2RSUA

Alternative structure of ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQNRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Solution Structure of the Q41N Variant of Ubiquitin as a Model for the Alternatively Folded N2 State of Ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rsuA00
3L17A 4WWPA 3VTVA 1TGZB 3M63B 4MSMB 2ZCCA 4TKNA 2JRHA 4KIKA 2FCMA 2BWFA 2GBMA 4WJNA 2BYVE 1VCBA 2LWPA 2KD0A 3A1QB 1H8CA 3KH0A 2HD5B 3QJZA 2K6DB 4GN1A 3OLMD 2GBKA 1XQQA 4K7SA 2C5LC 2JPHA 1VD2A 2KJHB 5BO4B 4MGYE 4N9F4 3W1YA 2FAZA 2PE9A 2I1KA 4XZ4A 1CMXB 2JY6A 2DYOA 3ML9A 4HCNB 4HVBA 3TMPB 1IP9A 3UIPB 3ZRCA 3H6NA 3UGBB 5HKHA 3K9OB 4A20A 2ZEQA 1R4MI 4WAAA 2BF8B 4IG7B 4MM3A 3ZNHB 4DHZE 4W9KA 4BOSC 1V5OA 3PPAA 1E5WA 2M1MA 3A9KA 3H7PB 4I6NB 2UYZB 4LDTB 3BINA 3IBEA 4HXDA 5LLIA 1LQBA 2MA9B 4WQOB 1TZ1A 3WALA 4EFOA 3DBRI 2QHOA 3PS6A 2NPTB 1V80A 4B6WA 5JHBA 2MQJA 2HE7A 2IYDB 3A9JA 2G4SA 3RD2A 3W1SA 4NQLB 2JXXA 5DCNA 4GIVA 2KWVB 4EZKA 4KVGB 2KOXA 4WJOA 2ZZPB 4DDGD 2M0XA 2BPSA 3DOWA 1GNUA 1EUVB 1PQSA 1WGYA 2W9NA 4YL8A 1I35A 4E74A 1WGGA 1SGHA 4GMVA 2DAJA 2UWQA 4W9IA 1YIWA 1LM8B 3WAOA 1WXMA 1NDDA 3NZUA 2LGYA 4KDIC 1ISNA 1WXSA 3JSVB 1UBIA 3CSFA 3DVGY 3KUZA 5E6NA 3IG3A 1AARA 4GGQA 1J8CA 3ZUNA 1WMHB 3UQBA 1V86A 3DBSA 3JVZX 3UINB 2KKCA 3KW5B 3KYDD 3PRPB 4AJYB 1G6JA 4NJ7A 2C7HA 2KJ6A 3KUCB 3O65B 2O6VB 4ICVA 4IWPA 3I3TB 5IA7A 1UELA 5DPWA 4EOYA 2G4DB 1GC7A 4DDID 2V4LA 1ZGUB 4XC2A 5CX3A 2RGFA 1WXVA 3WANA 4BVUC 2RSUA 3KUDB 4RMAA 2RR9A 1E8YA 5AZHA 5L95C 2C7MB 2J0MA 4MSQB 4FJZA 4FLHA 3ZIMA 2EMSA 2LVOA 1Q5WB 2NCNA 3JW0X 2A4ZA 2ZPNA 3ML8A 3QARA 4M8NA 4TQ0A 3M95A 4PS8A 4JGHB 3VXWA 2MBHA 1BT0A 2LUEA 4MGZE 2WX0A 2I1JA 4ANVA 1MG8A 2ZJDA 1RFAA 3ONSA 2GOWA 4NAWB 2CR5A 3TJPA 3L10B 4HCPB 1WR1A 1WGHA 2KFKB 3APFA 2DZIA 3PHWB 2JVCA 3EECA 3HM3A 3D32A 4JIOU 2L05A 4KSKC 2CHZA 3GOEA 3U8ZA 2LRUA 2MCNB 3LDZE 1Z5SB 2KXJA 2AYOB 2Y5BB 3B08A 4HWIB 3VHTC 1RRBA 1SE9A 3SDLC 3H1UA 3RCZA 2O2VA 2KX0A 1S3SG 4IM3A 2KQSA 1M94A 2AWTA 2DENB 4DHZB 1EF5A 1YX6B 3A4SC 2WX1A 2KWCA 3MTNB 1WJNA 2JZZA 3A1QA 3ZW3A 2KQ7A 3DCGA 5KHOA 2M8SA 5LXIB 3NHEB 1S1QB 1Q1OA 2CU1A 4FHKA 2OOBB 4K7UA 2DZMA 1TBEA 2EMTA 3EHVA 3QWZB 4FHJA 3U7DA 4ZDVA 3T8MA 2D3GA 2L00B 2R2QA 3DBHI 2PEAA 2BKRB 2N4FA 4GDKA 3SHQA 2V1YA 5KHQA 1GJZA 4KZ0A 1NI2A 2L0TA 3CSTA 2DZJA 2LXCA 3HK0A 3DBLI 3ZNGC 4K7WA 5J17A 3WIMA 4A3PA 3ZTCA 1E8WA 2IO2B 4URKA 4EKUA 4DXAB 3V60A 2VRRB 3R66C 3H7PA 5D94A 1GG3A 1KOTA 2EKEC 2BGFA 5CHFA 4IWOA 4P7IA 2KZRA 3AXCA 5CTRC 2D10A 3L54A 4MJSA 4IM0A 2KC2A 2IO3B 1YQBA 4MH0E 4F7ZA 1UH6A 4HDOA 3KVFB 4FULA 3OJ3A 3VTWA 4HK2A 3MHSD 4PS7A 2ASQA 1OQYA 4FA6A 1WX8A 2KHWB 3PZDA 4PYUA 3VDZA 2FCQA 2MWSB 4IM2A 4KIKB 3Q3FA 4WWNA 5E6PA 3ZVVA 1KJTA 3IVFA 3PVLA 2C9WB 3UQAA 5G55A 3ZNID 4WJQA 2ZPYA 1WX7A 3DVNV 4W9GA 2CHWA 5LXHA 4J6IA 2L8JA 3N30A 4ANUA 4NJ6A 1A5RA 1ZW7A 3CMMB 3MJWA 4W9HA 2RD0A 4KZCA 2IZVB 2KDFB 1V81A 4M8MA 2DZKA 3BY4B 4IW0A 1WZ0A 3DVGX 3QC8B 1D3ZA 2LJ5A 1WGDA 2LD9A 1WFYA 1WE6A 3APDA 4W9EA 5JHAA 5JZEB 4TQ1A 4GOCA 3M3JA 4A3OA 1WRDB 4NNJB 4HDQA 3A9KB 2LXAA 4PYZA 2GMIC 3QHTA 1QZEA 4CHKA 3WAMA 5GMVA 2KWUB 3CF6E 2N1WA 2BYFA 2M4NA 4TUUA 4GSWA 1GC6A 4B95A 3PLVA 3DVNU 4KV2A 3V61A 4AP4C 2WYQA 4AWJA 4E71A 2ZNVC 2FIFA 4HPLB 5EDSA 2Z0EB 2KTRA 3A9JB 1YX5B 1XD3B 1J0GA 5FR6A 4OVVA 3SD5A 2CS4A 2IY1B 4GDLA 2XK5A 4MGIE 3SU8X 4RM8A 3QX1A 1P1AA 2LVQA 3DDCB 3VQIA 1OGWA 4NAWA 5D6JB 2G3QB 2N7EA 1E90A 3VUWA 3L16A 2HTHA 2J0KA 2JWZA 3TL5A 1HE8A 3HM6X 1WZ3A 3X23A 2WDTB 1J19A 2MSED 3H9DA 4LJOB 2YLMA 4NY0A 1LXDA 3PT2B 3M62B 3HHMA 3UIOB 1NBFC 3R3MA 4HLEA 1RAXA 1WI0A 2BYEA 3ZKJC 1OEYJ 4F8CB 2IO0B 2MBQA 4K1RB 2J7QB 3VTUA 1WXAA 2KMCA 2L3ZA 2ZNVB 3EFUA 4BFRA 4XX5A 1WIAA 2PE6B 4G0NB 4JLCA 3L13A 3N3KB 4LJPB 4ANXA 2XEWA 2MBEA 2D11A 3VH4B 3ZTDA 3IFWB 2IO1B 3QK0A 4FADA 2NS5A 1OEYA 2MRPA 3ZDTA 4BKTA 4DHJD 1UGMA 2KTFA 5C1ZA 4AOFA 2AL6A 1K8RB 3VVWB 3IHPC 2MP2B 2JZ3B 3ZDMC 2D07B 4EEWA 2LI5A 3NOBA 4M0WB 5E6OA 3RZFA 2BWES 2CKHB 2LVPA 1GUAB 2FCNA 2KDIA 2XBBC 5J2RA 3PLUA 2FUHB 2K8HA 4FBJB 2MX2A 5TR5A 1WYWB 1EF1A 4W9LA 4WJPA 2KANA 5DPTA 4BKSD 3NY5A 1WX9A 2L7RA 2MBOA 3AU5A 3PHXB 4II2B 4BOZB 1E7VA 2AEHA 1WJUA 1SIFA 5DPSA 2KLCA 1UZXB 3WAPA 2MW5A 3P2BA 2K25A 3TBLD 2N7DA 2KC1A 2WWZA 2ZCBA 3R7QA 4BBNF 2MLBA 1WY8A 1WE7A 2JF5A 2O2VB 3PV1A 3AI5A 1RLFA 3LJ3A 2L76A 2NPTA 4RM9A 1YD8U 3PREA 4DBGA 4IC7B 4CO7A 4HJKA 2K1FA 3L0WB 3QIJA 1H4RA 3PSEB 3ALBA 1WM3A 3JYUA 4I6PA 2K8BA 2Z0DB 4MELA 3ZLZA 4EZJA 2ZVOA 2NR2A 3A4RA 2DAFA 1C1YB 1Y8RC 3EC8A 4LDTD 4GU2A 1TTNA 3RULA 2IBIB 4DWFA 2GBNA 2DYMA 4OVUA 3B0AA 3K9PB 2HJ8A 3Q3JA 2REXA 4GDKB 3VH3B 5CHWA 5AZFA 3W1SC 4ANWA 2JUOA 3UF8A 2C7NB 3OAWA 2LRWA 3R7RA 4G50A 2KO3A 3V6EB 3JSVA 1E8XA 2PPHA 4MDKE 4BKGA 4MEMA 1XT9B 1P0RA 1WMHA 4CYEA 2N9XA 3VAWA 3ZRFA 3QA8A 4W9FA 2AL3A 1FXTB 4AUQC 1E8ZA 2O6VA 4DK5A 2BKFA 4EUTA 4MJSB 5G2NA 4AJWA 4FN2A 5L83A 2M17A 2DHZA 2NBUA 4W9CA 3TCAA 1Z2MA 3N32A 3AU4A 3ZO5B 1E7UA 5AEKB 1V9JA 3DPDA 4GXBA 2GBJA 3X0WA 3RYTA 1I42A 2KK8A 3L08A 2LGXA 3PRZA 2G45B 2IY0B 4PS3A 4ASWC 3U30A 4E3CA 4F1SA 2Z59B 2B3AA 1C3TA 3VUXA 1JRUA 2JT4B 4B9KA 2LGDA 2O6VD 4X57B 4ZRIA 1OTRB 4ZRKA 2R2OA 2CHXA 3V62A 2NBVB 2KFJA 2FIDA 3QCAA 4FJYA 3VFKA 5DPRA 3T9LA 3V6CB 5IAAC 1V2YA 2L0FA 1L7YA 1IPGA 1L2NA 1R4NI 4G11A 1EO6A 3PRMB 2KFKA 4ZYNA 3ZNZB 1YJ1A 4HPMB 5D7GA 4NPNA 3VUYA 1V6EA 2ZVNA 1WF9A 2KMAA 2FCSA 1KLVA 5JH5C 3H7SA 1LFDA 5AZGA 2D2QA 1P9DU 2GBRA 4I6LB 5C23A 1T0YA 2NBWB 3PTFC 4ICUA 3RUIB 1WGRA 4IWQA 2KN5A 3NZSA 1WM2A 3ECIA 1Q0WB 3B1LX 2KTRB 2MP2A 3APCA 2N9PC 4FJVB 3HIZA 1UBQA 5D2MB 2LZ6A 1IYFA 3A33B 3KYCD 3PGEA 1WH3A 3RT3B 3TIXA 4GDLB 2MBBB 2XK5B 2K8CA 4WWOA 3GZNI 4ZRJA 2N9EB 2KLGA 1F9JA 3RZWC 4BBNC 4BKSA 1X1MA 2V3SA 1UD7A 4KSLC 2K39A 1V5TA 2KJRA 2KVRA 2LASA 4LCDE 3AULA 4W9DA 3S2AA 2JRIB 4NQKE 2K6QA 2DYBA 3OJ4B 5CHVC 3QAQA 2KDEB 2OJRA 4W9JA 3WA0A 2KNBA 4KDLB 4IUMB 4G3XB 5J18A 2A5UA 3C0RB 1V49A 1WJ6A 2NVUI 1WJ4A 1P98A 2YVCA 1P3QU 2PJHA 4TV3A 4K81A 1U4AA 1ZKHA 2FNJB 3DQVA 1WR6E 2J0JA 4DHJB 4EZLA 2RPQA 4MGKE 4GB9A 2C60A 4II3B 3NS8A 4JQWC 2DX5B 2KX3A 3ENEA 4JL9A 3QQ8B 1KM7A 2N1VA 2KDBA
chains in the Genus database with same CATH superfamily
