2RSTA

Nmr structure of the c-terminal domain of ew29
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
132
structure length
132
Chain Sequence
MKPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 29-kDa galactose-binding lectin
publication title NMR structure and dynamics of the C-terminal domain of R-type lectin from the earthworm Lumbricus terrestris
pubmed doi rcsb
source organism Lumbricus terrestris
molecule tags Sugar binding protein
total genus 22
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2rstA00
4OEFA 1J0SA 4USOA 3OBRA 1I1BA 4A7YA 3N7JA 4AN7B 1S0BA 1D0HA 2LIQA 1S0CA 4ISRA 2D7RA 2D7IA 4OEEA 4GAFA 4LO1A 1K5VA 4HA2A 1BLAA 1FN0A 4ZKTB 4J2KA 4LO2C 4I4XA 2R9KB 4H9WA 3V0AA 5FNXA 3VT1A 3O44A 4Z8SB 2AXMA 1S0FA 1WD3A 3F62B 1L2HA 4QKRA 7I1BA 3FUOA 4Q9PA 4FGFA 1XZZA 3BAOA 4XFSA 3FUQA 3BAQA 3QYDA 4ZFWB 3UD8A 4J23B 3POKA 1IHKA 4OW4A 4H04A 5BVPI 4G9NA 3BRGC 3FJCA 2DREA 1P63A 1WD4A 4IY9A 4P0KA 1JT3A 1ISWA 5F8WA 3OBTA 3NBEA 1DJSB 3HSMA 3I29B 4FVVA 1RZOB 5BQUC 41BIA 2AQZA 3HBWA 1AXMA 1DZCA 1BFBA 1TFMB 2BFHA 3O3QA 3ILAA 8I1BA 1AF9A 3O4OA 4I3NA 1HWNB 2E4MC 4I37A 3ZC9A 2FO1A 1S0DA 4QD2C 2YUGA 4J2XA 4KC3A 3V79C 2D43A 4QALA 4L4IA 3V0BB 5BXRA 2HZ9A 3AKIA 3T8SA 3FFZA 3K1XA 3OJ2A 4I0YA 5BXPA 4L4HA 3CAHA 3O5WB 5F8SA 1MC9A 3I2XA 2DRZA 3BX1C 3MPPG 4F34A 5F8YA 3W9TA 4OWKA 3N0KA 3UD9A 4G1RA 3O4CA 4KEIA 4I96A 4J2YA 5EC5A 4DCKC 3UD7A 2D1ZA 4EEEB 3RMXA 2LIEA 4LO8B 3FJKA 3RSJA 3AZWA 1FMMS 1YTOA 4ZLBB 2Q9XA 3BA7A 3CA0A 4EFPA 3NBDA 1RY7A 4ZA3B 4X3AA 4Z9WB 4GOVA 1TIEA 1DQOA 4A7KA 1JLYA 3OGFA 5EHAA 2NP0A 1JT4A 3IM7A 1ISXA 5JMCA 4II0A 3MALA 2ZR1B 3BAUA 1JTCA 4KBBA 4KEJA 1G9BA 1HWMB 1Z4SA 2VLCA 2NM1A 1BA7A 4I8MA 4LO3A 1SR4A 1NUNA 1II4A 1W3FA 3AH2A 1BARA 2FFUA 3PUBA 3Q7WA 2X2TA 4IYBA 3UJ0A 1DIWA 1S0LA 4I1EA 4WBCA 1M16A 1MD6A 4QBCA 2Z48A 3VUOA 3F1RA 4GOYA 1JLXA 1IRPA 3CA4A 1S0GA 4X38A 3WMUA 3VSFA 4KEKA 1AVUA 1FV2A 5D62A 3BAVA 3CQAA 1JQZA 1XYFA 2QYIB 1FWVA 1BFFA 3BTAA 3RTJB 1R8NA 2UUSA 2K4AB 3HOMA 3HN1A 2K43A 1YXWA 4HR6C 5F90A 1A8DA 3AJ5A 3FJFA 5B2HA 4Q91A 3VWCA 4ENDA 1HCEA 3OJVA 5BOWA 3VSZA 2Q3NB 1K5UA 3FJ8A 2RSTA 3D7WB 21BIA 2KKIA 3BA4A 4I2SA 4ZFYB 2IHOA 4D0TA 3H6RB 3UDAA 3FJBA 2RQ9A 2ZQNA 1IILA 3WINA 2VSEA 2NZ9A 3ZC8A 1BLDA 1WBAA 1PC8B 1Q1UA 3FJEA 3I2AA 4GP0A 4EKXB 3LLPA 1ISVA 4OUJA 1T4QA 3FJDA 3IIRA 3EF2A 3RTIB 3PG0A 2HWAA 4LO3C 1W3AA 3N7LA 2L5XA 3O4AA 1YBIA 3FJHA 3OGGA 3R4UA 1PUUB 2AFGA 5G00A 1S0EA 3KMVA 3A07A 4TLPA 1ISZA 2F2FA 2MLLB 4ZBVB 1WBCA 3AKGA 4AN6A 3P53A 1EVTA 5I1BA 2KI6B 4I4RA 1ONKB 3S8JA 1XG6A 5DSSB 4LO1C 1V6XA 1IRAX 1TOOA 1CE7B 4D8HA 1T9FA 31BIA 1BASA 5HPZA 5FNWA 1AVWB 5D63A 3H6SE 2GO2A 2VUAA 1EV2A 4LO0A 4YOLA 2K8RA 4LO7C 1Z2VA 4EB2B 2VXRA 4IY8A 3BA5A 4QKSA 9ILBA 2J3PA 5BXTA 4X39A 4G6JA 4EFRA 1DLLA 3H6RA 2I1BA 3FJIA 4IZEA 1RG8A 1TWEA 3FJJA 3CRGA 4ZGRB 4QD2B 4I4SA 1IT0A 3HMYA 4I7IA 3O4DA 3WO3A 1HIBA 1SZ6B 3BRDA 4I4QA 3V0AB 1BFCA 1V6VA 3B9UA 4XFTA 3O4BA 2AAIB 2NTDA 4OWJA 2D24A 3CU1B 3FJAA 2Y9FA 1QQLA 1DQGA 2NVHA 5BXSA 4LO2A 5FZYA 2WBCA 3AH4A 3IM5A 4JRAA 2DRYA 3PHZA 2GZBA 3UJ4A 2FFVA 2XOAA 4R6UB 3Q7YA 3CA6A 5FZUA 4QO3A 5BP5A 1DZDA 3BRFA 1DFQA 2KH2A 4DEPA 1NZKA 4LO0C 3CA3A 4X37A 3V0BA 4OWLA 3TC2A 1FGAA 4J2SA 4OEGA 1Q03A 3NBNA 3JUTA 1OQLB 4JAWA 1QQKA 1JY0A 4HJJA 4IHZA 4USPA 4DENA 4CJMA 3ZX7A 6I1BA 2P39A 5BQUA 3ZXGA 4GAIA 1AVAC 2HWMA 3WA1A 1JT7A 4QC4A 3BAGA 1AVXB 4I4VA 2E4MA 1DFCA 1V6UA 2M49A 1Q04A 2IWTB 1ITBA 3WO2A 2Z49A 1PUMB 3SNVA 2D44A 4XKIA 4QBVA 1M2TB 4XFUA 3CA5A 1SR4C 1HWPB 3BAHA 3Q7XA 2BEAA 4IONA 5DUYA 1IOBA 3AZVA 1IJTA 4GP3A 2RG9B 4ISQA 3FGMA 1XHBA 3E8LC 3FJ9A 4Q9GA 2X2SA 5BP5C 3OJMA 3CRHA 1UPSA 2WRYA 1W3GA 1G9DA 3IAGC 1FMZA 3S8KA 1N4KA 1HCDA 1F31A 4JKXB 5DVHA 1GGPB 5FZZA 2VU9A 3AJ6A 3JRRA 2HW9A 1Z0HA 2ERMA 1G9CA 4I4PA 4D0ZA 2F8XC 1I1EA 4ZFUB 2Y9WC 3AH1A 5EG6C 1E0OA 2D22A 2ZQOA 1KNMA 4G9MA 