QSIA 4K59A 3CJ5A 3MR7A 1LFWA 4NCAA 2B7BB 4MYTA 4PQUB 5L1JA 2LP4A 4DPTA 2FVQA 5G4DA 2V2VA 3O6QA 1FRXA 3TQ1A 2COLA 3HI9A 1I1GA 4RBUA 1T7PA 2ZBIA 4R8UB 2FVPA 3T9NA 3CJRA 2R4FA 4F7VA 3W1YC 1N48A 1QAYA 1RT6B 2XSJB 5U47A 1FVQA 4WWSA 1NKEA 4TVAB 1VQ4S 3KLIA 1SXLA 2IJFA 4LSLB 3DGPB 3PW5A 1S76D 3UN5A 2LU2A 3PEJA 1KTQA 4LF7F 2M70A 2N7YA 4PEOA 5E5NA 2HQFA 4IFYB 2GMJA 3E01B 4N7TA 4PR6A 4NLRA 2VFSA 2HNZB 1B7FA 1ZYQA 4DX8H 4MYUA 3J7ZT 4LBHA 3SCIE 1S9FA 2EK6A 1QVFR 1O51A 5KFWA 1ZPVA 2RF2A 2UXDJ 1VCTA 2HHTA 1RWOB 4IDKA 2NPIA 1SKRA 4IUFA 4OZ0A 4I67A 3IWNC 2OPQB 2W2QP 1H2UX 3CEDA 1XNQJ 5KFFA 4M5HA 4Y2MA 2CVEA 3V6KA 2BVZA 3KLFA 5KFLA 5ETVA 2B8PA 3DRXA 2RU9A 2F8MA 4ZCLA 5T41A 3G96A 4A8OA 2BJ9A 2IHR1 4FXDA 3MD1A 1KOHA 3R6GB 4QOTA 2DGTA 4L73A 2CQ2A 3HD2A 3K5MA 1YIJS 3KKFA 1AUSL 3M32B 1MROA 3KMSA 4JI4J 4EBEA 4DN0A 1HNWF 3DLGA 1N34F 3DYAB 3CJSA 3HF5A 5JVHQ 3UVJA 1FXDA 1RU2A 2LFVA 1OWXA 2JC1A 1HBNA 1URRA 1YJUA 4DV1J 2QGFB 3RUBL 5DG7A 2H65B 2OFHX 3FJ2A 2J9DE 1X5OA 5E2QA 2VODA 3GJTB 4LBPA 4F3OA 3KLGA 1BD6A 1RA7A 2HZAA 3MR6A 4DG1A 1F6TA 5LMNJ 3G6YA 5A6PA 5HATA 2BE2B 2VOPA 1EP4B 3LGNA 4I2PB 1RE1B 5H9FK 1G7CB 4MFBA 1R8HA 1VQSA 4WF9Q 1NSAA 3LWLA 1JQGA 2JDJA 4DPYA 1BWEA 3BO4A 2V50A 3ISND 2HFUA 3UD5A 3POTA 3H8YA 4DL0C 2V6AA 2OSRA 2BOPA 2AIRB 2ACYA 1T95A 4NYOA 3KJNB 3D9BA 2LEAA 1IJFB 4J9NA 4USWA 3GMGA 2QIFA 2JNJA 4K4YA 5L1KA 1WC4A 3K2YA 3CJKB 2J5AA 3FFIA 4XPCA 4B3MJ 4B9NA 3KUHA 4PYDA 2N3OA 1FFWB 1VQYA 2LCWA 3KWMA 4L3KA 5C25A 3P5TL 3VR1A 1TMMA 2QLBB 3PG9A 3MPDA 4RJVA 1FD8A 4F3MA 3C19A 4X4QA 4QYZJ 3KJVA 1NJXA 4N47A 4OV1A 4N8OA 4DFMA 1FT8A 1FKAF 2IMOA 2M5YA 2K06A 4UZBA 2MKJA 2KH9A 1FK9B 3OL6A 4YY3J 2W2MP 2ZKUA 2HHXA 1GMUA 4IG0B 1LKZA 5RUBA 4RW4B 2EC0A 1KSPA 3K58A 3IAS9 2J0XA 1ZAXA 3D54A 5D3GA 2V34A 1HWLA 1T9WA 4IQXA 4Y2KA 3KHGA 2F4VJ 1U6ZA 4KO0B 4DV0J 3OPKA 2VKZG 4P71A 5DG9A 1ELOA 2OSQA 3O8WA 1JWWA 3VGTA 2DNMA 1H72C 1HBOB 3CJ8A 2HHHJ 2LQ5A 2N3LA 4PWWA 4ZVRB 2GQCA 3HSJA 3PYEA 2MZ1A 3HCXA 4IR1A 1KRPA 4NZ7A 3G82A 2MQOA 5L1IA 2A18A 3GIMA 4WKRA 2ACMA 3GWCA 1H38A 2ALYB 5IT4A 1LFPA 1EETB 4X4PA 4CLLA 4ID8A 1F5BA 2B4OA 2FJBB 5IT9Y 5KTQA 3KK3A 2FVRA 1TV6B 4WZMA 1S10A 2R8GA 2VQFJ 1FDAA 4RW8A 4NXMJ 2QSWA 