2VZKD 1TGZB 4HEA1 2N7JA 1DYQA 1SBBB 2J4XA 1VCBA 3VR8B 3KH0A 4XWTA 2HD5B 1MG4A 5FK9C 2WXMA 1VD2A 5IO9A 3W1YA 3J9CA 1N63A 2I1KA 2N0SB 2BS2B 4XZ4A 3ABVB 1CMXB 2EKIA 3H6NA 4WWMA 4XE0A 4IG7B 1IGDA 3PPAA 4I6NB 3BINA 4ITKA 4WQOB 3WALA 1TZ1A 3ZJVA 4L23A 4EFOA 3CWIA 3KWVA 5EE1A 2NPTB 2HTME 3RD2A 2EELA 3W1SA 2KWVB 1UF0A 1FO4A 2KOXA 4WJOA 2ZZPB 2IDYA 4TSSA 2M0XA 5EE9A 3DOWA 4KGSA 2W9NA 5BMHA 2UWQA 1LM8B 3WAOA 1NDDA 3V3XA 1ZDVA 3KUZA 1L4DB 1C9FA 1J8CA 2W55A 1FRRA 1V86A 1D6EC 3JVZX 3KW5B 1Q10A 3NVWA 3PRPB 1P7FA 1G6JA 4NJ7A 4ICVA 5IKCM 1M4VA 2WXLA 2INCC 1EWYC 4XC2A 5CX3A 2RGFA 4BVUC 3KUDB 5AZHA 5L95C 2A4ZA 3ML8A 1UGJA 2WXFA 1BT0A 4MGZE 1MG8A 2INDC 1QKZA 3PHWB 1HTQA 2PTLA 2CHZA 3U8ZA 2MCNB 2AYOB 3B08A 1RRBA 2QIEB 4IM3A 2AWTA 1AW7A 4DHZB 3A4SC 2KWCA 4US8A 5KHOA 2M8SA 5LXIB 3AE5B 3W5UB 2ONQA 3DBHI 1WYGA 2KAJA 1I4RA 4GDKA 1IBXA 1GJZA 2DZJA 2G9HD 1K51A 2JU6X 5J17A 4ZHOA 2ACZB 5HI1A 4WIPA 1ZP0B 3R66C 1GG3A 4A8XC 4IWOA 3VRAB 5CTRC 3L54A 3WCQA 1C78A 1HXYD 2KC2A 1YQBA 2G1EA 4MH0E 1TY2A 4HDOA 4FULA 1AYFA 3OJ3A 3P4RB 1YMHE 1OQYA 4FA6A 3Q69A 2KHWB 3VDZA 5E6PA 3Q3FA 1T6BX 2C9WB 3GZNB 3UQAA 2ZPYA 3N30A 3NVYA 4ANUA 2OJWA 2IZVB 1V81A 3Q8FA 2DZKA 1WZ0A 3MP9A 1D3ZA 4RGMA 2LJ5A 1UWMA 1WE6A 3ZQ4A 4TQ1A 2KWDA 2WXOA 1PDXA 1EM7A 3R2IA 3WAMA 2N1WA 1OQQA 2ICIA 1GC6A 3PLVA 4KV2A 5EDSA 1XD3B 2WP9B 1J0GA 2X8XX 1HTOA 2M19A 3EGRA 3QX1A 1P1AA 3DDCB 2G3QB 2JWUA 1E90A 2N7EA 3CIRB 2HTHA 4WAFA 1WZ3A 3BK1A 1LXDA 1ET9A 2BYTA 3UIOB 3R3MA 1RAXA 2IO0B 4K1RB 1SF0A 2MH7A 3NZ3A 1VZ8A 3LB8C 2ZNVB 4LJPB 2HDEA 3ZTDA 4FADA 3QK0A 1MFWA 3VVWB 2JZ3B 3ZDMC 2D07B 1C79A 2K8HA 4FBJB 3RPFC 5TR5A 1WYWB 1WX9A 4XWWA 3FILA 1DGJA 1SIFA 3BYYB 5DPSA 3P2BA 1ZOYB 4HKZE 2LMCA 3PV1A 5EE3A 1HQRD 1Y56A 1PGBA 1H4RA 3ALBA 2XN9C 1HZ6A 4I6PA 2K8BA 3ZLZA 1AN8A 2NR2A 1Y8RC 5T8IA 2MJ3A 2IBIB 2DYMA 1C4CA 2REXA 1QOFA 2IGDA 2JUOA 5E6JA 4HJGE 3UF8A 2C7NB 3BK2A 3R7RA 2KO3A 3GP7A 1XT9B 4RF0A 4CYEA 3VAWA 3EUB2 4W9FA 2O6VA 4FN2A 2NBUA 3TCAA 3N32A 1V9JA 3RYTA 1T0SC 3U30A 1FD6A 2Z59B 1C3TA 3Q8BA 1E6EB 2LGDA 2O6VD 3DHIC 3DBHB 3PO0A 3U7ZA 4FJYA 1FPYA 2Y5CA 3VFKA 5DPRA 3NUHB 3P42A 2FUG1 1EO6A 3PRMB 1YNTE 1FXAA 1TS5A 5JH5C 2WXNA 4M02A 2DNFA 2AQ3B 4RGTA 2KN5A 2K5PA 4LNKA 3B1LX 2KTRB 1IYFA 2LZ6A 3IT6B 3KYCD 1WH3A 3ZYYX 3NVVA 2XK5B 2K8CA 2QC8A 1F9JA 1X1MA 2LASA 4W9DA 3MC8A 4G3XB 3AE3B 2WXKA 2YVCA 2RMMA 2BT6A 3AE2B 2PMVA 4DHJB 1E7PB 1JWBD 2MJDA 4GB9A 2C60A 3NS8A 5I4DA 4KGTA 3EA6A 1F2RC 2QSDA 3L17A 4NAMA 4LNFA 2ZCCA 4TKNA 2H88B 2JRHA 3BVZA 2AX5A 2KACA 1YJIA 2BYVE 2LWPA 2KD0A 1KF6B 3A1QB 3QJZA 2GBKA 3AEEB 1L0XB 4K7SA 2KJHB 1IP9A 4HVBA 3TMPB 4XGAB 1FCCC 1KH0A 1PUTA 1V5OA 3A9KA 3H7PB 4LDTB 3U2SC 1LQBA 1FRDA 3ZJUA 2IYDB 3A9JA 2G4SA 3MHZA 5IN7A 4KVGB 4WURA 3KLSX 1EUVB 1TJEA 1SGHA 1ZE3D 2MJEA 2DAJA 3HUIA 2RDGA 4W9IA 1T3QA 1YIWA 3NZUA 1WXSA 4XYCA 1UBIA 3CSFA 3IG3A 1AARA 4AS1A 1WMHB 4AJYB 2M0AA 2Y3AA 2DWQA 2KJ6A 4LNIA 2LGSA 1UELA 3BWUD 1QOAA 2ZW1A 1ZGUB 5HG2A 4PK1A 2RR9A 2C7MB 2J0MA 4FLHA 3JW0X 2NCNA 3EFCA 2ZPNA 3QARA 4M8NA 1JQ4A 4TQ0A 4PS8A 1ENFA 3SFDB 4ANVA 2ZJDA 1KLUD 1WGHA 1N61A 5HFYA 2R61A 5JXVA 2KFKB 4YSZB 2JVCA 3EECA 3D32A 2L05A 2CJOA 2KXJA 4HWIB 2Y5BB 1NI3A 3H1UA 3RCZA 3W2DA 1YX6B 3MTNB 3MJ5A 3ZW3A 5MPOA 4IDIA 3DWMA 5BMGA 1Q1OA 2CU1A 4USAA 2OOBB 3U7DA 4ZDVA 1J7CA 2EMTA 2KMMA 2L00B 2N4FA 1V1OA 5KHQA 1BXTA 2WS3B 3HK0A 3DBLI 3ZNGC 1PFDA 3RN9C 2IO2B 1R7SA 1HZ5A 2VRRB 2VZKB 5D94A 1FEHA 3AEGB 1XEEA 5EE0A 3N9YC 4IM0A 1C77A 5FKAC 1PGXA 2KYWA 1VR9A 5G5GA 3VTWA 3MHSD 3B2FA 3TEXA 1WX8A 4LLGM 2J52A 5G55A 3DVNV 4W9GA 2CHWA 5LXHA 1SB3C 1DOXA 1A5RA 3MJWA 1WRIA 4KZCA 1TZOA 4M8MA 4LK0M 3BVGA 1XF5L 1K50A 4C4VA 4IW0A 4KKIA 2AQ1B 3DVGX 1WGDA 2LD9A 2JSVX 5JHAA 5JZEB 4GOCA 4NNJB 3HRDD 4MT5A 4D2KA 1XCQL 2LXAA 2GMIC 3QHTA 1QZEA 1FFVA 3RNBC 4C7ZA 1D4BA 3AEBB 4B95A 3DVNU 4AWJA 4E71A 1N5WA 2ZNVC 2FIFA 2Z0EB 1YN4A 3P4PB 3IT4B 3NJTA 5FR6A 3H8HA 1VDVA 1IGCA 4MGIE 4M00A 1OGWA 2KT7A 1JWUD 4OZCA 3HM6X 2YLMA 4NY0A 1F77A 1NBFC 4K3BA 2MBQA 2INPE 1QOGA 3C8YA 3VTUA 2B76B 2W82A 3E56A 2MHJA 4HRSA 4XX5A 1WIAA 2PE6B 4IOIE 3N3KB 1FCLA 2K3UA 3IFWB 2QILA 4BKTA 1FNVA 1UGMA 2KTFA 4OZAA 2K22A 3VRBB 4AOFA 1K8RB 5IP4D 3IAM1 4EEWA 2LI5A 4M0WB 3RZFA 2CKHB 2LVPA 4ARIA 1MVKA 2FCNA 2XBBC 1QF6A 3ZJTA 1T0RC 1TKYA 2MX2A 3TEYA 5DPTA 4BKSD 3I5JC 3U52E 1WJUA 4A90A 2KLCA 1UZXB 1SEBD 2MW5A 2N7DA 2WWZA 3AEAB 1CK1A 2JF5A 2IGHA 3RNAC 4IC7B 2QJLA 4CO7A 4HJKA 3QIJA 1WM3A 3U4EG 2Z0DB 4MELA 2DAFA 3EC8A 2WXRA 4YTNB 4GU2A 4BAXA 4DWFA 2GBNA 3NG0A 3K9PB 1C4PA 1E9MA 1JW9D 1SSNA 4IKGA 4GDKB 1ZPSA 1IBXB 4ANWA 1HA5A 2LRWA 1UWXA 2LFIA 1VZ6A 3JSVA 4R3DA 4RGOS 4BKGA 4MEMA 2CU3A 1FNWA 3ZRFA 3QA8A 4AUQC 2KQ4X 4EUTA 2BKFA 3PZ8A 4W9CA 3ZO5B 1Z2MA 3AU4A 1E7UA 3Q2AC 4JE3B 1TYGB 1YN5A 1L6UA 2SAKA 1I42A 4PT5A 1XLQA 2LGXA 3PRZA 2IY0B 2B3AA 2JT4B 4ZRKA 2SEBD 2CHXA 1XLPA 3BYTB 3T9LA 1F52A 3V6CB 1TS3A 1V2YA 1IPGA 3FC4A 1L2NA 3I63C 1R4NI 3Q8CA 3AH7A 2RDHA 2I2YA 1YJ1A 3AV8A 5D7GA 5AUKA 4NPNA 1I4HA 3Q3OC 1PYWD 4YT0B 4ZHPA 2KMAA 2FCSA 3H7SA 5G5HA 2D2QA 1P9DU 1V1PB 4ICUA 3RUIB 2J42A 1WGRA 5GXGB 3APCA 1KLVA 5D2MB 4FJVB 2Y5PA 4C00A 3PGEA 1QT9A 3AB5A 3FAHA 1VZ7A 4WWOA 2KLGA 2V3SA 2WLBA 1L0YB 2JQRB 1V5TA 2KVRA 1E0ZA 3AULA 1D5MC 2BB6A 2K6QA 3OJ4B 5CHVC 3QAQA 1K52A 2OJRA 4W9JA 3C0RB 1WJ6A 2NVUI 3TEZA 1WJ4A 3BVMA 1ZKHA 2FNJB 2J0JA 3ZGZA 3MC9A 3TUOA 2D3BA 2N9PC 1WSPA 3ENEA 2PIAA 2N1VA 2LHEA 2L32A 2KDBA 4WWPA 1ZXHA 1GOZA 4MSMB 4BZAA 4KIKA 1SJED 1SXTA 2QDFA 3SFEB 4WJNA 5AUIA 2W3SA 5C2TB 2K6DB 4QAYA 2C5LC 2DBYA 2JPHA 2KDMA 5BO4B 4MGYE 4N9F4 2JY6A 2DYOA 3UIPB 5HKHA 3UGBB 3K9OB 2ZEQA 1R4MI 3FILB 4WAAA 4MM3A 4DHZE 4W9KA 1N60A 1E5WA 3LYYA 2UYZB 3V05A 3IBEA 4HXDA 5LLIA 2MA9B 2HJ1A 1QILA 2QHOA 5JHBA 2MQJA 2L1AA 4NQLB 2JXXA 1LGRA 1TS2A 4LNOA 2PVGC 1I35A 3B2GA 4E74A 1WGKA 1XXGA 1WXMA 3N1ZC 4WQMA 2LGYA 4KDIC 1ISNA 4ARCA 4GGQA 1JCKB 1RFKA 4S0RA 2KKCA 3KYDD 2C7HA 3KUCB 4IWPA 3O65B 2O6VB 1MHHE 2X38A 4EOYA 2G4DB 4DDID 2V4LA 3DHHC 2WXJA 2K9XA 1JWAD 2PLPA 2RSUA 4FJZA 2EMSA 1Q5WB 2E6XA 4DXFA 1JMLA 4JX1C 3M95A 4JGHB 2XNAC 1MJDA 2J53A 3ONSA 2GOWA 4NAWB 2CR5A 3TJPA 3L10B 5FR3A 4HCPB 4TMAB 1L0VB 4JIOU 4S17A 3GOEA 2H89B 1Z5SB 1GAQB 3VHTC 2BW2A 2GLSA 1ACCA 2O2VA 1NVID 1S3SG 1ZDXA 1M94A 3P63A 2D3AA 1EF5A 1WJNA 3A1QA 2KQ7A 2OHFA 3DCGA 2NTTA 1S1QB 4FHKA 4FHJA 3EHVA 4L2YA 3T8MA 4ZRQA 2BKRB 1WXQA 2LEKA 5HHDG 2L0TA 3CSTA 1R4NB 4YTPB 2GRIA 3AE7B 3AM9A 4RH6A 3WIMA 3ZTCA 1E8WA 4URKA 4EKUA 4DXAB 1I4PA 3H7PA 1J7AA 2EKEC 4C80A 4JPSA 4P7IA 2KZRA 3AXCA 2VH2A 2WGSA 4MJSA 2LGIA 1JWSD 2IO3B 4F7ZA 1UH6A 3KVFB 1N62A 5LNK1 4HK2A 4PS7A 2ASQA 3OWEB 3PZDA 4PYUA 2FCQA 2MWSB 3ZVVA 1XLNA 3IVFA 2E3TA 3ZNID 4WJQA 1XLOA 3T3NA 4NJ6A 1FNUA 1N5XA 1ZW7A 4W9HA 1I7HA 2RDBC 2RD0A 2KDFB 3E9SA 1E10A 4RF1A 3BY4B 3P4QB 3QC8B 2PVOD 4RCOA 3URYA 4N6EB 4A3OA 3Q6BA 1WRDB 3RNEC 3A9KB 3BZDB 4AQ7A 4CHKA 5GMVA 1XCTL 2KWUB 3CF6E 1N6ZA 4JWUC 2BYFA 1JALA 1ZXIA 4EZJA 4AP4C 2WYQA 4HPLB 3A9JB 1YX5B 4GDLA 4RGNA 4RM8A 2LVQA 2INNE 1C76A 3VQIA 2JYTA 5D6JB 1TS4A 1QOBA 3TEWA 2WDTB 1J19A 2MSED 4LJOB 3PT2B 4P16A 2BB5A 3HHMA 1R4MB 3ZKJC 4F8CB 1L6VA 2J7QB 2KMCA 4DQOC 2JXTA 3GE3C 4BFRA 4JLCA 3RNCC 2XEWA 3PZ7A 2D11A 2NS5A 1STEA 2K0PA 3IHPC 2MP2B 4O1NA 1NENB 4P6VF 3IXSA 4J3OD 2JZPA 5J2RA 3PLUA 1EF1A 4WJPA 2KANA 1YQ3B 4II2B 2L7RA 2MBOA 3AU5A 3NY5A 3PHXB 3W9CB 1ZUD2 3WAPA 1T5XD 2FBWB 3TBLD 3R7QA 2KC1A 2ZCBA 3NVZA 4BBNF 2WHIA 1WE7A 3AI5A 4RM9A 2NPTA 1YD8U 5BYQA 2NTSA 3UI3A 3JYUA 3DWGC 1C1YB 1J7BA 3Q3JA 2I38A 1CZPA 3VH3B 5CHWA 2WDRB 3OAWA 4G50A 4MDKE 3RFZB 1MPEA 1P0RA 1F0ZA 2N9XA 2AL3A 1FXTB 4DK5A 5G2NA 1UNSA 4ZOHC 2JYEA 1T0QC 2M17A 5H8YE 1ESFA 1MHXA 1PGAA 4YXDB 5AEKB 1MI0A 4GXBA 2V3NA 1LO5D 3N20C 2G45B 2WXGA 4PS3A 4ASWC 4E3CA 3T3OA 2M56B 4X57B 1OTRB 2R2OA 2FIDA 3GS2A 3QCAA 2PKOA 4OHJA 1A70A 5IOIA 1AWDA 4G11A 1F1HA 4C4VB 1KFYB 3ZNZB 4ACFA 3GE8C 4YSYB 1WF9A 5BMIA 1CJEA 2GBRA 4I6LB 5C23A 1T0YA 2NMQA 4EE2A 1KTKA 2ON8A 4IWQA 1WM2A 3Q8AA 3AN1A 4REZA 1DOYA 3HIZA 1UBQA 4M0WA 3A33B 3RT3B 3TIXA 2MBBB 4ZRJA 5D3DA 2N9EB 3L4PA 4N59A 4BKSA 1FMAD 1I4GA 1UD7A 2YEPF 4KSLC 1SE2A 3AEFB 3O13A 3AE4B 2KDEB 4MACA 3WA0A 5TSSA 5J18A 1V49A 3HVZA 1P98A 2PJHA 4K81A 4EZLA 1GB1A 1WR6E 2RPQA 4II3B 4JQWC 4JL9A 2KX3A 3QQ8B 1KM7A 