1JT5A 4PC4A 2KLLA 1TTUA 3VT0A 3AKFA 2Y9XE 1ABRB 1R8OA 1ISYA 3WINC 2P23A 4P0LA 1QXMA 1EYLA 1G9AA 4P0JA 2DS0A 2QN4A 5GAQA 3H6QA 2Y9GA 3P6IA 3VT2A 1CVSA 2MIBA 4I4YA 1TWMA 3IM6A 4IZXA 3NJ5A 3O49A 2FDBM 3NBCA 3A21A 1G82A 3P6JA 4G6MA 4I1BA 5DZUA 1FWUA 3HALA 4I4UA 1YF8B 4ZOTA 3C9ZA 2F2FC 4LO7B 1AFCA 3WMVA 3VEQA 4JPZA 2VSAA 1FV3A 2VXTI 3A23A 1V6WA 3BB2A 3R4SA 4JQ0A 1EPWA 1BFGA 3QR5A 2BEBA 5JLVA 1PZZA 1VCLA 1YYNA 3N7MA 3RMYA 2ET2A 4P6AA 4EFQA 1PWAA 5D61A 2MC2A 4I6IA 4A7ZA 2KI4A 4JP0A 3ZXDA 3N7KA 3LTQA 3WO4A 3A22A 2FGFA 5E24E 2ESUA 2NYYA 3CRIA 1HWOB 4IQPA 3CA1A 2D23A 3AKHA 4F83A 3BADA 1FQ9A 4I4OA 1RMLA 4JKQA 1HKNA 3PMEA 1ILR1 2D20A 1TP0A
chains in the Genus database with same CATH superfamily
4OEFA 1J0SA 4USOA 3OBRA 1I1BA 2NS2A 3N7JA 4A7YA 4AN7B 1S0BA 1D0HA 2LIQA 1S0CA 4ISRA 2D7RA 2D7IA 4OEEA 4GAFA 4LO1A 1K5VA 4HA2A 1BLAA 1FN0A 4ZKTB 4J2KA 4LO2C 4I4XA 2R9KB 4H9WA 3V0AA 5FNXA 3VT1A 3O44A 4Z8SB 2AXMA 1S0FA 1WD3A 3F62B 1L2HA 4QKRA 7I1BA 3FUOA 4Q9PA 4FGFA 1XZZA 3BAOA 4XFSA 3FUQA 3BAQA 3QYDA 4ZFWB 3UD8A 4J23B 3POKA 1IHKA 4OW4A 4H04A 5BVPI 4G9NA 3BRGC 3FJCA 2DREA 1P63A 1WD4A 4IY9A 4P0KA 1JT3A 1ISWA 5F8WA 3OBTA 3NBEA 1DJSB 3HSMA 3I29B 4FVVA 1RZOB 5BQUC 41BIA 2AQZA 3HBWA 1AXMA 1DZCA 1BFBA 1TFMB 2BFHA 3O3QA 3ILAA 8I1BA 1AF9A 3O4OA 4I3NA 1HWNB 2E4MC 4I37A 3ZC9A 2FO1A 1S0DA 4QD2C 2YUGA 4J2XA 4KC3A 3V79C 2D43A 4QALA 4L4IA 3V0BB 5BXRA 2HZ9A 3AKIA 3T8SA 3FFZA 3K1XA 3OJ2A 4I0YA 5BXPA 4L4HA 3CAHA 3O5WB 4MZGB 5F8SA 1MC9A 3I2XA 2DRZA 3BX1C 3MPPG 4F34A 5F8YA 3W9TA 4OWKA 3N0KA 3UD9A 4G1RA 3O4CA 4KEIA 4I96A 4J2YA 5EC5A 4DCKC 3UD7A 2D1ZA 4EEEB 3RMXA 2LIEA 4LO8B 3FJKA 3RSJA 3AZWA 1FMMS 1YTOA 4ZLBB 2Q9XA 3BA7A 3CA0A 4EFPA 3NBDA 1RY7A 4ZA3B 4X3AA 4Z9WB 4GOVA 1TIEA 1DQOA 4A7KA 1JLYA 3OGFA 5EHAA 2NP0A 1JT4A 3IM7A 1ISXA 5JMCA 4II0A 3MALA 2ZR1B 3BAUA 1JTCA 4KBBA 4KEJA 1G9BA 1HWMB 1Z4SA 2VLCA 2NM1A 1BA7A 4I8MA 4LO3A 1SR4A 1NUNA 1II4A 1W3FA 3AH2A 1BARA 2FFUA 3PUBA 3Q7WA 2X2TA 4IYBA 3UJ0A 1DIWA 1S0LA 4I1EA 4WBCA 1M16A 1MD6A 4QBCA 2Z48A 3VUOA 3F1RA 4GOYA 1JLXA 1IRPA 3CA4A 1S0GA 4X38A 3WMUA 3VSFA 4KEKA 1AVUA 1FV2A 5D62A 3BAVA 3CQAA 1JQZA 1XYFA 2QYIB 1FWVA 1BFFA 3BTAA 3RTJB 1R8NA 2UUSA 2K4AB 3HOMA 3HN1A 2K43A 1YXWA 4HR6C 5F90A 1A8DA 3AJ5A 3FJFA 5B2HA 4Q91A 3VWCA 4ENDA 1HCEA 3OJVA 5BOWA 3VSZA 2Q3NB 1K5UA 3FJ8A 2RSTA 3D7WB 21BIA 2KKIA 3BA4A 4I2SA 4MZFB 4ZFYB 2IHOA 4D0TA 3H6RB 3UDAA 3FJBA 2RQ9A 2ZQNA 1IILA 3WINA 2VSEA 2NZ9A 3ZC8A 1BLDA 1WBAA 1PC8B 1Q1UA 3FJEA 3I2AA 4GP0A 4EKXB 3LLPA 1ISVA 4OUJA 1T4QA 3FJDA 3IIRA 3EF2A 3RTIB 3PG0A 2HWAA 4LO3C 1W3AA 3N7LA 2L5XA 3O4AA 1YBIA 3FJHA 3OGGA 3R4UA 1PUUB 2AFGA 5G00A 1S0EA 3KMVA 3A07A 4TLPA 1ISZA 2F2FA 2MLLB 4ZBVB 1WBCA 3AKGA 4AN6A 3P53A 1EVTA 5I1BA 2KI6B 4I4RA 1ONKB 3S8JA 1XG6A 5DSSB 4LO1C 4MZHA 1V6XA 1IRAX 1TOOA 1CE7B 4D8HA 1T9FA 31BIA 1BASA 5HPZA 5FNWA 1AVWB 5D63A 3H6SE 2GO2A 2VUAA 1EV2A 4LO0A 4YOLA 2K8RA 4LO7C 1Z2VA 4EB2B 2VXRA 4IY8A 3BA5A 4QKSA 9ILBA 2J3PA 5BXTA 4X39A 4G6JA 4EFRA 1DLLA 3H6RA 2I1BA 3FJIA 4IZEA 1RG8A 1TWEA 3FJJA 3CRGA 4ZGRB 4QD2B 4I4SA 1IT0A 3HMYA 4I7IA 3O4DA 3WO3A 1HIBA 1SZ6B 3BRDA 4I4QA 3V0AB 1BFCA 1V6VA 3B9UA 4XFTA 3O4BA 2AAIB 2NTDA 4OWJA 2D24A 4H75A 3CU1B 3FJAA 2Y9FA 1QQLA 1DQGA 2NVHA 5BXSA 4LO2A 5FZYA 2WBCA 3AH4A 3IM5A 4JRAA 2DRYA 3PHZA 2GZBA 3UJ4A 2FFVA 2XOAA 4R6UB 3Q7YA 3CA6A 5FZUA 4QO3A 5BP5A 1DZDA 3BRFA 1DFQA 2KH2A 4DEPA 1NZKA 4LO0C 3CA3A 4X37A 3V0BA 4OWLA 3TC2A 1FGAA 4J2SA 4OEGA 1Q03A 3NBNA 3JUTA 1OQLB 4JAWA 1QQKA 1JY0A 4HJJA 4IHZA 4USPA 4DENA 4CJMA 3ZX7A 6I1BA 2P39A 5BQUA 3ZXGA 4GAIA 1AVAC 2HWMA 3WA1A 1JT7A 4QC4A 3BAGA 1AVXB 4I4VA 2E4MA 1DFCA 1V6UA 2M49A 1Q04A 2IWTB 1ITBA 3WO2A 2Z49A 1PUMB 3SNVA 2D44A 4XKIA 4QBVA 1M2TB 4XFUA 3CA5A 1SR4C 1HWPB 3BAHA 3Q7XA 2BEAA 4IONA 5DUYA 1IOBA 3AZVA 1IJTA 4GP3A 2RG9B 4ISQA 3FGMA 1XHBA 3E8LC 3FJ9A 4Q9GA 2X2SA 5BP5C 3OJMA 3CRHA 1UPSA 2WRYA 