5DS7A 2XI3A 1AB8A 4NLXA 3FK4A 3E8OA 2CPEA 3T1HJ 2BRKA 1JXVA 2QL9B 3Q86A 2DNNA 3AA9A 1YQHA 3HVWA 2MHEA 4LF4F 1NUEA 3C6TA 1NB2A 2CQCA 3HHNB 3D67A 2YWWA 1MMNA 2K7KA 2FGCA 1FJGF 4EO6A 5LOQA 1RBLA 4BDPA 3ETOA 1X31C 4RWXA 1UMJA 3ZTRA 4DX7A 2B5JB 3W60A 2CPJA 2I2YA 1F60B 2YH0A 4P75A 1HNXJ 1YRXA 1TELA 1XEZA 5A0YB 2OPSA 1RBAA 3PZPA 2KZZA 2C2OB 5ETOA 2OPRB 4YHHF 1YJWS 1Q7YT 3R2DJ 4S0MA 1M1KT 4NCGB 3NS6A 3H4BA 2GC8A 4OZLA 3HZEA 3MI7X 5L39A 4KE5A 5ETMA 4JI2F 4TQRA 2XO6A 1X4AA 5D8HB 1N33F 4X4SA 1TUVA 4OYPA 4Y2CA 4KFBA 1FRMA 2QLFB 5HMXA 5HLFA 1S9EA 3QSYB 1ZAWA 2B6AB 1CJUB 4XO0A 4U7UD 2YWHA 3EMTA 2YPZA 3NMRA 3IRXB 2KXFA 2DJWA 2GW8A 5GAGI 4UF4A 4RLEA 1VOMA 3P8BB 4CLTA 1IBKF 1B7YB 1I51B 4WK3A 3CJ0A 4X4RA 1CG2A 2JEFA 4ED3A 1XWLA 1RACB 2W7OA 1SJQA 5IC4B 2C2ZB 3DOLA 1Y11A 4CT9A 2Y0BB 1Q86T 1RHJB 4BWJA 1RCXB 3J7A1 5DDOC 2AEJA 4NL5A 3PACA 1U1MA 1IKWB 5KFJA 2GQ2A 3HPOA 3KLHB 1DAXA 3MOJB 3TVYA 4NA1A 2EEYA 1G3OA 1RAFB 3BSNA 3FRZA 1RT2A 5JVGQ 1L5UA 1XMQJ 5LMUF 1KNZA 1IR2A 2LXIA 2G2OA 4DOZA 4CLKA 4GVBA 3VHQA 1REGX 3SQGA 2DRAA 4PWDA 2NQPA 2Y3YA 1SL1A 1YJNS 1JLGA 1LV5A 2QLJB 3S6EA 2DH7A 1N32J 2XZWA 2Z2LA 3W8PA 1RQ0A 4DR1F 2GV1A 2L9WA 3AAWB 2YQ3A 1JNRB 5EUHA 1IWGA 5KG4A 2C1EB 5KFUA 2IY5B 5KG2A 1IBMF 3CCVS 2DT9A 3H2VE 3HSGA 1B70B 1FKPB 1UEUA 1P9YA 4PRFA 2GA7A 2YWFA 2BUNA 4YB1P 1KTVA 4X84A 3IR7B 3T19A 2CFXA 4O3SA 2RKIB 2B4PA 4I6YA 5J2QB 3D2WA 4KHMA 2OEMA 1GTHA 2PO4A 2ZWPA 1VQ7S 2HMIA 3PHTA 4ED2A 1NU4A 3OHBA 1S48A 1NSKL 3EZ5A 2F40A 1FTCA 3FGVA 2CJXB 5KFHA 3ITHB 1KDNA 4PZVA 3G6ES 1B3TA 4RNOA 3AODA 2C2RA 3DOMA 2GFFA 3LGHA 2CG4A 3FKBA 2Y8WA 4GKKF 4GO5X 3CO9A 1GMWA 3FEXB 2BW7A 4RW9B 1QSLA 3PXGa 4FYXB 5ETSA 4DR7F 3AOBA 4GO7X 2Z58B 5I3UA 2PGCA 1WHWA 1OQ3A 3FDSA 4OHZA 2W8KA 3BSOA 3CDUA 1HI1A 1N88A 1NHKL 4QJVA 3VQSA 4DR4F 4Q5VA 5GVQA 2UUBJ 2GMHA 3MCMA 1RJJA 5K14B 1WKKA 1BGXT 4JI3F 3W61A 4CYUA 4O23A 4F36A 4QWBA 2QRRA 3GCWP 2ZH1A 1GH8A 5J1NA 1TVRA 1V9OA 3W5XA 2BJ7A 4IQMA 1UVJA 2CAJA 5KFNA 2XS5A 4IO9Q 3PX4A 2DNGA 1HI8A 4FBTA 8AT1B 4DCPB 1KLNA 1UJ5A 1SI9A 4USHA 2DGSA 3MM9A 1SKUB 4WZQA 4P2XA 1T9VA 2C3PA 2AEFA 4Z2XA 1FDNA 4U8YA 1JIHA 4YR0A 3I32A 1LWFA 2G1DA 2V4JB 2OP5A 2P6SA 1X0PA 2NCKL 3NL0A 2BA9A 1N0VC 