2BS3B 3VTVA 1HEZE 3M63B 3B9JA 4UDUC 1SE3A 4DXGA 3MFGA 2FCMA 3ETRA 1TT5B 2BWFA 2GBMA 3SEBA 2V0GA 4LNNA 1H8CA 4GN1A 3OLMD 4OVZA 1XQQA 5BYSA 4ZRPA 5BYRA 2W3RA 2GB1A 2FAZA 2PE9A 3AE9B 3LXFA 3ML9A 4HCNB 3HVDA 3ZRCA 4A20A 2BF8B 3ZNHB 4BOSC 2LJIA 2M1MA 3NRZA 4US9A 2QEJC 3DBRI 3PS6A 4B6WA 1V80A 2LHDA 3BIID 2HE7A 1L5PA 1JRPA 5DCNA 4GIVA 1VRAB 2Q5WD 4OZBA 4EZKA 1QQRA 4M01A 4K3CA 4DDGD 4P1CC 1BUIC 3ZXVA 1OFFA 2BPSA 1GNUA 3RI7C 1PQSA 1WGYA 4YL8A 1WGGA 1IUEA 4GMVA 2Z8LA 2V4IB 1SJHD 3DBLB 2IJ0A 3JSVB 3DVGY 3IAS1 5E6NA 1V1PA 3Q3NC 3ZUNA 3UQBA 3DBSA 3UINB 4C7YA 3I3TB 3Q8EA 2CJNA 5IA7A 5DPWA 1GC7A 3TSSA 3DHGC 3WANA 1WXVA 4RMAA 1VLBA 4P1BC 1E8YA 4MSQB 1FXIA 3ZIMA 2LVOA 3R2TA 2BS4B 4KX6B 1YOVB 2MBHA 3VXWA 1V8CA 3P4SB 2LUEA 2WX0A 2WQYB 4ZYSA 2I1JA 1RFAA 3AE1B 2AQ2B 4B0MA 1WR1A 3APFA 2DZIA 3HM3A 1BMLC 4KSKC 3AE6B 2LRUA 1ET6A 3LDZE 2YEPB 4OW0A 1SE4A 1SE9A 3SDLC 1FM0D 2KX0A 2ZW0A 2BVCA 2KQSA 5H92C 3C19A 2DENB 2WX1A 1TKEA 2JZZA 1P7EA 2V9HA 3NHEB 4K7UA 2DZMA 1TBEA 3QWZB 1TIFA 2D3GA 2R2QA 2PEAA 3SHQA 2V1YA 4KZ0A 1NI2A 2LXCA 1FFUA 2N9LA 4K7WA 1V97A 4A3PA 4KGRA 3V60A 3W5VB 1KOTA 2BGFA 5CHFA 2L52A 2D10A 3I57A 4HPPA 3VR9B 1QLBB 1L4ZB 4WWNA 4IM2A 4KIKB 4L1BA 3KWLA 1KJTA 3PVLA 3AEDB 3Q3MC 1WX7A 3N1XC 4J6IA 2L8JA 3CMMB 2V3PA 4RNAA 2UU7A 2WXHA 1WFYA 3AMZA 3APDA 4W9EA 1XO3A 4MM3B 3M3JA 1TY0A 1D5XC 4HDQA 2OEDA 4PYZA 1WWTA 1JWMD 1D5ZC 2M4NA 4TUUA 4GSWA 4YTMB 2KVZA 3V61A 1ROEA 1NEKB 2KTRA 2PW9A 3SD5A 4OVVA 2CS4A 2IY1B 2XK5A 3SU8X 1YJJA 4NAWA 1JROA 1C4AA 3VUWA 1EU3A 3P1MA 3L16A 2J0KA 2JWZA 3TL5A 1HE8A 3X23A 1B9RA 2QMTA 3H9DA 4Q2JA 1GB4A 4LTUA 3M62B 4HLEA 2WXPA 1WI0A 2BYEA 1OEYJ 1NYQA 1WXAA 4HROA 2L3ZA 1F2RI 1DOIA 3DBRB 3EFUA 2WXQA 2WXIA 3AECB 4G0NB 3L13A 4ANXA 2MBEA 3VH4B 2IO1B 1OEYA 4XDCA 2MRPA 2VH1A 3ZDTA 4DHJD 5C1ZA 2AL6A 3NOBA 5E6OA 2BWES 1GUAB 2KDIA 1RYJA 2FUHB 3RNFC 1YQ4B 2D3CA 4W9LA 4BOZB 2BQQA 1E7VA 2AEHA 1RM6C 2K25A 1EU4A 2MLBA 1WY8A 1NYRA 4C56C 2O2VB 1RLFA 3LJ3A 2L76A 3PREA 4DBGA 2KN4A 3I9V1 4FXCA 4MH8A 2K1FA 3L0WB 3PSEB 4RFBA 3MC0B 2ZVOA 3A4RA 4LDTD 2L83A 4GLSC 3RULA 1TTNA 4OVUA 4N58A 3B0AA 2HJ8A 2WU5B 5AZFA 3W1SC 5C3JB 2DLBA 3V6EB 1E8XA 2PPHA 1WMHA 2FE8A 3N1YC 1CQVA 1KLGD 3KQ4A 2QCZA 1GPXA 3GB1A 1E8ZA 4MJSB 1FIQA 4AJWA 3AE8B 5L83A 2DHZA 3RMKC 1KRHA 1B1ZA 3DPDA 2WDVB 1RWSA 2GBJA 3X0WA 2KK8A 3L08A 3Q14C 2BTEA 2BBCA 2WDQB 4F1SA 3VUXA 1JRUA 1YN3A 1UUPA 4YWGG 4B9KA 4XDDA 4ZRIA 3V62A 2NBVB 2KFJA 3RNGC 4A6QA 4NZLB 5IAAC 2L0FA 5D3IB 1L7YA 3NS1A 2WNMA 2TSSA 3OG5A 1VJKA 4A55A 2IGGA 2KFKA 1EWCA 4HPMB 4JWSC 1V6EA 3VUYA 2ZVNA 1LFDA 2LUMA 5AZGA 2RPVA 1I4XA 4YSXB 2NBWB 3PTFC 4A9AA 2W54A 3NZSA 3ECIA 1Q0WB 2MP2A 4KKJA 2WU2B 1K53A 3SR6A 1I4QA 4GDLB 2D5GA 3GZNI 4H2AA 3RZWC 3FKYA 4NJCA 4BBNC 2IPKD 2N9KA 2K39A 4CQNA 2JX5A 2KJRA 4LCDE 3S2AA 2JRIB 4NQKE 1OQRA 2DYBA 4HKQA 2KNBA 4KDLB 4IUMB 2A5UA 3R8BA 1TKGA 4B0EA 2MEKA 1P3QU 1SIJA 2GI9A 3ZXRA 4TV3A 1U4AA 3DQVA 4WH4A 4MGKE 2DX5B 4ZYNA
chains in the Genus database with same CATH topology
3L17A 4WWPA 3VTVA 1TGZB 3M63B 4MSMB 2ZCCA 4TKNA 2JRHA 4KIKA 2FCMA 2BWFA 2GBMA 4WJNA 2BYVE 1VCBA 2LWPA 2KD0A 3A1QB 1H8CA 3KH0A 2HD5B 3QJZA 2K6DB 4GN1A 3OLMD 2GBKA 1XQQA 4K7SA 2C5LC 2JPHA 1VD2A 2KJHB 5BO4B 4MGYE 4N9F4 3W1YA 2FAZA 2PE9A 2I1KA 4XZ4A 1CMXB 2JY6A 2DYOA 3ML9A 4HCNB 4HVBA 3TMPB 1IP9A 3UIPB 3ZRCA 3H6NA 3UGBB 5HKHA 3K9OB 4A20A 2ZEQA 1R4MI 4WAAA 2BF8B 4IG7B 4MM3A 3ZNHB 4DHZE 4W9KA 4BOSC 1V5OA 3PPAA 1E5WA 2M1MA 3A9KA 3H7PB 4I6NB 2UYZB 4LDTB 3BINA 3IBEA 4HXDA 5LLIA 1LQBA 2MA9B 4WQOB 1TZ1A 3WALA 4EFOA 3DBRI 2QHOA 3PS6A 2NPTB 1V80A 4B6WA 5JHBA 2MQJA 2HE7A 2IYDB 3A9JA 2G4SA 3RD2A 3W1SA 4NQLB 2JXXA 5DCNA 4GIVA 2KWVB 4EZKA 4KVGB 2KOXA 4WJOA 2ZZPB 4DDGD 2M0XA 2BPSA 3DOWA 1GNUA 1EUVB 1PQSA 1WGYA 2W9NA 4YL8A 1I35A 4E74A 1WGGA 1SGHA 4GMVA 2DAJA 2UWQA 4W9IA 1YIWA 1LM8B 3WAOA 1WXMA 1NDDA 3NZUA 2LGYA 4KDIC 1ISNA 1WXSA 3JSVB 1UBIA 3CSFA 3DVGY 3KUZA 5E6NA 3IG3A 1AARA 4GGQA 1J8CA 3ZUNA 1WMHB 3UQBA 1V86A 3DBSA 3JVZX 3UINB 2KKCA 3KW5B 3KYDD 3PRPB 4AJYB 1G6JA 4NJ7A 2C7HA 2KJ6A 3KUCB 3O65B 2O6VB 4ICVA 4IWPA 3I3TB 5IA7A 1UELA 5DPWA 4EOYA 2G4DB 1GC7A 4DDID 2V4LA 1ZGUB 4XC2A 5CX3A 2RGFA 1WXVA 3WANA 4BVUC 2RSUA 3KUDB 4RMAA 2RR9A 1E8YA 5AZHA 5L95C 2C7MB 2J0MA 4MSQB 4FJZA 4FLHA 3ZIMA 2EMSA 2LVOA 1Q5WB 2NCNA 3JW0X 2A4ZA 2ZPNA 3ML8A 3QARA 4M8NA 4TQ0A 3M95A 4PS8A 4JGHB 3VXWA 2MBHA 1BT0A 2LUEA 4MGZE 2WX0A 2I1JA 4ANVA 1MG8A 2ZJDA 1RFAA 3ONSA 2GOWA 4NAWB 2CR5A 3TJPA 3L10B 4HCPB 1WR1A 1WGHA 2KFKB 3APFA 2DZIA 3PHWB 2JVCA 3EECA 3HM3A 3D32A 4JIOU 2L05A 4KSKC 2CHZA 3GOEA 3U8ZA 2LRUA 2MCNB 3LDZE 1Z5SB 2KXJA 2AYOB 2Y5BB 3B08A 4HWIB 3VHTC 1RRBA 1SE9A 3SDLC 3H1UA 3RCZA 2O2VA 2KX0A 1S3SG 4IM3A 2KQSA 1M94A 2AWTA 2DENB 4DHZB 1EF5A 1YX6B 3A4SC 2WX1A 2KWCA 3MTNB 1WJNA 2JZZA 3A1QA 3ZW3A 2KQ7A 3DCGA 5KHOA 2M8SA 5LXIB 3NHEB 1S1QB 1Q1OA 2CU1A 4FHKA 2OOBB 4K7UA 2DZMA 1TBEA 2EMTA 3EHVA 3QWZB 4FHJA 3U7DA 4ZDVA 3T8MA 2D3GA 2L00B 2R2QA 3DBHI 2PEAA 2BKRB 2N4FA 4GDKA 3SHQA 2V1YA 5KHQA 1GJZA 4KZ0A 1NI2A 2L0TA 3CSTA 2DZJA 2LXCA 3HK0A 3DBLI 3ZNGC 4K7WA 5J17A 3WIMA 4A3PA 3ZTCA 1E8WA 2IO2B 4URKA 4EKUA 4DXAB 3V60A 2VRRB 3R66C 3H7PA 5D94A 1GG3A 1KOTA 2EKEC 2BGFA 5CHFA 4IWOA 4P7IA 2KZRA 3AXCA 5CTRC 2D10A 3L54A 4MJSA 4IM0A 2KC2A 2IO3B 1YQBA 4MH0E 4F7ZA 1UH6A 4HDOA 3KVFB 4FULA 3OJ3A 3VTWA 4HK2A 3MHSD 4PS7A 2ASQA 1OQYA 4FA6A 1WX8A 2KHWB 3PZDA 4PYUA 3VDZA 2FCQA 2MWSB 4IM2A 4KIKB 3Q3FA 4WWNA 5E6PA 3ZVVA 1KJTA 3IVFA 3PVLA 2C9WB 3UQAA 5G55A 3ZNID 4WJQA 2ZPYA 1WX7A 3DVNV 4W9GA 2CHWA 5LXHA 4J6IA 2L8JA 3N30A 4ANUA 4NJ6A 1A5RA 1ZW7A 3CMMB 3MJWA 4W9HA 2RD0A 4KZCA 2IZVB 2KDFB 1V81A 4M8MA 2DZKA 3BY4B 4IW0A 1WZ0A 3DVGX 3QC8B 1D3ZA 2LJ5A 1WGDA 2LD9A 1WFYA 1WE6A 3APDA 4W9EA 5JHAA 5JZEB 4TQ1A 4GOCA 3M3JA 4A3OA 1WRDB 4NNJB 4HDQA 3A9KB 2LXAA 4PYZA 2GMIC 3QHTA 1QZEA 4CHKA 3WAMA 5GMVA 2KWUB 3CF6E 2N1WA 2BYFA 2M4NA 4TUUA 4GSWA 1GC6A 4B95A 3PLVA 3DVNU 4KV2A 3V61A 4AP4C 2WYQA 4AWJA 4E71A 2ZNVC 2FIFA 4HPLB 5EDSA 2Z0EB 2KTRA 3A9JB 1YX5B 1XD3B 1J0GA 5FR6A 4OVVA 3SD5A 2CS4A 2IY1B 4GDLA 2XK5A 4MGIE 3SU8X 4RM8A 3QX1A 1P1AA 2LVQA 3DDCB 3VQIA 1OGWA 4NAWA 5D6JB 2G3QB 2N7EA 1E90A 3VUWA 3L16A 2HTHA 2J0KA 2JWZA 3TL5A 1HE8A 3HM6X 1WZ3A 3X23A 2WDTB 1J19A 2MSED 3H9DA 4LJOB 2YLMA 4NY0A 1LXDA 3PT2B 3M62B 3HHMA 3UIOB 1NBFC 3R3MA 4HLEA 1RAXA 1WI0A 2BYEA 3ZKJC 1OEYJ 4F8CB 2IO0B 2MBQA 4K1RB 2J7QB 3VTUA 1WXAA 2KMCA 2L3ZA 2ZNVB 3EFUA 4BFRA 4XX5A 1WIAA 2PE6B 4G0NB 4JLCA 3L13A 3N3KB 4LJPB 4ANXA 2XEWA 2MBEA 2D11A 3VH4B 3ZTDA 3IFWB 2IO1B 3QK0A 4FADA 2NS5A 1OEYA 2MRPA 3ZDTA 4BKTA 4DHJD 1UGMA 2KTFA 5C1ZA 4AOFA 2AL6A 1K8RB 3VVWB 3IHPC 2MP2B 2JZ3B 3ZDMC 2D07B 4EEWA 2LI5A 3NOBA 4M0WB 5E6OA 3RZFA 2BWES 2CKHB 2LVPA 1GUAB 2FCNA 2KDIA 2XBBC 5J2RA 3PLUA 2FUHB 2K8HA 4FBJB 2MX2A 5TR5A 1WYWB 1EF1A 4W9LA 4WJPA 2KANA 5DPTA 4BKSD 3NY5A 1WX9A 2L7RA 2MBOA 3AU5A 3PHXB 4II2B 4BOZB 1E7VA 2AEHA 1WJUA 1SIFA 5DPSA 2KLCA 1UZXB 3WAPA 2MW5A 3P2BA 2K25A 3TBLD 2N7DA 2KC1A 2WWZA 2ZCBA 3R7QA 4BBNF 2MLBA 1WY8A 1WE7A 2JF5A 2O2VB 3PV1A 3AI5A 1RLFA 3LJ3A 2L76A 2NPTA 4RM9A 1YD8U 3PREA 4DBGA 4IC7B 4CO7A 4HJKA 2K1FA 3L0WB 3QIJA 1H4RA 3PSEB 3ALBA 1WM3A 3JYUA 4I6PA 2K8BA 2Z0DB 4MELA 3ZLZA 4EZJA 2ZVOA 2NR2A 3A4RA 2DAFA 