2RTBB

Apostreptavidin, ph 3.32, space group i222
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 25
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2rtbB00
2RTLA 3RDUA 1STPA 1SWNA 2CAMA 2RTDB 3X00A 4JHQA 1STRB 1NQMA 1VWBB 2IZJA 1WBIA 5IRWA 4BBOA 2F01A 2RTEB 1HXZA 1VWDB 3SZIA 1HQQA 2IZAA 1KFFA 3VHIA 4Z28A 2RTFB 2RTKA 1N9YA 1SRGA 1VWAB 1DF8A 3PK2A 1SLFB 1SWLA 4Z27A 2RTOB 3RDMA 1SLEB 1SWEA 1Y53X 2OFBA 1VWFB 3RDSA 4YVBA 3T6LA 1MM9A 2IZKA 5IRUA 5CHKA 1MOYA 3MG5A 3T2XA 4Z6JA 1LCZA 2IZCB 4BX6B 2JGSA 2UYWA 1VWPB 1PTSA 2UZ2A 2OFAA 1MEPA 2FHLA 2RTQB 2ZSCA 4BX6A 2RTRB 1VWMB 1N4JA 2A5CA 5F2BA 2A8GA 2FHNX 3WZOA 1SRFA 2Y3FA 1RSTB 4JNJA 3WYQA 2A5BA 1SWSA 2IZDB 1LCWA 1KL4A 1RAVA 2Y32A 4GD9A 2G5LA 1SWDA 5L3YA 5K68A 2QCBA 3RDXA 1VWNB 1KL5A 1NDJA 3T2WA 4CPFA 2RTGB 2RTNB 1VWJB 2RTHB 4IRWA 3T6FA 1VWKB 3RY2A 3RE6A 1VWGB 1LELA 2IZGB 1VWQB 1SRHA 1LUQA 1SWFA 1VWIB 1RSUB 1RXHA 2AVIA 1VWRB 2RTAA 5B5GA 1N9MA 1SLGB 3RY1A 3EW2A 2WPUA 2RTMA 1N7YA 4GDAA 4BCSA 3VHHA 4BX7B 3WZPA 1VWCB 1SRIA 4Y5DA 2GH7A 3FDCA 2OF8A 1RXKA 3WYPA 4BX7A 2MF6A 2IZHB 1SWOA 3MM0A 1SWJA 3WZNA 4CPIA 4DNEA 1I9HA 4GGTA 2C4IA 4I60A 4OKAA 1SWUA 2RTJA 2Y3EA 2RTBB 1N43A 3RE5A 4GGZA 4JO6A 1NQNA 1HY2A 1VWLB 2OF9A 3RDOA 1NBXA 1MK5A 1VYOA 1SWQA 1SWAA 4GJVA 1SLDB 2RTCB 3RDQA 1LDOA 4BJ8A 5CSEA 2C1QA 1VWHB 4BX5B 4CPEA 2IZIA 5B5FA 2BC3A 1HXLA 4GJSA 4Z2PA 5IRAA 1RXJA 1LDQA 1SWTA 1KL3A 1SWGA 1SWCA 4U46A 4BX5A 3VGWA 1VWEB 3SZJA 1Y52X 1IJ8A 2RTIB 1SWBA 4CPHB 5JD2A 1AVDA 4Y59A 1SWPA 2IZLB 4Z2OA 1Y55X 2C1SA 3EW1A 2IZBA 4EKVA 2IZFB 4Z2VA 3VHMA 1SREA 5K67A 1AVEA 4CPHA 1NC9A 1LCVA 1SWKA 1STSB 2IZEB 1SWHA 2RTPB 3WZQA 1VWOB 4GGRA 1SWRA 1SRJA 3SZHA
chains in the Genus database with same CATH superfamily