2XZTB 4LFBJ 2YY3A 3QBCA 3J7YI 1R89A 4JYAJ 2AJQA 3PV8A 5A8RA 2WBRA 1YGYA 3AT1B 3QO9B 3JSYA 1XBWA 3AY0A 5GAEU 4ECXA 4A8FA 1RKIA 4GMKA 4OJ1A 3LQVA 4WTYA 2GQQA 3T6BA 2Q66A 1TFYA 3H5YA 4W92B 3OTCA 5F8HA 1ZZFA 2BKOA 1WG4A 4ZLPA 4C97A 3MPYA 4OX8A 1FJEB 3UD4P 1ZM4A 4A46A 2UXDF 3HJVA 4ECVA 2PN6A 5K9FA 2XBPA 3K5PA 2HRTA 2ZBCA 4ECSA 3DC2A 1XNQF 2CWXA 2XS7A 1TKTB 3OLAA 3FNNA 5A8WA 2DEIA 3RW6A 4R25A 3MEGB 3EUNA 5ETLA 2MEWA 3Q83A 1J27A 1S1UB 1W2BR 3I9V9 1I6JA 3MCOA 3KK2A 4CWBA 2XZDB 1C4AA 2B9XA 1X5SA 3CUNA 3I0SB 3CCQS 1LW2A 2YKNA 2VPZB 1NNDA 1NJWA 1KHWA 3NNAA 3MM7A 4ZPDA 1S1VB 2DNZA 1DQ9A 1YJVA 4ED7A 1XMOJ 1PCAA 2OUGA 2X1FA 4DV1F 3P49B 3VCDA 3CDAA 2EG1A 4ZLLA 3J80U 4LR8A 1RSCA 3C3LA 4JI1J 3MWBA 4DV6J 4AD6A 3QMQA 3MEEB 5IM0B 4LR7A 2HK2A 1BQXA 2R7OA 3D7SB 2C2EA 5I42B 4EBCA 4CLSA 4LREA 2GVZA 5HBMB 1CJVB 1YBAA 1JLEA 4Y65A 2C3YA 2HAIA 4WXOA 5A2QU 3TZYA 7FD1A 4PPDA 1C1BA 1VLOA 2E1MC 1DTQB 3TAMB 3AJ2A 4Q0BA 4RNNA 4DQRA 1RWPB 3VF0B 4ED8A 4NLVA 2CPFA 3THTA 3ET6A 2A6MA 3SV4A 3MZIA 3FCWA 3EXCX 3OXGA 3SSSA 1HHQA 1I5OB 5KAKA 1DTTB 1H98A 2MQNA 4ID5B 2JX2A 3QLHB 4R0EA 2UXBF 3EWGA 4C3LA 3QQCD 1AYEA 1Q53A 2B8QA 4YB5A 2CNLB 2Q3PA 3A4TA 3CC2S 5LXYA 2GAHC 1QAJA 4KT0C 1SJ4P 2YNHB 4OMFG 3TQEA 2IA6A 1EHWA 4DUTA 4PYAA 4F0HA 2J6SA 1Y3JA 4W4MA 3MPVA 1VK8A 4B3MF 1ZM3A 1OPZA 2C42A 2WW8A 2DHAA 5I3PA 5DQGA 1RAEB 3M6UA 4F0MA 1RWXB 3EZUA 4HH0A 2MKSA 4K2XA 4KC5A 3Q2SC 2KKHA 4LFAJ 4PXEA 4HR2A 3BQ1A 4J9MA 2V8GA 4K2JA 3B4MA 2AJ2A 2G0IA 3S1TA 1T11A 3TEHB 2BM0A 5IT0A 5D4LA 5H9EK 5HP1A 3DLEB 1H7WA 4JI5J 1OQ6A 3OFFA 5J2PB 1K47A 3M6VA 1SV5B 1Z1ZA 4X4UA 4J5OA 3ZTOA 2XMVA 1E6YA 3J81j 2KZMA 1SKWA 4K4XA 2FY8A 3BYRA 3TVKA 2MQMA 2JHEA 2IC3A 3PO5A 3HVTB 3GU0A 3H4DA 1VRUA 5A2QY 1MLAA 3M7VA 3TYTA 5HJYA 2F4VF 1JB0C 1NHVA 4C98A 4DV0F 1XQIA 4XAKA 1JLAB 1FEEA 3QT8A 1H0HB 3C15B 4DPOA 2CNKB 2BEFA 3CB4A 1LW0A 2HHHF 5IV3A 1JLFA 2ZJRQ 2M52A 3NS5A 1OPIA 4Q2MA 2CPXA 1PG5B 3AD9C 5CYJA 3HVAA 5KT4A 4NPOA 1AZSA 4E0DA 5G0RB 2RQMA 3CE8A 4B3RF 2X3DA 1PBUA 5DDQC 2BQRA 3FVYA 3ENVA 4C8KA 2BACA 3DYAA 1LK7A 2BBEA 1U2CA 2MLXA 4ED6A 3BKFA 2VQFF 1T03A 5HQLA 3MUTP 1ROFA 2I5JB 3F41A 3GB0A 4DUYJ 2VC0A 2ZFHA 4F02A 2UVWA 1B0TA 2DGOA 3NGSA 3R97A 2J6TA 