1C1YB 1Y8RC 3EC8A 4LDTD 4GU2A 1TTNA 3RULA 2IBIB 4DWFA 2GBNA 2DYMA 4OVUA 3B0AA 3K9PB 2HJ8A 3Q3JA 2REXA 4GDKB 3VH3B 5CHWA 5AZFA 3W1SC 4ANWA 2JUOA 3UF8A 2C7NB 3OAWA 2LRWA 3R7RA 4G50A 2KO3A 3V6EB 3JSVA 1E8XA 2PPHA 4MDKE 4BKGA 4MEMA 1XT9B 1P0RA 1WMHA 4CYEA 2N9XA 3VAWA 3ZRFA 3QA8A 4W9FA 2AL3A 1FXTB 4AUQC 1E8ZA 2O6VA 4DK5A 2BKFA 4EUTA 4MJSB 5G2NA 4AJWA 4FN2A 5L83A 2M17A 2DHZA 2NBUA 4W9CA 3TCAA 1Z2MA 3N32A 3AU4A 3ZO5B 1E7UA 5AEKB 1V9JA 3DPDA 4GXBA 2GBJA 3X0WA 3RYTA 1I42A 2KK8A 3L08A 2LGXA 3PRZA 2G45B 2IY0B 4PS3A 4ASWC 3U30A 4E3CA 4F1SA 2Z59B 2B3AA 1C3TA 3VUXA 1JRUA 2JT4B 4B9KA 2LGDA 2O6VD 4X57B 4ZRIA 1OTRB 4ZRKA 2R2OA 2CHXA 3V62A 2NBVB 2KFJA 2FIDA 3QCAA 4FJYA 3VFKA 5DPRA 3T9LA 3V6CB 5IAAC 1V2YA 2L0FA 1L7YA 1IPGA 1L2NA 1R4NI 4G11A 1EO6A 3PRMB 2KFKA 4ZYNA 3ZNZB 1YJ1A 4HPMB 5D7GA 4NPNA 3VUYA 1V6EA 2ZVNA 1WF9A 2KMAA 2FCSA 1KLVA 5JH5C 3H7SA 1LFDA 5AZGA 2D2QA 1P9DU 2GBRA 4I6LB 5C23A 1T0YA 2NBWB 3PTFC 4ICUA 3RUIB 1WGRA 4IWQA 2KN5A 3NZSA 1WM2A 3ECIA 1Q0WB 3B1LX 2KTRB 2MP2A 3APCA 2N9PC 4FJVB 3HIZA 1UBQA 5D2MB 2LZ6A 1IYFA 3A33B 3KYCD 3PGEA 1WH3A 3RT3B 3TIXA 4GDLB 2MBBB 2XK5B 2K8CA 4WWOA 3GZNI 4ZRJA 2N9EB 2KLGA 1F9JA 3RZWC 4BBNC 4BKSA 1X1MA 2V3SA 1UD7A 4KSLC 2K39A 1V5TA 2KJRA 2KVRA 2LASA 4LCDE 3AULA 4W9DA 3S2AA 2JRIB 4NQKE 2K6QA 2DYBA 3OJ4B 5CHVC 3QAQA 2KDEB 2OJRA 4W9JA 3WA0A 2KNBA 4KDLB 4IUMB 4G3XB 5J18A 2A5UA 3C0RB 1V49A 1WJ6A 2NVUI 1WJ4A 1P98A 2YVCA 1P3QU 2PJHA 4TV3A 4K81A 1U4AA 1ZKHA 2FNJB 3DQVA 1WR6E 2J0JA 4DHJB 4EZLA 2RPQA 4MGKE 4GB9A 2C60A 4II3B 3NS8A 4JQWC 2DX5B 2KX3A 3ENEA 4JL9A 3QQ8B 1KM7A 2N1VA 2KDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L17 A;  4WWP A;  3VTV A;  1TGZ B;  3M63 B;  4MSM B;  2ZCC A;  4TKN A;  2JRH A;  4KIK A;  2FCM A;  2BWF A;  2GBM A;  4WJN A;  2BYV E;  1VCB A;  2LWP A;  2KD0 A;  3A1Q B;  1H8C A;  3KH0 A;  2HD5 B;  3QJZ A;  2K6D B;  4GN1 A;  3OLM D;  2GBK A;  1XQQ A;  4K7S A;  2C5L C;  2JPH A;  1VD2 A;  2KJH B;  5BO4 B;  4MGY E;  4N9F 4;  3W1Y A;  2FAZ A;  2PE9 A;  2I1K A;  4XZ4 A;  1CMX B;  2JY6 A;  2DYO A;  3ML9 A;  4HCN B;  4HVB A;  3TMP B;  1IP9 A;  3UIP B;  3ZRC A;  3H6N A;  3UGB B;  5HKH A;  3K9O B;  4A20 A;  2ZEQ A;  1R4M I;  4WAA A;  2BF8 B;  4IG7 B;  4MM3 A;  3ZNH B;  4DHZ E;  4W9K A;  4BOS C;  1V5O A;  3PPA A;  1E5W A;  2M1M A;  3A9K A;  3H7P B;  4I6N B;  2UYZ B;  4LDT B;  3BIN A;  3IBE A;  4HXD A;  5LLI A;  1LQB A;  2MA9 B;  4WQO B;  1TZ1 A;  3WAL A;  4EFO A;  3DBR I;  2QHO A;  3PS6 A;  2NPT B;  1V80 A;  4B6W A;  5JHB A;  2MQJ A;  2HE7 A;  2IYD B;  3A9J A;  2G4S A;  3RD2 A;  3W1S A;  4NQL B;  2JXX A;  5DCN A;  4GIV A;  2KWV B;  4EZK A;  4KVG B;  2KOX A;  4WJO A;  2ZZP B;  4DDG D;  2M0X A;  2BPS A;  3DOW A;  1GNU A;  1EUV B;  1PQS A;  1WGY A;  2W9N A;  4YL8 A;  1I35 A;  4E74 A;  1WGG A;  1SGH A;  4GMV A;  2DAJ A;  2UWQ A;  4W9I A;  1YIW A;  1LM8 B;  3WAO A;  1WXM A;  1NDD A;  3NZU A;  2LGY A;  4KDI C;  1ISN A;  1WXS A;  3JSV B;  1UBI A;  3CSF A;  3DVG Y;  3KUZ A;  5E6N A;  3IG3 A;  1AAR A;  4GGQ A;  1J8C A;  3ZUN A;  1WMH B;  3UQB A;  1V86 A;  3DBS A;  3JVZ X;  3UIN B;  2KKC A;  3KW5 B;  3KYD D;  3PRP B;  4AJY B;  1G6J A;  4NJ7 A;  2C7H A;  2KJ6 A;  3KUC B;  3O65 B;  2O6V B;  4ICV A;  4IWP A;  3I3T B;  5IA7 A;  1UEL A;  5DPW A;  4EOY A;  2G4D B;  1GC7 A;  4DDI D;  2V4L A;  1ZGU B;  4XC2 A;  5CX3 A;  2RGF A;  1WXV A;  3WAN A;  4BVU C;  2RSU A;  3KUD B;  4RMA A;  2RR9 A;  1E8Y A;  5AZH A;  5L95 C;  2C7M B;  2J0M A;  4MSQ B;  4FJZ A;  4FLH A;  3ZIM A;  2EMS A;  2LVO A;  1Q5W B;  2NCN A;  3JW0 X;  2A4Z A;  2ZPN A;  3ML8 A;  3QAR A;  4M8N A;  4TQ0 A;  3M95 A;  4PS8 A;  4JGH B;  3VXW A;  2MBH A;  1BT0 A;  2LUE A;  4MGZ E;  2WX0 A;  2I1J A;  4ANV A;  1MG8 A;  2ZJD A;  1RFA A;  3ONS A;  2GOW A;  4NAW B;  2CR5 A;  3TJP A;  3L10 B;  4HCP B;  1WR1 A;  1WGH A;  2KFK B;  3APF A;  2DZI A;  3PHW B;  2JVC A;  3EEC A;  3HM3 A;  3D32 A;  4JIO U;  2L05 A;  4KSK C;  2CHZ A;  3GOE A;  3U8Z A;  2LRU A;  2MCN B;  3LDZ E;  1Z5S B;  2KXJ A;  2AYO B;  2Y5B B;  3B08 A;  4HWI B;  3VHT C;  1RRB A;  1SE9 A;  3SDL C;  3H1U A;  3RCZ A;  2O2V A;  2KX0 A;  1S3S G;  4IM3 A;  2KQS A;  1M94 A;  2AWT A;  2DEN B;  4DHZ B;  1EF5 A;  1YX6 B;  3A4S C;  2WX1 A;  2KWC A;  3MTN B;  1WJN A;  2JZZ A;  3A1Q A;  3ZW3 A;  2KQ7 A;  3DCG A;  5KHO A;  2M8S A;  5LXI B;  3NHE B;  1S1Q B;  1Q1O A;  2CU1 A;  4FHK A;  2OOB B;  4K7U A;  2DZM A;  1TBE A;  2EMT A;  3EHV A;  3QWZ B;  4FHJ A;  3U7D A;  4ZDV A;  3T8M A;  2D3G A;  2L00 B;  2R2Q A;  3DBH I;  2PEA A;  2BKR B;  2N4F A;  4GDK A;  3SHQ A;  2V1Y A;  5KHQ A;  1GJZ A;  4KZ0 A;  1NI2 A;  2L0T A;  3CST A;  2DZJ A;  2LXC A;  3HK0 A;  3DBL I;  3ZNG C;  4K7W A;  5J17 A;  3WIM A;  4A3P A;  3ZTC A;  1E8W A;  2IO2 B;  4URK A;  4EKU A;  4DXA B;  3V60 A;  2VRR B;  3R66 C;  3H7P A;  5D94 A;  1GG3 A;  1KOT A;  2EKE C;  2BGF A;  5CHF A;  4IWO A;  4P7I A;  2KZR A;  3AXC A;  5CTR C;  2D10 A;  3L54 A;  4MJS A;  4IM0 A;  2KC2 A;  2IO3 B;  1YQB A;  4MH0 E;  4F7Z A;  1UH6 A;  4HDO A;  3KVF B;  4FUL A;  3OJ3 A;  3VTW A;  4HK2 A;  3MHS D;  4PS7 A;  2ASQ A;  1OQY A;  4FA6 A;  1WX8 A;  2KHW B;  3PZD A;  4PYU A;  3VDZ A;  2FCQ A;  2MWS B;  4IM2 A;  4KIK B;  3Q3F A;  4WWN A;  5E6P A;  3ZVV A;  1KJT A;  3IVF A;  3PVL A;  2C9W B;  3UQA A;  5G55 A;  3ZNI D;  4WJQ A;  2ZPY A;  1WX7 A;  3DVN V;  4W9G A;  2CHW A;  5LXH A;  4J6I A;  2L8J A;  3N30 A;  4ANU A;  4NJ6 A;  1A5R A;  1ZW7 A;  3CMM B;  3MJW A;  4W9H A;  2RD0 A;  4KZC A;  2IZV B;  2KDF B;  1V81 A;  4M8M A;  2DZK A;  3BY4 B;  4IW0 A;  1WZ0 A;  3DVG X;  3QC8 B;  1D3Z A;  2LJ5 A;  1WGD A;  2LD9 A;  1WFY A;  1WE6 A;  3APD A;  4W9E A;  5JHA A;  5JZE B;  4TQ1 A;  4GOC A;  3M3J A;  4A3O A;  1WRD B;  4NNJ B;  4HDQ A;  3A9K B;  2LXA A;  4PYZ A;  2GMI C;  3QHT A;  1QZE A;  4CHK A;  3WAM A;  5GMV A;  2KWU B;  3CF6 E;  2N1W A;  2BYF A;  2M4N A;  4TUU A;  4GSW A;  1GC6 A;  4B95 A;  3PLV A;  3DVN U;  4KV2 A;  3V61 A;  4AP4 C;  2WYQ A;  4AWJ A;  4E71 A;  2ZNV C;  2FIF A;  4HPL B;  5EDS A;  2Z0E B;  2KTR A;  3A9J B;  1YX5 B;  1XD3 B;  1J0G A;  5FR6 A;  4OVV A;  3SD5 A;  2CS4 A;  2IY1 B;  4GDL A;  2XK5 A;  4MGI E;  3SU8 X;  4RM8 A;  3QX1 A;  1P1A A;  2LVQ A;  3DDC B;  3VQI A;  1OGW A;  4NAW A;  5D6J B;  2G3Q B;  2N7E A;  1E90 A;  3VUW A;  3L16 A;  2HTH A;  2J0K A;  2JWZ A;  3TL5 A;  1HE8 A;  3HM6 X;  1WZ3 A;  3X23 A;  2WDT B;  1J19 A;  2MSE D;  3H9D A;  4LJO B;  2YLM A;  4NY0 A;  1LXD A;  3PT2 B;  3M62 B;  3HHM A;  3UIO B;  1NBF C;  3R3M A;  4HLE A;  1RAX A;  1WI0 A;  2BYE A;  3ZKJ C;  1OEY J;  4F8C B;  2IO0 B;  2MBQ A;  4K1R B;  2J7Q B;  3VTU A;  1WXA A;  2KMC A;  2L3Z A;  2ZNV B;  3EFU A;  4BFR A;  4XX5 A;  1WIA A;  2PE6 B;  4G0N B;  4JLC A;  3L13 A;  3N3K B;  4LJP B;  4ANX A;  2XEW A;  2MBE A;  2D11 A;  3VH4 B;  3ZTD A;  3IFW B;  2IO1 B;  3QK0 A;  4FAD A;  2NS5 A;  1OEY A;  2MRP A;  3ZDT A;  4BKT A;  4DHJ D;  1UGM A;  2KTF A;  5C1Z A;  4AOF A;  2AL6 A;  1K8R B;  3VVW B;  3IHP C;  2MP2 B;  2JZ3 B;  3ZDM C;  2D07 B;  4EEW A;  2LI5 A;  3NOB A;  4M0W B;  5E6O A;  3RZF A;  2BWE S;  2CKH B;  2LVP A;  1GUA B;  2FCN A;  