2RSUA

Alternative structure of ubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQNRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Q41N Variant of Ubiquitin as a Model for the Alternatively Folded N2 State of Ubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2rsuA00
2DYBA 4GN1A 3TCAA 2ZCBA 1I42A 2IYDB 4GB9A 3VTWA 4DK5A 3HHMA 3B08A 2K8HA 3QK0A 4TQ0A 1LQBA 4HPMB 2MA9B 2KDBA 2KMAA 3TJPA 2BYFA 1RFAA 2LD9A 2LGDA 2W9NA 4W9HA 2N4FA 1WI0A 1WX9A 2KLCA 2GBNA 3EECA 1F9JA 3W1SC 3PZDA 2CS4A 3LDZE 1TBEA 2YLMA 2LGYA 3DBHI 2BKRB 2RSUA 4P7IA 4HXDA 1XT9B 3H7SA 1WYWB 3B0AA 2L0FA 2HJ8A 1YD8U 2O2VA 2FAZA 3QA8A 2MCNB 4IC7B 3WIMA 4WWNA 3AXCA 1Z5SB 1KOTA 5HKHA 4HCPB 3UIOB 1EF5A 2PJHA 1WM2A 2C60A 2NVUI 4JQWC 2AL3A 4KDIC 5BO4B 4G11A 4GOCA 4JL9A 4WJQA 3WA0A 2L7RA 4M0WB 3IG3A 4WWPA 1UH6A 1D3ZA 3WALA 4NQLB 4RM8A 3MJWA 2Z0EB 2Z0DB 3OAWA 4BBNC 2N9PC 2J0JA 3ZTDA 2HTHA 1WM3A 4BKSA 4OVVA 3VUWA 1WX8A 2K6DB 3M62B 2K39A 1U4AA 2LGXA 2L76A 2FCNA 2K8CA 3ECIA 2CKHB 2ZCCA 4M8MA 4MJSA 3QQ8B 2D11A 1WXMA 4TKNA 1TTNA 3VQIA 1NDDA 1P0RA 5C23A 4MGYE 2LZ6A 3DVGY 2KTRA 2JVCA 1V2YA 4PYUA 3VTVA 1WE7A 3ZRFA 3GZNI 2JRHA 4DHZB 4W9CA 1Q0WB 2KTRB 4OVUA 2KHWB 2LJ5A 4HJKA 3R7QA 3VHTC 3NY5A 4MELA 4BKGA 1YQBA 3JVZX 3TIXA 2M8SA 3HK0A 1E8ZA 2IO2B 4IUMB 4PS8A 4PS7A 2N7DA 2MP2B 1MG8A 3ZNID 1J0GA 2ZNVC 1WX7A 4II3B 4NY0A 3VDZA 4KV2A 3UF8A 2RGFA 2C7NB 4I6NB 3MTNB 3APCA 4K7WA 3DCGA 3PGEA 2M17A 3NHEB 4K7UA 1J8CA 2AL6A 2M0XA 4I6PA 5AEKB 2WWZA 4XC2A 2KJRA 2JUOA 3L13A 4MSQB 4ANWA 1GC7A 4URKA 1ZGUB 2IY1B 5J18A 2J7QB 4HVBA 4W9IA 3H6NA 3H7PA 4II2B 4DHZE 3PPAA 4XX5A 4DWFA 1Q1OA 1Z2MA 3OJ4B 3PS6A 1IYFA 3NS8A 1WGRA 1WMHA 2ZPYA 4AJWA 3LJ3A 2C5LC 4WJNA 3RCZA 4ZRIA 4MDKE 3T9LA 2KDEB 3CSTA 2MQJA 4JGHB 1RRBA 2G4SA 4NAWB 3ZDTA 5JH5C 4W9GA 2NR2A 2BPSA 4BOZB 4FULA 3S2AA 3A9KA 1RLFA 2NS5A 3K9OB 3KVFB 1WXSA 1HE8A 2DYMA 1QZEA 3A9KB 1V49A 4FJYA 1WFYA 2RR9A 4PYZA 2J0MA 2JRIB 4ASWC 1GC6A 2KXJA 4HDQA 3V61A 3ZLZA 3H7PB 3SDLC 4GDKA 4F1SA 2NPTA 4TV3A 2IO0B 3QARA 2K6QA 3CMMB 4KZ0A 3AU4A 4ZRKA 2D2QA 3NZSA 4MSMB 2WX0A 3ML9A 4WQOB 1K8RB 2IO3B 1WF9A 4RM9A 4HPLB 4BOSC 1GJZA 3IBEA 4KIKA 3C0RB 4NNJB 1WGHA 4LJOB 5D7GA 3JYUA 3KUCB 5D2MB 2GBJA 4LDTB 2DZMA 3RUIB 5C1ZA 1E8YA 2FIFA 2ZVOA 2BWES 2DENB 1EF1A 3A9JB 2KDFB 5TR5A 1E7VA 5L83A 2REXA 4JLCA 2ASQA 2MP2A 4EEWA 4DDID 2B3AA 2G45B 3PHXB 2L00B 2UYZB 4CO7A 3R3MA 4PS3A 3TMPB 4FBJB 4DHJB 2JY6A 2C7MB 4IM0A 2LWPA 1C1YB 2LXAA 3VVWB 4BKTA 2MLBA 2LVQA 4LCDE 4GDLA 4MEMA 3WANA 2JF5A 4NJ6A 4E74A 3ZUNA 1WJNA 3OJ3A 3DVNU 2KN5A 2MRPA 2V3SA 4KZCA 4FJZA 2KVRA 1IP9A 3HM6X 5E6OA 2C9WB 2XK5B 4GSWA 2CHXA 4HLEA 5JZEB 3PREA 1UGMA 1SE9A 3H9DA 3EC8A 3ZO5B 3GOEA 1XD3B 1WMHB 4KVGB 4EZLA 3ALBA 1WJ4A 5CHWA 2MBOA 4W9JA 2AWTA 4NJ7A 3WAOA 3TBLD 4EUTA 2DYOA 2KKCA 3ZNZB 4NQKE 1OEYA 4F7ZA 3PVLA 2R2QA 4HK2A 3PLUA 1UBQA 2O6VB 4N9F4 1WH3A 2K25A 2MW5A 3KUDB 2MX2A 2G4DB 2JZ3B 2KFJA 1E7UA 2DAFA 2BYEA 3I3TB 3A9JA 4MGIE 4MGKE 3AI5A 5D6JB 1ISNA 4FHJA 1E8XA 1GUAB 2KLGA 3RULA 3PLVA 1KLVA 1EUVB 2FUHB 2K8BA 4LDTD 5G2NA 4FA6A 4A3OA 2N1WA 2GMIC 3L0WB 1G6JA 2MSED 5CX3A 3HIZA 2LUEA 3RT3B 2N7EA 2NBUA 1CMXB 2D10A 1WE6A 4G3XB 5D94A 4K81A 3V6CB 2J0KA 2KQSA 1UD7A 3N3KB 2K1FA 1LM8B 2GBMA 2JT4B 1R4NI 2MBEA 2MBBB 1NI2A 4TUUA 4E71A 2OOBB 4WJPA 4FLHA 2KTFA 3VH4B 2D07B 2L05A 2M1MA 1UBIA 1TZ1A 1P1AA 2XEWA 1WR1A 2KC2A 3UGBB 1V86A 1YX5B 2MBQA 3KYCD 4GDLB 4NPNA 2JWZA 2R2OA 3DVGX 3APDA 5FR6A 4WWOA 3BY4B 2LRWA 3PTFC 3ZTCA 1JRUA 1WY8A 3WAPA 2V4LA 3V6EB 3ZIMA 2MBHA 4K7SA 1V81A 4HDOA 2N1VA 4FADA 3DBSA 1I35A 2EMSA 3QC8B 4W9KA 2OJRA 1V5OA 3U30A 4HCNB 4A3PA 2KO3A 2KX3A 1SGHA 3KW5B 4W9EA 3IVFA 4NAWA 3VTUA 2GBRA 4W9LA 5E6NA 4A20A 2L0TA 4JIOU 4BKSD 4MJSB 2LASA 5DPTA 2BF8B 2Y5BB 1GNUA 2ZJDA 3VUXA 2WYQA 4KIKB 1WJ6A 2UWQA 2ZZPB 1WZ3A 2LI5A 3B1LX 5G55A 4FJVB 1YX6B 2CHZA 3A1QB 4ANUA 3DPDA 3U8ZA 3PRMB 3SU8X 3IFWB 2FCQA 4J6IA 1FXTB 3BINA 1AARA 1L7YA 5IAAC 3VUYA 4DDGD 3R7RA 2N9EB 3AU5A 1XQQA 5CHVC 3KYDD 2RPQA 4WJOA 4AOFA 4EZKA 5KHQA 5DPRA 4I6LB 3QX1A 3DVNV 4ZDVA 4AP4C 5L95C 4EZJA 3P2BA 1EO6A 5DCNA 4BFRA 1E8WA 2O2VB 3Q3FA 3UQAA 4TQ1A 4DXAB 1WGYA 3KH0A 4G0NB 3VH3B 3N32A 1R4MI 3DBRI 1GG3A 3JSVA 1BT0A 1ZKHA 3ONSA 3W1YA 3H1UA 1WRDB 2JXXA 1E5WA 4FHKA 1PQSA 2KJ6A 4M8NA 4CYEA 2A4ZA 3ZVVA 4MGZE 3SD5A 1WZ0A 2XBBC 2CU1A 3PRPB 2AEHA 1OQYA 2ZNVB 4WAAA 1V6EA 3TL5A 2KX0A 4BVUC 2JPHA 1S1QB 3ZKJC 3EFUA 2IY0B 5LXHA 3VFKA 2KD0A 2WX1A 3DDCB 2EKEC 1TGZB 2KQ7A 2PE9A 2KK8A 3N30A 4IG7B 3X23A 2KWUB 2ZPNA 1OTRB 2D3GA 2DZJA 2DZKA 5GMVA 2DX5B 2DZIA 1WGGA 1KM7A 1VD2A 5AZHA 2FCSA 3UQBA 3UINB 2GBKA 5JHAA 3A33B 1S3SG 2HD5B 3JSVB 3K9PB 4K1RB 4KSLC 5AZGA 2FNJB 3ZNGC 4GDKB 1NBFC 2KWCA 3DQVA 2NBWB 2VRRB 1P9DU 1OGWA 3W1SA 4W9DA 3O65B 3V62A 1Q5WB 4G50A 5LXIB 1RAXA 4EOYA 2M4NA 5AZFA 1WGDA 3VAWA 4F8CB 1ZW7A 2IZVB 1WXAA 3PHWB 4AWJA 5DPSA 2KWVB 2O6VD 1WXVA 3A4RA 3Q3JA 3MHSD 5CTRC 2FCMA 2KC1A 1H4RA 2V1YA 4B9KA 1SIFA 4MH0E 2CR5A 2I1JA 3PV1A 3QHTA 4KDLB 3AULA 4W9FA 2QHOA 3JW0X 3M95A 3RZWC 3QJZA 3WAMA 3CSFA 2PE6B 4BBNF 5IA7A 2NPTB 3V60A 3RD2A 2HE7A 5JHBA 1YJ1A 1LFDA 1P3QU 5E6PA 1X1MA 2JZZA 2GOWA 2BGFA 2KJHB 2KDIA 3QWZB 3NOBA 2NBVB 4ICUA 2KMCA 4YL8A 4DBGA 1L2NA 3R66C 3M63B 2BKFA 2PPHA 2WDTB 3QAQA 4ZRJA 1H8CA 3T8MA 3L08A 3ENEA 2IBIB 1M94A 3ZNHB 1E90A 4IM2A 2LVOA 4EKUA 2LRUA 1T0YA 2C7HA 4RMAA 1WR6E 4GIVA 3APFA 3L10B 4IW0A 2AYOB 5EDSA 4IWQA 1KJTA 3D32A 3KUZA 4LJPB 2A5UA 4ANVA 3UIPB 4B6WA 3DOWA 3NZUA 5CHFA 1V5TA 3L17A 3RZFA 3RYTA 4AUQC 2KANA 4DHJD 1UZXB 4GU2A 5DPWA 5J2RA 2KOXA 2KFKB 3L16A 5KHOA 5LLIA 1WIAA 4E3CA 2LXCA 4ICVA 5J17A 4HWIB 4FN2A 4IWPA 3OLMD 1A5RA 3X0WA 2ZVNA 2YVCA 3PRZA 4KSKC 4IM3A 3A1QA 3PSEB 4XZ4A 4ZYNA 4AJYB 1J19A 4GXBA 3SHQA 1OEYJ 3QIJA 4GGQA 3ZRCA 4GMVA 2EMTA 4EFOA 1YIWA 2G3QB 1LXDA 3ZDMC 3ZW3A 2KFKA 1P98A 2RD0A 4CHKA 2IO1B 3IHPC 2XK5A 2MWSB 2BWFA 3HM3A 3EHVA 1V9JA 2CHWA 2Z59B 2PEAA 4ANXA 1VCBA 3ML8A 2I1KA 2L3ZA 3VXWA 2ZEQA 2DHZA 2DAJA 1IPGA 4MM3A 1V80A 3L54A 4B95A 4X57B 2N9XA 2BYVE 2LVPA 3CF6E 3U7DA 2L8JA 3M3JA 4IWOA 2O6VA 3A4SC 2NCNA 3QCAA 1C3TA 2FIDA 2KZRA 1UELA 1WJUA 3PT2B 1Y8RC 2KNBA 3DBLI
chains in the Genus database with same CATH superfamily