1ZH5A 3VVTA 2IFXA 4OYXA 3T5KA 3TANA 4QR0A 1SL2A 4OHWA 2BE2A 5HANA 4A8KA 2RUSA 2EFGA 2H5EA 4WFNQ 1WI8A 3D1HA 2VBYA 3V5RA 3Q8RB 3BH6B 4RU9A 4YDDB 1S5ZA 2BANB 2YNIB 4HVZA 1AXQA 1CS4A 1CJTA 1HNXF 4KPCA 3K8WA 1E6VB 3F73A 1NH8A 2DNOA 1HA1A 2O3DA 3BBFA 4MJKA 4PABA 4AL6A 3M8PA 2P8IA 3CO0P 2X1BA 3TP2A 4ZVTB 2QA2A 1HR0F 1L3KA 2K1RA 1QY7A 3ZFVA 1AFJA 4BHQA 1Q1KA 2HIQA 2ZEJA 3Q8YA 1I3OB 3PRVA 2YKQA 1KQKA 4F3QA 4TU9A 1KEKA 5T7LB 3ENAA 4K50A 2VA3A 4JI0F 5AE2A 5J1EB 1YJRA 3RBXA 3IA0A 4KGVB 4C8ZA 3R7SB 2DR8A 2K2PA 2HEKA 4CLYA 2IRUA 3CPWR 3NWRA 2B9EA 5FDLA 5EX0A 3QRPA 3UCGA 3D4JA 3SSQA 1TL3B 1J2VA 2N82B 2Q1LA 1DFDA 3PNIA 1XMQF 3CXCR 1R27B 5LL6d 1SC3B 2VASA 2XG8A 5DZ7A 3QJPA 1X9MA 2W2OP 1U8SA 1RWMB 3M8QA 3QIDA 3A13A 1RTJB 1N32F 4DSKA 1LWEB 1R7IA 5GAGU 2WBMA 2L48A 4J90A 2I9SA 1FDBA 1JNZB 4JI6J 3TA0A 3HHLC 3I9ZA 3KJFB 3UR0A 1X9WA 1RWVB 1FESA 1JJCB 2NZ4A 2CQDA 4RKUC 1UVMA 4O44B 1LNQA 1HYSB 3IC1A 4RWWA 1XMBA 3ICLA 2UXCJ 2QYCA 3IBFB 1HBOA 4MAKA 4ZVPB 3DI6B 2RRBA 4LRDA 3W9JA 1S97A 1U4BA 2PMWA 4KPYA 3CMAS 3IRWP 2MQPA 1RT5A 2ZUAA 2QJ3A 3IP0A 1PYTA 1WC0A 4DCJB 4ZOSA 2PI4A 2VA2A 2XGPA 2VICA 2WTFA 4IH5A 2C3OA 4RNFA 4KYZA 1PC5A 2DCLA 1Q8BA 2Z57B 5A76A 2QX0A 3MAQA 4KSEB 3U27A 5H9FJ 2HKEA 2GJ2A 3IM8A 1T9XA 1EQMA 2ZHAA 4L75A 3LP0A 2HFSA 3T5LA 2ZVSA 1KD1T 1FEHA 3KNAA 2W7PA 2W9CB 1UW9A 2BABA 2X1AA 3K5LA 2ZNZA 3J7AN 2HGLA 2OPPA 3KLIB 2DBBA 3RAMA 2U2FA 3H42A 4HYKA 3E3XA 2F9JA 3N5BA 1X8DA 3EPIA 4DQPA 4ED5A 1M1GA 1R8BA 2VBWA 4J91A 1NKBA 5DZ6A 4ERDA 2OTLS 2RF2B 1M5PC 4GKJF 2HYIB 1JXEA 3A12A 1Q5VA 4IDKB 2KL8A 1WSRA 3HMJG 4QU6A 2WSEC 1ZZNA 3TX8A 1SVDA 4TYBA 5ETRA 1I94J 3M6WA 3KLFB 4ECYA 3BPSP 4GVLA 1WOPA 3BKUA 1RABB 2CJKA 1S0NA 4F4XA 4F0KA 2YNGA 3EICA 5HI7A 5DG8A 3A8KA 1PGZA 4M5NA 3WIUA 5A8KA 2JOQA 2FHOB 2L41A 4OZ5A 2M4MA 1Q5YA 4DX6A 1MROB 5LSRA 2IDLA 2FHKA 4OZ1A 2GIQA 1QTMA 4DHVA 3KG1A 3HFZB 1OY9A 4DR3F 2NXNA 1HBNB 4JOUA 4X64J 1GNKA 2XO7A 2M0GB 3QWUA 4DPXA 3HSDA 4EWTA 2RS8A 2NPFA 2H5IB 3KLHA 1BQNB 1WF2A 3CCUS 3HVRA 3QAEA 2YQ1A 3MAAA 4A47A 1J5EF 4M63A 5B0GA 3RRKA 1S57A 4AQYF 1WHXA 3KLGB 3X3UA 4B9UA 4B3OA 3HD1A 2AYMA 3GG1A 5D78A 1VC6A 4ZP9A 3JTOA 1BMQB 5GAHI 4PAAA 1WC1A 3VALA 1YZ6A 2R8JA 1EX8A 2LVWA 