2KDI A;  2XBB C;  5J2R A;  3PLU A;  2FUH B;  2K8H A;  4FBJ B;  2MX2 A;  5TR5 A;  1WYW B;  1EF1 A;  4W9L A;  4WJP A;  2KAN A;  5DPT A;  4BKS D;  3NY5 A;  1WX9 A;  2L7R A;  2MBO A;  3AU5 A;  3PHX B;  4II2 B;  4BOZ B;  1E7V A;  2AEH A;  1WJU A;  1SIF A;  5DPS A;  2KLC A;  1UZX B;  3WAP A;  2MW5 A;  3P2B A;  2K25 A;  3TBL D;  2N7D A;  2KC1 A;  2WWZ A;  2ZCB A;  3R7Q A;  4BBN F;  2MLB A;  1WY8 A;  1WE7 A;  2JF5 A;  2O2V B;  3PV1 A;  3AI5 A;  1RLF A;  3LJ3 A;  2L76 A;  2NPT A;  4RM9 A;  1YD8 U;  3PRE A;  4DBG A;  4IC7 B;  4CO7 A;  4HJK A;  2K1F A;  3L0W B;  3QIJ A;  1H4R A;  3PSE B;  3ALB A;  1WM3 A;  3JYU A;  4I6P A;  2K8B A;  2Z0D B;  4MEL A;  3ZLZ A;  4EZJ A;  2ZVO A;  2NR2 A;  3A4R A;  2DAF A;  1C1Y B;  1Y8R C;  3EC8 A;  4LDT D;  4GU2 A;  1TTN A;  3RUL A;  2IBI B;  4DWF A;  2GBN A;  2DYM A;  4OVU A;  3B0A A;  3K9P B;  2HJ8 A;  3Q3J A;  2REX A;  4GDK B;  3VH3 B;  5CHW A;  5AZF A;  3W1S C;  4ANW A;  2JUO A;  3UF8 A;  2C7N B;  3OAW A;  2LRW A;  3R7R A;  4G50 A;  2KO3 A;  3V6E B;  3JSV A;  1E8X A;  2PPH A;  4MDK E;  4BKG A;  4MEM A;  1XT9 B;  1P0R A;  1WMH A;  4CYE A;  2N9X A;  3VAW A;  3ZRF A;  3QA8 A;  4W9F A;  2AL3 A;  1FXT B;  4AUQ C;  1E8Z A;  2O6V A;  4DK5 A;  2BKF A;  4EUT A;  4MJS B;  5G2N A;  4AJW A;  4FN2 A;  5L83 A;  2M17 A;  2DHZ A;  2NBU A;  4W9C A;  3TCA A;  1Z2M A;  3N32 A;  3AU4 A;  3ZO5 B;  1E7U A;  5AEK B;  1V9J A;  3DPD A;  4GXB A;  2GBJ A;  3X0W A;  3RYT A;  1I42 A;  2KK8 A;  3L08 A;  2LGX A;  3PRZ A;  2G45 B;  2IY0 B;  4PS3 A;  4ASW C;  3U30 A;  4E3C A;  4F1S A;  2Z59 B;  2B3A A;  1C3T A;  3VUX A;  1JRU A;  2JT4 B;  4B9K A;  2LGD A;  2O6V D;  4X57 B;  4ZRI A;  1OTR B;  4ZRK A;  2R2O A;  2CHX A;  3V62 A;  2NBV B;  2KFJ A;  2FID A;  3QCA A;  4FJY A;  3VFK A;  5DPR A;  3T9L A;  3V6C B;  5IAA C;  1V2Y A;  2L0F A;  1L7Y A;  1IPG A;  1L2N A;  1R4N I;  4G11 A;  1EO6 A;  3PRM B;  2KFK A;  4ZYN A;  3ZNZ B;  1YJ1 A;  4HPM B;  5D7G A;  4NPN A;  3VUY A;  1V6E A;  2ZVN A;  1WF9 A;  2KMA A;  2FCS A;  1KLV A;  5JH5 C;  3H7S A;  1LFD A;  5AZG A;  2D2Q A;  1P9D U;  2GBR A;  4I6L B;  5C23 A;  1T0Y A;  2NBW B;  3PTF C;  4ICU A;  3RUI B;  1WGR A;  4IWQ A;  2KN5 A;  3NZS A;  1WM2 A;  3ECI A;  1Q0W B;  3B1L X;  2KTR B;  2MP2 A;  3APC A;  2N9P C;  4FJV B;  3HIZ A;  1UBQ A;  5D2M B;  2LZ6 A;  1IYF A;  3A33 B;  3KYC D;  3PGE A;  1WH3 A;  3RT3 B;  3TIX A;  4GDL B;  2MBB B;  2XK5 B;  2K8C A;  4WWO A;  3GZN I;  4ZRJ A;  2N9E B;  2KLG A;  1F9J A;  3RZW C;  4BBN C;  4BKS A;  1X1M A;  2V3S A;  1UD7 A;  4KSL C;  2K39 A;  1V5T A;  2KJR A;  2KVR A;  2LAS A;  4LCD E;  3AUL A;  4W9D A;  3S2A A;  2JRI B;  4NQK E;  2K6Q A;  2DYB A;  3OJ4 B;  5CHV C;  3QAQ A;  2KDE B;  2OJR A;  4W9J A;  3WA0 A;  2KNB A;  4KDL B;  4IUM B;  4G3X B;  5J18 A;  2A5U A;  3C0R B;  1V49 A;  1WJ6 A;  2NVU I;  1WJ4 A;  1P98 A;  2YVC A;  1P3Q U;  2PJH A;  4TV3 A;  4K81 A;  1U4A A;  1ZKH A;  2FNJ B;  3DQV A;  1WR6 E;  2J0J A;  4DHJ B;  4EZL A;  2RPQ A;  4MGK E;  4GB9 A;  2C60 A;  4II3 B;  3NS8 A;  4JQW C;  2DX5 B;  2KX3 A;  3ENE A;  4JL9 A;  3QQ8 B;  1KM7 A;  2N1V A;  2KDB A; 
#chains in the Genus database with same CATH topology
 2VZK D;  1TGZ B;  4HEA 1;  2N7J A;  1DYQ A;  1SBB B;  2J4X A;  1VCB A;  3VR8 B;  3KH0 A;  4XWT A;  2HD5 B;  1MG4 A;  5FK9 C;  2WXM A;  1VD2 A;  5IO9 A;  3W1Y A;  3J9C A;  1N63 A;  2I1K A;  2N0S B;  2BS2 B;  4XZ4 A;  3ABV B;  1CMX B;  2EKI A;  3H6N A;  4WWM A;  4XE0 A;  4IG7 B;  1IGD A;  3PPA A;  4I6N B;  3BIN A;  4ITK A;  4WQO B;  3WAL A;  1TZ1 A;  3ZJV A;  4L23 A;  4EFO A;  3CWI A;  3KWV A;  5EE1 A;  2NPT B;  2HTM E;  3RD2 A;  2EEL A;  3W1S A;  2KWV B;  1UF0 A;  1FO4 A;  2KOX A;  4WJO A;  2ZZP B;  2IDY A;  4TSS A;  2M0X A;  5EE9 A;  3DOW A;  4KGS A;  2W9N A;  5BMH A;  2UWQ A;  1LM8 B;  3WAO A;  1NDD A;  3V3X A;  1ZDV A;  3KUZ A;  1L4D B;  1C9F A;  1J8C A;  2W55 A;  1FRR A;  1V86 A;  1D6E C;  3JVZ X;  3KW5 B;  1Q10 A;  3NVW A;  3PRP B;  1P7F A;  1G6J A;  4NJ7 A;  4ICV A;  5IKC M;  1M4V A;  2WXL A;  2INC C;  1EWY C;  4XC2 A;  5CX3 A;  2RGF A;  4BVU C;  3KUD B;  5AZH A;  5L95 C;  2A4Z A;  3ML8 A;  1UGJ A;  2WXF A;  1BT0 A;  4MGZ E;  1MG8 A;  2IND C;  1QKZ A;  3PHW B;  1HTQ A;  2PTL A;  2CHZ A;  3U8Z A;  2MCN B;  2AYO B;  3B08 A;  1RRB A;  2QIE B;  4IM3 A;  2AWT A;  1AW7 A;  4DHZ B;  3A4S C;  2KWC A;  4US8 A;  5KHO A;  2M8S A;  5LXI B;  3AE5 B;  3W5U B;  2ONQ A;  3DBH I;  1WYG A;  2KAJ A;  1I4R A;  4GDK A;  1IBX A;  1GJZ A;  2DZJ A;  2G9H D;  1K51 A;  2JU6 X;  5J17 A;  4ZHO A;  2ACZ B;  5HI1 A;  4WIP A;  1ZP0 B;  3R66 C;  1GG3 A;  4A8X C;  4IWO A;  3VRA B;  5CTR C;  3L54 A;  3WCQ A;  1C78 A;  1HXY D;  2KC2 A;  1YQB A;  2G1E A;  4MH0 E;  1TY2 A;  4HDO A;  4FUL A;  1AYF A;  3OJ3 A;  3P4R B;  1YMH E;  1OQY A;  4FA6 A;  3Q69 A;  2KHW B;  3VDZ A;  5E6P A;  3Q3F A;  1T6B X;  2C9W B;  3GZN B;  3UQA A;  2ZPY A;  3N30 A;  3NVY A;  4ANU A;  2OJW A;  2IZV B;  1V81 A;  3Q8F A;  2DZK A;  1WZ0 A;  3MP9 A;  1D3Z A;  4RGM A;  2LJ5 A;  1UWM A;  1WE6 A;  3ZQ4 A;  4TQ1 A;  2KWD A;  2WXO A;  1PDX A;  1EM7 A;  3R2I A;  3WAM A;  2N1W A;  1OQQ A;  2ICI A;  1GC6 A;  3PLV A;  4KV2 A;  5EDS A;  1XD3 B;  2WP9 B;  1J0G A;  2X8X X;  1HTO A;  2M19 A;  3EGR A;  3QX1 A;  1P1A A;  3DDC B;  2G3Q B;  2JWU A;  1E90 A;  2N7E A;  3CIR B;  2HTH A;  4WAF A;  1WZ3 A;  3BK1 A;  1LXD A;  1ET9 A;  2BYT A;  3UIO B;  3R3M A;  1RAX A;  2IO0 B;  4K1R B;  1SF0 A;  2MH7 A;  3NZ3 A;  1VZ8 A;  3LB8 C;  2ZNV B;  4LJP B;  2HDE A;  3ZTD A;  4FAD A;  3QK0 A;  1MFW A;  3VVW B;  2JZ3 B;  3ZDM C;  2D07 B;  1C79 A;  2K8H A;  4FBJ B;  3RPF C;  5TR5 A;  1WYW B;  1WX9 A;  4XWW A;  3FIL A;  1DGJ A;  1SIF A;  3BYY B;  5DPS A;  3P2B A;  1ZOY B;  4HKZ E;  2LMC A;  3PV1 A;  5EE3 A;  1HQR D;  1Y56 A;  1PGB A;  1H4R A;  3ALB A;  2XN9 C;  1HZ6 A;  4I6P A;  2K8B A;  3ZLZ A;  1AN8 A;  2NR2 A;  1Y8R C;  5T8I A;  2MJ3 A;  2IBI B;  2DYM A;  1C4C A;  2REX A;  1QOF A;  2IGD A;  2JUO A;  5E6J A;  4HJG E;  3UF8 A;  2C7N B;  3BK2 A;  3R7R A;  2KO3 A;  3GP7 A;  1XT9 B;  4RF0 A;  4CYE A;  3VAW A;  3EUB 2;  4W9F A;  2O6V A;  4FN2 A;  2NBU A;  3TCA A;  3N32 A;  1V9J A;  3RYT A;  1T0S C;  3U30 A;  1FD6 A;  2Z59 B;  1C3T A;  3Q8B A;  1E6E B;  2LGD A;  2O6V D;  3DHI C;  3DBH B;  3PO0 A;  3U7Z A;  4FJY A;  1FPY A;  2Y5C A;  3VFK A;  5DPR A;  3NUH B;  3P42 A;  2FUG 1;  1EO6 A;  3PRM B;  1YNT E;  1FXA A;  1TS5 A;  5JH5 C;  2WXN A;  4M02 A;  2DNF A;  2AQ3 B;  4RGT A;  2KN5 A;  2K5P A;  4LNK A;  3B1L X;  2KTR B;  1IYF A;  2LZ6 A;  3IT6 B;  3KYC D;  1WH3 A;  3ZYY X;  3NVV A;  2XK5 B;  2K8C A;  2QC8 A;  1F9J A;  1X1M A;  2LAS A;  4W9D A;  3MC8 A;  4G3X B;  3AE3 B;  2WXK A;  2YVC A;  2RMM A;  2BT6 A;  3AE2 B;  2PMV A;  4DHJ B;  1E7P B;  1JWB D;  2MJD A;  4GB9 A;  2C60 A;  3NS8 A;  5I4D A;  4KGT A;  3EA6 A;  1F2R C;  2QSD A;  3L17 A;  4NAM A;  4LNF A;  2ZCC A;  4TKN A;  2H88 B;  2JRH A;  3BVZ A;  2AX5 A;  2KAC A;  1YJI A;  2BYV E;  2LWP A;  2KD0 A;  1KF6 B;  3A1Q B;  3QJZ A;  2GBK A;  3AEE B;  1L0X B;  4K7S A;  2KJH B;  1IP9 A;  4HVB A;  3TMP B;  4XGA B;  1FCC C;  1KH0 A;  