2W3SA 2DYBA 3AE9B 4YSYB 4GN1A 1I42A 4GB9A 2W3RA 3N1YC 4DK5A 2IGHA 2X8XX 2N4FA 2LGSA 2WXKA 1FPYA 3BK2A 1SF0A 1F9JA 3PZDA 1HXYD 4HXDA 4OZBA 1UF0A 3IXSA 2WP9B 4ZHPA 2EELA 3B2FA 4P1BC 2MCNB 1Z5SB 5HKHA 1JWBD 1TKEA 2NVUI 3AEAB 2AL3A 4G11A 1T0QC 5H92C 2LMCA 2L7RA 4WWPA 3WALA 1VLBA 2R61A 3MJWA 2Z0DB 3KWLA 2SAKA 3ZTDA 1WM3A 4BZAA 3MHZA 2K6DB 3MC9A 3EGRA 2FCNA 2K8CA 1HTOA 2ZCCA 2D11A 2AX5A 1TTNA 3ETRA 2XNAC 3T3NA 3VTVA 3DVGY 1V2YA 3GZNI 1N63A 4W9CA 1Q0WB 4RH6A 3VHTC 4MELA 5C3JB 1HZ6A 3HK0A 2IO2B 4PS8A 1KLUD 4PS7A 2MP2B 1SXTA 1FM0D 3RNBC 3VDZA 3MTNB 5EE0A 3PGEA 2M0XA 4XC2A 1PGBA 3L13A 1B9RA 5HFYA 3RMKC 3NS1A 4OW0A 4DWFA 3FILB 1Z2MA 2INNE 1TY0A 3P4RB 3NS8A 2ZPYA 3LJ3A 3RCZA 3T9LA 4N6EB 3Q8BA 3ZDTA 4IOIE 2NR2A 2BPSA 4FULA 1P7EA 3KVFB 1WXSA 1YJIA 2DYMA 1J7AA 1QZEA 3A9KB 1V49A 4FJYA 1WFYA 4YWGG 4PYZA 4LNFA 2JRIB 5IN7A 4HDQA 3ZLZA 3E9SA 4KZ0A 1ROEA 4ZRKA 4RF0A 3NZSA 1SSNA 3BIID 1WF9A 4RM9A 4HPLB 3SR6A 4BOSC 2KDMA 1DOXA 4NNJB 3NVWA 1P7FA 4LJOB 3KUCB 2GBJA 1TS5A 1XLOA 2FIFA 1WXQA 2BWES 4A6QA 2ONQA 3A9JB 5L83A 2QDFA 5TR5A 4JLCA 3ZQ4A 4EEWA 1QOBA 2UYZB 4PS3A 3TMPB 4FBJB 4IM0A 3Q3NC 3B2GA 3VVWB 2LVQA 4MEMA 3AEDB 3BYTB 1UGJA 1VZ6A 4RNAA 1MJDA 3W5UB 1A70A 1CK1A 2V3SA 4KZCA 4AS1A 1IP9A 5E6OA 4HKZE 3GOEA 1WMHB 3ALBA 1WJ4A 2LEKA 3IT4B 2X38A 3TBLD 2KKCA 3ZNZB 2VH1A 3PVLA 2R2QA 4AQ7A 4N9F4 2G4DB 2KFJA 2QCZA 3I3TB 4MGKE 3N1ZC 1SB3C 2LJIA 1PGAA 2Y5PA 1TJEA 3HUIA 4A3OA 1BUIC 3IAS1 1Q10A 1D6EC 3OWEB 2AQ2B 4G3XB 3P42A 1F52A 3U7ZA 4M0WA 1LM8B 2MBBB 2E6XA 4REZA 1ACCA 1D5XC 4WJPA 1NVID 3VH4B 1P1AA 2XEWA 3UGBB 3KYCD 2KVZA 2JWZA 3ZTCA 1ZXIA 1PFDA 1TKYA 3DBSA 2WXQA 3U30A 3PO0A 2W55A 2KX3A 1SGHA 3H8HA 4W9EA 4ITKA 3IVFA 3VTUA 5E6NA 4A20A 4JIOU 4MJSB 3MJ5A 3VUXA 4OZCA 2WYQA 2UWQA 3A1QB 3DPDA 2WGSA 1NI3A 3PRMB 1NYQA 2K0PA 3BINA 1IGCA 2N9EB 3AU5A 4AOFA 4EZKA 3C8YA 4MT5A 2GI9A 4I6LB 1SJED 3BWUD 4XYCA 4ZDVA 4BFRA 1YN3A 3BK1A 3Q3FA 1LO5D 4TQ1A 1WGYA 3KH0A 5D3DA 2PTLA 3VH3B 3BYYB 1R4MI 3DBRI 1GG3A 1BT0A 3ONSA 3E56A 3SFDB 2KJ6A 2D3AA 4K3BA 3N9YC 1V6EA 3BVMA 4BVUC 2JPHA 1S1QB 2Y3AA 3EFUA 1C77A 3VFKA 2WX1A 3DDCB 2RDBC 2XN9C 4RGNA 1FNUA 3N30A 4UDUC 3TUOA 5HI1A 2W82A 4NJCA 4LK0M 5AZHA 2J53A 2WXMA 3A33B 4OVZA 2FNJB 3ZNGC 4M01A 1YQ4B 1N6ZA 1P9DU 2MJ3A 4W9DA 2WXIA 1Q5WB 4G50A 5MPOA 2QILA 4F8CB 1WXAA 2O6VD 3AE1B 3Q3JA 3MHSD 1QILA 3N20C 4MH0E 1JROA 2CR5A 1N61A 4M02A 4KX6B 4W9FA 3R2IA 3JW0X 4C7ZA 3GE3C 4RGOS 1R4MB 1LFDA 1X1MA 4WH4A 2HDEA 5IOIA 4OZAA 4DBGA 4JPSA 2WDTB 3QAQA 1H8CA 3T8MA 3DWGC 3ENEA 1M94A 3ZNHB 3CWIA 2LVOA 1NENB 4IW0A 2WDRB 3D32A 4B6WA 1V5TA 2KOXA 2I38A 5KHOA 1SEBD 2KT7A 4FN2A 3X0WA 1LGRA 3A1QA 3PSEB 1WYGA 1E6EB 2BS2B 4EFOA 1KF6B 3ZDMC 2RD0A 3NUHB 3IHPC 3LXFA 1AWDA 4ANXA 3NVVA 4WIPA 2GRIA 1QOFA 1R7SA 2LVPA 3J9CA 2L8JA 4IWOA 3UI3A 3A4SC 2NCNA 4M00A 1WJUA 1Y8RC 2KNBA 2NMQA 3DHGC 2ZCBA 2IYDB 5GXGB 3HHMA 2K8HA 4S0RA 2MJEA 3FKYA 1L5PA 2AQ3B 2BYFA 1RFAA 2LD9A 4KKIA 1YN5A 3EECA 2QC8A 3WCQA 1FRDA 1TBEA 5BMIA 1C76A 1C4CA 1XT9B 1C78A 1T0RC 3H7SA 1YQ3B 1C4PA 1FXAA 1HEZE 2O2VA 3I5JC 1KOTA 4IC7B 2WDVB 3AXCA 4WWNA 1GB4A 1FFUA 1WM2A 4JQWC 4JWSC 5BO4B 4KDIC 1MI0A 4JL9A 4HKQA 3WA0A 3O13A 5H8YE 1D3ZA 3V3XA 1E9MA 2Z0EB 4ARIA 1TIFA 1WX8A 3AE3B 3M62B 2CKHB 4M8MA 3QQ8B 2QIEB 1WXMA 1HA5A 2KYWA 4TKNA 4R3DA 1P0RA 5C23A 4PYUA 4N58A 4DHZB 4P1CC 4OVUA 2KHWB 4BKGA 4KGRA 3FC4A 4IUMB 2N7DA 1J0GA 3P1MA 5EE9A 3APCA 3HVZA 1J8CA 1PUTA 4I6PA 1L4ZB 2WWZA 2V3PA 1I4HA 4MSQB 4ANWA 4YTNB 2IY1B 5D3IB 2J7QB 2BS3B 3H6NA 4II2B 4LTUA 1IYFA 1ZPSA 1HQRD 3GB1A 1WGRA 1WMHA 3NG0A 2L1AA 3MP9A 4MDKE 2BVCA 4NAWB 2AQ1B 1SE3A 4LNNA 3S2AA 3A9KA 3IAM1 1L6VA 2RR9A 2J0MA 2KXJA 3SDLC 4GDKA 4F1SA 4TV3A 5HHDG 5I4DA 1D5MC 2YEPB 3KQ4A 2D2QA 4MSMB 2WX0A 4YTMB 1K8RB 2IO3B 2N0SB 4B0EA 3IBEA 1AW7A 3VRAB 1V1PA 1J7CA 4YSZB 1OQQA 1E8YA 2WNMA 2DENB 1RFKA 4S17A 2MP2A 4DXFA 3W9CB 2G45B 3T3OA 1WRIA 2L00B 4JX1C 1STEA 4WURA 2C7MB 4BKTA 3AEGB 4C56C 4E74A 3ZUNA 3OJ3A 2K9XA 2KN5A 3CIRB 3GS2A 1EM7A 4HLEA 4GSWA 2CU3A 2CHXA 1UGMA 1UUPA 3H9DA 3EC8A 2IGDA 1UWMA 1XD3B 4EZLA 1B1ZA 4NJ7A 3WAOA 3Q8EA 2KMMA 1OEYA 3I63C 2DLBA 4HK2A 2VZKD 4XGAB 1EWYC 1KFYB 2WXGA 4ARCA 3Q2AC 2MX2A 2IPKD 2BYEA 1V8CA 2W54A 3AI5A 3HVDA 5D6JB 1ISNA 2NTTA 5BYQA 2KLGA 2FUHB 2WXHA 3AMZA 1G6JA 2FE8A 3HIZA 3AN1A 4US9A 2N7EA 2NBUA 1FIQA 5D94A 4D2KA 1VRAB 3AEEB 2KQSA 2K1FA 2GBMA 1SBBB 4FLHA 1N60A 2L05A 2M1MA 1UBIA 1GB1A 1TS3A 1WR1A 1TYGB 2MBQA 4NPNA 1L0XB 3GP7A 3BY4B 3HRDD 1JRUA 1WY8A 3WAPA 2V4LA 1C79A 2N1VA 2PVGC 2OJRA 1WWTA 3AH7A 2KO3A 2RMMA 4HJGE 1CZPA 4W9LA 3AM9A 4H2AA 2LASA 4MACA 5DPTA 2BF8B 1GNUA 2WLBA 4KIKB 2LI5A 4ANUA 3U8ZA 1VZ8A 3SEBA 3SU8X 4J6IA 2M0AA 3P4QB 1AARA 5IAAC 3AE4B 3IT6B 1XQQA 5CHVC 3KYDD 5FR3A 1HTQA 3P2BA 3NRZA 1EO6A 1E8WA 2O2VB 2BT6A 3UQAA 4G0NB 2M56B 5G5GA 3H1UA 2JZPA 4B0MA 4FHKA 3ZVVA 4MGZE 2CU1A 1ZOYB 3L4PA 2WXOA 1OQYA 3TL5A 4DXGA 2ZW0A 2IY0B 4L23A 1ZE3D 2KD0A 1IBXA 2KK8A 3X23A 2JU6X 2D3BA 2KWUB 1MVKA 1OTRB 2D3GA 2DZJA 2BS4B 2RDHA 1DYQA 1TKGA 2QMTA 1I4RA 3RN9C 1MHHE 1TY2A 3JSVB 3K9PB 1YJJA 2INCC 2KWCA 3DQVA 3OG5A 2NBWB 1OGWA 3NVZA 1SJHD 5BMGA 1KH0A 1IUEA 4ZYSA 5C2TB 1T5XD 3PHWB 1VZ7A 2VZKB 2KC1A 4B9KA 1KRHA 2I1JA 3QHTA 3QJZA 3CSFA 3R8BA 4BBNF 1I4QA 5IA7A 3V60A 3RD2A 1T6BX 1YJ1A 1ZP0B 1P3QU 2WXFA 2KJHB 3QWZB 3NOBA 1JWUD 1XEEA 2GLSA 4RF1A 1FCLA 2PPHA 3L08A 2IBIB 2HTME 2LRUA 2WU2B 2C7HA 4ACFA 3UIPB 2ICIA 3DOWA 3NZUA 3L17A 3RZFA 3P63A 3RYTA 1UZXB 1RYJA 1ET6A 1WIAA 5TSSA 4ICVA 4IWPA 1A5RA 2ZVNA 2YVCA 3PRZA 1OFFA 4KSKC 1J19A 4GXBA 1OEYJ 3QIJA 4GGQA 1YIWA 3ZW3A 4CHKA 2PEAA 1VCBA 2I1KA 1ET9A 2DAJA 1IPGA 3L54A 2BYVE 3CF6E 3M3JA 2O6VA 3QCAA 1C3TA 2HJ1A 2B76B 2KZRA 1UELA 3DBRB 3TSSA 3DBLI 1ZDVA 2WHIA 3TCAA 2NTSA 4ZRQA 2K3UA 3B08A 2Y5CA 1YN4A 2MA9B 2LGDA 4W9HA 1WI0A 2KLCA 1YMHE 2CS4A 2IJ0A 2YLMA 2LFIA 2RSUA 1WYWB 3B0AA 2L0FA 2HJ8A 1YD8U 1NEKB 3QA8A 3WIMA 1XF5L 2KAJA 4HCPB 3UIOB 1EF5A 2PJHA 4GOCA 4WJQA 3AEBB 4M0WB 3IG3A 1UH6A 2PKOA 2Q5WD 5JXVA 4BBNC 2H88B 2J0JA 2N9PC 2HTHA 1JMLA 4OVVA 2LGXA 1U4AA 1IBXB 2L76A 4MJSA 2G1EA 3VQIA 1NDDA 2KTRA 2JVCA 3GZNB 1WE7A 1FRRA 3N1XC 2KTRB 1HZ5A 2RDGA 3R7QA 1YQBA 1ZDXA 3TIXA 2M8SA 1E8ZA 1MG8A 4XWTA 1XXGA 1XLPA 1WX7A 3NZ3A 4NY0A 4PK1A 2RGFA 2WQYB 1VR9A 1WSPA 3DCGA 2M17A 4K7UA 2D5GA 5AEKB 3SFEB 2KJRA 1GC7A 1FO4A 4URKA 1SE4A 1ZGUB 5J18A 4QAYA 4HVBA 4W9IA 3H7PA 3PPAA 4XX5A 1Q1OA 3OJ4B 1QOAA 3U4EG 1FMAD 1EU4A 5IP4D 4WJNA 4ZRIA 2KDEB 4WAFA 2MQJA 1RRBA 2G4SA 1FCCC 4BOZB 2CJNA 2NS5A 3K9OB 1FXIA 4LNIA 4ASWC 1CJEA 2N9LA 2K6QA 3CMMB 3AU4A 2L32A 1F2RC 1XLQA 3C0RB 1WGHA 5D7GA 3JYUA 4LDTB 3RUIB 5C1ZA 1F0ZA 4YSXB 1MG4A 2ZVOA 3Q3MC 3AEFB 1VDVA 2KDFB 2ASQA 3BVZA 4RGTA 1PYWD 2ACZB 2B3AA 4DHJB 2LWPA 4XDDA 1C1YB 2PW9A 2MLBA 4GDLA 2JF5A 1WJNA 2J52A 5EE3A 3DVNU 3W2DA 4FJZA 3HM6X 2C9WB 3PREA 2GB1A 1SE9A 2FBWB 1FNVA 5CHWA 4W9JA 4IDIA 4NQKE 4F7ZA 3W5VB 3PLUA 2O6VB 1GAQB 5EE1A 1WH3A 2K25A 3KUDB 3RNCC 2JZ3B 2K5PA 1R4NB 3LYYA 1L0YB 1GUAB 3RULA 1KLVA 1EUVB 2G9HD 2K8BA 5G2NA 4FA6A 1C9FA 4YXDB 1V1PB 3L0WB 5CX3A 2LUEA 3RT3B 2RPVA 1CMXB 1FFVA 2D10A 4K81A 2J0KA 1UD7A 3FILA 3AE2B 2JT4B 1R4NI 2MBEA 1NI2A 4TUUA 4E71A 2KTFA 4GDLB 3DVGX 1JWMD 3APDA 2J42A 4WWOA 5FR6A 3PTFC 2J4XA 3V6EB 2MBHA 1T0SC 2WS3B 4HDOA 4FADA 2EMSA 3QC8B 1V5OA 4A3PA 3BVGA 1XCQL 1DOIA 4A8XC 4OHJA 1TS2A 3KW5B 4NAWA 4WWMA 4BKSD 3I57A 2ZJDA 1JWAD 2MJDA 4RGMA 3B1LX 5G55A 3DBLB 2ZW1A 1AN8A 4FJVB 1XO3A 3IFWB 1K52A 2FCQA 1FXTB 2V4IB 1JQ4A 1L7YA 3R7RA 2ON8A 2RPQA 4WJOA 4RCOA 2K22A 2BBCA 4JWUC 2BB6A 2BW2A 4XWWA 2V3NA 1N5XA 2CJOA 3JSVA 1ZKHA 1BMLC 2JXXA 1E5WA 1PQSA 2QEJC 3SD5A 3ZJUA 2XBBC 3MFGA 2PVOD 2AEHA 3PRPB 4C4VA 4TMAB 4WAAA 3AE5B 5LXHA 2V9HA 1TGZB 4IG7B 2ZPNA 2DNFA 2DX5B 2DZIA 3RNAC 2FCSA 3UQBA 3UINB 3I9V1 2GBKA 1RWSA 5JHAA 4IKGA 1S3SG 2HD5B 4K1RB 4KSLC 2EKIA 4K3CA 3Q6BA 2KWDA 3Q3OC 2VRRB 3W1SA 5FKAC 1ESFA 1SE2A 5LXIB 4EOYA 5AZFA 3B9JA 3VAWA 3ABVB 2WXRA 2IZVB 4PT5A 4AWJA 5DPSA 2KWVB 1WXVA 3A4RA 2KACA 2QSDA 1H4RA 2V1YA 1SIFA 3PV1A 4KDLB 5LNK1 3M95A 3RZWC 1DOYA 5AUKA 2L83A 4JE3B 2NPTB 2WXJA 3LB8C 3EUB2 4C4VB 5BMHA 5E6PA 2JZZA 2GOWA 3DBHB 3MC8A 2JX5A 1L2NA 3M63B 2BKFA 5BYRA 3C19A 1IGDA 4ZRJA 1QLBB 1GPXA 4IM2A 1YNTE 1T0YA 1DGJA 4RMAA 1WR6E 1TS4A 3APFA 2AYOB 2BQQA 2JXTA 1KJTA 3KUZA 2A5UA 4ANVA 1OQRA 