1W3GA 1G9DA 3IAGC 1FMZA 3S8KA 1N4KA 1HCDA 1F31A 4JKXB 5DVHA 1GGPB 5FZZA 2VU9A 3AJ6A 3JRRA 2HW9A 1Z0HA 2ERMA 1G9CA 4I4PA 4D0ZA 2F8XC 1I1EA 4ZFUB 2Y9WC 3AH1A 5EG6C 1E0OA 2D22A 2ZQOA 1KNMA 4G9MA 1JT5A 4PC4A 2KLLA 1TTUA 3VT0A 3AKFA 2Y9XE 1ABRB 1R8OA 1ISYA 3WINC 2P23A 4P0LA 1QXMA 1EYLA 1G9AA 4UY4A 4P0JA 2DS0A 2QN4A 5GAQA 3H6QA 2Y9GA 3P6IA 3VT2A 1CVSA 2MIBA 4I4YA 1TWMA 3IM6A 4IZXA 3NJ5A 3O49A 2FDBM 3NBCA 3A21A 1G82A 3P6JA 4G6MA 4I1BA 5DZUA 1FWUA 3HALA 4I4UA 1YF8B 4ZOTA 3C9ZA 2F2FC 4LO7B 1AFCA 3WMVA 3VEQA 4JPZA 2VSAA 1FV3A 2VXTI 3A23A 1V6WA 3BB2A 3R4SA 4JQ0A 1EPWA 1BFGA 3QR5A 2BEBA 5JLVA 1PZZA 1VCLA 1YYNA 3N7MA 3RMYA 2ET2A 4P6AA 4EFQA 1PWAA 5D61A 2MC2A 4I6IA 4A7ZA 2KI4A 4JP0A 3ZXDA 3N7KA 3LTQA 3WO4A 3A22A 2FGFA 5E24E 2ESUA 2NYYA 3CRIA 1HWOB 4IQPA 3CA1A 2D23A 3AKHA 4F83A 3BADA 1FQ9A 4I4OA 1RMLA 4JKQA 1HKNA 3PMEA 1ILR1 2D20A 1TP0A
chains in the Genus database with same CATH topology
4OEFA 1J0SA 4USOA 3OBRA 1I1BA 2NS2A 3N7JA 4A7YA 4AN7B 1S0BA 1D0HA 2LIQA 1S0CA 4ISRA 2D7RA 2D7IA 4OEEA 4GAFA 4LO1A 1K5VA 4HA2A 1BLAA 1FN0A 4ZKTB 4J2KA 4LO2C 4I4XA 2R9KB 4H9WA 3V0AA 5FNXA 3VT1A 3O44A 4Z8SB 2AXMA 1S0FA 1WD3A 3F62B 1L2HA 4QKRA 7I1BA 3FUOA 4Q9PA 4FGFA 1XZZA 3BAOA 4XFSA 3FUQA 3BAQA 3QYDA 4ZFWB 3UD8A 4J23B 3POKA 1IHKA 4OW4A 4H04A 5BVPI 4G9NA 3BRGC 3FJCA 2DREA 1P63A 1WD4A 4IY9A 4P0KA 1JT3A 1ISWA 5F8WA 3OBTA 3NBEA 1DJSB 3HSMA 3I29B 4FVVA 1RZOB 5BQUC 41BIA 2AQZA 3HBWA 1AXMA 1DZCA 1BFBA 1TFMB 2BFHA 3O3QA 3ILAA 8I1BA 1AF9A 3O4OA 4I3NA 1HWNB 2E4MC 4I37A 3ZC9A 2FO1A 1S0DA 4QD2C 2YUGA 4J2XA 4KC3A 3V79C 2D43A 4QALA 4L4IA 3V0BB 5BXRA 2HZ9A 3AKIA 3T8SA 3FFZA 3K1XA 3OJ2A 4I0YA 5BXPA 4L4HA 3CAHA 3O5WB 4MZGB 5F8SA 1MC9A 3I2XA 2DRZA 3BX1C 3MPPG 4F34A 5F8YA 3W9TA 4OWKA 3N0KA 3UD9A 4G1RA 3O4CA 4KEIA 4I96A 4J2YA 5EC5A 4DCKC 3UD7A 2D1ZA 4EEEB 3RMXA 2LIEA 4LO8B 3FJKA 3RSJA 3AZWA 1FMMS 1YTOA 4ZLBB 2Q9XA 3BA7A 3CA0A 4EFPA 3NBDA 1RY7A 4ZA3B 4X3AA 4Z9WB 4GOVA 1TIEA 1DQOA 4A7KA 1JLYA 3OGFA 5EHAA 2NP0A 1JT4A 3IM7A 1ISXA 5JMCA 4II0A 3MALA 2ZR1B 3BAUA 1JTCA 4KBBA 4KEJA 1G9BA 1HWMB 1Z4SA 2VLCA 2NM1A 1BA7A 4I8MA 4LO3A 1SR4A 1NUNA 1II4A 1W3FA 3AH2A 1BARA 2FFUA 3PUBA 3Q7WA 2X2TA 4IYBA 3UJ0A 1DIWA 1S0LA 4I1EA 4WBCA 1M16A 1MD6A 4QBCA 2Z48A 3VUOA 3F1RA 4GOYA 1JLXA 1IRPA 3CA4A 1S0GA 4X38A 3WMUA 3VSFA 4KEKA 1AVUA 1FV2A 5D62A 3BAVA 3CQAA 1JQZA 1XYFA 2QYIB 1FWVA 1BFFA 3BTAA 3RTJB 1R8NA 2UUSA 2K4AB 3HOMA 3HN1A 2K43A 1YXWA 4HR6C 5F90A 1A8DA 3AJ5A 3FJFA 5B2HA 4Q91A 3VWCA 4ENDA 1HCEA 3OJVA 5BOWA 3VSZA 2Q3NB 1K5UA 3FJ8A 2RSTA 3D7WB 21BIA 2KKIA 3BA4A 4I2SA 4MZFB 4ZFYB 2IHOA 4D0TA 3H6RB 3UDAA 3FJBA 2RQ9A 2ZQNA 1IILA 3WINA 2VSEA 2NZ9A 3ZC8A 1BLDA 1WBAA 1PC8B 1Q1UA 3FJEA 3I2AA 4GP0A 4EKXB 3LLPA 1ISVA 4OUJA 1T4QA 3FJDA 3IIRA 3EF2A 3RTIB 3PG0A 2HWAA 4LO3C 1W3AA 3N7LA 2L5XA 3O4AA 1YBIA 3FJHA 3OGGA 3R4UA 1PUUB 2AFGA 5G00A 1S0EA 3KMVA 3A07A 4TLPA 1ISZA 2F2FA 2MLLB 4ZBVB 1WBCA 3AKGA 4AN6A 3P53A 1EVTA 5I1BA 2KI6B 4I4RA 1ONKB 3S8JA 1XG6A 5DSSB 4LO1C 4MZHA 1V6XA 1IRAX 1TOOA 1CE7B 4D8HA 1T9FA 31BIA 1BASA 5HPZA 5FNWA 1AVWB 5D63A 3H6SE 2GO2A 2VUAA 1EV2A 4LO0A 4YOLA 2K8RA 4LO7C 1Z2VA 4EB2B 2VXRA 4IY8A 3BA5A 4QKSA 9ILBA 2J3PA 5BXTA 4X39A 4G6JA 4EFRA 1DLLA 3H6RA 2I1BA 3FJIA 4IZEA 1RG8A 1TWEA 3FJJA 3CRGA 4ZGRB 4QD2B 4I4SA 1IT0A 3HMYA 4I7IA 3O4DA 3WO3A 1HIBA 1SZ6B 3BRDA 4I4QA 3V0AB 1BFCA 1V6VA 3B9UA 4XFTA 3O4BA 2AAIB 2NTDA 4OWJA 2D24A 4H75A 3CU1B 3FJAA 2Y9FA 1QQLA 1DQGA 2NVHA 5BXSA 4LO2A 5FZYA 2WBCA 3AH4A 3IM5A 4JRAA 2DRYA 3PHZA 2GZBA 3UJ4A 2FFVA 2XOAA 4R6UB 3Q7YA 3CA6A 5FZUA 4QO3A 5BP5A 1DZDA 3BRFA 1DFQA 2KH2A 4DEPA 1NZKA 4LO0C 3CA3A 4X37A 3V0BA 4OWLA 3TC2A 1FGAA 4J2SA 4OEGA 1Q03A 3NBNA 3JUTA 1OQLB 4JAWA 1QQKA 1JY0A 4HJJA 4IHZA 4USPA 4DENA 4CJMA 3ZX7A 6I1BA 2P39A 5BQUA 3ZXGA 4GAIA 1AVAC 2HWMA 3WA1A 1JT7A 4QC4A 3BAGA 1AVXB 4I4VA 2E4MA 1DFCA 1V6UA 2M49A 1Q04A 2IWTB 1ITBA 3WO2A 