1PUT A;  1V5O A;  3A9K A;  3H7P B;  4LDT B;  3U2S C;  1LQB A;  1FRD A;  3ZJU A;  2IYD B;  3A9J A;  2G4S A;  3MHZ A;  5IN7 A;  4KVG B;  4WUR A;  3KLS X;  1EUV B;  1TJE A;  1SGH A;  1ZE3 D;  2MJE A;  2DAJ A;  3HUI A;  2RDG A;  4W9I A;  1T3Q A;  1YIW A;  3NZU A;  1WXS A;  4XYC A;  1UBI A;  3CSF A;  3IG3 A;  1AAR A;  4AS1 A;  1WMH B;  4AJY B;  2M0A A;  2Y3A A;  2DWQ A;  2KJ6 A;  4LNI A;  2LGS A;  1UEL A;  3BWU D;  1QOA A;  2ZW1 A;  1ZGU B;  5HG2 A;  4PK1 A;  2RR9 A;  2C7M B;  2J0M A;  4FLH A;  3JW0 X;  2NCN A;  3EFC A;  2ZPN A;  3QAR A;  4M8N A;  1JQ4 A;  4TQ0 A;  4PS8 A;  1ENF A;  3SFD B;  4ANV A;  2ZJD A;  1KLU D;  1WGH A;  1N61 A;  5HFY A;  2R61 A;  5JXV A;  2KFK B;  4YSZ B;  2JVC A;  3EEC A;  3D32 A;  2L05 A;  2CJO A;  2KXJ A;  4HWI B;  2Y5B B;  1NI3 A;  3H1U A;  3RCZ A;  3W2D A;  1YX6 B;  3MTN B;  3MJ5 A;  3ZW3 A;  5MPO A;  4IDI A;  3DWM A;  5BMG A;  1Q1O A;  2CU1 A;  4USA A;  2OOB B;  3U7D A;  4ZDV A;  1J7C A;  2EMT A;  2KMM A;  2L00 B;  2N4F A;  1V1O A;  5KHQ A;  1BXT A;  2WS3 B;  3HK0 A;  3DBL I;  3ZNG C;  1PFD A;  3RN9 C;  2IO2 B;  1R7S A;  1HZ5 A;  2VRR B;  2VZK B;  5D94 A;  1FEH A;  3AEG B;  1XEE A;  5EE0 A;  3N9Y C;  4IM0 A;  1C77 A;  5FKA C;  1PGX A;  2KYW A;  1VR9 A;  5G5G A;  3VTW A;  3MHS D;  3B2F A;  3TEX A;  1WX8 A;  4LLG M;  2J52 A;  5G55 A;  3DVN V;  4W9G A;  2CHW A;  5LXH A;  1SB3 C;  1DOX A;  1A5R A;  3MJW A;  1WRI A;  4KZC A;  1TZO A;  4M8M A;  4LK0 M;  3BVG A;  1XF5 L;  1K50 A;  4C4V A;  4IW0 A;  4KKI A;  2AQ1 B;  3DVG X;  1WGD A;  2LD9 A;  2JSV X;  5JHA A;  5JZE B;  4GOC A;  4NNJ B;  3HRD D;  4MT5 A;  4D2K A;  1XCQ L;  2LXA A;  2GMI C;  3QHT A;  1QZE A;  1FFV A;  3RNB C;  4C7Z A;  1D4B A;  3AEB B;  4B95 A;  3DVN U;  4AWJ A;  4E71 A;  1N5W A;  2ZNV C;  2FIF A;  2Z0E B;  1YN4 A;  3P4P B;  3IT4 B;  3NJT A;  5FR6 A;  3H8H A;  1VDV A;  1IGC A;  4MGI E;  4M00 A;  1OGW A;  2KT7 A;  1JWU D;  4OZC A;  3HM6 X;  2YLM A;  4NY0 A;  1F77 A;  1NBF C;  4K3B A;  2MBQ A;  2INP E;  1QOG A;  3C8Y A;  3VTU A;  2B76 B;  2W82 A;  3E56 A;  2MHJ A;  4HRS A;  4XX5 A;  1WIA A;  2PE6 B;  4IOI E;  3N3K B;  1FCL A;  2K3U A;  3IFW B;  2QIL A;  4BKT A;  1FNV A;  1UGM A;  2KTF A;  4OZA A;  2K22 A;  3VRB B;  4AOF A;  1K8R B;  5IP4 D;  3IAM 1;  4EEW A;  2LI5 A;  4M0W B;  3RZF A;  2CKH B;  2LVP A;  4ARI A;  1MVK A;  2FCN A;  2XBB C;  1QF6 A;  3ZJT A;  1T0R C;  1TKY A;  2MX2 A;  3TEY A;  5DPT A;  4BKS D;  3I5J C;  3U52 E;  1WJU A;  4A90 A;  2KLC A;  1UZX B;  1SEB D;  2MW5 A;  2N7D A;  2WWZ A;  3AEA B;  1CK1 A;  2JF5 A;  2IGH A;  3RNA C;  4IC7 B;  2QJL A;  4CO7 A;  4HJK A;  3QIJ A;  1WM3 A;  3U4E G;  2Z0D B;  4MEL A;  2DAF A;  3EC8 A;  2WXR A;  4YTN B;  4GU2 A;  4BAX A;  4DWF A;  2GBN A;  3NG0 A;  3K9P B;  1C4P A;  1E9M A;  1JW9 D;  1SSN A;  4IKG A;  4GDK B;  1ZPS A;  1IBX B;  4ANW A;  1HA5 A;  2LRW A;  1UWX A;  2LFI A;  1VZ6 A;  3JSV A;  4R3D A;  4RGO S;  4BKG A;  4MEM A;  2CU3 A;  1FNW A;  3ZRF A;  3QA8 A;  4AUQ C;  2KQ4 X;  4EUT A;  2BKF A;  3PZ8 A;  4W9C A;  3ZO5 B;  1Z2M A;  3AU4 A;  1E7U A;  3Q2A C;  4JE3 B;  1TYG B;  1YN5 A;  1L6U A;  2SAK A;  1I42 A;  4PT5 A;  1XLQ A;  2LGX A;  3PRZ A;  2IY0 B;  2B3A A;  2JT4 B;  4ZRK A;  2SEB D;  2CHX A;  1XLP A;  3BYT B;  3T9L A;  1F52 A;  3V6C B;  1TS3 A;  1V2Y A;  1IPG A;  3FC4 A;  1L2N A;  3I63 C;  1R4N I;  3Q8C A;  3AH7 A;  2RDH A;  2I2Y A;  1YJ1 A;  3AV8 A;  5D7G A;  5AUK A;  4NPN A;  1I4H A;  3Q3O C;  1PYW D;  4YT0 B;  4ZHP A;  2KMA A;  2FCS A;  3H7S A;  5G5H A;  2D2Q A;  1P9D U;  1V1P B;  4ICU A;  3RUI B;  2J42 A;  1WGR A;  5GXG B;  3APC A;  1KLV A;  5D2M B;  4FJV B;  2Y5P A;  4C00 A;  3PGE A;  1QT9 A;  3AB5 A;  3FAH A;  1VZ7 A;  4WWO A;  2KLG A;  2V3S A;  2WLB A;  1L0Y B;  2JQR B;  1V5T A;  2KVR A;  1E0Z A;  3AUL A;  1D5M C;  2BB6 A;  2K6Q A;  3OJ4 B;  5CHV C;  3QAQ A;  1K52 A;  2OJR A;  4W9J A;  3C0R B;  1WJ6 A;  2NVU I;  3TEZ A;  1WJ4 A;  3BVM A;  1ZKH A;  2FNJ B;  2J0J A;  3ZGZ A;  3MC9 A;  3TUO A;  2D3B A;  2N9P C;  1WSP A;  3ENE A;  2PIA A;  2N1V A;  2LHE A;  2L32 A;  2KDB A;  4WWP A;  1ZXH A;  1GOZ A;  4MSM B;  4BZA A;  4KIK A;  1SJE D;  1SXT A;  2QDF A;  3SFE B;  4WJN A;  5AUI A;  2W3S A;  5C2T B;  2K6D B;  4QAY A;  2C5L C;  2DBY A;  2JPH A;  2KDM A;  5BO4 B;  4MGY E;  4N9F 4;  2JY6 A;  2DYO A;  3UIP B;  5HKH A;  3UGB B;  3K9O B;  2ZEQ A;  1R4M I;  3FIL B;  4WAA A;  4MM3 A;  4DHZ E;  4W9K A;  1N60 A;  1E5W A;  3LYY A;  2UYZ B;  3V05 A;  3IBE A;  4HXD A;  5LLI A;  2MA9 B;  2HJ1 A;  1QIL A;  2QHO A;  5JHB A;  2MQJ A;  2L1A A;  4NQL B;  2JXX A;  1LGR A;  1TS2 A;  4LNO A;  2PVG C;  1I35 A;  3B2G A;  4E74 A;  1WGK A;  1XXG A;  1WXM A;  3N1Z C;  4WQM A;  2LGY A;  4KDI C;  1ISN A;  4ARC A;  4GGQ A;  1JCK B;  1RFK A;  4S0R A;  2KKC A;  3KYD D;  2C7H A;  3KUC B;  4IWP A;  3O65 B;  2O6V B;  1MHH E;  2X38 A;  4EOY A;  2G4D B;  4DDI D;  2V4L A;  3DHH C;  2WXJ A;  2K9X A;  1JWA D;  2PLP A;  2RSU A;  4FJZ A;  2EMS A;  1Q5W B;  2E6X A;  4DXF A;  1JML A;  4JX1 C;  3M95 A;  4JGH B;  2XNA C;  1MJD A;  2J53 A;  3ONS A;  2GOW A;  4NAW B;  2CR5 A;  3TJP A;  3L10 B;  5FR3 A;  4HCP B;  4TMA B;  1L0V B;  4JIO U;  4S17 A;  3GOE A;  2H89 B;  1Z5S B;  1GAQ B;  3VHT C;  2BW2 A;  2GLS A;  1ACC A;  2O2V A;  1NVI D;  1S3S G;  1ZDX A;  1M94 A;  3P63 A;  2D3A A;  1EF5 A;  1WJN A;  3A1Q A;  2KQ7 A;  2OHF A;  3DCG A;  2NTT A;  1S1Q B;  4FHK A;  4FHJ A;  3EHV A;  4L2Y A;  3T8M A;  4ZRQ A;  2BKR B;  1WXQ A;  2LEK A;  5HHD G;  2L0T A;  3CST A;  1R4N B;  4YTP B;  2GRI A;  3AE7 B;  3AM9 A;  4RH6 A;  3WIM A;  3ZTC A;  1E8W A;  4URK A;  4EKU A;  4DXA B;  1I4P A;  3H7P A;  1J7A A;  2EKE C;  4C80 A;  4JPS A;  4P7I A;  2KZR A;  3AXC A;  2VH2 A;  2WGS A;  4MJS A;  2LGI A;  1JWS D;  2IO3 B;  4F7Z A;  1UH6 A;  3KVF B;  1N62 A;  5LNK 1;  4HK2 A;  4PS7 A;  2ASQ A;  3OWE B;  3PZD A;  4PYU A;  2FCQ A;  2MWS B;  3ZVV A;  1XLN A;  3IVF A;  2E3T A;  3ZNI D;  4WJQ A;  1XLO A;  3T3N A;  4NJ6 A;  1FNU A;  1N5X A;  1ZW7 A;  4W9H A;  1I7H A;  2RDB C;  2RD0 A;  2KDF B;  3E9S A;  1E10 A;  4RF1 A;  3BY4 B;  3P4Q B;  3QC8 B;  2PVO D;  4RCO A;  3URY A;  4N6E B;  4A3O A;  3Q6B A;  1WRD B;  3RNE C;  3A9K B;  3BZD B;  4AQ7 A;  4CHK A;  5GMV A;  1XCT L;  2KWU B;  3CF6 E;  1N6Z A;  4JWU C;  2BYF A;  1JAL A;  1ZXI A;  4EZJ A;  4AP4 C;  2WYQ A;  4HPL B;  3A9J B;  1YX5 B;  4GDL A;  4RGN A;  4RM8 A;  2LVQ A;  2INN E;  1C76 A;  3VQI A;  2JYT A;  5D6J B;  1TS4 A;  1QOB A;  3TEW A;  2WDT B;  1J19 A;  2MSE D;  4LJO B;  3PT2 B;  4P16 A;  2BB5 A;  3HHM A;  1R4M B;  3ZKJ C;  4F8C B;  1L6V A;  2J7Q B;  2KMC A;  4DQO C;  2JXT A;  3GE3 C;  4BFR A;  4JLC A;  3RNC C;  2XEW A;  3PZ7 A;  2D11 A;  2NS5 A;  1STE A;  2K0P A;  3IHP C;  2MP2 B;  4O1N A;  1NEN B;  4P6V F;  3IXS A;  4J3O D;  2JZP A;  5J2R A;  3PLU A;  1EF1 A;  4WJP A;  2KAN A;  1YQ3 B;  4II2 B;  2L7R A;  2MBO A;  3AU5 A;  3NY5 A;  3PHX B;  3W9C B;  1ZUD 2;  3WAP A;  1T5X D;  2FBW B;  3TBL D;  3R7Q A;  2KC1 A;  2ZCB A;  3NVZ A;  4BBN F;  2WHI A;  1WE7 A;  3AI5 A;  4RM9 A;  2NPT A;  1YD8 U;  5BYQ A;  2NTS A;  3UI3 A;  3JYU A;  3DWG C;  