4AUQC 3U52E 2KANA 5DPWA 5J2RA 3L16A 1PGXA 3AB5A 4E3CA 3OLMD 4USAA 1RM6C 4ZYNA 1QQRA 4AJYB 4GMVA 1F2RI 3RFZB 1FNWA 3EA6A 4C7YA 1P98A 2MWSB 4A9AA 3HM3A 3EHVA 2CHWA 2Z59B 2IDYA 3ML8A 2OJWA 2ZEQA 2DHZA 4ZOHC 1XCTL 3Q8AA 3NJTA 1V80A 2N9XA 3U7DA 1FD6A 1UNSA 2PLPA 2FIDA 2JWUA 2D3CA 4A90A 2JQRB 1BXTA 3VTWA 4TQ0A 3QK0A 1EWCA 1M4VA 1LQBA 4HPMB 2KDBA 2KMAA 3TJPA 2W9NA 5BYSA 1WX9A 3ZXRA 2GBNA 1N62A 3W1SC 3LDZE 2LGYA 3DBHI 2BKRB 4P7IA 3AE7B 2MEKA 2FAZA 3Q14C 4A55A 2C60A 2Z8LA 4HROA 1N5WA 4NQLB 4RM8A 1QF6A 3KWVA 3OAWA 3Q69A 4BKSA 3VUWA 2K39A 1JWSD 1JW9D 4EE2A 2IGGA 3ECIA 3V05A 3R2TA 2KN4A 1VJKA 4MGYE 2LZ6A 1I7HA 3ZRFA 2JRHA 4TSSA 2WXPA 4HJKA 2LJ5A 3NY5A 1JRPA 3JVZX 2JYEA 3TEWA 4NZLB 3MC0B 3ZNID 2I2YA 2ZNVC 4II3B 3VR8B 4KV2A 3UF8A 3P4SB 2C7NB 4I6NB 4P16A 4K7WA 2FUG1 3NHEB 2AL6A 1V1OA 2JUOA 2LHDA 1MPEA 1L0VB 1K51A 4US8A 4DHZE 3PS6A 5E6JA 3TEZA 4AJWA 3Q8FA 4ZRPA 2C5LC 4C80A 3CSTA 4JGHB 3VRBB 5JH5C 4W9GA 2N7JA 4MM3B 3RI7C 1RLFA 1HE8A 4J3OD 4RFBA 1GC6A 3V61A 3H7PB 2NPTA 2IO0B 1K53A 3QARA 4XDCA 1D4BA 5AUIA 1J7BA 3ML9A 4WQOB 1GJZA 4KIKA 5D2MB 2DZMA 5IO9A 1YOVB 1CQVA 2BTEA 1EF1A 1E7VA 2REXA 1I4PA 3AE6B 1L6UA 4DDID 3PHXB 4CO7A 3R3MA 3PZ8A 2JY6A 1MHXA 2LXAA 4LCDE 2LGIA 3WANA 4GLSC 4NJ6A 2BYTA 1GOZA 2OHFA 2MRPA 3KLSX 2KVRA 5T8IA 2XK5B 4BAXA 5JZEB 4CQNA 3ZO5B 1QT9A 4KVGB 4YTPB 2MBOA 2AWTA 4ZHOA 4EUTA 2DYOA 1UBQA 4KGSA 5G5HA 2YEPF 2MW5A 1F1HA 1E7UA 2DAFA 2DWQA 4NAMA 3A9JA 4MGIE 3BZDB 4FHJA 1E8XA 4L1BA 2WU5B 1JCKB 3PLVA 4LDTD 3ZJTA 2N1WA 2GMIC 2MSED 4P6VF 2WXNA 3AV8A 1WE6A 3V6CB 3N3KB 2L52A 2VH2A 2WDQB 2OOBB 2D07B 1L4DB 1TZ1A 1SIJA 2JSVX 2KC2A 3RNFC 1V86A 1YX5B 2R2OA 2LRWA 3GE8C 3ZIMA 4K7SA 1V81A 2V0GA 1I35A 4W9KA 4LNKA 2BB5A 4HCNB 4HRSA 3ZYYX 3PZ7A 3TEYA 2GBRA 2L0TA 2Y5BB 4WQMA 1TT5B 3ZJVA 1WJ6A 2ZZPB 1WZ3A 4MH8A 1YX6B 2CHZA 2SEBD 4KGTA 3URYA 1TZOA 2INPE 1PDXA 2INDC 3VUYA 2JYTA 2OEDA 1E10A 4DDGD 5KHQA 5DPRA 2WXLA 3QX1A 1E0ZA 3DVNV 3RPFC 3Q8CA 4AP4C 1F77A 5L95C 4EZJA 5DCNA 2N9KA 2MHJA 1KLGD 4DXAB 4LNOA 1UWXA 4HPPA 3N32A 2TSSA 1K50A 3W1YA 5FK9C 1WRDB 4M8NA 4CYEA 2A4ZA 3P4PB 1WZ0A 4C00A 2QJLA 2ZNVB 2KX0A 3ZKJC 2H89B 1FEHA 2EKEC 2KQ7A 2PE9A 1KTKA 1MFWA 2DZKA 5GMVA 1WGGA 1I4GA 1KM7A 1VD2A 3DWMA 4HEA1 1QOGA 5AZGA 4GDKB 4O1NA 1NBFC 1NYRA 3FAHA 3O65B 4XE0A 2PIAA 3AE8B 4LLGM 3V62A 2MH7A 4FXCA 4Q2JA 1ZUD2 2PMVA 1RAXA 4DQOC 3ZGZA 2M4NA 1WGDA 1ZW7A 3RNGC 3EFCA 1V97A 5CTRC 2FCMA 2M19A 1JALA 3AULA 2QHOA 3WAMA 3TEXA 2PE6B 4L2YA 2HE7A 5JHBA 2DBYA 2BGFA 2KDIA 1T3QA 2NBVB 4ICUA 1ENFA 2KMCA 4YL8A 3R66C 4KKJA 3ZXVA 1E90A 3VR9B 4EKUA 1ZXHA 1AYFA 2E3TA 1Y56A 4GIVA 4YT0B 3L10B 5EDSA 4IWQA 5HG2A 1WGKA 4LJPB 5CHFA 4DHJD 3DHHC 2LUMA 4GU2A 2KFKB 5LLIA 2KQ4X 2LXCA 5J17A 4HWIB 1E7PB 2LHEA 4IM3A 4XZ4A 1QKZA 3SHQA 3ZRCA 1C4AA 2EMTA 2UU7A 3AECB 2G3QB 1LXDA 2KFKA 2IO1B 2XK5A 2BWFA 3RNEC 1V9JA 1D5ZC 3U2SC 2L3ZA 3NVYA 3VXWA 5IKCM 3DHIC 1XLNA 4MM3A 4B95A 4X57B 1EU3A 4N59A 1I4XA 3PT2B
chains in the Genus database with same CATH topology
2DYBA 4GN1A 3TCAA 2ZCBA 1I42A 2IYDB 4GB9A 3VTWA 4DK5A 3HHMA 3B08A 2K8HA 3QK0A 4TQ0A 1LQBA 4HPMB 2MA9B 2KDBA 2KMAA 3TJPA 2BYFA 1RFAA 2LD9A 2LGDA 2W9NA 4W9HA 2N4FA 1WI0A 1WX9A 2KLCA 2GBNA 3EECA 1F9JA 3W1SC 3PZDA 2CS4A 3LDZE 1TBEA 2YLMA 2LGYA 3DBHI 2BKRB 2RSUA 4P7IA 4HXDA 1XT9B 3H7SA 1WYWB 3B0AA 2L0FA 2HJ8A 1YD8U 2O2VA 2FAZA 3QA8A 2MCNB 4IC7B 3WIMA 4WWNA 3AXCA 1Z5SB 1KOTA 5HKHA 4HCPB 3UIOB 1EF5A 2PJHA 1WM2A 2C60A 2NVUI 4JQWC 2AL3A 4KDIC 5BO4B 4G11A 4GOCA 4JL9A 4WJQA 3WA0A 2L7RA 4M0WB 3IG3A 4WWPA 1UH6A 1D3ZA 3WALA 4NQLB 4RM8A 3MJWA 2Z0EB 2Z0DB 3OAWA 4BBNC 2N9PC 2J0JA 3ZTDA 2HTHA 1WM3A 4BKSA 4OVVA 3VUWA 1WX8A 2K6DB 3M62B 2K39A 1U4AA 2LGXA 2L76A 2FCNA 2K8CA 3ECIA 2CKHB 2ZCCA 4M8MA 4MJSA 3QQ8B 2D11A 1WXMA 4TKNA 1TTNA 3VQIA 1NDDA 1P0RA 5C23A 4MGYE 2LZ6A 3DVGY 2KTRA 2JVCA 1V2YA 4PYUA 3VTVA 1WE7A 3ZRFA 3GZNI 2JRHA 4DHZB 4W9CA 1Q0WB 2KTRB 4OVUA 2KHWB 2LJ5A 4HJKA 3R7QA 3VHTC 3NY5A 4MELA 4BKGA 1YQBA 3JVZX 3TIXA 2M8SA 3HK0A 1E8ZA 2IO2B 4IUMB 4PS8A 4PS7A 2N7DA 2MP2B 1MG8A 3ZNID 1J0GA 2ZNVC 1WX7A 4II3B 4NY0A 3VDZA 4KV2A 3UF8A 2RGFA 2C7NB 4I6NB 3MTNB 3APCA 4K7WA 3DCGA 3PGEA 2M17A 3NHEB 4K7UA 1J8CA 2AL6A 2M0XA 4I6PA 5AEKB 2WWZA 4XC2A 2KJRA 2JUOA 3L13A 4MSQB 4ANWA 1GC7A 4URKA 1ZGUB 2IY1B 5J18A 2J7QB 4HVBA 4W9IA 3H6NA 3H7PA 4II2B 4DHZE 3PPAA 4XX5A 4DWFA 1Q1OA 1Z2MA 3OJ4B 3PS6A 1IYFA 3NS8A 1WGRA 1WMHA 2ZPYA 4AJWA 3LJ3A 2C5LC 4WJNA 3RCZA 4ZRIA 4MDKE 3T9LA 2KDEB 3CSTA 2MQJA 4JGHB 1RRBA 2G4SA 4NAWB 3ZDTA 5JH5C 4W9GA 2NR2A 2BPSA 4BOZB 4FULA 3S2AA 3A9KA 1RLFA 2NS5A 3K9OB 3KVFB 1WXSA 1HE8A 2DYMA 1QZEA 3A9KB 1V49A 4FJYA 1WFYA 2RR9A 4PYZA 2J0MA 2JRIB 4ASWC 1GC6A 2KXJA 4HDQA 3V61A 3ZLZA 3H7PB 3SDLC 4GDKA 4F1SA 2NPTA 4TV3A 2IO0B 3QARA 2K6QA 3CMMB 4KZ0A 3AU4A 4ZRKA 2D2QA 3NZSA 4MSMB 2WX0A 3ML9A 4WQOB 1K8RB 2IO3B 1WF9A 4RM9A 4HPLB 4BOSC 1GJZA 3IBEA 4KIKA 3C0RB 4NNJB 1WGHA 4LJOB 5D7GA 3JYUA 3KUCB 5D2MB 2GBJA 4LDTB 2DZMA 3RUIB 5C1ZA 1E8YA 2FIFA 2ZVOA 2BWES 2DENB 1EF1A 3A9JB 2KDFB 5TR5A 1E7VA 5L83A 2REXA 4JLCA 2ASQA 2MP2A 4EEWA 4DDID 2B3AA 2G45B 3PHXB 2L00B 2UYZB 4CO7A 3R3MA 4PS3A 3TMPB 4FBJB 4DHJB 2JY6A 2C7MB 4IM0A 2LWPA 1C1YB 2LXAA 3VVWB 4BKTA 2MLBA 2LVQA 4LCDE 4GDLA 4MEMA 3WANA 2JF5A 4NJ6A 4E74A 3ZUNA 1WJNA 3OJ3A 3DVNU 2KN5A 2MRPA 2V3SA 4KZCA 4FJZA 2KVRA 1IP9A 3HM6X 5E6OA 2C9WB 2XK5B 4GSWA 2CHXA 4HLEA 5JZEB 3PREA 1UGMA 1SE9A 3H9DA 3EC8A 3ZO5B 3GOEA 1XD3B 1WMHB 4KVGB 4EZLA 3ALBA 1WJ4A 5CHWA 2MBOA 4W9JA 2AWTA 4NJ7A 3WAOA 3TBLD 4EUTA 2DYOA 2KKCA 3ZNZB 4NQKE 1OEYA 4F7ZA 3PVLA 2R2QA 4HK2A 3PLUA 1UBQA 2O6VB 4N9F4 1WH3A 2K25A 2MW5A 3KUDB 2MX2A 2G4DB 2JZ3B 2KFJA 1E7UA 2DAFA 2BYEA 3I3TB 3A9JA 4MGIE 4MGKE 3AI5A 5D6JB 1ISNA 4FHJA 1E8XA 1GUAB 2KLGA 3RULA 3PLVA 1KLVA 1EUVB 2FUHB 2K8BA 4LDTD 5G2NA 4FA6A 4A3OA 2N1WA 2GMIC 3L0WB 1G6JA 2MSED 5CX3A 3HIZA 2LUEA 3RT3B 2N7EA 2NBUA 1CMXB 2D10A 1WE6A 4G3XB 5D94A 4K81A 3V6CB 2J0KA 2KQSA 1UD7A 3N3KB 2K1FA 1LM8B 2GBMA 2JT4B 1R4NI 2MBEA 2MBBB 1NI2A 4TUUA 4E71A 2OOBB 4WJPA 4FLHA 2KTFA 3VH4B 2D07B 2L05A 2M1MA 1UBIA 1TZ1A 1P1AA 2XEWA 1WR1A 2KC2A 3UGBB 1V86A 1YX5B 2MBQA 3KYCD 4GDLB 4NPNA 2JWZA 2R2OA 3DVGX 3APDA 5FR6A 4WWOA 3BY4B 2LRWA 3PTFC 3ZTCA 1JRUA 1WY8A 3WAPA 2V4LA 3V6EB 3ZIMA 2MBHA 4K7SA 1V81A 4HDOA 2N1VA 4FADA 3DBSA 1I35A 2EMSA 3QC8B 4W9KA 2OJRA 1V5OA 3U30A 4HCNB 4A3PA 2KO3A 2KX3A 1SGHA 3KW5B 4W9EA 3IVFA 4NAWA 3VTUA 2GBRA 4W9LA 5E6NA 4A20A 2L0TA 4JIOU 4BKSD 4MJSB 2LASA 5DPTA 2BF8B 2Y5BB 1GNUA 2ZJDA 3VUXA 2WYQA 4KIKB 1WJ6A 2UWQA 2ZZPB 1WZ3A 2LI5A 3B1LX 5G55A 4FJVB 1YX6B 2CHZA 3A1QB 4ANUA 3DPDA 3U8ZA 3PRMB 3SU8X 3IFWB 2FCQA 4J6IA 1FXTB 3BINA 1AARA 1L7YA 5IAAC 3VUYA 4DDGD 3R7RA 2N9EB 3AU5A 1XQQA 5CHVC 3KYDD 2RPQA 4WJOA 4AOFA 4EZKA 5KHQA 5DPRA 4I6LB 3QX1A 3DVNV 4ZDVA 4AP4C 5L95C 4EZJA 3P2BA 1EO6A 5DCNA 4BFRA 1E8WA 2O2VB 3Q3FA 3UQAA 4TQ1A 4DXAB 1WGYA 3KH0A 4G0NB 3VH3B 3N32A 1R4MI 3DBRI 1GG3A 3JSVA 1BT0A 1ZKHA 3ONSA 3W1YA 3H1UA 1WRDB 2JXXA 1E5WA 4FHKA 1PQSA 2KJ6A 4M8NA 4CYEA 2A4ZA 3ZVVA 4MGZE 3SD5A 1WZ0A 2XBBC 2CU1A 3PRPB 2AEHA 1OQYA 2ZNVB 4WAAA 1V6EA 3TL5A 2KX0A 4BVUC 2JPHA 1S1QB 3ZKJC 3EFUA 2IY0B 5LXHA 3VFKA 2KD0A 2WX1A 3DDCB 2EKEC 1TGZB 2KQ7A 2PE9A 2KK8A 3N30A 4IG7B 3X23A 2KWUB 2ZPNA 