3IMQJ 1LWCB 4K8RA 1SBRA 2GCFA 2AX0A 1NDKA 1XJWB 1ZM9A 3CD7A 3M1VA 1J5OB 2FC9A 4C0OC 3J7YU 2RHQB 3POTB 4K4ZA 3QFWA 4ETXA 3EVMA 3TI0A 3LF0A 4FPIA 4K7QA 5FJ4A 1FKOA 4G1QB 5KFGA 3W2WA 4ED0A 2AYGA 1M5HA 1N4LA 1RTDA 1XMOF 1A0OB 1NZAA 3FFIB 1AUDA 4DV7J 3GE9A 4NLUA 4UTGA 1OY6A 4NZ6A 4JI1F 4DV6F 3H5UA 2GVDA 1D9AA 1FWKA 2CQGA 2ILYA 4X4OA 4NI2B 2E1CA 4PG4A 3KJVB 4K5RA 2B4VA 3GIJA 4Z37A 3G71S 2LQ8A 5KT7A 5E3PA 4J37A 3JAMU 3IWLA 3BGUA 1TKZA 4KQZA 2M9KA 1MN9A 4CO5A 2LMIA 4WYWA 2RSQA 2BE9B 3H20A 1EJ7L 1NJYA 1NDLA 3V6JA 2E5IA 4ELVA 2BR0A 5KFIA 1FNOA 1TFWA 3V4MA 1O5JA 1U1OA 2UZAA 2WAQD 3AOAA 2JH3A 4OIXA 4CO3A 3NAIA 1IQZA 4RX6A 4WFAQ 2GO9A 2WK4A 2VPYB 3D68A 1K0TA 3GV8B 1SKSA 4OX9F 3EX7B 1MU2A 4LUBA 1WNEA 2N7CA 4ZMMA 2DH9A 2GHPA 4F4KA 1ZTTA 5CYQA 1X9SA 1VBZA 1QTNB 1UFWA 3DNCA 2XLIA 2HHQA 3ZNUA 2EK1A 2MPUA 3TRGA 1TP7A 2CPZA 1H3DA 3FMWA 3LP1B 2HS4A 1BE4A 1M5OC 1XNRJ 1V6HA 2F63A 1FFSB 3ENQA 4RW6A 1H6KX 1T05A 4LFAF 1JLQA 4C6AA 2RT3A 4HDGA 2FB0A 2W25A 4KH0B 4B9TA 3MMAA 2HHWA 5EWGA 2V4JA 3NGDA 3SCJE 1RT1A 1SC1B 2VHGA 1ZAVA 4M5LA 1FA0A 4WK1A 3OUYA 3PFOA 4EZ9A 3K0JA 2XSFA 2UUTA 3IBWA 2HRYA 5CCMA 3TW0A 1Q95G 3L95X 2YXLA 4RW8B 1S1XA 1TL4A 4N76A 1VLYA 4JI8J 1SPBP 2PDAA 2ZC3A 3NKYA 2DEJA 4PUOA 3C6TB 5D6GA 3NGTA 2I8EA 4HH1A 4UOGA 1FERA 1U6BA 2JFKA 4I0WA 1CULA 1NM2A 1QVGR 5HVGA 1F0XA 1L3UA 4ZPBA 4OV6A 5FLXY 1YWXA 4ALZA 3JTPA 4RNMA 1DRZA 2IIHA 3NCPA 3ZXWA 2UVVA 3AD7C 3KDOA 1RYSA 4ZJQA 3O1LA 2VL1A 2DHGA 3O3LA 3BSCA 3T5JA 1W7WA 3I0SA 3ADAC 2YWGA 2E7VA 2NUUG 3EJMA 1YHQS 4QWAA 3RZAA 1G4CA 1NCLA 1S9EB 3H2LA 3UR3C 4NYPA 4TU7A 2XY7A 3U7JA 3WDOA 2DKOB 1RI7A 4DUYF 1N5YA 4HI1A 2DR5A 4CM0A 2RMLA 2H4WB 1TUGB 3DOLB 3VAFA 2I0XA 1CJVA 2R7VA
chains in the Genus database with same CATH topology
5KFVA 1JJ4A 1FRMA 1S6QA 2YKMA 3UD3P 4IH6A 5HMXA 1N5QA 2VG5B 5THWA 4BCAA 5HLFA 1S9EA 1WHYA 4PQAA 2E7XA 4XIUA 4NA3A 1ZAWA 2B6AB 4PXBA 2KB2A 2DHXA 1KONA 2VFUA 4XO0A 2YWHA 2V5HG 2I1RA 3OTEA 5A0YA 2R9LA 3NMRA 3I55S 4QQBA 2AJ0A 3IRXB 2KXFA 2DJWA 2GW8A 5GAGI 1HHTP 4I7FA 3I6PA 2D3ZA 4ECRA 4RLEA 1VOMA 1NRKA 2AWZA 3DHWC 2OPRA 1RT2B 3SSRA 3TAMA 1Z2ZA 2DNKA 2DVIA 1IBKF 2DPJA 4R5PB 3W2VB 2CKWA 5C24B 2B0GA 4NCGA 2LQJA 2L08A 1HL6A 