2Z49A 1PUMB 3SNVA 2D44A 4XKIA 4QBVA 1M2TB 4XFUA 3CA5A 1SR4C 1HWPB 3BAHA 3Q7XA 2BEAA 4IONA 5DUYA 1IOBA 3AZVA 1IJTA 4GP3A 2RG9B 4ISQA 3FGMA 1XHBA 3E8LC 3FJ9A 4Q9GA 2X2SA 5BP5C 3OJMA 3CRHA 1UPSA 2WRYA 1W3GA 1G9DA 3IAGC 1FMZA 3S8KA 1N4KA 1HCDA 1F31A 4JKXB 5DVHA 1GGPB 5FZZA 2VU9A 3AJ6A 3JRRA 2HW9A 1Z0HA 2ERMA 1G9CA 4I4PA 4D0ZA 2F8XC 1I1EA 4ZFUB 2Y9WC 3AH1A 5EG6C 1E0OA 2D22A 2ZQOA 1KNMA 4G9MA 1JT5A 4PC4A 2KLLA 1TTUA 3VT0A 3AKFA 2Y9XE 1ABRB 1R8OA 1ISYA 3WINC 2P23A 4P0LA 1QXMA 1EYLA 1G9AA 4UY4A 4P0JA 2DS0A 2QN4A 5GAQA 3H6QA 2Y9GA 3P6IA 3VT2A 1CVSA 2MIBA 4I4YA 1TWMA 3IM6A 4IZXA 3NJ5A 3O49A 2FDBM 3NBCA 3A21A 1G82A 3P6JA 4G6MA 4I1BA 5DZUA 1FWUA 3HALA 4I4UA 1YF8B 4ZOTA 3C9ZA 2F2FC 4LO7B 1AFCA 3WMVA 3VEQA 4JPZA 2VSAA 1FV3A 2VXTI 3A23A 1V6WA 3BB2A 3R4SA 4JQ0A 1EPWA 1BFGA 3QR5A 2BEBA 5JLVA 1PZZA 1VCLA 1YYNA 3N7MA 3RMYA 2ET2A 4P6AA 4EFQA 1PWAA 5D61A 2MC2A 4I6IA 4A7ZA 2KI4A 4JP0A 3ZXDA 3N7KA 3LTQA 3WO4A 3A22A 2FGFA 5E24E 2ESUA 2NYYA 3CRIA 1HWOB 4IQPA 3CA1A 2D23A 3AKHA 4F83A 3BADA 1FQ9A 4I4OA 1RMLA 4JKQA 1HKNA 3PMEA 1ILR1 2D20A 1TP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEF A;  1J0S A;  4USO A;  3OBR A;  1I1B A;  4A7Y A;  3N7J A;  4AN7 B;  1S0B A;  1D0H A;  2LIQ A;  1S0C A;  4ISR A;  2D7R A;  2D7I A;  4OEE A;  4GAF A;  4LO1 A;  1K5V A;  4HA2 A;  1BLA A;  1FN0 A;  4ZKT B;  4J2K A;  4LO2 C;  4I4X A;  2R9K B;  4H9W A;  3V0A A;  5FNX A;  3VT1 A;  3O44 A;  4Z8S B;  2AXM A;  1S0F A;  1WD3 A;  3F62 B;  1L2H A;  4QKR A;  7I1B A;  3FUO A;  4Q9P A;  4FGF A;  1XZZ A;  3BAO A;  4XFS A;  3FUQ A;  3BAQ A;  3QYD A;  4ZFW B;  3UD8 A;  4J23 B;  3POK A;  1IHK A;  4OW4 A;  4H04 A;  5BVP I;  4G9N A;  3BRG C;  3FJC A;  2DRE A;  1P63 A;  1WD4 A;  4IY9 A;  4P0K A;  1JT3 A;  1ISW A;  5F8W A;  3OBT A;  3NBE A;  1DJS B;  3HSM A;  3I29 B;  4FVV A;  1RZO B;  5BQU C;  41BI A;  2AQZ A;  3HBW A;  1AXM A;  1DZC A;  1BFB A;  1TFM B;  2BFH A;  3O3Q A;  3ILA A;  8I1B A;  1AF9 A;  3O4O A;  4I3N A;  1HWN B;  2E4M C;  4I37 A;  3ZC9 A;  2FO1 A;  1S0D A;  4QD2 C;  2YUG A;  4J2X A;  4KC3 A;  3V79 C;  2D43 A;  4QAL A;  4L4I A;  3V0B B;  5BXR A;  2HZ9 A;  3AKI A;  3T8S A;  3FFZ A;  3K1X A;  3OJ2 A;  4I0Y A;  5BXP A;  4L4H A;  3CAH A;  3O5W B;  5F8S A;  1MC9 A;  3I2X A;  2DRZ A;  3BX1 C;  3MPP G;  4F34 A;  5F8Y A;  3W9T A;  4OWK A;  3N0K A;  3UD9 A;  4G1R A;  3O4C A;  4KEI A;  4I96 A;  4J2Y A;  5EC5 A;  4DCK C;  3UD7 A;  2D1Z A;  4EEE B;  3RMX A;  2LIE A;  4LO8 B;  3FJK A;  3RSJ A;  3AZW A;  1FMM S;  1YTO A;  4ZLB B;  2Q9X A;  3BA7 A;  3CA0 A;  4EFP A;  3NBD A;  1RY7 A;  4ZA3 B;  4X3A A;  4Z9W B;  4GOV A;  1TIE A;  1DQO A;  4A7K A;  1JLY A;  3OGF A;  5EHA A;  2NP0 A;  1JT4 A;  3IM7 A;  1ISX A;  5JMC A;  4II0 A;  3MAL A;  2ZR1 B;  3BAU A;  1JTC A;  4KBB A;  4KEJ A;  1G9B A;  1HWM B;  1Z4S A;  2VLC A;  2NM1 A;  1BA7 A;  4I8M A;  4LO3 A;  1SR4 A;  1NUN A;  1II4 A;  1W3F A;  3AH2 A;  1BAR A;  2FFU A;  3PUB A;  3Q7W A;  2X2T A;  4IYB A;  3UJ0 A;  1DIW A;  1S0L A;  4I1E A;  4WBC A;  1M16 A;  1MD6 A;  4QBC A;  2Z48 A;  3VUO A;  3F1R A;  4GOY A;  1JLX A;  1IRP A;  3CA4 A;  1S0G A;  4X38 A;  3WMU A;  3VSF A;  4KEK A;  1AVU A;  1FV2 A;  5D62 A;  3BAV A;  3CQA A;  1JQZ A;  1XYF A;  2QYI B;  1FWV A;  1BFF A;  3BTA A;  3RTJ B;  1R8N A;  2UUS A;  2K4A B;  3HOM A;  3HN1 A;  2K43 A;  1YXW A;  4HR6 C;  5F90 A;  1A8D A;  3AJ5 A;  3FJF A;  5B2H A;  4Q91 A;  3VWC A;  4END A;  1HCE A;  3OJV A;  5BOW A;  3VSZ A;  2Q3N B;  1K5U A;  3FJ8 A;  2RST A;  3D7W B;  21BI A;  2KKI A;  3BA4 A;  4I2S A;  4ZFY B;  2IHO A;  4D0T A;  3H6R B;  3UDA A;  3FJB A;  2RQ9 A;  2ZQN A;  1IIL A;  3WIN A;  2VSE A;  2NZ9 A;  3ZC8 A;  1BLD A;  1WBA A;  1PC8 B;  1Q1U A;  3FJE A;  3I2A A;  4GP0 A;  4EKX B;  3LLP A;  1ISV A;  4OUJ A;  1T4Q A;  3FJD A;  3IIR A;  3EF2 A;  3RTI B;  3PG0 A;  2HWA