1OTRB 2D3GA 2DZJA 2DZKA 5GMVA 2DX5B 2DZIA 1WGGA 1KM7A 1VD2A 5AZHA 2FCSA 3UQBA 3UINB 2GBKA 5JHAA 3A33B 1S3SG 2HD5B 3JSVB 3K9PB 4K1RB 4KSLC 5AZGA 2FNJB 3ZNGC 4GDKB 1NBFC 2KWCA 3DQVA 2NBWB 2VRRB 1P9DU 1OGWA 3W1SA 4W9DA 3O65B 3V62A 1Q5WB 4G50A 5LXIB 1RAXA 4EOYA 2M4NA 5AZFA 1WGDA 3VAWA 4F8CB 1ZW7A 2IZVB 1WXAA 3PHWB 4AWJA 5DPSA 2KWVB 2O6VD 1WXVA 3A4RA 3Q3JA 3MHSD 5CTRC 2FCMA 2KC1A 1H4RA 2V1YA 4B9KA 1SIFA 4MH0E 2CR5A 2I1JA 3PV1A 3QHTA 4KDLB 3AULA 4W9FA 2QHOA 3JW0X 3M95A 3RZWC 3QJZA 3WAMA 3CSFA 2PE6B 4BBNF 5IA7A 2NPTB 3V60A 3RD2A 2HE7A 5JHBA 1YJ1A 1LFDA 1P3QU 5E6PA 1X1MA 2JZZA 2GOWA 2BGFA 2KJHB 2KDIA 3QWZB 3NOBA 2NBVB 4ICUA 2KMCA 4YL8A 4DBGA 1L2NA 3R66C 3M63B 2BKFA 2PPHA 2WDTB 3QAQA 4ZRJA 1H8CA 3T8MA 3L08A 3ENEA 2IBIB 1M94A 3ZNHB 1E90A 4IM2A 2LVOA 4EKUA 2LRUA 1T0YA 2C7HA 4RMAA 1WR6E 4GIVA 3APFA 3L10B 4IW0A 2AYOB 5EDSA 4IWQA 1KJTA 3D32A 3KUZA 4LJPB 2A5UA 4ANVA 3UIPB 4B6WA 3DOWA 3NZUA 5CHFA 1V5TA 3L17A 3RZFA 3RYTA 4AUQC 2KANA 4DHJD 1UZXB 4GU2A 5DPWA 5J2RA 2KOXA 2KFKB 3L16A 5KHOA 5LLIA 1WIAA 4E3CA 2LXCA 4ICVA 5J17A 4HWIB 4FN2A 4IWPA 3OLMD 1A5RA 3X0WA 2ZVNA 2YVCA 3PRZA 4KSKC 4IM3A 3A1QA 3PSEB 4XZ4A 4ZYNA 4AJYB 1J19A 4GXBA 3SHQA 1OEYJ 3QIJA 4GGQA 3ZRCA 4GMVA 2EMTA 4EFOA 1YIWA 2G3QB 1LXDA 3ZDMC 3ZW3A 2KFKA 1P98A 2RD0A 4CHKA 2IO1B 3IHPC 2XK5A 2MWSB 2BWFA 3HM3A 3EHVA 1V9JA 2CHWA 2Z59B 2PEAA 4ANXA 1VCBA 3ML8A 2I1KA 2L3ZA 3VXWA 2ZEQA 2DHZA 2DAJA 1IPGA 4MM3A 1V80A 3L54A 4B95A 4X57B 2N9XA 2BYVE 2LVPA 3CF6E 3U7DA 2L8JA 3M3JA 4IWOA 2O6VA 3A4SC 2NCNA 3QCAA 1C3TA 2FIDA 2KZRA 1UELA 1WJUA 3PT2B 1Y8RC 2KNBA 3DBLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  4GN1 A;  3TCA A;  2ZCB A;  1I42 A;  2IYD B;  4GB9 A;  3VTW A;  4DK5 A;  3HHM A;  3B08 A;  2K8H A;  3QK0 A;  4TQ0 A;  1LQB A;  4HPM B;  2MA9 B;  2KDB A;  2KMA A;  3TJP A;  2BYF A;  1RFA A;  2LD9 A;  2LGD A;  2W9N A;  4W9H A;  2N4F A;  1WI0 A;  1WX9 A;  2KLC A;  2GBN A;  3EEC A;  1F9J A;  3W1S C;  3PZD A;  2CS4 A;  3LDZ E;  1TBE A;  2YLM A;  2LGY A;  3DBH I;  2BKR B;  2RSU A;  4P7I A;  4HXD A;  1XT9 B;  3H7S A;  1WYW B;  3B0A A;  2L0F A;  2HJ8 A;  1YD8 U;  2O2V A;  2FAZ A;  3QA8 A;  2MCN B;  4IC7 B;  3WIM A;  4WWN A;  3AXC A;  1Z5S B;  1KOT A;  5HKH A;  4HCP B;  3UIO B;  1EF5 A;  2PJH A;  1WM2 A;  2C60 A;  2NVU I;  4JQW C;  2AL3 A;  4KDI C;  5BO4 B;  4G11 A;  4GOC A;  4JL9 A;  4WJQ A;  3WA0 A;  2L7R A;  4M0W B;  3IG3 A;  4WWP A;  1UH6 A;  1D3Z A;  3WAL A;  4NQL B;  4RM8 A;  3MJW A;  2Z0E B;  2Z0D B;  3OAW A;  4BBN C;  2N9P C;  2J0J A;  3ZTD A;  2HTH A;  1WM3 A;  4BKS A;  4OVV A;  3VUW A;  1WX8 A;  2K6D B;  3M62 B;  2K39 A;  1U4A A;  2LGX A;  2L76 A;  2FCN A;  2K8C A;  3ECI A;  2CKH B;  2ZCC A;  4M8M A;  4MJS A;  3QQ8 B;  2D11 A;  1WXM A;  4TKN A;  1TTN A;  3VQI A;  1NDD A;  1P0R A;  5C23 A;  4MGY E;  2LZ6 A;  3DVG Y;  2KTR A;  2JVC A;  1V2Y A;  4PYU A;  3VTV A;  1WE7 A;  3ZRF A;  3GZN I;  2JRH A;  4DHZ B;  4W9C A;  1Q0W B;  2KTR B;  4OVU A;  2KHW B;  2LJ5 A;  4HJK A;  3R7Q A;  3VHT C;  3NY5 A;  4MEL A;  4BKG A;  1YQB A;  3JVZ X;  3TIX A;  2M8S A;  3HK0 A;  1E8Z A;  2IO2 B;  4IUM B;  4PS8 A;  4PS7 A;  2N7D A;  2MP2 B;  1MG8 A;  3ZNI D;  1J0G A;  2ZNV C;  1WX7 A;  4II3 B;  4NY0 A;  3VDZ A;  4KV2 A;  3UF8 A;  2RGF A;  2C7N B;  4I6N B;  3MTN B;  3APC A;  4K7W A;  3DCG A;  3PGE A;  2M17 A;  3NHE B;  4K7U A;  1J8C A;  2AL6 A;  2M0X A;  4I6P A;  5AEK B;  2WWZ A;  4XC2 A;  2KJR A;  2JUO A;  3L13 A;  4MSQ B;  4ANW A;  1GC7 A;  4URK A;  1ZGU B;  2IY1 B;  5J18 A;  2J7Q B;  4HVB A;  4W9I A;  3H6N A;  3H7P A;  4II2 B;  4DHZ E;  3PPA A;  4XX5 A;  4DWF A;  1Q1O A;  1Z2M A;  3OJ4 B;  3PS6 A;  1IYF A;  3NS8 A;  1WGR A;  1WMH A;  2ZPY A;  4AJW A;  3LJ3 A;  2C5L C;  4WJN A;  3RCZ A;  4ZRI A;  4MDK E;  3T9L A;  2KDE B;  3CST A;  2MQJ A;  4JGH B;  1RRB A;  2G4S A;  4NAW B;  3ZDT A;  5JH5 C;  4W9G A;  2NR2 A;  2BPS A;  4BOZ B;  4FUL A;  3S2A A;  3A9K A;  1RLF A;  2NS5 A;  3K9O B;  3KVF B;  1WXS A;  1HE8 A;  2DYM A;  1QZE A;  3A9K B;  1V49 A;  4FJY A;  1WFY A;  2RR9 A;  4PYZ A;  2J0M A;  2JRI B;  4ASW C;  1GC6 A;  2KXJ A;  4HDQ A;  3V61 A;  3ZLZ A;  3H7P B;  3SDL C;  4GDK A;  4F1S A;  2NPT A;  4TV3 A;  2IO0 B;  3QAR A;  2K6Q A;  3CMM B;  4KZ0 A;  3AU4 A;  4ZRK A;  2D2Q A;  3NZS A;  4MSM B;  2WX0 A;  3ML9 A;  4WQO B;  1K8R B;  2IO3 B;  1WF9 A;  4RM9 A;  4HPL B;  4BOS C;  1GJZ A;  3IBE A;  4KIK A;  3C0R B;  4NNJ B;  1WGH A;  4LJO B;  5D7G A;  3JYU A;  3KUC B;  5D2M B;  2GBJ A;  4LDT B;  2DZM A;  3RUI B;  5C1Z A;  1E8Y A;  2FIF A;  2ZVO A;  2BWE S;  2DEN B;  1EF1 A;  3A9J B;  2KDF B;  5TR5 A;  1E7V A;  5L83 A;  2REX A;  4JLC A;  2ASQ A;  2MP2 A;  4EEW A;  4DDI D;  2B3A A;  2G45 B;  3PHX B;  2L00 B;  2UYZ B;  4CO7 A;  3R3M A;  4PS3 A;  3TMP B;  4FBJ B;  4DHJ B;  2JY6 A;  2C7M B;  4IM0 A;  2LWP A;  1C1Y B;  2LXA A;  3VVW B;  4BKT A;  2MLB A;  2LVQ A;  4LCD E;  4GDL A;  4MEM A;  3WAN A;  2JF5 A;  4NJ6 A;  4E74 A;  3ZUN A;  1WJN A;  3OJ3 A;  3DVN U;  2KN5 A;  2MRP A;  2V3S A;  4KZC A;  4FJZ A;  2KVR A;  1IP9 A;  3HM6 X;  5E6O A;  2C9W B;  2XK5 B;  4GSW A;  2CHX A;  4HLE A;  5JZE B;  3PRE A;  1UGM A;  1SE9 A;  3H9D A;  3EC8 A;  3ZO5 B;  3GOE A;  1XD3 B;  1WMH B;  4KVG B;  4EZL A;  3ALB A;  1WJ4 A;  5CHW A;  2MBO A;  4W9J A;  2AWT A;  4NJ7 A;  3WAO A;  3TBL D;  4EUT A;  2DYO A;  2KKC A;  3ZNZ B;  4NQK E;  1OEY A;  4F7Z A;  3PVL A;  2R2Q A;  4HK2 A;  3PLU A;  1UBQ A;  2O6V B;  4N9F 4;  1WH3 A;  2K25 A;  2MW5 A;  3KUD B;  2MX2 A;  2G4D B;  2JZ3 B;  2KFJ A;  1E7U A;  2DAF A;  2BYE A;  3I3T B;  3A9J A;  4MGI E;  4MGK E;  3AI5 A;  5D6J B;  1ISN A;  4FHJ A;  1E8X A;  1GUA B;  2KLG A;  3RUL A;  3PLV A;  1KLV A;  1EUV B;  2FUH B;  2K8B A;  4LDT D;  5G2N A;  4FA6 A;  4A3O A;  2N1W A;  2GMI C;  3L0W B;  1G6J A;  2MSE D;  5CX3 A;  3HIZ A;  2LUE A;  3RT3 B;  2N7E A;  2NBU A;  1CMX B;  2D10 A;  1WE6 A;  4G3X B;  5D94 A;  4K81 A;  3V6C B;  2J0K A;  2KQS A;  1UD7 A;  3N3K B;  2K1F A;  1LM8 B;  2GBM A;  2JT4 B;  1R4N I;  2MBE A;  2MBB B;  1NI2 A;  4TUU A;  4E71 A;  2OOB B;  4WJP A;  4FLH A;  2KTF A;  3VH4 B;  2D07 B;  2L05 A;  2M1M A;  1UBI A;  1TZ1 A;  1P1A A;  2XEW A;  1WR1 A;  2KC2 A;  3UGB B;  1V86 A;  1YX5 B;  2MBQ A;  3KYC D;  4GDL B;  4NPN A;  2JWZ A;  2R2O A;  3DVG X;  3APD A;  5FR6 A;  4WWO A;  3BY4 B;  2LRW A;  3PTF C;  3ZTC A;  1JRU A;  1WY8 A;  3WAP A;  2V4L A;  3V6E B;  3ZIM A;  2MBH A;  4K7S A;  1V81 A;  4HDO A;  2N1V A;  4FAD A;  3DBS A;  1I35 A;  2EMS A;  3QC8 B;  4W9K A;  2OJR A;  1V5O A;  3U30 A;  4HCN B;  4A3P A;  2KO3 A;  2KX3 A;  1SGH A;  3KW5 B;  4W9E A;  3IVF A;  4NAW A;  3VTU A;  2GBR A;  4W9L A;  5E6N A;  4A20 A;  2L0T A;  4JIO U;  4BKS D;  4MJS B;  2LAS A;  5DPT A;  2BF8 B;  2Y5B B;  1GNU A;  2ZJD A;  3VUX A;  2WYQ A;  4KIK B;  1WJ6 A;  2UWQ A;  2ZZP B;  1WZ3 A;  2LI5 A;  3B1L X;  5G55 A;  4FJV B;  1YX6 B;  2CHZ A;  3A1Q B;  4ANU A;  3DPD A;  3U8Z A;  3PRM B;  3SU8 X;  3IFW B;  2FCQ A;  4J6I A;  1FXT B;  3BIN A;  1AAR A;  1L7Y A;  5IAA C;  3VUY A;  4DDG D;  3R7R A;  2N9E B;  3AU5 A;  1XQQ A;  5CHV C;  3KYD D;  2RPQ A;  4WJO A;  4AOF A;  4EZK