1C1Y B;  1J7B A;  3Q3J A;  2I38 A;  1CZP A;  3VH3 B;  5CHW A;  2WDR B;  3OAW A;  4G50 A;  4MDK E;  3RFZ B;  1MPE A;  1P0R A;  1F0Z A;  2N9X A;  2AL3 A;  1FXT B;  4DK5 A;  5G2N A;  1UNS A;  4ZOH C;  2JYE A;  1T0Q C;  2M17 A;  5H8Y E;  1ESF A;  1MHX A;  1PGA A;  4YXD B;  5AEK B;  1MI0 A;  4GXB A;  2V3N A;  1LO5 D;  3N20 C;  2G45 B;  2WXG A;  4PS3 A;  4ASW C;  4E3C A;  3T3O A;  2M56 B;  4X57 B;  1OTR B;  2R2O A;  2FID A;  3GS2 A;  3QCA A;  2PKO A;  4OHJ A;  1A70 A;  5IOI A;  1AWD A;  4G11 A;  1F1H A;  4C4V B;  1KFY B;  3ZNZ B;  4ACF A;  3GE8 C;  4YSY B;  1WF9 A;  5BMI A;  1CJE A;  2GBR A;  4I6L B;  5C23 A;  1T0Y A;  2NMQ A;  4EE2 A;  1KTK A;  2ON8 A;  4IWQ A;  1WM2 A;  3Q8A A;  3AN1 A;  4REZ A;  1DOY A;  3HIZ A;  1UBQ A;  4M0W A;  3A33 B;  3RT3 B;  3TIX A;  2MBB B;  4ZRJ A;  5D3D A;  2N9E B;  3L4P A;  4N59 A;  4BKS A;  1FMA D;  1I4G A;  1UD7 A;  2YEP F;  4KSL C;  1SE2 A;  3AEF B;  3O13 A;  3AE4 B;  2KDE B;  4MAC A;  3WA0 A;  5TSS A;  5J18 A;  1V49 A;  3HVZ A;  1P98 A;  2PJH A;  4K81 A;  4EZL A;  1GB1 A;  1WR6 E;  2RPQ A;  4II3 B;  4JQW C;  4JL9 A;  2KX3 A;  3QQ8 B;  1KM7 A;  2BS3 B;  3VTV A;  1HEZ E;  3M63 B;  3B9J A;  4UDU C;  1SE3 A;  4DXG A;  3MFG A;  2FCM A;  3ETR A;  1TT5 B;  2BWF A;  2GBM A;  3SEB A;  2V0G A;  4LNN A;  1H8C A;  4GN1 A;  3OLM D;  4OVZ A;  1XQQ A;  5BYS A;  4ZRP A;  5BYR A;  2W3R A;  2GB1 A;  2FAZ A;  2PE9 A;  3AE9 B;  3LXF A;  3ML9 A;  4HCN B;  3HVD A;  3ZRC A;  4A20 A;  2BF8 B;  3ZNH B;  4BOS C;  2LJI A;  2M1M A;  3NRZ A;  4US9 A;  2QEJ C;  3DBR I;  3PS6 A;  4B6W A;  1V80 A;  2LHD A;  3BII D;  2HE7 A;  1L5P A;  1JRP A;  5DCN A;  4GIV A;  1VRA B;  2Q5W D;  4OZB A;  4EZK A;  1QQR A;  4M01 A;  4K3C A;  4DDG D;  4P1C C;  1BUI C;  3ZXV A;  1OFF A;  2BPS A;  1GNU A;  3RI7 C;  1PQS A;  1WGY A;  4YL8 A;  1WGG A;  1IUE A;  4GMV A;  2Z8L A;  2V4I B;  1SJH D;  3DBL B;  2IJ0 A;  3JSV B;  3DVG Y;  3IAS 1;  5E6N A;  1V1P A;  3Q3N C;  3ZUN A;  3UQB A;  3DBS A;  3UIN B;  4C7Y A;  3I3T B;  3Q8E A;  2CJN A;  5IA7 A;  5DPW A;  1GC7 A;  3TSS A;  3DHG C;  3WAN A;  1WXV A;  4RMA A;  1VLB A;  4P1B C;  1E8Y A;  4MSQ B;  1FXI A;  3ZIM A;  2LVO A;  3R2T A;  2BS4 B;  4KX6 B;  1YOV B;  2MBH A;  3VXW A;  1V8C A;  3P4S B;  2LUE A;  2WX0 A;  2WQY B;  4ZYS A;  2I1J A;  1RFA A;  3AE1 B;  2AQ2 B;  4B0M A;  1WR1 A;  3APF A;  2DZI A;  3HM3 A;  1BML C;  4KSK C;  3AE6 B;  2LRU A;  1ET6 A;  3LDZ E;  2YEP B;  4OW0 A;  1SE4 A;  1SE9 A;  3SDL C;  1FM0 D;  2KX0 A;  2ZW0 A;  2BVC A;  2KQS A;  5H92 C;  3C19 A;  2DEN B;  2WX1 A;  1TKE A;  2JZZ A;  1P7E A;  2V9H A;  3NHE B;  4K7U A;  2DZM A;  1TBE A;  3QWZ B;  1TIF A;  2D3G A;  2R2Q A;  2PEA A;  3SHQ A;  2V1Y A;  4KZ0 A;  1NI2 A;  2LXC A;  1FFU A;  2N9L A;  4K7W A;  1V97 A;  4A3P A;  4KGR A;  3V60 A;  3W5V B;  1KOT A;  2BGF A;  5CHF A;  2L52 A;  2D10 A;  3I57 A;  4HPP A;  3VR9 B;  1QLB B;  1L4Z B;  4WWN A;  4IM2 A;  4KIK B;  4L1B A;  3KWL A;  1KJT A;  3PVL A;  3AED B;  3Q3M C;  1WX7 A;  3N1X C;  4J6I A;  2L8J A;  3CMM B;  2V3P A;  4RNA A;  2UU7 A;  2WXH A;  1WFY A;  3AMZ A;  3APD A;  4W9E A;  1XO3 A;  4MM3 B;  3M3J A;  1TY0 A;  1D5X C;  4HDQ A;  2OED A;  4PYZ A;  1WWT A;  1JWM D;  1D5Z C;  2M4N A;  4TUU A;  4GSW A;  4YTM B;  2KVZ A;  3V61 A;  1ROE A;  1NEK B;  2KTR A;  2PW9 A;  3SD5 A;  4OVV A;  2CS4 A;  2IY1 B;  2XK5 A;  3SU8 X;  1YJJ A;  4NAW A;  1JRO A;  1C4A A;  3VUW A;  1EU3 A;  3P1M A;  3L16 A;  2J0K A;  2JWZ A;  3TL5 A;  1HE8 A;  3X23 A;  1B9R A;  2QMT A;  3H9D A;  4Q2J A;  1GB4 A;  4LTU A;  3M62 B;  4HLE A;  2WXP A;  1WI0 A;  2BYE A;  1OEY J;  1NYQ A;  1WXA A;  4HRO A;  2L3Z A;  1F2R I;  1DOI A;  3DBR B;  3EFU A;  2WXQ A;  2WXI A;  3AEC B;  4G0N B;  3L13 A;  4ANX A;  2MBE A;  3VH4 B;  2IO1 B;  1OEY A;  4XDC A;  2MRP A;  2VH1 A;  3ZDT A;  4DHJ D;  5C1Z A;  2AL6 A;  3NOB A;  5E6O A;  2BWE S;  1GUA B;  2KDI A;  1RYJ A;  2FUH B;  3RNF C;  1YQ4 B;  2D3C A;  4W9L A;  4BOZ B;  2BQQ A;  1E7V A;  2AEH A;  1RM6 C;  2K25 A;  1EU4 A;  2MLB A;  1WY8 A;  1NYR A;  4C56 C;  2O2V B;  1RLF A;  3LJ3 A;  2L76 A;  3PRE A;  4DBG A;  2KN4 A;  3I9V 1;  4FXC A;  4MH8 A;  2K1F A;  3L0W B;  3PSE B;  4RFB A;  3MC0 B;  2ZVO A;  3A4R A;  4LDT D;  2L83 A;  4GLS C;  3RUL A;  1TTN A;  4OVU A;  4N58 A;  3B0A A;  2HJ8 A;  2WU5 B;  5AZF A;  3W1S C;  5C3J B;  2DLB A;  3V6E B;  1E8X A;  2PPH A;  1WMH A;  2FE8 A;  3N1Y C;  1CQV A;  1KLG D;  3KQ4 A;  2QCZ A;  1GPX A;  3GB1 A;  1E8Z A;  4MJS B;  1FIQ A;  4AJW A;  3AE8 B;  5L83 A;  2DHZ A;  3RMK C;  1KRH A;  1B1Z A;  3DPD A;  2WDV B;  1RWS A;  2GBJ A;  3X0W A;  2KK8 A;  3L08 A;  3Q14 C;  2BTE A;  2BBC A;  2WDQ B;  4F1S A;  3VUX A;  1JRU A;  1YN3 A;  1UUP A;  4YWG G;  4B9K A;  4XDD A;  4ZRI A;  3V62 A;  2NBV B;  2KFJ A;  3RNG C;  4A6Q A;  4NZL B;  5IAA C;  2L0F A;  5D3I B;  1L7Y A;  3NS1 A;  2WNM A;  2TSS A;  3OG5 A;  1VJK A;  4A55 A;  2IGG A;  2KFK A;  1EWC A;  4HPM B;  4JWS C;  1V6E A;  3VUY A;  2ZVN A;  1LFD A;  2LUM A;  5AZG A;  2RPV A;  1I4X A;  4YSX B;  2NBW B;  3PTF C;  4A9A A;  2W54 A;  3NZS A;  3ECI A;  1Q0W B;  2MP2 A;  4KKJ A;  2WU2 B;  1K53 A;  3SR6 A;  1I4Q A;  4GDL B;  2D5G A;  3GZN I;  4H2A A;  3RZW C;  3FKY A;  4NJC A;  4BBN C;  2IPK D;  2N9K A;  2K39 A;  4CQN A;  2JX5 A;  2KJR A;  4LCD E;  3S2A A;  2JRI B;  4NQK E;  1OQR A;  2DYB A;  4HKQ A;  2KNB A;  4KDL B;  4IUM B;  2A5U A;  3R8B A;  1TKG A;  4B0E A;  2MEK A;  1P3Q U;  1SIJ A;  2GI9 A;  3ZXR A;  4TV3 A;  1U4A A;  3DQV A;  4WH4 A;  4MGK E;  2DX5 B;  4ZYN A; 
#chains in the Genus database with same CATH homology
 3L17 A;  4WWP A;  3VTV A;  1TGZ B;  3M63 B;  4MSM B;  2ZCC A;  4TKN A;  2JRH A;  4KIK A;  2FCM A;  2BWF A;  2GBM A;  4WJN A;  2BYV E;  1VCB A;  2LWP A;  2KD0 A;  3A1Q B;  1H8C A;  3KH0 A;  2HD5 B;  3QJZ A;  2K6D B;  4GN1 A;  3OLM D;  2GBK A;  1XQQ A;  4K7S A;  2C5L C;  2JPH A;  1VD2 A;  2KJH B;  5BO4 B;  4MGY E;  4N9F 4;  3W1Y A;  2FAZ A;  2PE9 A;  2I1K A;  4XZ4 A;  1CMX B;  2JY6 A;  2DYO A;  3ML9 A;  4HCN B;  4HVB A;  3TMP B;  1IP9 A;  3UIP B;  3ZRC A;  3H6N A;  3UGB B;  5HKH A;  3K9O B;  4A20 A;  2ZEQ A;  1R4M I;  4WAA A;  2BF8 B;  4IG7 B;  4MM3 A;  3ZNH B;  4DHZ E;  4W9K A;  4BOS C;  1V5O A;  3PPA A;  1E5W A;  2M1M A;  3A9K A;  3H7P B;  4I6N B;  2UYZ B;  4LDT B;  3BIN A;  3IBE A;  4HXD A;  5LLI A;  1LQB A;  2MA9 B;  4WQO B;  1TZ1 A;  3WAL A;  4EFO A;  3DBR I;  2QHO A;  3PS6 A;  2NPT B;  1V80 A;  4B6W A;  5JHB A;  2MQJ A;  2HE7 A;  2IYD B;  3A9J A;  2G4S A;  3RD2 A;  3W1S A;  4NQL B;  2JXX A;  5DCN A;  4GIV A;  2KWV B;  4EZK A;  4KVG B;  2KOX A;  4WJO A;  2ZZP B;  4DDG D;  2M0X A;  2BPS A;  3DOW A;  1GNU A;  1EUV B;  1PQS A;  1WGY A;  2W9N A;  4YL8 A;  1I35 A;  4E74 A;  1WGG A;  1SGH A;  4GMV A;  2DAJ A;  2UWQ A;  4W9I A;  1YIW A;  1LM8 B;  3WAO A;  1WXM A;  1NDD A;  3NZU A;  2LGY A;  4KDI C;  1ISN A;  1WXS A;  3JSV B;  1UBI A;  3CSF A;  3DVG Y;  3KUZ A;  5E6N A;  3IG3 A;  1AAR A;  4GGQ A;  1J8C A;  3ZUN A;  1WMH B;  3UQB A;  1V86 A;  3DBS A;  3JVZ X;  3UIN B;  2KKC A;  3KW5 B;  3KYD D;  3PRP B;  4AJY B;  1G6J A;  4NJ7 A;  2C7H A;  2KJ6 