A;  4LO3 C;  1W3A A;  3N7L A;  2L5X A;  3O4A A;  1YBI A;  3FJH A;  3OGG A;  3R4U A;  1PUU B;  2AFG A;  5G00 A;  1S0E A;  3KMV A;  3A07 A;  4TLP A;  1ISZ A;  2F2F A;  2MLL B;  4ZBV B;  1WBC A;  3AKG A;  4AN6 A;  3P53 A;  1EVT A;  5I1B A;  2KI6 B;  4I4R A;  1ONK B;  3S8J A;  1XG6 A;  5DSS B;  4LO1 C;  1V6X A;  1IRA X;  1TOO A;  1CE7 B;  4D8H A;  1T9F A;  31BI A;  1BAS A;  5HPZ A;  5FNW A;  1AVW B;  5D63 A;  3H6S E;  2GO2 A;  2VUA A;  1EV2 A;  4LO0 A;  4YOL A;  2K8R A;  4LO7 C;  1Z2V A;  4EB2 B;  2VXR A;  4IY8 A;  3BA5 A;  4QKS A;  9ILB A;  2J3P A;  5BXT A;  4X39 A;  4G6J A;  4EFR A;  1DLL A;  3H6R A;  2I1B A;  3FJI A;  4IZE A;  1RG8 A;  1TWE A;  3FJJ A;  3CRG A;  4ZGR B;  4QD2 B;  4I4S A;  1IT0 A;  3HMY A;  4I7I A;  3O4D A;  3WO3 A;  1HIB A;  1SZ6 B;  3BRD A;  4I4Q A;  3V0A B;  1BFC A;  1V6V A;  3B9U A;  4XFT A;  3O4B A;  2AAI B;  2NTD A;  4OWJ A;  2D24 A;  3CU1 B;  3FJA A;  2Y9F A;  1QQL A;  1DQG A;  2NVH A;  5BXS A;  4LO2 A;  5FZY A;  2WBC A;  3AH4 A;  3IM5 A;  4JRA A;  2DRY A;  3PHZ A;  2GZB A;  3UJ4 A;  2FFV A;  2XOA A;  4R6U B;  3Q7Y A;  3CA6 A;  5FZU A;  4QO3 A;  5BP5 A;  1DZD A;  3BRF A;  1DFQ A;  2KH2 A;  4DEP A;  1NZK A;  4LO0 C;  3CA3 A;  4X37 A;  3V0B A;  4OWL A;  3TC2 A;  1FGA A;  4J2S A;  4OEG A;  1Q03 A;  3NBN A;  3JUT A;  1OQL B;  4JAW A;  1QQK A;  1JY0 A;  4HJJ A;  4IHZ A;  4USP A;  4DEN A;  4CJM A;  3ZX7 A;  6I1B A;  2P39 A;  5BQU A;  3ZXG A;  4GAI A;  1AVA C;  2HWM A;  3WA1 A;  1JT7 A;  4QC4 A;  3BAG A;  1AVX B;  4I4V A;  2E4M A;  1DFC A;  1V6U A;  2M49 A;  1Q04 A;  2IWT B;  1ITB A;  3WO2 A;  2Z49 A;  1PUM B;  3SNV A;  2D44 A;  4XKI A;  4QBV A;  1M2T B;  4XFU A;  3CA5 A;  1SR4 C;  1HWP B;  3BAH A;  3Q7X A;  2BEA A;  4ION A;  5DUY A;  1IOB A;  3AZV A;  1IJT A;  4GP3 A;  2RG9 B;  4ISQ A;  3FGM A;  1XHB A;  3E8L C;  3FJ9 A;  4Q9G A;  2X2S A;  5BP5 C;  3OJM A;  3CRH A;  1UPS A;  2WRY A;  1W3G A;  1G9D A;  3IAG C;  1FMZ A;  3S8K A;  1N4K A;  1HCD A;  1F31 A;  4JKX B;  5DVH A;  1GGP B;  5FZZ A;  2VU9 A;  3AJ6 A;  3JRR A;  2HW9 A;  1Z0H A;  2ERM A;  1G9C A;  4I4P A;  4D0Z A;  2F8X C;  1I1E A;  4ZFU B;  2Y9W C;  3AH1 A;  5EG6 C;  1E0O A;  2D22 A;  2ZQO A;  1KNM A;  4G9M A;  1JT5 A;  4PC4 A;  2KLL A;  1TTU A;  3VT0 A;  3AKF A;  2Y9X E;  1ABR B;  1R8O A;  1ISY A;  3WIN C;  2P23 A;  4P0L A;  1QXM A;  1EYL A;  1G9A A;  4P0J A;  2DS0 A;  2QN4 A;  5GAQ A;  3H6Q A;  2Y9G A;  3P6I A;  3VT2 A;  1CVS A;  2MIB A;  4I4Y A;  1TWM A;  3IM6 A;  4IZX A;  3NJ5 A;  3O49 A;  2FDB M;  3NBC A;  3A21 A;  1G82 A;  3P6J A;  4G6M A;  4I1B A;  5DZU A;  1FWU A;  3HAL A;  4I4U A;  1YF8 B;  4ZOT A;  3C9Z A;  2F2F C;  4LO7 B;  1AFC A;  3WMV A;  3VEQ A;  4JPZ A;  2VSA A;  1FV3 A;  2VXT I;  3A23 A;  1V6W A;  3BB2 A;  3R4S A;  4JQ0 A;  1EPW A;  1BFG A;  3QR5 A;  2BEB A;  5JLV A;  1PZZ A;  1VCL A;  1YYN A;  3N7M A;  3RMY A;  2ET2 A;  4P6A A;  4EFQ A;  1PWA A;  5D61 A;  2MC2 A;  4I6I A;  4A7Z A;  2KI4 A;  4JP0 A;  3ZXD A;  3N7K A;  3LTQ A;  3WO4 A;  3A22 A;  2FGF A;  5E24 E;  2ESU A;  2NYY A;  3CRI A;  1HWO B;  4IQP A;  3CA1 A;  2D23 A;  3AKH A;  4F83 A;  3BAD A;  1FQ9 A;  4I4O A;  1RML A;  4JKQ A;  1HKN A;  3PME A;  1ILR 1;  2D20 A;  1TP0 A; 
#chains in the Genus database with same CATH topology