3KNGA 4WK3A 1KLMA 4D3GA 5KFMA 2ZITA 3CJ0A 3LP2B 5CD4H 3MUMP 4C3MA 2MY7A 4X4RA 4YR3A 1CG2A 4ECWA 3PW7A 5BYRA 2ZH5A 2BQ3A 4RU2A 2JEFA 4ED3A 3HK2A 4AL7A 5J2MA 3SQGB 4CI0B 3Q24A 3QGGA 4A8WA 1XWLA 3JSRA 2W7OA 3P96A 1SJQA 3OHAA 3TOQA 1LXNA 1U24A 3I87A 5ITHA 2YX7A 3CWJA 3DOLA 4RUAA 2J0QD 4PWDB 4CT9A 3DHXA 1Q86T 2IAJB 2CQ4A 4BWJA 4E8UA 2V4RA 3GV5B 3J7A1 2KT5A 5DDOC 2P9GA 2VG5A 4NL5A 3PACA 2PT0A 4HLBA 4RW7B 2B6AA 1U1MA 1IKWB 2J7KA 3GYNA 5KFJA 4ED1A 3DRSA 2GQ2A 3FRYA 3OXFA 3HPOA 2R7UA 2NSBA 3KLHB 5F8IA 1U48A 1DAXA 1Q78A 3MOJB 1UETA 3IRXA 3TVYA 4NA1A 1GXTA 2VFTA 2JVRA 1IJEB 1G3OA 3BSNA 3FRZA 1RT2A 5JVGQ 2CPDA 3PDNA 4WCEQ 5K8OA 5HMYA 5HROB 2XLJA 1L5UA 4R5PA 5C24A 5LMUF 1VIXA 5DQIA 2MZQA 4DS4A 1KNZA 1S4FA 4HTJA 2FLLA 2LXIA 4QU7A 3KG0A 2HG4A 4DQQA 2AGQA 2J7WA 3LP2A 4DV5F 1QSSA 2LA6A 1REVA 4DOZA 2PC6A 4FBUA 1KFDA 2HWHA 3DLGB 2EW9A 3SQGA 3I0RB 3NP5A 2HWIA 2ASYA 3CULA 2JVOA 2DRAA 4PWDA 4TY8A 3PEHA 2NQPA 3VQTA 3J80Y 1SL1A 2MY8A 3FQKA 4YY3F 3K5OA 4C0BA 1YJNS 1HW9A 2R7RA 1JLGA 2IAJA 1LV5A 1QLNA 5F0WA 3S6EA 2DH7A 2D3UA 4K4WA 3DLJA 3NMAA 1S79A 2XZWA 4TXSA 3DLLQ 2Z2LA 1DHMA 1D8ZA 1RQ0A 2KRBA 4MK7A 1IKWA 2GV1A 1WEZA 2RRNA 4DR1F 2L9WA 1JKHB 3AAWB 4UW2A 2K3KA 2ABYA 1XNRF 2YQ3A 2D3OR 1JNRB 3QWPA 5EUHA 4N77A 5KG4A 3Q8PB 3HO1A 3DLHA 2F3JA 3JYTB 5E3AA 2R8HA 2EBEA 2ZOFA 1RTIA 3PVXA 1TZ0A 4OJGA 2ZJQQ 1X4EA 5HROA 2EG2A 2HFZA 4DG1B 1IN0A 5KFUA 5KG2A 2NXUA 2MSSA 3Q22A 1IBMF 2JZ5A 4QIVA 3CCVS 2DT9A 3PW4A 2YX1A 3PO4A 3H2VE 4CH7A 1LOUA 3I0RA 4K5SA 2WB4A 5J2PA 1HD1A 1FKPB 4I4BA 1UEUA 4DMZA 2Y1JA 4PRFA 2GA7A 4LVOP 1X4CA 2YWFA 4MFBB 2BUNA 4I69A 4YB1P 2ZE2B 4IRCA 1KTVA 3KFWX 3WX4A 1G1XA 4OHXA 4BS2A 4X84A 3SI8A 3IR7B 3BEGB 3T19A 2B43A 2CFXA 3QGHA 4O3SA 1R3NA 2FJWA 2EVZA 4KR0B 2RKIB 3DM2A 2B4PA 4I6YA 1JKHA 5I3UB 3D2WA 2ZH8A 4KHMA 5J2QB 2P5VA 1GTHA 2PO4A 1VQ7S 3UCZP 3LPYA 4WFXA 2HMIA 2ZC4A 4OI3A 2F1FA 4ED2A 3RBEA 2XS2A 1NU4A 3OHBA 3PM9A 3JYTA 1S48A 2LDIA 3BO2A 3EZ5A 2F40A 4BC7A 2GHVC 1FTCA 3FGVA 4JI6F 3QYYA 2FHMA 2XI2A 1FXLA 1QUVA 1U2FA 1DARA 4F2RA 4FVCA 2BZ2A 1M0SA 3GR0A 1KS2A 2IM2A 3OBIA 4ZCKA 1NK6A 5KFHA 3ITHB 1V3RA 2IYGA 5T14A 1SL0A 5KFEA 2DIVA 4FN5A 1VQ8S 3Q8QB 4QIFA 3G6ES 4RNOA 1UL3A 1YJTA 2Y0SD 