A;  5KHQ A;  5DPR A;  4I6L B;  3QX1 A;  3DVN V;  4ZDV A;  4AP4 C;  5L95 C;  4EZJ A;  3P2B A;  1EO6 A;  5DCN A;  4BFR A;  1E8W A;  2O2V B;  3Q3F A;  3UQA A;  4TQ1 A;  4DXA B;  1WGY A;  3KH0 A;  4G0N B;  3VH3 B;  3N32 A;  1R4M I;  3DBR I;  1GG3 A;  3JSV A;  1BT0 A;  1ZKH A;  3ONS A;  3W1Y A;  3H1U A;  1WRD B;  2JXX A;  1E5W A;  4FHK A;  1PQS A;  2KJ6 A;  4M8N A;  4CYE A;  2A4Z A;  3ZVV A;  4MGZ E;  3SD5 A;  1WZ0 A;  2XBB C;  2CU1 A;  3PRP B;  2AEH A;  1OQY A;  2ZNV B;  4WAA A;  1V6E A;  3TL5 A;  2KX0 A;  4BVU C;  2JPH A;  1S1Q B;  3ZKJ C;  3EFU A;  2IY0 B;  5LXH A;  3VFK A;  2KD0 A;  2WX1 A;  3DDC B;  2EKE C;  1TGZ B;  2KQ7 A;  2PE9 A;  2KK8 A;  3N30 A;  4IG7 B;  3X23 A;  2KWU B;  2ZPN A;  1OTR B;  2D3G A;  2DZJ A;  2DZK A;  5GMV A;  2DX5 B;  2DZI A;  1WGG A;  1KM7 A;  1VD2 A;  5AZH A;  2FCS A;  3UQB A;  3UIN B;  2GBK A;  5JHA A;  3A33 B;  1S3S G;  2HD5 B;  3JSV B;  3K9P B;  4K1R B;  4KSL C;  5AZG A;  2FNJ B;  3ZNG C;  4GDK B;  1NBF C;  2KWC A;  3DQV A;  2NBW B;  2VRR B;  1P9D U;  1OGW A;  3W1S A;  4W9D A;  3O65 B;  3V62 A;  1Q5W B;  4G50 A;  5LXI B;  1RAX A;  4EOY A;  2M4N A;  5AZF A;  1WGD A;  3VAW A;  4F8C B;  1ZW7 A;  2IZV B;  1WXA A;  3PHW B;  4AWJ A;  5DPS A;  2KWV B;  2O6V D;  1WXV A;  3A4R A;  3Q3J A;  3MHS D;  5CTR C;  2FCM A;  2KC1 A;  1H4R A;  2V1Y A;  4B9K A;  1SIF A;  4MH0 E;  2CR5 A;  2I1J A;  3PV1 A;  3QHT A;  4KDL B;  3AUL A;  4W9F A;  2QHO A;  3JW0 X;  3M95 A;  3RZW C;  3QJZ A;  3WAM A;  3CSF A;  2PE6 B;  4BBN F;  5IA7 A;  2NPT B;  3V60 A;  3RD2 A;  2HE7 A;  5JHB A;  1YJ1 A;  1LFD A;  1P3Q U;  5E6P A;  1X1M A;  2JZZ A;  2GOW A;  2BGF A;  2KJH B;  2KDI A;  3QWZ B;  3NOB A;  2NBV B;  4ICU A;  2KMC A;  4YL8 A;  4DBG A;  1L2N A;  3R66 C;  3M63 B;  2BKF A;  2PPH A;  2WDT B;  3QAQ A;  4ZRJ A;  1H8C A;  3T8M A;  3L08 A;  3ENE A;  2IBI B;  1M94 A;  3ZNH B;  1E90 A;  4IM2 A;  2LVO A;  4EKU A;  2LRU A;  1T0Y A;  2C7H A;  4RMA A;  1WR6 E;  4GIV A;  3APF A;  3L10 B;  4IW0 A;  2AYO B;  5EDS A;  4IWQ A;  1KJT A;  3D32 A;  3KUZ A;  4LJP B;  2A5U A;  4ANV A;  3UIP B;  4B6W A;  3DOW A;  3NZU A;  5CHF A;  1V5T A;  3L17 A;  3RZF A;  3RYT A;  4AUQ C;  2KAN A;  4DHJ D;  1UZX B;  4GU2 A;  5DPW A;  5J2R A;  2KOX A;  2KFK B;  3L16 A;  5KHO A;  5LLI A;  1WIA A;  4E3C A;  2LXC A;  4ICV A;  5J17 A;  4HWI B;  4FN2 A;  4IWP A;  3OLM D;  1A5R A;  3X0W A;  2ZVN A;  2YVC A;  3PRZ A;  4KSK C;  4IM3 A;  3A1Q A;  3PSE B;  4XZ4 A;  4ZYN A;  4AJY B;  1J19 A;  4GXB A;  3SHQ A;  1OEY J;  3QIJ A;  4GGQ A;  3ZRC A;  4GMV A;  2EMT A;  4EFO A;  1YIW A;  2G3Q B;  1LXD A;  3ZDM C;  3ZW3 A;  2KFK A;  1P98 A;  2RD0 A;  4CHK A;  2IO1 B;  3IHP C;  2XK5 A;  2MWS B;  2BWF A;  3HM3 A;  3EHV A;  1V9J A;  2CHW A;  2Z59 B;  2PEA A;  4ANX A;  1VCB A;  3ML8 A;  2I1K A;  2L3Z A;  3VXW A;  2ZEQ A;  2DHZ A;  2DAJ A;  1IPG A;  4MM3 A;  1V80 A;  3L54 A;  4B95 A;  4X57 B;  2N9X A;  2BYV E;  2LVP A;  3CF6 E;  3U7D A;  2L8J A;  3M3J A;  4IWO A;  2O6V A;  3A4S C;  2NCN A;  3QCA A;  1C3T A;  2FID A;  2KZR A;  1UEL A;  1WJU A;  3PT2 B;  1Y8R C;  2KNB A;  3DBL I; 
#chains in the Genus database with same CATH topology
 2W3S A;  2DYB A;  3AE9 B;  4YSY B;  4GN1 A;  1I42 A;  4GB9 A;  2W3R A;  3N1Y C;  4DK5 A;  2IGH A;  2X8X X;  2N4F A;  2LGS A;  2WXK A;  1FPY A;  3BK2 A;  1SF0 A;  1F9J A;  3PZD A;  1HXY D;  4HXD A;  4OZB A;  1UF0 A;  3IXS A;  2WP9 B;  4ZHP A;  2EEL A;  3B2F A;  4P1B C;  2MCN B;  1Z5S B;  5HKH A;  1JWB D;  1TKE A;  2NVU I;  3AEA B;  2AL3 A;  4G11 A;  1T0Q C;  5H92 C;  2LMC A;  2L7R A;  4WWP A;  3WAL A;  1VLB A;  2R61 A;  3MJW A;  2Z0D B;  3KWL A;  2SAK A;  3ZTD A;  1WM3 A;  4BZA A;  3MHZ A;  2K6D B;  3MC9 A;  3EGR A;  2FCN A;  2K8C A;  1HTO A;  2ZCC A;  2D11 A;  2AX5 A;  1TTN A;  3ETR A;  2XNA C;  3T3N A;  3VTV A;  3DVG Y;  1V2Y A;  3GZN I;  1N63 A;  4W9C A;  1Q0W B;  4RH6 A;  3VHT C;  4MEL A;  5C3J B;  1HZ6 A;  3HK0 A;  2IO2 B;  4PS8 A;  1KLU D;  4PS7 A;  2MP2 B;  1SXT A;  1FM0 D;  3RNB C;  3VDZ A;  3MTN B;  5EE0 A;  3PGE A;  2M0X A;  4XC2 A;  1PGB A;  3L13 A;  1B9R A;  5HFY A;  3RMK C;  3NS1 A;  4OW0 A;  4DWF A;  3FIL B;  1Z2M A;  2INN E;  1TY0 A;  3P4R B;  3NS8 A;  2ZPY A;  3LJ3 A;  3RCZ A;  3T9L A;  4N6E B;  3Q8B A;  3ZDT A;  4IOI E;  2NR2 A;  2BPS A;  4FUL A;  1P7E A;  3KVF B;  1WXS A;  1YJI A;  2DYM A;  1J7A A;  1QZE A;  3A9K B;  1V49 A;  4FJY A;  1WFY A;  4YWG G;  4PYZ A;  4LNF A;  2JRI B;  5IN7 A;  4HDQ A;  3ZLZ A;  3E9S A;  4KZ0 A;  1ROE A;  4ZRK A;  4RF0 A;  3NZS A;  1SSN A;  3BII D;  1WF9 A;  4RM9 A;  4HPL B;  3SR6 A;  4BOS C;  2KDM A;  1DOX A;  4NNJ B;  3NVW A;  1P7F A;  4LJO B;  3KUC B;  2GBJ A;  1TS5 A;  1XLO A;  2FIF A;  1WXQ A;  2BWE S;  4A6Q A;  2ONQ A;  3A9J B;  5L83 A;  2QDF A;  5TR5 A;  4JLC A;  3ZQ4 A;  4EEW A;  1QOB A;  2UYZ B;  4PS3 A;  3TMP B;  4FBJ B;  4IM0 A;  3Q3N C;  3B2G A;  3VVW B;  2LVQ A;  4MEM A;  3AED B;  3BYT B;  1UGJ A;  1VZ6 A;  4RNA A;  1MJD A;  3W5U B;  1A70 A;  1CK1 A;  2V3S A;  4KZC A;  4AS1 A;  1IP9 A;  5E6O A;  4HKZ E;  3GOE A;  1WMH B;  3ALB A;  1WJ4 A;  2LEK A;  3IT4 B;  2X38 A;  3TBL D;  2KKC A;  3ZNZ B;  2VH1 A;  3PVL A;  2R2Q A;  4AQ7 A;  4N9F 4;  2G4D B;  2KFJ A;  2QCZ A;  3I3T B;  4MGK E;  3N1Z C;  1SB3 C;  2LJI A;  1PGA A;  2Y5P A;  1TJE A;  3HUI A;  4A3O A;  1BUI C;  3IAS 1;  1Q10 A;  1D6E C;  3OWE B;  2AQ2 B;  4G3X B;  3P42 A;  1F52 A;  3U7Z A;  4M0W A;  1LM8 B;  2MBB B;  2E6X A;  4REZ A;  1ACC A;  1D5X C;  4WJP A;  1NVI D;  3VH4 B;  1P1A A;  2XEW A;  3UGB B;  3KYC D;  2KVZ A;  2JWZ A;  3ZTC A;  1ZXI A;  1PFD A;  1TKY A;  3DBS A;  2WXQ A;  3U30 A;  3PO0 A;  2W55 A;  2KX3 A;  1SGH A;  3H8H A;  4W9E A;  4ITK A;  3IVF A;  3VTU A;  5E6N A;  4A20 A;  4JIO U;  4MJS B;  3MJ5 A;  3VUX A;  4OZC A;  2WYQ A;  2UWQ A;  3A1Q B;  3DPD A;  2WGS A;  1NI3 A;  3PRM B;  1NYQ A;  2K0P A;  3BIN A;  1IGC A;  2N9E B;  3AU5 A;  4AOF A;  4EZK A;  3C8Y A;  4MT5 A;  2GI9 A;  4I6L B;  1SJE D;  3BWU D;  4XYC A;  4ZDV A;  4BFR A;  1YN3 A;  3BK1 A;  3Q3F A;  1LO5 D;  4TQ1 A;  1WGY A;  3KH0 A;  5D3D A;  2PTL A;  3VH3 B;  3BYY B;  1R4M I;  3DBR I;  1GG3 A;  1BT0 A;  3ONS A;  3E56 A;  3SFD B;  2KJ6 A;  2D3A A;  4K3B A;  3N9Y C;  1V6E A;  3BVM A;  4BVU C;  2JPH A;  1S1Q B;  2Y3A A;  3EFU A;  1C77 A;  3VFK A;  2WX1 A;  3DDC B;  2RDB C;  2XN9 C;  4RGN A;  1FNU A;  3N30 A;  4UDU C;  3TUO A;  5HI1 A;  2W82 A;  4NJC A;  4LK0 M;  5AZH A;  2J53 A;  2WXM A;  3A33 B;  4OVZ A;  2FNJ B;  3ZNG C;  4M01 A;  1YQ4 B;  1N6Z A;  1P9D U;  2MJ3 A;  4W9D A;  2WXI A;  1Q5W B;  4G50 A;  5MPO A;  2QIL A;  4F8C B;  1WXA A;  2O6V D;  3AE1 B;  3Q3J A;  3MHS D;  1QIL A;  3N20 C;  4MH0 E;  1JRO A;  2CR5 A;  1N61 A;  4M02 A;  4KX6 B;  4W9F A;  3R2I A;  3JW0 X;  4C7Z A;  3GE3 C;  4RGO S;  1R4M B;  1LFD A;  1X1M A;  4WH4 A;  2HDE A;  5IOI A;  4OZA A;  4DBG A;  4JPS A;  2WDT B;  3QAQ A;  1H8C A;  3T8M A;  3DWG C;  3ENE A;  1M94 A;  3ZNH B;  3CWI A;  2LVO A;  1NEN B;  4IW0 A;  2WDR B;  3D32 A;  4B6W A;  1V5T A;  2KOX A;  2I38 A;  5KHO A;  1SEB D;  2KT7 A;  4FN2 A;  3X0W A;  1LGR A;  3A1Q A;  3PSE B;  