 4OEF A;  1J0S A;  4USO A;  3OBR A;  1I1B A;  2NS2 A;  3N7J A;  4A7Y A;  4AN7 B;  1S0B A;  1D0H A;  2LIQ A;  1S0C A;  4ISR A;  2D7R A;  2D7I A;  4OEE A;  4GAF A;  4LO1 A;  1K5V A;  4HA2 A;  1BLA A;  1FN0 A;  4ZKT B;  4J2K A;  4LO2 C;  4I4X A;  2R9K B;  4H9W A;  3V0A A;  5FNX A;  3VT1 A;  3O44 A;  4Z8S B;  2AXM A;  1S0F A;  1WD3 A;  3F62 B;  1L2H A;  4QKR A;  7I1B A;  3FUO A;  4Q9P A;  4FGF A;  1XZZ A;  3BAO A;  4XFS A;  3FUQ A;  3BAQ A;  3QYD A;  4ZFW B;  3UD8 A;  4J23 B;  3POK A;  1IHK A;  4OW4 A;  4H04 A;  5BVP I;  4G9N A;  3BRG C;  3FJC A;  2DRE A;  1P63 A;  1WD4 A;  4IY9 A;  4P0K A;  1JT3 A;  1ISW A;  5F8W A;  3OBT A;  3NBE A;  1DJS B;  3HSM A;  3I29 B;  4FVV A;  1RZO B;  5BQU C;  41BI A;  2AQZ A;  3HBW A;  1AXM A;  1DZC A;  1BFB A;  1TFM B;  2BFH A;  3O3Q A;  3ILA A;  8I1B A;  1AF9 A;  3O4O A;  4I3N A;  1HWN B;  2E4M C;  4I37 A;  3ZC9 A;  2FO1 A;  1S0D A;  4QD2 C;  2YUG A;  4J2X A;  4KC3 A;  3V79 C;  2D43 A;  4QAL A;  4L4I A;  3V0B B;  5BXR A;  2HZ9 A;  3AKI A;  3T8S A;  3FFZ A;  3K1X A;  3OJ2 A;  4I0Y A;  5BXP A;  4L4H A;  3CAH A;  3O5W B;  4MZG B;  5F8S A;  1MC9 A;  3I2X A;  2DRZ A;  3BX1 C;  3MPP G;  4F34 A;  5F8Y A;  3W9T A;  4OWK A;  3N0K A;  3UD9 A;  4G1R A;  3O4C A;  4KEI A;  4I96 A;  4J2Y A;  5EC5 A;  4DCK C;  3UD7 A;  2D1Z A;  4EEE B;  3RMX A;  2LIE A;  4LO8 B;  3FJK A;  3RSJ A;  3AZW A;  1FMM S;  1YTO A;  4ZLB B;  2Q9X A;  3BA7 A;  3CA0 A;  4EFP A;  3NBD A;  1RY7 A;  4ZA3 B;  4X3A A;  4Z9W B;  4GOV A;  1TIE A;  1DQO A;  4A7K A;  1JLY A;  3OGF A;  5EHA A;  2NP0 A;  1JT4 A;  3IM7 A;  1ISX A;  5JMC A;  4II0 A;  3MAL A;  2ZR1 B;  3BAU A;  1JTC A;  4KBB A;  4KEJ A;  1G9B A;  1HWM B;  1Z4S A;  2VLC A;  2NM1 A;  1BA7 A;  4I8M A;  4LO3 A;  1SR4 A;  1NUN A;  1II4 A;  1W3F A;  3AH2 A;  1BAR A;  2FFU A;  3PUB A;  3Q7W A;  2X2T A;  4IYB A;  3UJ0 A;  1DIW A;  1S0L A;  4I1E A;  4WBC A;  1M16 A;  1MD6 A;  4QBC A;  2Z48 A;  3VUO A;  3F1R A;  4GOY A;  1JLX A;  1IRP A;  3CA4 A;  1S0G A;  4X38 A;  3WMU A;  3VSF A;  4KEK A;  1AVU A;  1FV2 A;  5D62 A;  3BAV A;  3CQA A;  1JQZ A;  1XYF A;  2QYI B;  1FWV A;  1BFF A;  3BTA A;  3RTJ B;  1R8N A;  2UUS A;  2K4A B;  3HOM A;  3HN1 A;  2K43 A;  1YXW A;  4HR6 C;  5F90 A;  1A8D A;  3AJ5 A;  3FJF A;  5B2H A;  4Q91 A;  3VWC A;  4END A;  1HCE A;  3OJV A;  5BOW A;  3VSZ A;  2Q3N B;  1K5U A;  3FJ8 A;  2RST A;  3D7W B;  21BI A;  2KKI A;  3BA4 A;  4I2S A;  4MZF B;  4ZFY B;  2IHO A;  4D0T A;  3H6R B;  3UDA A;  3FJB A;  2RQ9 A;  2ZQN A;  1IIL A;  3WIN A;  2VSE A;  2NZ9 A;  3ZC8 A;  1BLD A;  1WBA A;  1PC8 B;  1Q1U A;  3FJE A;  3I2A A;  4GP0 A;  4EKX B;  3LLP A;  1ISV A;  4OUJ A;  1T4Q A;  3FJD A;  3IIR A;  3EF2 A;  3RTI B;  3PG0 A;  2HWA A;  4LO3 C;  1W3A A;  3N7L A;  2L5X A;  3O4A A;  1YBI A;  3FJH A;  3OGG A;  3R4U A;  1PUU B;  2AFG A;  5G00 A;  1S0E A;  3KMV A;  3A07 A;  4TLP A;  1ISZ A;  2F2F A;  2MLL B;  4ZBV B;  1WBC A;  3AKG A;  4AN6 A;  3P53 A;  1EVT A;  5I1B A;  2KI6 B;  4I4R A;  1ONK B;  3S8J A;  1XG6 A;  5DSS B;  4LO1 C;  4MZH A;  1V6X A;  1IRA X;  1TOO A;  1CE7 B;  4D8H A;  1T9F A;  31BI A;  1BAS A;  5HPZ A;  5FNW A;  1AVW B;  5D63 A;  3H6S E;  2GO2 A;  2VUA A;  1EV2 A;  4LO0 A;  4YOL A;  2K8R A;  4LO7 C;  1Z2V A;  4EB2 B;  2VXR A;  4IY8 A;  3BA5 A;  4QKS A;  9ILB A;  2J3P A;  5BXT A;  4X39 A;  4G6J A;  4EFR A;  1DLL A;  3H6R A;  2I1B A;  3FJI A;  4IZE A;  1RG8 A;  1TWE A;  3FJJ A;  3CRG A;  4ZGR B;  4QD2 B;  4I4S A;  1IT0 A;  3HMY A;  4I7I A;  3O4D A;  3WO3 A;  1HIB A;  1SZ6 B;  3BRD A;  4I4Q A;  3V0A B;  1BFC A;  1V6V A;  3B9U A;  4XFT A;  3O4B A;  2AAI B;  2NTD A;  4OWJ A;  2D24 A;  4H75 A;  3CU1 B;  3FJA A;  2Y9F A;  1QQL A;  1DQG A;  2NVH A;  5BXS A;  4LO2 A;  5FZY A;  2WBC A;  3AH4 A;  3IM5 A;  4JRA A;  2DRY A;  3PHZ A;  2GZB A;  3UJ4 A;  2FFV A;  2XOA A;  4R6U B;  3Q7Y A;  3CA6 A;  5FZU A;  4QO3 A;  5BP5 A;  1DZD A;  3BRF A;  1DFQ A;  2KH2 A;  4DEP A;  1NZK A;  4LO0 C;  3CA3 A;  4X37 A;  3V0B A;  4OWL A;  3TC2 A;  1FGA A;  4J2S A;  4OEG A;  1Q03 A;  3NBN A;  3JUT A;  1OQL B;  4JAW A;  1QQK A;  1JY0 A;  4HJJ A;  4IHZ A;  4USP A;  4DEN A;  4CJM A;  3ZX7 A;  6I1B A;  2P39 A;  5BQU A;  3ZXG A;  4GAI A;  1AVA C;  2HWM A;  3WA1 A;  1JT7 A;  4QC4 A;  3BAG A;  1AVX B;  4I4V A;  2E4M A;  1DFC A;  1V6U A;  2M49 A;  1Q04 A;  2IWT B;  1ITB A;  3WO2 A;  2Z49 A;  1PUM B;  3SNV A;  2D44 A;  