A;  3KUC B;  3O65 B;  2O6V B;  4ICV A;  4IWP A;  3I3T B;  5IA7 A;  1UEL A;  5DPW A;  4EOY A;  2G4D B;  1GC7 A;  4DDI D;  2V4L A;  1ZGU B;  4XC2 A;  5CX3 A;  2RGF A;  1WXV A;  3WAN A;  4BVU C;  2RSU A;  3KUD B;  4RMA A;  2RR9 A;  1E8Y A;  5AZH A;  5L95 C;  2C7M B;  2J0M A;  4MSQ B;  4FJZ A;  4FLH A;  3ZIM A;  2EMS A;  2LVO A;  1Q5W B;  2NCN A;  3JW0 X;  2A4Z A;  2ZPN A;  3ML8 A;  3QAR A;  4M8N A;  4TQ0 A;  3M95 A;  4PS8 A;  4JGH B;  3VXW A;  2MBH A;  1BT0 A;  2LUE A;  4MGZ E;  2WX0 A;  2I1J A;  4ANV A;  1MG8 A;  2ZJD A;  1RFA A;  3ONS A;  2GOW A;  4NAW B;  2CR5 A;  3TJP A;  3L10 B;  4HCP B;  1WR1 A;  1WGH A;  2KFK B;  3APF A;  2DZI A;  3PHW B;  2JVC A;  3EEC A;  3HM3 A;  3D32 A;  4JIO U;  2L05 A;  4KSK C;  2CHZ A;  3GOE A;  3U8Z A;  2LRU A;  2MCN B;  3LDZ E;  1Z5S B;  2KXJ A;  2AYO B;  2Y5B B;  3B08 A;  4HWI B;  3VHT C;  1RRB A;  1SE9 A;  3SDL C;  3H1U A;  3RCZ A;  2O2V A;  2KX0 A;  1S3S G;  4IM3 A;  2KQS A;  1M94 A;  2AWT A;  2DEN B;  4DHZ B;  1EF5 A;  1YX6 B;  3A4S C;  2WX1 A;  2KWC A;  3MTN B;  1WJN A;  2JZZ A;  3A1Q A;  3ZW3 A;  2KQ7 A;  3DCG A;  5KHO A;  2M8S A;  5LXI B;  3NHE B;  1S1Q B;  1Q1O A;  2CU1 A;  4FHK A;  2OOB B;  4K7U A;  2DZM A;  1TBE A;  2EMT A;  3EHV A;  3QWZ B;  4FHJ A;  3U7D A;  4ZDV A;  3T8M A;  2D3G A;  2L00 B;  2R2Q A;  3DBH I;  2PEA A;  2BKR B;  2N4F A;  4GDK A;  3SHQ A;  2V1Y A;  5KHQ A;  1GJZ A;  4KZ0 A;  1NI2 A;  2L0T A;  3CST A;  2DZJ A;  2LXC A;  3HK0 A;  3DBL I;  3ZNG C;  4K7W A;  5J17 A;  3WIM A;  4A3P A;  3ZTC A;  1E8W A;  2IO2 B;  4URK A;  4EKU A;  4DXA B;  3V60 A;  2VRR B;  3R66 C;  3H7P A;  5D94 A;  1GG3 A;  1KOT A;  2EKE C;  2BGF A;  5CHF A;  4IWO A;  4P7I A;  2KZR A;  3AXC A;  5CTR C;  2D10 A;  3L54 A;  4MJS A;  4IM0 A;  2KC2 A;  2IO3 B;  1YQB A;  4MH0 E;  4F7Z A;  1UH6 A;  4HDO A;  3KVF B;  4FUL A;  3OJ3 A;  3VTW A;  4HK2 A;  3MHS D;  4PS7 A;  2ASQ A;  1OQY A;  4FA6 A;  1WX8 A;  2KHW B;  3PZD A;  4PYU A;  3VDZ A;  2FCQ A;  2MWS B;  4IM2 A;  4KIK B;  3Q3F A;  4WWN A;  5E6P A;  3ZVV A;  1KJT A;  3IVF A;  3PVL A;  2C9W B;  3UQA A;  5G55 A;  3ZNI D;  4WJQ A;  2ZPY A;  1WX7 A;  3DVN V;  4W9G A;  2CHW A;  5LXH A;  4J6I A;  2L8J A;  3N30 A;  4ANU A;  4NJ6 A;  1A5R A;  1ZW7 A;  3CMM B;  3MJW A;  4W9H A;  2RD0 A;  4KZC A;  2IZV B;  2KDF B;  1V81 A;  4M8M A;  2DZK A;  3BY4 B;  4IW0 A;  1WZ0 A;  3DVG X;  3QC8 B;  1D3Z A;  2LJ5 A;  1WGD A;  2LD9 A;  1WFY A;  1WE6 A;  3APD A;  4W9E A;  5JHA A;  5JZE B;  4TQ1 A;  4GOC A;  3M3J A;  4A3O A;  1WRD B;  4NNJ B;  4HDQ A;  3A9K B;  2LXA A;  4PYZ A;  2GMI C;  3QHT A;  1QZE A;  4CHK A;  3WAM A;  5GMV A;  2KWU B;  3CF6 E;  2N1W A;  2BYF A;  2M4N A;  4TUU A;  4GSW A;  1GC6 A;  4B95 A;  3PLV A;  3DVN U;  4KV2 A;  3V61 A;  4AP4 C;  2WYQ A;  4AWJ A;  4E71 A;  2ZNV C;  2FIF A;  4HPL B;  5EDS A;  2Z0E B;  2KTR A;  3A9J B;  1YX5 B;  1XD3 B;  1J0G A;  5FR6 A;  4OVV A;  3SD5 A;  2CS4 A;  2IY1 B;  4GDL A;  2XK5 A;  4MGI E;  3SU8 X;  4RM8 A;  3QX1 A;  1P1A A;  2LVQ A;  3DDC B;  3VQI A;  1OGW A;  4NAW A;  5D6J B;  2G3Q B;  2N7E A;  1E90 A;  3VUW A;  3L16 A;  2HTH A;  2J0K A;  2JWZ A;  3TL5 A;  1HE8 A;  3HM6 X;  1WZ3 A;  3X23 A;  2WDT B;  1J19 A;  2MSE D;  3H9D A;  4LJO B;  2YLM A;  4NY0 A;  1LXD A;  3PT2 B;  3M62 B;  3HHM A;  3UIO B;  1NBF C;  3R3M A;  4HLE A;  1RAX A;  1WI0 A;  2BYE A;  3ZKJ C;  1OEY J;  4F8C B;  2IO0 B;  2MBQ A;  4K1R B;  2J7Q B;  3VTU A;  1WXA A;  2KMC A;  2L3Z A;  2ZNV B;  3EFU A;  4BFR A;  4XX5 A;  1WIA A;  2PE6 B;  4G0N B;  4JLC A;  3L13 A;  3N3K B;  4LJP B;  4ANX A;  2XEW A;  2MBE A;  2D11 A;  3VH4 B;  3ZTD A;  3IFW B;  2IO1 B;  3QK0 A;  4FAD A;  2NS5 A;  1OEY A;  2MRP A;  3ZDT A;  4BKT A;  4DHJ D;  1UGM A;  2KTF A;  5C1Z A;  4AOF A;  2AL6 A;  1K8R B;  3VVW B;  3IHP C;  2MP2 B;  2JZ3 B;  3ZDM C;  2D07 B;  4EEW A;  2LI5 A;  3NOB A;  4M0W B;  5E6O A;  3RZF A;  2BWE S;  2CKH B;  2LVP A;  1GUA B;  2FCN A;  2KDI A;  2XBB C;  5J2R A;  3PLU A;  2FUH B;  2K8H A;  4FBJ B;  2MX2 A;  5TR5 A;  1WYW B;  1EF1 A;  4W9L A;  4WJP A;  2KAN A;  5DPT A;  4BKS D;  3NY5 A;  1WX9 A;  2L7R A;  2MBO A;  3AU5 A;  3PHX B;  4II2 B;  4BOZ B;  1E7V A;  2AEH A;  1WJU A;  1SIF A;  5DPS A;  2KLC A;  1UZX B;  3WAP A;  2MW5 A;  3P2B A;  2K25 A;  3TBL D;  2N7D A;  2KC1 A;  2WWZ A;  2ZCB A;  3R7Q A;  4BBN F;  2MLB A;  1WY8 A;  1WE7 A;  2JF5 A;  2O2V B;  3PV1 A;  3AI5 A;  1RLF A;  3LJ3 A;  2L76 A;  2NPT A;  4RM9 A;  1YD8 U;  3PRE A;  4DBG A;  4IC7 B;  4CO7 A;  4HJK A;  2K1F A;  3L0W B;  3QIJ A;  1H4R A;  3PSE B;  3ALB A;  1WM3 A;  3JYU A;  4I6P A;  2K8B A;  2Z0D B;  4MEL A;  3ZLZ A;  4EZJ A;  2ZVO A;  2NR2 A;  3A4R A;  2DAF A;  1C1Y B;  1Y8R C;  3EC8 A;  4LDT D;  4GU2 A;  1TTN A;  3RUL A;  2IBI B;  4DWF A;  2GBN A;  2DYM A;  4OVU A;  3B0A A;  3K9P B;  2HJ8 A;  3Q3J A;  2REX A;  4GDK B;  3VH3 B;  5CHW A;  5AZF A;  3W1S C;  4ANW A;  2JUO A;  3UF8 A;  2C7N B;  3OAW A;  2LRW A;  3R7R A;  4G50 A;  2KO3 A;  3V6E B;  3JSV A;  1E8X A;  2PPH A;  4MDK E;  4BKG A;  4MEM A;  1XT9 B;  1P0R A;  1WMH A;  4CYE A;  2N9X A;  3VAW A;  3ZRF A;  3QA8 A;  4W9F A;  2AL3 A;  1FXT B;  4AUQ C;  1E8Z A;  2O6V A;  4DK5 A;  2BKF A;  4EUT A;  4MJS B;  5G2N A;  4AJW A;  4FN2 A;  5L83 A;  2M17 A;  2DHZ A;  2NBU A;  4W9C A;  3TCA A;  1Z2M A;  3N32 A;  3AU4 A;  3ZO5 B;  1E7U A;  5AEK B;  1V9J A;  3DPD A;  4GXB A;  2GBJ A;  3X0W A;  3RYT A;  1I42 A;  2KK8 A;  3L08 A;  2LGX A;  3PRZ A;  2G45 B;  2IY0 B;  4PS3 A;  4ASW C;  3U30 A;  4E3C A;  4F1S A;  2Z59 B;  2B3A A;  1C3T A;  3VUX A;  1JRU A;  2JT4 B;  4B9K A;  2LGD A;  2O6V D;  4X57 B;  4ZRI A;  1OTR B;  4ZRK A;  2R2O A;  2CHX A;  3V62 A;  2NBV B;  2KFJ A;  2FID A;  3QCA A;  4FJY A;  3VFK A;  5DPR A;  3T9L A;  3V6C B;  5IAA C;  1V2Y A;  2L0F A;  1L7Y A;  1IPG A;  1L2N A;  1R4N I;  4G11 A;  1EO6 A;  3PRM B;  2KFK A;  4ZYN A;  3ZNZ B;  1YJ1 A;  4HPM B;  5D7G A;  4NPN A;  3VUY A;  1V6E A;  2ZVN A;  1WF9 A;  2KMA A;  2FCS A;  1KLV A;  5JH5 C;  3H7S A;  1LFD A;  5AZG A;  2D2Q A;  1P9D U;  2GBR A;  4I6L B;  5C23 A;  1T0Y A;  2NBW B;  3PTF C;  4ICU A;  3RUI B;  1WGR A;  4IWQ A;  2KN5 A;  3NZS A;  1WM2 A;  3ECI A;  1Q0W B;  3B1L X;  2KTR B;  2MP2 A;  3APC A;  2N9P C;  4FJV B;  3HIZ A;  1UBQ A;  5D2M B;  2LZ6 A;  1IYF A;  3A33 B;  3KYC D;  3PGE A;  1WH3 A;  3RT3 B;  3TIX A;  4GDL B;  2MBB B;  2XK5 B;  2K8C A;  4WWO A;  3GZN I;  4ZRJ A;  2N9E B;  2KLG A;  1F9J A;  3RZW C;  4BBN C;  4BKS A;  1X1M A;  2V3S A;  1UD7 A;  4KSL C;  2K39 A;  1V5T A;  2KJR A;  2KVR A;  2LAS A;  4LCD E;  3AUL A;  4W9D A;  3S2A A;  2JRI B;  4NQK E;  2K6Q A;  2DYB A;  3OJ4 B;  5CHV C;  3QAQ A;  2KDE B;  2OJR A;  4W9J A;  3WA0 A;  2KNB A;  4KDL B;  4IUM B;  4G3X B;  5J18 A;  2A5U A;  3C0R B;  1V49 A;  1WJ6 A;  2NVU I;  1WJ4 A;  1P98 A;  2YVC A;  1P3Q U;  2PJH A;  4TV3 A;  4K81 A;  1U4A A;  1ZKH A;  2FNJ B;  3DQV A;  1WR6 E;  2J0J A;  4DHJ B;  4EZL A;  2RPQ A;  4MGK E;  4GB9 A;  2C60 A;  4II3 B;  3NS8 A;  4JQW C;  2DX5 B;  2KX3 A;  3ENE A;  4JL9 A;  3QQ8 B;  1KM7 A;  2N1V A;  2KDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...