1WYG A;  1E6E B;  2BS2 B;  4EFO A;  1KF6 B;  3ZDM C;  2RD0 A;  3NUH B;  3IHP C;  3LXF A;  1AWD A;  4ANX A;  3NVV A;  4WIP A;  2GRI A;  1QOF A;  1R7S A;  2LVP A;  3J9C A;  2L8J A;  4IWO A;  3UI3 A;  3A4S C;  2NCN A;  4M00 A;  1WJU A;  1Y8R C;  2KNB A;  2NMQ A;  3DHG C;  2ZCB A;  2IYD B;  5GXG B;  3HHM A;  2K8H A;  4S0R A;  2MJE A;  3FKY A;  1L5P A;  2AQ3 B;  2BYF A;  1RFA A;  2LD9 A;  4KKI A;  1YN5 A;  3EEC A;  2QC8 A;  3WCQ A;  1FRD A;  1TBE A;  5BMI A;  1C76 A;  1C4C A;  1XT9 B;  1C78 A;  1T0R C;  3H7S A;  1YQ3 B;  1C4P A;  1FXA A;  1HEZ E;  2O2V A;  3I5J C;  1KOT A;  4IC7 B;  2WDV B;  3AXC A;  4WWN A;  1GB4 A;  1FFU A;  1WM2 A;  4JQW C;  4JWS C;  5BO4 B;  4KDI C;  1MI0 A;  4JL9 A;  4HKQ A;  3WA0 A;  3O13 A;  5H8Y E;  1D3Z A;  3V3X A;  1E9M A;  2Z0E B;  4ARI A;  1TIF A;  1WX8 A;  3AE3 B;  3M62 B;  2CKH B;  4M8M A;  3QQ8 B;  2QIE B;  1WXM A;  1HA5 A;  2KYW A;  4TKN A;  4R3D A;  1P0R A;  5C23 A;  4PYU A;  4N58 A;  4DHZ B;  4P1C C;  4OVU A;  2KHW B;  4BKG A;  4KGR A;  3FC4 A;  4IUM B;  2N7D A;  1J0G A;  3P1M A;  5EE9 A;  3APC A;  3HVZ A;  1J8C A;  1PUT A;  4I6P A;  1L4Z B;  2WWZ A;  2V3P A;  1I4H A;  4MSQ B;  4ANW A;  4YTN B;  2IY1 B;  5D3I B;  2J7Q B;  2BS3 B;  3H6N A;  4II2 B;  4LTU A;  1IYF A;  1ZPS A;  1HQR D;  3GB1 A;  1WGR A;  1WMH A;  3NG0 A;  2L1A A;  3MP9 A;  4MDK E;  2BVC A;  4NAW B;  2AQ1 B;  1SE3 A;  4LNN A;  3S2A A;  3A9K A;  3IAM 1;  1L6V A;  2RR9 A;  2J0M A;  2KXJ A;  3SDL C;  4GDK A;  4F1S A;  4TV3 A;  5HHD G;  5I4D A;  1D5M C;  2YEP B;  3KQ4 A;  2D2Q A;  4MSM B;  2WX0 A;  4YTM B;  1K8R B;  2IO3 B;  2N0S B;  4B0E A;  3IBE A;  1AW7 A;  3VRA B;  1V1P A;  1J7C A;  4YSZ B;  1OQQ A;  1E8Y A;  2WNM A;  2DEN B;  1RFK A;  4S17 A;  2MP2 A;  4DXF A;  3W9C B;  2G45 B;  3T3O A;  1WRI A;  2L00 B;  4JX1 C;  1STE A;  4WUR A;  2C7M B;  4BKT A;  3AEG B;  4C56 C;  4E74 A;  3ZUN A;  3OJ3 A;  2K9X A;  2KN5 A;  3CIR B;  3GS2 A;  1EM7 A;  4HLE A;  4GSW A;  2CU3 A;  2CHX A;  1UGM A;  1UUP A;  3H9D A;  3EC8 A;  2IGD A;  1UWM A;  1XD3 B;  4EZL A;  1B1Z A;  4NJ7 A;  3WAO A;  3Q8E A;  2KMM A;  1OEY A;  3I63 C;  2DLB A;  4HK2 A;  2VZK D;  4XGA B;  1EWY C;  1KFY B;  2WXG A;  4ARC A;  3Q2A C;  2MX2 A;  2IPK D;  2BYE A;  1V8C A;  2W54 A;  3AI5 A;  3HVD A;  5D6J B;  1ISN A;  2NTT A;  5BYQ A;  2KLG A;  2FUH B;  2WXH A;  3AMZ A;  1G6J A;  2FE8 A;  3HIZ A;  3AN1 A;  4US9 A;  2N7E A;  2NBU A;  1FIQ A;  5D94 A;  4D2K A;  1VRA B;  3AEE B;  2KQS A;  2K1F A;  2GBM A;  1SBB B;  4FLH A;  1N60 A;  2L05 A;  2M1M A;  1UBI A;  1GB1 A;  1TS3 A;  1WR1 A;  1TYG B;  2MBQ A;  4NPN A;  1L0X B;  3GP7 A;  3BY4 B;  3HRD D;  1JRU A;  1WY8 A;  3WAP A;  2V4L A;  1C79 A;  2N1V A;  2PVG C;  2OJR A;  1WWT A;  3AH7 A;  2KO3 A;  2RMM A;  4HJG E;  1CZP A;  4W9L A;  3AM9 A;  4H2A A;  2LAS A;  4MAC A;  5DPT A;  2BF8 B;  1GNU A;  2WLB A;  4KIK B;  2LI5 A;  4ANU A;  3U8Z A;  1VZ8 A;  3SEB A;  3SU8 X;  4J6I A;  2M0A A;  3P4Q B;  1AAR A;  5IAA C;  3AE4 B;  3IT6 B;  1XQQ A;  5CHV C;  3KYD D;  5FR3 A;  1HTQ A;  3P2B A;  3NRZ A;  1EO6 A;  1E8W A;  2O2V B;  2BT6 A;  3UQA A;  4G0N B;  2M56 B;  5G5G A;  3H1U A;  2JZP A;  4B0M A;  4FHK A;  3ZVV A;  4MGZ E;  2CU1 A;  1ZOY B;  3L4P A;  2WXO A;  1OQY A;  3TL5 A;  4DXG A;  2ZW0 A;  2IY0 B;  4L23 A;  1ZE3 D;  2KD0 A;  1IBX A;  2KK8 A;  3X23 A;  2JU6 X;  2D3B A;  2KWU B;  1MVK A;  1OTR B;  2D3G A;  2DZJ A;  2BS4 B;  2RDH A;  1DYQ A;  1TKG A;  2QMT A;  1I4R A;  3RN9 C;  1MHH E;  1TY2 A;  3JSV B;  3K9P B;  1YJJ A;  2INC C;  2KWC A;  3DQV A;  3OG5 A;  2NBW B;  1OGW A;  3NVZ A;  1SJH D;  5BMG A;  1KH0 A;  1IUE A;  4ZYS A;  5C2T B;  1T5X D;  3PHW B;  1VZ7 A;  2VZK B;  2KC1 A;  4B9K A;  1KRH A;  2I1J A;  3QHT A;  3QJZ A;  3CSF A;  3R8B A;  4BBN F;  1I4Q A;  5IA7 A;  3V60 A;  3RD2 A;  1T6B X;  1YJ1 A;  1ZP0 B;  1P3Q U;  2WXF A;  2KJH B;  3QWZ B;  3NOB A;  1JWU D;  1XEE A;  2GLS A;  4RF1 A;  1FCL A;  2PPH A;  3L08 A;  2IBI B;  2HTM E;  2LRU A;  2WU2 B;  2C7H A;  4ACF A;  3UIP B;  2ICI A;  3DOW A;  3NZU A;  3L17 A;  3RZF A;  3P63 A;  3RYT A;  1UZX B;  1RYJ A;  1ET6 A;  1WIA A;  5TSS A;  4ICV A;  4IWP A;  1A5R A;  2ZVN A;  2YVC A;  3PRZ A;  1OFF A;  4KSK C;  1J19 A;  4GXB A;  1OEY J;  3QIJ A;  4GGQ A;  1YIW A;  3ZW3 A;  4CHK A;  2PEA A;  1VCB A;  2I1K A;  1ET9 A;  2DAJ A;  1IPG A;  3L54 A;  2BYV E;  3CF6 E;  3M3J A;  2O6V A;  3QCA A;  1C3T A;  2HJ1 A;  2B76 B;  2KZR A;  1UEL A;  3DBR B;  3TSS A;  3DBL I;  1ZDV A;  2WHI A;  3TCA A;  2NTS A;  4ZRQ A;  2K3U A;  3B08 A;  2Y5C A;  1YN4 A;  2MA9 B;  2LGD A;  4W9H A;  1WI0 A;  2KLC A;  1YMH E;  2CS4 A;  2IJ0 A;  2YLM A;  2LFI A;  2RSU A;  1WYW B;  3B0A A;  2L0F A;  2HJ8 A;  1YD8 U;  1NEK B;  3QA8 A;  3WIM A;  1XF5 L;  2KAJ A;  4HCP B;  3UIO B;  1EF5 A;  2PJH A;  4GOC A;  4WJQ A;  3AEB B;  4M0W B;  3IG3 A;  1UH6 A;  2PKO A;  2Q5W D;  5JXV A;  4BBN C;  2H88 B;  2J0J A;  2N9P C;  2HTH A;  1JML A;  4OVV A;  2LGX A;  1U4A A;  1IBX B;  2L76 A;  4MJS A;  2G1E A;  3VQI A;  1NDD A;  2KTR A;  2JVC A;  3GZN B;  1WE7 A;  1FRR A;  3N1X C;  2KTR B;  1HZ5 A;  2RDG A;  3R7Q A;  1YQB A;  1ZDX A;  3TIX A;  2M8S A;  1E8Z A;  1MG8 A;  4XWT A;  1XXG A;  1XLP A;  1WX7 A;  3NZ3 A;  4NY0 A;  4PK1 A;  2RGF A;  2WQY B;  1VR9 A;  1WSP A;  3DCG A;  2M17 A;  4K7U A;  2D5G A;  5AEK B;  3SFE B;  2KJR A;  1GC7 A;  1FO4 A;  4URK A;  1SE4 A;  1ZGU B;  5J18 A;  4QAY A;  4HVB A;  4W9I A;  3H7P A;  3PPA A;  4XX5 A;  1Q1O A;  3OJ4 B;  1QOA A;  3U4E G;  1FMA D;  1EU4 A;  5IP4 D;  4WJN A;  4ZRI A;  2KDE B;  4WAF A;  2MQJ A;  1RRB A;  2G4S A;  1FCC C;  4BOZ B;  2CJN A;  2NS5 A;  3K9O B;  1FXI A;  4LNI A;  4ASW C;  1CJE A;  2N9L A;  2K6Q A;  3CMM B;  3AU4 A;  2L32 A;  1F2R C;  1XLQ A;  3C0R B;  1WGH A;  5D7G A;  3JYU A;  4LDT B;  3RUI B;  5C1Z A;  1F0Z A;  4YSX B;  1MG4 A;  2ZVO A;  3Q3M C;  3AEF B;  1VDV A;  2KDF B;  2ASQ A;  3BVZ A;  4RGT A;  1PYW D;  2ACZ B;  2B3A A;  4DHJ B;  2LWP A;  4XDD A;  1C1Y B;  2PW9 A;  2MLB A;  4GDL A;  2JF5 A;  1WJN A;  2J52 A;  5EE3 A;  3DVN U;  3W2D A;  4FJZ A;  3HM6 X;  2C9W B;  3PRE A;  2GB1 A;  1SE9 A;  2FBW B;  1FNV A;  5CHW A;  4W9J A;  4IDI A;  4NQK E;  4F7Z A;  3W5V B;  3PLU A;  2O6V B;  1GAQ B;  5EE1 A;  1WH3 A;  2K25 A;  3KUD B;  3RNC C;  2JZ3 B;  2K5P A;  1R4N B;  3LYY A;  1L0Y B;  1GUA B;  3RUL A;  1KLV A;  1EUV B;  2G9H D;  2K8B A;  5G2N A;  4FA6 A;  1C9F A;  4YXD B;  1V1P B;  3L0W B;  5CX3 A;  2LUE A;  3RT3 B;  2RPV A;  1CMX B;  1FFV A;  2D10 A;  4K81 A;  2J0K A;  1UD7 A;  3FIL A;  3AE2 B;  2JT4 B;  1R4N I;  2MBE A;  1NI2 A;  4TUU A;  4E71 A;  2KTF A;  4GDL B;  3DVG X;  1JWM D;  3APD A;  2J42 A;  4WWO A;  5FR6 A;  3PTF C;  2J4X A;  3V6E B;  2MBH A;  1T0S C;  2WS3 B;  4HDO A;  4FAD A;  2EMS A;  3QC8 B;  1V5O A;  4A3P A;  3BVG A;  1XCQ L;  1DOI A;  4A8X C;  4OHJ A;  1TS2 A;  3KW5 B;  4NAW A;  4WWM A;  4BKS D;  3I57 A;  2ZJD A;  1JWA D;  2MJD A;  4RGM A;  3B1L X;  5G55 A;  3DBL B;  2ZW1 A;  1AN8 A;  4FJV B;  1XO3 A;  3IFW B;  1K52 A;  2FCQ A;  1FXT B;  2V4I B;  1JQ4 A;  1L7Y A;  3R7R A;  2ON8 A;  2RPQ A;  4WJO A;  4RCO A;  2K22 A;  