4XKI A;  4QBV A;  1M2T B;  4XFU A;  3CA5 A;  1SR4 C;  1HWP B;  3BAH A;  3Q7X A;  2BEA A;  4ION A;  5DUY A;  1IOB A;  3AZV A;  1IJT A;  4GP3 A;  2RG9 B;  4ISQ A;  3FGM A;  1XHB A;  3E8L C;  3FJ9 A;  4Q9G A;  2X2S A;  5BP5 C;  3OJM A;  3CRH A;  1UPS A;  2WRY A;  1W3G A;  1G9D A;  3IAG C;  1FMZ A;  3S8K A;  1N4K A;  1HCD A;  1F31 A;  4JKX B;  5DVH A;  1GGP B;  5FZZ A;  2VU9 A;  3AJ6 A;  3JRR A;  2HW9 A;  1Z0H A;  2ERM A;  1G9C A;  4I4P A;  4D0Z A;  2F8X C;  1I1E A;  4ZFU B;  2Y9W C;  3AH1 A;  5EG6 C;  1E0O A;  2D22 A;  2ZQO A;  1KNM A;  4G9M A;  1JT5 A;  4PC4 A;  2KLL A;  1TTU A;  3VT0 A;  3AKF A;  2Y9X E;  1ABR B;  1R8O A;  1ISY A;  3WIN C;  2P23 A;  4P0L A;  1QXM A;  1EYL A;  1G9A A;  4UY4 A;  4P0J A;  2DS0 A;  2QN4 A;  5GAQ A;  3H6Q A;  2Y9G A;  3P6I A;  3VT2 A;  1CVS A;  2MIB A;  4I4Y A;  1TWM A;  3IM6 A;  4IZX A;  3NJ5 A;  3O49 A;  2FDB M;  3NBC A;  3A21 A;  1G82 A;  3P6J A;  4G6M A;  4I1B A;  5DZU A;  1FWU A;  3HAL A;  4I4U A;  1YF8 B;  4ZOT A;  3C9Z A;  2F2F C;  4LO7 B;  1AFC A;  3WMV A;  3VEQ A;  4JPZ A;  2VSA A;  1FV3 A;  2VXT I;  3A23 A;  1V6W A;  3BB2 A;  3R4S A;  4JQ0 A;  1EPW A;  1BFG A;  3QR5 A;  2BEB A;  5JLV A;  1PZZ A;  1VCL A;  1YYN A;  3N7M A;  3RMY A;  2ET2 A;  4P6A A;  4EFQ A;  1PWA A;  5D61 A;  2MC2 A;  4I6I A;  4A7Z A;  2KI4 A;  4JP0 A;  3ZXD A;  3N7K A;  3LTQ A;  3WO4 A;  3A22 A;  2FGF A;  5E24 E;  2ESU A;  2NYY A;  3CRI A;  1HWO B;  4IQP A;  3CA1 A;  2D23 A;  3AKH A;  4F83 A;  3BAD A;  1FQ9 A;  4I4O A;  1RML A;  4JKQ A;  1HKN A;  3PME A;  1ILR 1;  2D20 A;  1TP0 A; 
#chains in the Genus database with same CATH homology
 4OEF A;  1J0S A;  4USO A;  3OBR A;  1I1B A;  2NS2 A;  3N7J A;  4A7Y A;  4AN7 B;  1S0B A;  1D0H A;  2LIQ A;  1S0C A;  4ISR A;  2D7R A;  2D7I A;  4OEE A;  4GAF A;  4LO1 A;  1K5V A;  4HA2 A;  1BLA A;  1FN0 A;  4ZKT B;  4J2K A;  4LO2 C;  4I4X A;  2R9K B;  4H9W A;  3V0A A;  5FNX A;  3VT1 A;  3O44 A;  4Z8S B;  2AXM A;  1S0F A;  1WD3 A;  3F62 B;  1L2H A;  4QKR A;  7I1B A;  3FUO A;  4Q9P A;  4FGF A;  1XZZ A;  3BAO A;  4XFS A;  3FUQ A;  3BAQ A;  3QYD A;  4ZFW B;  3UD8 A;  4J23 B;  3POK A;  1IHK A;  4OW4 A;  4H04 A;  5BVP I;  4G9N A;  3BRG C;  3FJC A;  2DRE A;  1P63 A;  1WD4 A;  4IY9 A;  4P0K A;  1JT3 A;  1ISW A;  5F8W A;  3OBT A;  3NBE A;  1DJS B;  3HSM A;  3I29 B;  4FVV A;  1RZO B;  5BQU C;  41BI A;  2AQZ A;  3HBW A;  1AXM A;  1DZC A;  1BFB A;  1TFM B;  2BFH A;  3O3Q A;  3ILA A;  8I1B A;  1AF9 A;  3O4O A;  4I3N A;  1HWN B;  2E4M C;  4I37 A;  3ZC9 A;  2FO1 A;  1S0D A;  4QD2 C;  2YUG A;  4J2X A;  4KC3 A;  3V79 C;  2D43 A;  4QAL A;  4L4I A;  3V0B B;  5BXR A;  2HZ9 A;  3AKI A;  3T8S A;  3FFZ A;  3K1X A;  3OJ2 A;  4I0Y A;  5BXP A;  4L4H A;  3CAH A;  3O5W B;  4MZG B;  5F8S A;  1MC9 A;  3I2X A;  2DRZ A;  3BX1 C;  3MPP G;  4F34 A;  5F8Y A;  3W9T A;  4OWK A;  3N0K A;  3UD9 A;  4G1R A;  3O4C A;  4KEI A;  4I96 A;  4J2Y A;  5EC5 A;  4DCK C;  3UD7 A;  2D1Z A;  4EEE B;  3RMX A;  2LIE A;  4LO8 B;  3FJK A;  3RSJ A;  3AZW A;  1FMM S;  1YTO A;  4ZLB B;  2Q9X A;  3BA7 A;  3CA0 A;  4EFP A;  3NBD A;  1RY7 A;  4ZA3 B;  4X3A A;  4Z9W B;  4GOV A;  1TIE A;  1DQO A;  4A7K A;  1JLY A;  3OGF A;  5EHA A;  2NP0 A;  1JT4 A;  3IM7 A;  1ISX A;  5JMC A;  4II0 A;  3MAL A;  2ZR1 B;  3BAU A;  1JTC A;  4KBB A;  4KEJ A;  1G9B A;  1HWM B;  1Z4S A;  2VLC A;  2NM1 A;  1BA7 A;  4I8M A;  4LO3 A;  1SR4 A;  1NUN A;  1II4 A;  1W3F A;  3AH2 A;  1BAR A;  2FFU A;  3PUB A;  3Q7W A;  2X2T A;  4IYB A;  3UJ0 A;  1DIW A;  1S0L A;  4I1E A;  4WBC A;  1M16 A;  1MD6 A;  4QBC A;  2Z48 A;  3VUO A;  3F1R A;  4GOY A;  1JLX A;  1IRP A;  3CA4 A;  1S0G A;  4X38 A;  3WMU A;  3VSF A;  4KEK A;  1AVU A;  1FV2 A;  5D62 A;  3BAV A;  3CQA A;  1JQZ A;  1XYF A;  2QYI B;  1FWV A;  1BFF A;  3BTA A;  3RTJ B;  1R8N A;  2UUS A;  2K4A B;  3HOM A;  