4URSA 3AB4B 1MNEA 2IVYA 3MHYA 2C2RA 2F8HA 1FKPA 3DOMA 2GFFA 2CG4A 3M4XA 3V81B 2A3JA 1BLUA 4Y2AA 3I5AA 1S6PB 2J76E 2O5DA 4GO5X 2QA4S 3HHDA 3CO9A 2KT3A 4ZCIA 4DL4A 1UA1A 3FEXB 1TVRB 4RW9B 3FSIA 1QSLA 3PXGa 2R7WA 2UXCF 4AXIA 3PKMA 3KMQA 4DR7F 4JUZA 5EGYA 4GO7X 1FXRA 2RKIA 1X4DA 2BQUA 5J2QA 5I3UA 2PGCA 1WHWA 1OQ3A 3FDSA 2EBGA 3IR5B 3N5FA 4OHZA 1Y4ZB 1P27B 3CTRA 2W8KA 3BSOA 1PSDA 2DGWA 3CDUA 4X4TA 4WU2A 1HI1A 1N88A 4Y00A 1HD0A 2W7AA 2Q6BA 4QJVA 3RW7A 5MAOA 4DQIA 2AP6A 3VQSA 2MZTA 3RB0A 4DR4F 1HBUB 3N79A 5GVQA 4Q5VA 4NXMF 4CNYA 2GMHA 2BJEA 1RJJA 1HQEB 2F9DA 3ITHA 5K14B 4EGLA 1BGXT 4JI3F 4TN2A 1WI6A 2DGVA 2RH3A 5C25B 3OL8A 2HHVA 4J9QA 3T1HF 4O23A 3MTKA 1NJZA 2OTJS 4I6WA 4QWBA 1U2RA 3TAPA 2QRRA 1YSJA 3AJ1A 3L7OA 3RR7A 4J9KA 2ZH1A 1GH8A 4ILMA 1S6PA 1WWHA 5J1NA 4QIGA 1TVRA 4RW9A 3BGRB 2DK2A 5F8MA 1V9OA 3AA8A 2GJIA 4PXCA 5F8GA 4B17A 1Y7PA 1P1LA 2QE5A 4IQMA 2J6UA 1UVJA 5KFNA 3HZGA 1S77D 2XS5A 4IO9Q 3PX4A 2DNGA 2J9CA 4A8YA 1HI8A 2V2KA 4DR6F 2OAUA 2RQKA 4FBTA 4U9RA 2ERRA 3N4WA 3ZC4A 2DPIA 2VH7A 3M9OB 1HBUA 2ZHBA 4NRTA 1KLNA 3FMBA 2ZH6A 1UJ5A 4UY8T 3CCES 1HQEA 3IG1A 5KT5A 1SI9A 4USHA 5K14A 3K57A 3PW2A 2DGSA 4NCBA 3MM9A 1RDRA 3ENWA 4NLWA 5I3QA 2XCAA 1IBLF 1JJ2R 3KLEB 2C22A 5CH7B 2DNRA 3CF5Q 4WZQA 5A8RB 5C5JA 1SJFA 4F4ZA 4M94A 1HNIB 1S0MA 1NK7A 2C3PA 2VUGA 1TL5A 1FTRA 1RT4B 4Z2XA 3BGRA 4FZVA 4QW8A 4R0JA 2H9ZA 1FE4A 1Q4RA 2OMOA 1M5VC 1FDNA 2D41A 1NEEA 3ZZOA 1JIHA 1FRHA 2DGUA 2ZH9A 5D3GB 4JV2A 4YR0A 3I32A 2FIUA 1ULRA 4JBCA 5H1SV 3BJYA 1LWFA 1VQKS 3CCTA 2UVUA 2G1DA 2V4JB 4X4NA 2KDOA 3TVZA 2RILA 5GMKa 2OP5A 3GYXB 2P6SA 5EN1A 3CIZA 4WIIA 3MCSA 2YX4A 3C66A 4C7QA 4ZHRB 4DR5F 1SB6A 1X0PA 2M8DB 4QR2A 3PW0A 4ES2A 2MDAA 2YNIA 2DO0A 3NL0A 2BA9A 4MIAA 1N0VC 2ROEA 4QZVB 2VPXB 3NBPB 3M6XA 4D3HA 1UFLA 1O8BA 2CYYA 4LF6F 2JC0A 2RE1A 3SCLE 1YRTA 1NH7A 5KFTA 1NK0A 1Y5IB 4HKQA 3HX9A 2YY3A 3M30A 3J7YI 3KLEA 2QLWA 2DR7A 1UA0A 4ZDNA 1KOOA 2JL9A 2IA0A 1R89A 3OLBA 4KB7A 2RS2A 4NYZA 2AJQA 3MM5A 1Q8IA 3PV8A 5A8RA 2WBRA 4TYAA 4KGKA 2X3GA 3V6HA 3E2EA 1YGYA 1XTZA 4LSNB 1HNIA 4CQ1A 4C3KA 3CCSS 1D9FA 1RT4A 1CLFA 2UV8G 3O5TB 3QO9B 1H2VZ 3JSYA 2HVHA 2A2CA 4DSJA 2VOOA 1XBWA 2VG7A 3AY0A 3BGFA 5GAEU 3DU5A 4ECXA 