2BBC A;  4JWU C;  2BB6 A;  2BW2 A;  4XWW A;  2V3N A;  1N5X A;  2CJO A;  3JSV A;  1ZKH A;  1BML C;  2JXX A;  1E5W A;  1PQS A;  2QEJ C;  3SD5 A;  3ZJU A;  2XBB C;  3MFG A;  2PVO D;  2AEH A;  3PRP B;  4C4V A;  4TMA B;  4WAA A;  3AE5 B;  5LXH A;  2V9H A;  1TGZ B;  4IG7 B;  2ZPN A;  2DNF A;  2DX5 B;  2DZI A;  3RNA C;  2FCS A;  3UQB A;  3UIN B;  3I9V 1;  2GBK A;  1RWS A;  5JHA A;  4IKG A;  1S3S G;  2HD5 B;  4K1R B;  4KSL C;  2EKI A;  4K3C A;  3Q6B A;  2KWD A;  3Q3O C;  2VRR B;  3W1S A;  5FKA C;  1ESF A;  1SE2 A;  5LXI B;  4EOY A;  5AZF A;  3B9J A;  3VAW A;  3ABV B;  2WXR A;  2IZV B;  4PT5 A;  4AWJ A;  5DPS A;  2KWV B;  1WXV A;  3A4R A;  2KAC A;  2QSD A;  1H4R A;  2V1Y A;  1SIF A;  3PV1 A;  4KDL B;  5LNK 1;  3M95 A;  3RZW C;  1DOY A;  5AUK A;  2L83 A;  4JE3 B;  2NPT B;  2WXJ A;  3LB8 C;  3EUB 2;  4C4V B;  5BMH A;  5E6P A;  2JZZ A;  2GOW A;  3DBH B;  3MC8 A;  2JX5 A;  1L2N A;  3M63 B;  2BKF A;  5BYR A;  3C19 A;  1IGD A;  4ZRJ A;  1QLB B;  1GPX A;  4IM2 A;  1YNT E;  1T0Y A;  1DGJ A;  4RMA A;  1WR6 E;  1TS4 A;  3APF A;  2AYO B;  2BQQ A;  2JXT A;  1KJT A;  3KUZ A;  2A5U A;  4ANV A;  1OQR A;  4AUQ C;  3U52 E;  2KAN A;  5DPW A;  5J2R A;  3L16 A;  1PGX A;  3AB5 A;  4E3C A;  3OLM D;  4USA A;  1RM6 C;  4ZYN A;  1QQR A;  4AJY B;  4GMV A;  1F2R I;  3RFZ B;  1FNW A;  3EA6 A;  4C7Y A;  1P98 A;  2MWS B;  4A9A A;  3HM3 A;  3EHV A;  2CHW A;  2Z59 B;  2IDY A;  3ML8 A;  2OJW A;  2ZEQ A;  2DHZ A;  4ZOH C;  1XCT L;  3Q8A A;  3NJT A;  1V80 A;  2N9X A;  3U7D A;  1FD6 A;  1UNS A;  2PLP A;  2FID A;  2JWU A;  2D3C A;  4A90 A;  2JQR B;  1BXT A;  3VTW A;  4TQ0 A;  3QK0 A;  1EWC A;  1M4V A;  1LQB A;  4HPM B;  2KDB A;  2KMA A;  3TJP A;  2W9N A;  5BYS A;  1WX9 A;  3ZXR A;  2GBN A;  1N62 A;  3W1S C;  3LDZ E;  2LGY A;  3DBH I;  2BKR B;  4P7I A;  3AE7 B;  2MEK A;  2FAZ A;  3Q14 C;  4A55 A;  2C60 A;  2Z8L A;  4HRO A;  1N5W A;  4NQL B;  4RM8 A;  1QF6 A;  3KWV A;  3OAW A;  3Q69 A;  4BKS A;  3VUW A;  2K39 A;  1JWS D;  1JW9 D;  4EE2 A;  2IGG A;  3ECI A;  3V05 A;  3R2T A;  2KN4 A;  1VJK A;  4MGY E;  2LZ6 A;  1I7H A;  3ZRF A;  2JRH A;  4TSS A;  2WXP A;  4HJK A;  2LJ5 A;  3NY5 A;  1JRP A;  3JVZ X;  2JYE A;  3TEW A;  4NZL B;  3MC0 B;  3ZNI D;  2I2Y A;  2ZNV C;  4II3 B;  3VR8 B;  4KV2 A;  3UF8 A;  3P4S B;  2C7N B;  4I6N B;  4P16 A;  4K7W A;  2FUG 1;  3NHE B;  2AL6 A;  1V1O A;  2JUO A;  2LHD A;  1MPE A;  1L0V B;  1K51 A;  4US8 A;  4DHZ E;  3PS6 A;  5E6J A;  3TEZ A;  4AJW A;  3Q8F A;  4ZRP A;  2C5L C;  4C80 A;  3CST A;  4JGH B;  3VRB B;  5JH5 C;  4W9G A;  2N7J A;  4MM3 B;  3RI7 C;  1RLF A;  1HE8 A;  4J3O D;  4RFB A;  1GC6 A;  3V61 A;  3H7P B;  2NPT A;  2IO0 B;  1K53 A;  3QAR A;  4XDC A;  1D4B A;  5AUI A;  1J7B A;  3ML9 A;  4WQO B;  1GJZ A;  4KIK A;  5D2M B;  2DZM A;  5IO9 A;  1YOV B;  1CQV A;  2BTE A;  1EF1 A;  1E7V A;  2REX A;  1I4P A;  3AE6 B;  1L6U A;  4DDI D;  3PHX B;  4CO7 A;  3R3M A;  3PZ8 A;  2JY6 A;  1MHX A;  2LXA A;  4LCD E;  2LGI A;  3WAN A;  4GLS C;  4NJ6 A;  2BYT A;  1GOZ A;  2OHF A;  2MRP A;  3KLS X;  2KVR A;  5T8I A;  2XK5 B;  4BAX A;  5JZE B;  4CQN A;  3ZO5 B;  1QT9 A;  4KVG B;  4YTP B;  2MBO A;  2AWT A;  4ZHO A;  4EUT A;  2DYO A;  1UBQ A;  4KGS A;  5G5H A;  2YEP F;  2MW5 A;  1F1H A;  1E7U A;  2DAF A;  2DWQ A;  4NAM A;  3A9J A;  4MGI E;  3BZD B;  4FHJ A;  1E8X A;  4L1B A;  2WU5 B;  1JCK B;  3PLV A;  4LDT D;  3ZJT A;  2N1W A;  2GMI C;  2MSE D;  4P6V F;  2WXN A;  3AV8 A;  1WE6 A;  3V6C B;  3N3K B;  2L52 A;  2VH2 A;  2WDQ B;  2OOB B;  2D07 B;  1L4D B;  1TZ1 A;  1SIJ A;  2JSV X;  2KC2 A;  3RNF C;  1V86 A;  1YX5 B;  2R2O A;  2LRW A;  3GE8 C;  3ZIM A;  4K7S A;  1V81 A;  2V0G A;  1I35 A;  4W9K A;  4LNK A;  2BB5 A;  4HCN B;  4HRS A;  3ZYY X;  3PZ7 A;  3TEY A;  2GBR A;  2L0T A;  2Y5B B;  4WQM A;  1TT5 B;  3ZJV A;  1WJ6 A;  2ZZP B;  1WZ3 A;  4MH8 A;  1YX6 B;  2CHZ A;  2SEB D;  4KGT A;  3URY A;  1TZO A;  2INP E;  1PDX A;  2IND C;  3VUY A;  2JYT A;  2OED A;  1E10 A;  4DDG D;  5KHQ A;  5DPR A;  2WXL A;  3QX1 A;  1E0Z A;  3DVN V;  3RPF C;  3Q8C A;  4AP4 C;  1F77 A;  5L95 C;  4EZJ A;  5DCN A;  2N9K A;  2MHJ A;  1KLG D;  4DXA B;  4LNO A;  1UWX A;  4HPP A;  3N32 A;  2TSS A;  1K50 A;  3W1Y A;  5FK9 C;  1WRD B;  4M8N A;  4CYE A;  2A4Z A;  3P4P B;  1WZ0 A;  4C00 A;  2QJL A;  2ZNV B;  2KX0 A;  3ZKJ C;  2H89 B;  1FEH A;  2EKE C;  2KQ7 A;  2PE9 A;  1KTK A;  1MFW A;  2DZK A;  5GMV A;  1WGG A;  1I4G A;  1KM7 A;  1VD2 A;  3DWM A;  4HEA 1;  1QOG A;  5AZG A;  4GDK B;  4O1N A;  1NBF C;  1NYR A;  3FAH A;  3O65 B;  4XE0 A;  2PIA A;  3AE8 B;  4LLG M;  3V62 A;  2MH7 A;  4FXC A;  4Q2J A;  1ZUD 2;  2PMV A;  1RAX A;  4DQO C;  3ZGZ A;  2M4N A;  1WGD A;  1ZW7 A;  3RNG C;  3EFC A;  1V97 A;  5CTR C;  2FCM A;  2M19 A;  1JAL A;  3AUL A;  2QHO A;  3WAM A;  3TEX A;  2PE6 B;  4L2Y A;  2HE7 A;  5JHB A;  2DBY A;  2BGF A;  2KDI A;  1T3Q A;  2NBV B;  4ICU A;  1ENF A;  2KMC A;  4YL8 A;  3R66 C;  4KKJ A;  3ZXV A;  1E90 A;  3VR9 B;  4EKU A;  1ZXH A;  1AYF A;  2E3T A;  1Y56 A;  4GIV A;  4YT0 B;  3L10 B;  5EDS A;  4IWQ A;  5HG2 A;  1WGK A;  4LJP B;  5CHF A;  4DHJ D;  3DHH C;  2LUM A;  4GU2 A;  2KFK B;  5LLI A;  2KQ4 X;  2LXC A;  5J17 A;  4HWI B;  1E7P B;  2LHE A;  4IM3 A;  4XZ4 A;  1QKZ A;  3SHQ A;  3ZRC A;  1C4A A;  2EMT A;  2UU7 A;  3AEC B;  2G3Q B;  1LXD A;  2KFK A;  2IO1 B;  2XK5 A;  2BWF A;  3RNE C;  1V9J A;  1D5Z C;  3U2S C;  2L3Z A;  3NVY A;  3VXW A;  5IKC M;  3DHI C;  1XLN A;  4MM3 A;  4B95 A;  4X57 B;  1EU3 A;  4N59 A;  1I4X A;  3PT2 B; 
#chains in the Genus database with same CATH homology
 2DYB A;  4GN1 A;  3TCA A;  2ZCB A;  1I42 A;  2IYD B;  4GB9 A;  3VTW A;  4DK5 A;  3HHM A;  3B08 A;  2K8H A;  3QK0 A;  4TQ0 A;  1LQB A;  4HPM B;  2MA9 B;  2KDB A;  2KMA A;  3TJP A;  2BYF A;  1RFA A;  2LD9 A;  2LGD A;  2W9N A;  4W9H A;  2N4F A;  1WI0 A;  1WX9 A;  2KLC A;  2GBN A;  3EEC A;  1F9J A;  3W1S C;  3PZD A;  2CS4 A;  3LDZ E;  1TBE A;  2YLM A;  2LGY A;  3DBH I;  2BKR B;  2RSU A;  4P7I A;  4HXD A;  1XT9 B;  3H7S A;  1WYW B;  3B0A A;  2L0F A;  2HJ8 A;  1YD8 U;  2O2V A;  2FAZ A;  3QA8 A;  2MCN B;  4IC7 B;  3WIM A;  4WWN A;  3AXC A;  1Z5S B;  1KOT A;  5HKH A;  4HCP B;  3UIO B;  1EF5 A;  2PJH A;  1WM2 A;  2C60 A;  2NVU I;  4JQW C;  2AL3 A;  4KDI C;  5BO4 B;  4G11 A;  4GOC A;  4JL9 A;  4WJQ A;  3WA0 A;  2L7R A;  4M0W B;  3IG3 A;  4WWP A;  1UH6 A;  1D3Z A;  3WAL A;  4NQL B;  4RM8 A;  3MJW A;  2Z0E B;  2Z0D B;  3OAW A;  4BBN C;  2N9P C;  2J0J A;  3ZTD A;  2HTH A;  1WM3 A;  4BKS A;  4OVV A;  3VUW A;  1WX8 A;  2K6D B;  3M62 B;  2K39 A;  1U4A A;  2LGX A;  2L76 A;  2FCN A;  2K8C A;  3ECI A;  2CKH B;  2ZCC A;  4M8M A;  4MJS A;  3QQ8 B;  2D11 A;  1WXM A;  4TKN A;  1TTN A;  3VQI A;  1NDD A;  1P0R A;  5C23 A;  4MGY E;  2LZ6 A;  3DVG Y;  2KTR A;  2JVC A;  1V2Y A;  4PYU A;  3VTV A;  1WE7 A;  3ZRF A;  3GZN I;  2JRH A;  4DHZ B;  4W9C A;  1Q0W B;  2KTR B;  4OVU A;  2KHW B;  2LJ5 A;  4HJK A;  3R7Q A;  3VHT C;  3NY5 A;  4MEL A;  4BKG A;  1YQB A;  3JVZ X;  3TIX A;  2M8S A;  3HK0 A;  1E8Z A;  2IO2 B;  4IUM B;  4PS8 A;  4PS7 A;  2N7D A;  2MP2 B;  1MG8 A;  3ZNI