3HN1 A;  2K43 A;  1YXW A;  4HR6 C;  5F90 A;  1A8D A;  3AJ5 A;  3FJF A;  5B2H A;  4Q91 A;  3VWC A;  4END A;  1HCE A;  3OJV A;  5BOW A;  3VSZ A;  2Q3N B;  1K5U A;  3FJ8 A;  2RST A;  3D7W B;  21BI A;  2KKI A;  3BA4 A;  4I2S A;  4MZF B;  4ZFY B;  2IHO A;  4D0T A;  3H6R B;  3UDA A;  3FJB A;  2RQ9 A;  2ZQN A;  1IIL A;  3WIN A;  2VSE A;  2NZ9 A;  3ZC8 A;  1BLD A;  1WBA A;  1PC8 B;  1Q1U A;  3FJE A;  3I2A A;  4GP0 A;  4EKX B;  3LLP A;  1ISV A;  4OUJ A;  1T4Q A;  3FJD A;  3IIR A;  3EF2 A;  3RTI B;  3PG0 A;  2HWA A;  4LO3 C;  1W3A A;  3N7L A;  2L5X A;  3O4A A;  1YBI A;  3FJH A;  3OGG A;  3R4U A;  1PUU B;  2AFG A;  5G00 A;  1S0E A;  3KMV A;  3A07 A;  4TLP A;  1ISZ A;  2F2F A;  2MLL B;  4ZBV B;  1WBC A;  3AKG A;  4AN6 A;  3P53 A;  1EVT A;  5I1B A;  2KI6 B;  4I4R A;  1ONK B;  3S8J A;  1XG6 A;  5DSS B;  4LO1 C;  4MZH A;  1V6X A;  1IRA X;  1TOO A;  1CE7 B;  4D8H A;  1T9F A;  31BI A;  1BAS A;  5HPZ A;  5FNW A;  1AVW B;  5D63 A;  3H6S E;  2GO2 A;  2VUA A;  1EV2 A;  4LO0 A;  4YOL A;  2K8R A;  4LO7 C;  1Z2V A;  4EB2 B;  2VXR A;  4IY8 A;  3BA5 A;  4QKS A;  9ILB A;  2J3P A;  5BXT A;  4X39 A;  4G6J A;  4EFR A;  1DLL A;  3H6R A;  2I1B A;  3FJI A;  4IZE A;  1RG8 A;  1TWE A;  3FJJ A;  3CRG A;  4ZGR B;  4QD2 B;  4I4S A;  1IT0 A;  3HMY A;  4I7I A;  3O4D A;  3WO3 A;  1HIB A;  1SZ6 B;  3BRD A;  4I4Q A;  3V0A B;  1BFC A;  1V6V A;  3B9U A;  4XFT A;  3O4B A;  2AAI B;  2NTD A;  4OWJ A;  2D24 A;  4H75 A;  3CU1 B;  3FJA A;  2Y9F A;  1QQL A;  1DQG A;  2NVH A;  5BXS A;  4LO2 A;  5FZY A;  2WBC A;  3AH4 A;  3IM5 A;  4JRA A;  2DRY A;  3PHZ A;  2GZB A;  3UJ4 A;  2FFV A;  2XOA A;  4R6U B;  3Q7Y A;  3CA6 A;  5FZU A;  4QO3 A;  5BP5 A;  1DZD A;  3BRF A;  1DFQ A;  2KH2 A;  4DEP A;  1NZK A;  4LO0 C;  3CA3 A;  4X37 A;  3V0B A;  4OWL A;  3TC2 A;  1FGA A;  4J2S A;  4OEG A;  1Q03 A;  3NBN A;  3JUT A;  1OQL B;  4JAW A;  1QQK A;  1JY0 A;  4HJJ A;  4IHZ A;  4USP A;  4DEN A;  4CJM A;  3ZX7 A;  6I1B A;  2P39 A;  5BQU A;  3ZXG A;  4GAI A;  1AVA C;  2HWM A;  3WA1 A;  1JT7 A;  4QC4 A;  3BAG A;  1AVX B;  4I4V A;  2E4M A;  1DFC A;  1V6U A;  2M49 A;  1Q04 A;  2IWT B;  1ITB A;  3WO2 A;  2Z49 A;  1PUM B;  3SNV A;  2D44 A;  4XKI A;  4QBV A;  1M2T B;  4XFU A;  3CA5 A;  1SR4 C;  1HWP B;  3BAH A;  3Q7X A;  2BEA A;  4ION A;  5DUY A;  1IOB A;  3AZV A;  1IJT A;  4GP3 A;  2RG9 B;  4ISQ A;  3FGM A;  1XHB A;  3E8L C;  3FJ9 A;  4Q9G A;  2X2S A;  5BP5 C;  3OJM A;  3CRH A;  1UPS A;  2WRY A;  1W3G A;  1G9D A;  3IAG C;  1FMZ A;  3S8K A;  1N4K A;  1HCD A;  1F31 A;  4JKX B;  5DVH A;  1GGP B;  5FZZ A;  2VU9 A;  3AJ6 A;  3JRR A;  2HW9 A;  1Z0H A;  2ERM A;  1G9C A;  4I4P A;  4D0Z A;  2F8X C;  1I1E A;  4ZFU B;  2Y9W C;  3AH1 A;  5EG6 C;  1E0O A;  2D22 A;  2ZQO A;  1KNM A;  4G9M A;  1JT5 A;  4PC4 A;  2KLL A;  1TTU A;  3VT0 A;  3AKF A;  2Y9X E;  1ABR B;  1R8O A;  1ISY A;  3WIN C;  2P23 A;  4P0L A;  1QXM A;  1EYL A;  1G9A A;  4UY4 A;  4P0J A;  2DS0 A;  2QN4 A;  5GAQ A;  3H6Q A;  2Y9G A;  3P6I A;  3VT2 A;  1CVS A;  2MIB A;  4I4Y A;  1TWM A;  3IM6 A;  4IZX A;  3NJ5 A;  3O49 A;  2FDB M;  3NBC A;  3A21 A;  1G82 A;  3P6J A;  4G6M A;  4I1B A;  5DZU A;  1FWU A;  3HAL A;  4I4U A;  1YF8 B;  4ZOT A;  3C9Z A;  2F2F C;  4LO7 B;  1AFC A;  3WMV A;  3VEQ A;  4JPZ A;  2VSA A;  1FV3 A;  2VXT I;  3A23 A;  1V6W A;  3BB2 A;  3R4S A;  4JQ0 A;  1EPW A;  1BFG A;  3QR5 A;  2BEB A;  5JLV A;  1PZZ A;  1VCL A;  1YYN A;  3N7M A;  3RMY A;  2ET2 A;  4P6A A;  4EFQ A;  1PWA A;  5D61 A;  2MC2 A;  4I6I A;  4A7Z A;  2KI4 A;  4JP0 A;  3ZXD A;  3N7K A;  3LTQ A;  3WO4 A;  3A22 A;  2FGF A;  5E24 E;  2ESU A;  2NYY A;  3CRI A;  1HWO B;  4IQP A;  3CA1 A;  2D23 A;  3AKH A;  4F83 A;  3BAD A;  1FQ9 A;  4I4O A;  1RML A;  4JKQ A;  1HKN A;  3PME A;  1ILR 1;  2D20 A;  1TP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...