4A8FA 2XLKA 3NLCA 2UP1A 2DNYA 5HMZA 1UP1A 2QA1A 1GT8A 4FVMA 2KRRA 3AB2B 2AW0A 2E9RX 2HW3A 1KQFB 3U1LA 4NLSA 4ZCMA 1RKIA 4GMKA 5E33A 2IRYA 4OJ1A 1B64A 2AJ4A 3LQVA 2ZJPQ 3RB3A 1F9FA 1VI7A 3G6XA 4WTYA 5A8WB 4ZHRA 3BR9A 3VTIA 2XWYA 4RBVA 5L1LA 2GQQA 5KT6A 3T6BA 1VQNS 3NRBA 1UAWA 2Q66A 5DLFA 1TFYA 3VZHA 3H5YA 1QAXA 4FXWA 4OI0A 4W92B 2HPUA 3NBPA 5IQQA 4EBDA 2FLPA 3OTCA 1FRKA 4YR2A 5F8HA 1SJRA 1ZZFA 2FHJD 1A6LA 1S1TB 2O1PA 3DDNA 3MM6B 3PJXA 4ZVEA 4TU8A 3OTOF 3QJLA 1URNA 1WG4A 4QWEA 1RGVA 1VHFA 3MECB 4C97A 4ZLPA 3MPYA 2RVJA 4OX8A 4YFUA 2NS1B 2UUWA 3UD4P 1FJEB 1ZM4A 3KK2B 4IOAQ 2RUGA 4A46A 1FNXH 2KM8B 6FDRA 5DDPC 2OIHA 4NRUA 1YITS 5JXSA 4DV2F 2UXDF 3HJFA 1FJ7A 1IKYB 2ZKTA 5CQGA 4FXVA 3HXMA 3DN9A 4ECVA 1S7HA 1U49A 2YNFA 2ZD1A 1HI0P 1APSA 2PN6A 3CJ3A 1FRIA 3KK3B 1LW2B 4OFZA 4Q43A 2AQ4A 3I31A 5K9FA 3NCQA 2PI5A 2XBPA 5CYMB 2UU9F 3QO9A 4ZVHA 4J9PA 3K5PA 3C6UA 3EGNA 3MM7B 3CCJS 2ZBCA 1DURA 1K1SA 2E7WA 4QWCA 4ECSA 3ZZZA 3DC2A 2QFJA 2G0CA 3BQ0A 5E7OB 3NWGA 2YKAA 1XNQF 2R7SA 5CHCB 2HHUA 2FJAB 2Y1IA 3CGIA 2L9NA 1ZOTA 2XS7A 1TKTB 3OLAA 2PFFB 3FNNA 3M2VB 5A8WA 2L9DA 2GGPB 2W4DA 5F9NA 3TUZC 2Q6CA 4OQJA 4F25A 3UFCX 4NLPA 3RW6A 4R25A 2Q79A 1FD2A 3MEGB 3EUNA 3OFHA 4X64F 2XCPA 4HL9A 2C2DA 4Q44A 3IGVA 5IFMA 1B0VA 1NK4A 2KI2A 2DHSA 1S1UB 4TY9A 3PR5B 1W2BR 3MM6A 2VG6B 3I9V9 1I6JA 2VQEF 2J0SD 3QGIA 5E0OA 2WONB 3MECA 4WJBA 5IWAF 4K0KF 3KK2A 2PIIA 3KHRA 1XC9A 5LXRA 2ASLA 2AGPA 3W3SA 4B02A 2CVIA 4O4RA 4URQU 4I1TA 1QE1A 1DJ0A 4YB6A 1Y9OA 1C4AA 2B9XA 1HW8A 1X5SA 3BSAA 3CUNA 3I0SB 4UQTA 3CCQS 5M2RA 1LW2A 2DIUA 2HS0A 2OO4A 2VPZB 2LDYA 2YKNA 4HT5A 4MK9A 4AUKA 1NNDA 1NJWA 2W4PA 1KHWA 1L3VA 3NNAA 1JLEB 2Y1RI 3MM7A 5F8JA 2GMLA 4J9OA 4DL7A 4ZPDA 1S1VB 2DNZA 1DQ9A 2RQCA 3LH2S 1TKXB 1TKDA 1YJVA 1HWJA 1C1BB 4ED7A 1TKTA 2X1FA 4DV1F 3P49B 2GGPA 2OPSB 4GC7A 1NKCA 3VCDA 5BYSA 1VS3A 3DRRB 1RP5A 2QA4G 4OX7A 3MEGA 4X62F 3CDAA 1VC5A 2EG1A 3H5SA 4AE5A 1N36F 1S1UA 4K4TA 2CJ9A 4JV1A 4Q0BB 2NREA 4LIWA 2WONA 1FO1A 3QIPB 1Q7LB 3UNGC 3C3LA 3MWBA 4G3IA 4NLOA 3KLVA 2FJDB 2J7UA 3A8EA 1VIOA 4NMLA 4USIA 3UDLA 2C28A 3QMQA 4ZPCA 3MEEB 1TK8A 5IM0B 2MKCA 1SIZA 1BQXA 2RDIA 1RAJA 2R7OA 2JJ4D 4CIOA 2C2EA 5I42B 4EBCA 3OVBA 2FC8A