D;  1J0G A;  2ZNV C;  1WX7 A;  4II3 B;  4NY0 A;  3VDZ A;  4KV2 A;  3UF8 A;  2RGF A;  2C7N B;  4I6N B;  3MTN B;  3APC A;  4K7W A;  3DCG A;  3PGE A;  2M17 A;  3NHE B;  4K7U A;  1J8C A;  2AL6 A;  2M0X A;  4I6P A;  5AEK B;  2WWZ A;  4XC2 A;  2KJR A;  2JUO A;  3L13 A;  4MSQ B;  4ANW A;  1GC7 A;  4URK A;  1ZGU B;  2IY1 B;  5J18 A;  2J7Q B;  4HVB A;  4W9I A;  3H6N A;  3H7P A;  4II2 B;  4DHZ E;  3PPA A;  4XX5 A;  4DWF A;  1Q1O A;  1Z2M A;  3OJ4 B;  3PS6 A;  1IYF A;  3NS8 A;  1WGR A;  1WMH A;  2ZPY A;  4AJW A;  3LJ3 A;  2C5L C;  4WJN A;  3RCZ A;  4ZRI A;  4MDK E;  3T9L A;  2KDE B;  3CST A;  2MQJ A;  4JGH B;  1RRB A;  2G4S A;  4NAW B;  3ZDT A;  5JH5 C;  4W9G A;  2NR2 A;  2BPS A;  4BOZ B;  4FUL A;  3S2A A;  3A9K A;  1RLF A;  2NS5 A;  3K9O B;  3KVF B;  1WXS A;  1HE8 A;  2DYM A;  1QZE A;  3A9K B;  1V49 A;  4FJY A;  1WFY A;  2RR9 A;  4PYZ A;  2J0M A;  2JRI B;  4ASW C;  1GC6 A;  2KXJ A;  4HDQ A;  3V61 A;  3ZLZ A;  3H7P B;  3SDL C;  4GDK A;  4F1S A;  2NPT A;  4TV3 A;  2IO0 B;  3QAR A;  2K6Q A;  3CMM B;  4KZ0 A;  3AU4 A;  4ZRK A;  2D2Q A;  3NZS A;  4MSM B;  2WX0 A;  3ML9 A;  4WQO B;  1K8R B;  2IO3 B;  1WF9 A;  4RM9 A;  4HPL B;  4BOS C;  1GJZ A;  3IBE A;  4KIK A;  3C0R B;  4NNJ B;  1WGH A;  4LJO B;  5D7G A;  3JYU A;  3KUC B;  5D2M B;  2GBJ A;  4LDT B;  2DZM A;  3RUI B;  5C1Z A;  1E8Y A;  2FIF A;  2ZVO A;  2BWE S;  2DEN B;  1EF1 A;  3A9J B;  2KDF B;  5TR5 A;  1E7V A;  5L83 A;  2REX A;  4JLC A;  2ASQ A;  2MP2 A;  4EEW A;  4DDI D;  2B3A A;  2G45 B;  3PHX B;  2L00 B;  2UYZ B;  4CO7 A;  3R3M A;  4PS3 A;  3TMP B;  4FBJ B;  4DHJ B;  2JY6 A;  2C7M B;  4IM0 A;  2LWP A;  1C1Y B;  2LXA A;  3VVW B;  4BKT A;  2MLB A;  2LVQ A;  4LCD E;  4GDL A;  4MEM A;  3WAN A;  2JF5 A;  4NJ6 A;  4E74 A;  3ZUN A;  1WJN A;  3OJ3 A;  3DVN U;  2KN5 A;  2MRP A;  2V3S A;  4KZC A;  4FJZ A;  2KVR A;  1IP9 A;  3HM6 X;  5E6O A;  2C9W B;  2XK5 B;  4GSW A;  2CHX A;  4HLE A;  5JZE B;  3PRE A;  1UGM A;  1SE9 A;  3H9D A;  3EC8 A;  3ZO5 B;  3GOE A;  1XD3 B;  1WMH B;  4KVG B;  4EZL A;  3ALB A;  1WJ4 A;  5CHW A;  2MBO A;  4W9J A;  2AWT A;  4NJ7 A;  3WAO A;  3TBL D;  4EUT A;  2DYO A;  2KKC A;  3ZNZ B;  4NQK E;  1OEY A;  4F7Z A;  3PVL A;  2R2Q A;  4HK2 A;  3PLU A;  1UBQ A;  2O6V B;  4N9F 4;  1WH3 A;  2K25 A;  2MW5 A;  3KUD B;  2MX2 A;  2G4D B;  2JZ3 B;  2KFJ A;  1E7U A;  2DAF A;  2BYE A;  3I3T B;  3A9J A;  4MGI E;  4MGK E;  3AI5 A;  5D6J B;  1ISN A;  4FHJ A;  1E8X A;  1GUA B;  2KLG A;  3RUL A;  3PLV A;  1KLV A;  1EUV B;  2FUH B;  2K8B A;  4LDT D;  5G2N A;  4FA6 A;  4A3O A;  2N1W A;  2GMI C;  3L0W B;  1G6J A;  2MSE D;  5CX3 A;  3HIZ A;  2LUE A;  3RT3 B;  2N7E A;  2NBU A;  1CMX B;  2D10 A;  1WE6 A;  4G3X B;  5D94 A;  4K81 A;  3V6C B;  2J0K A;  2KQS A;  1UD7 A;  3N3K B;  2K1F A;  1LM8 B;  2GBM A;  2JT4 B;  1R4N I;  2MBE A;  2MBB B;  1NI2 A;  4TUU A;  4E71 A;  2OOB B;  4WJP A;  4FLH A;  2KTF A;  3VH4 B;  2D07 B;  2L05 A;  2M1M A;  1UBI A;  1TZ1 A;  1P1A A;  2XEW A;  1WR1 A;  2KC2 A;  3UGB B;  1V86 A;  1YX5 B;  2MBQ A;  3KYC D;  4GDL B;  4NPN A;  2JWZ A;  2R2O A;  3DVG X;  3APD A;  5FR6 A;  4WWO A;  3BY4 B;  2LRW A;  3PTF C;  3ZTC A;  1JRU A;  1WY8 A;  3WAP A;  2V4L A;  3V6E B;  3ZIM A;  2MBH A;  4K7S A;  1V81 A;  4HDO A;  2N1V A;  4FAD A;  3DBS A;  1I35 A;  2EMS A;  3QC8 B;  4W9K A;  2OJR A;  1V5O A;  3U30 A;  4HCN B;  4A3P A;  2KO3 A;  2KX3 A;  1SGH A;  3KW5 B;  4W9E A;  3IVF A;  4NAW A;  3VTU A;  2GBR A;  4W9L A;  5E6N A;  4A20 A;  2L0T A;  4JIO U;  4BKS D;  4MJS B;  2LAS A;  5DPT A;  2BF8 B;  2Y5B B;  1GNU A;  2ZJD A;  3VUX A;  2WYQ A;  4KIK B;  1WJ6 A;  2UWQ A;  2ZZP B;  1WZ3 A;  2LI5 A;  3B1L X;  5G55 A;  4FJV B;  1YX6 B;  2CHZ A;  3A1Q B;  4ANU A;  3DPD A;  3U8Z A;  3PRM B;  3SU8 X;  3IFW B;  2FCQ A;  4J6I A;  1FXT B;  3BIN A;  1AAR A;  1L7Y A;  5IAA C;  3VUY A;  4DDG D;  3R7R A;  2N9E B;  3AU5 A;  1XQQ A;  5CHV C;  3KYD D;  2RPQ A;  4WJO A;  4AOF A;  4EZK A;  5KHQ A;  5DPR A;  4I6L B;  3QX1 A;  3DVN V;  4ZDV A;  4AP4 C;  5L95 C;  4EZJ A;  3P2B A;  1EO6 A;  5DCN A;  4BFR A;  1E8W A;  2O2V B;  3Q3F A;  3UQA A;  4TQ1 A;  4DXA B;  1WGY A;  3KH0 A;  4G0N B;  3VH3 B;  3N32 A;  1R4M I;  3DBR I;  1GG3 A;  3JSV A;  1BT0 A;  1ZKH A;  3ONS A;  3W1Y A;  3H1U A;  1WRD B;  2JXX A;  1E5W A;  4FHK A;  1PQS A;  2KJ6 A;  4M8N A;  4CYE A;  2A4Z A;  3ZVV A;  4MGZ E;  3SD5 A;  1WZ0 A;  2XBB C;  2CU1 A;  3PRP B;  2AEH A;  1OQY A;  2ZNV B;  4WAA A;  1V6E A;  3TL5 A;  2KX0 A;  4BVU C;  2JPH A;  1S1Q B;  3ZKJ C;  3EFU A;  2IY0 B;  5LXH A;  3VFK A;  2KD0 A;  2WX1 A;  3DDC B;  2EKE C;  1TGZ B;  2KQ7 A;  2PE9 A;  2KK8 A;  3N30 A;  4IG7 B;  3X23 A;  2KWU B;  2ZPN A;  1OTR B;  2D3G A;  2DZJ A;  2DZK A;  5GMV A;  2DX5 B;  2DZI A;  1WGG A;  1KM7 A;  1VD2 A;  5AZH A;  2FCS A;  3UQB A;  3UIN B;  2GBK A;  5JHA A;  3A33 B;  1S3S G;  2HD5 B;  3JSV B;  3K9P B;  4K1R B;  4KSL C;  5AZG A;  2FNJ B;  3ZNG C;  4GDK B;  1NBF C;  2KWC A;  3DQV A;  2NBW B;  2VRR B;  1P9D U;  1OGW A;  3W1S A;  4W9D A;  3O65 B;  3V62 A;  1Q5W B;  4G50 A;  5LXI B;  1RAX A;  4EOY A;  2M4N A;  5AZF A;  1WGD A;  3VAW A;  4F8C B;  1ZW7 A;  2IZV B;  1WXA A;  3PHW B;  4AWJ A;  5DPS A;  2KWV B;  2O6V D;  1WXV A;  3A4R A;  3Q3J A;  3MHS D;  5CTR C;  2FCM A;  2KC1 A;  1H4R A;  2V1Y A;  4B9K A;  1SIF A;  4MH0 E;  2CR5 A;  2I1J A;  3PV1 A;  3QHT A;  4KDL B;  3AUL A;  4W9F A;  2QHO A;  3JW0 X;  3M95 A;  3RZW C;  3QJZ A;  3WAM A;  3CSF A;  2PE6 B;  4BBN F;  5IA7 A;  2NPT B;  3V60 A;  3RD2 A;  2HE7 A;  5JHB A;  1YJ1 A;  1LFD A;  1P3Q U;  5E6P A;  1X1M A;  2JZZ A;  2GOW A;  2BGF A;  2KJH B;  2KDI A;  3QWZ B;  3NOB A;  2NBV B;  4ICU A;  2KMC A;  4YL8 A;  4DBG A;  1L2N A;  3R66 C;  3M63 B;  2BKF A;  2PPH A;  2WDT B;  3QAQ A;  4ZRJ A;  1H8C A;  3T8M A;  3L08 A;  3ENE A;  2IBI B;  1M94 A;  3ZNH B;  1E90 A;  4IM2 A;  2LVO A;  4EKU A;  2LRU A;  1T0Y A;  2C7H A;  4RMA A;  1WR6 E;  4GIV A;  3APF A;  3L10 B;  4IW0 A;  2AYO B;  5EDS A;  4IWQ A;  1KJT A;  3D32 A;  3KUZ A;  4LJP B;  2A5U A;  4ANV A;  3UIP B;  4B6W A;  3DOW A;  3NZU A;  5CHF A;  1V5T A;  3L17 A;  3RZF A;  3RYT A;  4AUQ C;  2KAN A;  4DHJ D;  1UZX B;  4GU2 A;  5DPW A;  5J2R A;  2KOX A;  2KFK B;  3L16 A;  5KHO A;  5LLI A;  1WIA A;  4E3C A;  2LXC A;  4ICV A;  5J17 A;  4HWI B;  4FN2 A;  4IWP A;  3OLM D;  1A5R A;  3X0W A;  2ZVN A;  2YVC A;  3PRZ A;  4KSK C;  4IM3 A;  3A1Q A;  3PSE B;  4XZ4 A;  4ZYN A;  4AJY B;  1J19 A;  4GXB A;  3SHQ A;  1OEY J;  3QIJ A;  4GGQ A;  3ZRC A;  4GMV A;  2EMT A;  4EFO A;  1YIW A;  2G3Q B;  1LXD A;  3ZDM C;  3ZW3 A;  2KFK A;  1P98 A;  2RD0 A;  4CHK A;  2IO1 B;  3IHP C;  2XK5 A;  2MWS B;  2BWF A;  3HM3 A;  3EHV A;  1V9J A;  2CHW A;  2Z59 B;  2PEA A;  4ANX A;  1VCB A;  3ML8 A;  2I1K A;  2L3Z A;  3VXW A;  2ZEQ A;  2DHZ A;  2DAJ A;  1IPG A;  4MM3 A;  1V80 A;  3L54 A;  4B95 A;  4X57 B;  2N9X A;  2BYV E;  2LVP A;  3CF6 E;  3U7D A;  2L8J A;  3M3J A;  4IWO A;  2O6V A;  3A4S C;  2NCN A;  3QCA A;  1C3T A;  2FID A;  2KZR A;  1UEL A;  1WJU A;  3PT2 B;  1Y8R C;  2KNB A;  3DBL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...