1TW4A 3EMMA 4I3BA 3RDUA 1B8EA 1SXXA 4ALOA 2CAMA 5EPQA 1X8OA 1X8UA 1K3BA 2JW1A 5LKEA 4YKMA 3AUMO 3OD9A 3UEVA 4ZHFA 3P6HA 4ORUA 1X89A 1XKIA 3VG6A 4D6AA 3FIQA 1OBPA 1HXZA 1SY1A 2L9CA 3NP1A 4YGHA 5AQ6A 3AEHA 2BSZA 4ORRA 5H9AA 4AZPA 3VHIA 4TKHA 1X8QA 4Z28A 1OEKA 2RTKA 1N9YA 2O62A 1SRGA 4KC8A 3SAOA 3BY0A 4EDEA 1ML7A 3JQOA 2NNDA 2ALLX 3BDRA 1D2UA 2OVSA 4Z27A 4QYNA 3DTQA 1Y53X 2DJFA 1LNMA 3PP6A 2DJGA 2X56A 3C78X 1KZWA 3ZUOA 3NX2A 4BX6B 3VU1A 2KTSA 2FR3A 4ZH6A 1PTSA 4AW8A 1Z24A 2BS5A 3HWGA 2IFBA 2RTRB 4QZUA 3P6EA 3TF6A 1JJXA 2A5CA 2BLGA 2WSJA 2YG2A 2FHNX 2ZAGA 3EBWA 3FLLA 1QG5A 5F2BA 3WZOA 2RCTA 4MVKA 5H9LA 2WEXA 2IZDB 3APUA 1LIEA 4FGIB 4GD9A 4HPCA 4PJ2A 1ICMA 5JR8A 1SWDA 2QCBA 3RDXA 4O4UA 4IB7A 3JS1A 2BT9A 1DFVA 1AQBA 1GT1A 2RTGB 4MEEA 3DSZA 2AT5X 2QOSC 3SLTA 1YIVA 3CQRA 4IRWA 2LBVA 4EQAC 5FENA 4IAXA 4U8UO 3PH6A 1KGLA 5C0NA 2RQ0A 3RE6A 2IZGB 1UREA 3EC5A 3KFFA 4NYRA 1W6FA 1I04A 5H8TA 1RXHA 1G74A 4YFRA 1SLGB 1TOUA 5B29A 1FE3A 2AH7X 3BLGA 1ZNEA 2WPUA 3ZQ3A 4GDAA 3ZWEA 1KZXA 3VHHA 3APWA 4O9SA 3PQSA 4Y5DA 5DPQA 2GC9A 5EDBA 2WQ9A 4BX7A 2CBRA 2WEWA 2A2GA 1SWJA 3KVNA 3WZNA 1KOIA 2FGSA 4YGZA 4NNSA 4YFQA 2C4IA 2I5ZO 2W2FA 3CQNA 1IW2A 3KQ0A 1CBIA 4OS8A 4YMYA 1BWYA 4MVEA 1EIIA 2N93A 1N0SA 2L67A 5LJKA 4JO6A 1NQNA 1HY2A 5B11O 4CDEA 2Q4NA 1CJ5A 2LKKA 1NBXA 1MK5A 2AT0X 3EYCA 2OZQA 1GM6A 1NP1A 4XMHA 2JU3A 4QAEA 1LDOA 4GNYA 4BJ8A 1QABE 1GKAA 2NNQA 2IZIA 2P8GA 3KFIA 4L3RA 2WQAE 2AT8X 3TZSA 3HOLA 1FDQA 1SWTA 4BX5A 1GXAA 1KL3A 1L6MA 1SWGA 1CBSA 2LFOA 1LICA 1YWCA 3QKGA 4QZTA 3V8UA 4O49A 1IKEA 5HCCC 4I6SA 3D96A 2RTIB 1YWDA 3VPJE 3ELXA 1AVDA 5AJCA 2VFBA 4Y59A 5F58A 4XMEA 5L8NA 1Y55X 3EW1A 5K67A 2JU7A 1MVGA 2IZFB 1JJUA 3S5VA 3VHMA 2GTLO 4EKVA 1K24A 1AB0A 1E02A 3VG7A 2QO5A 2G8CO 5F1EA 1DZKA 1ERBA 2OL8O 4NP1A 3D97A 3JSQA 3OE3A 2RTPB 2JMBA 4BVMA 1VWOB 1EQDA 3ZW0A 3SZHA 2HMBA 1JYJA 4IB6A 2NNEA 3CMPA 1X71A 1Y0GA 4MVIA 1YP7A 4A8ZA 5B10O 3NQ3A 4NLJA 2KT4B 3VG4A 3X00A 4TLJA 1STRB 4A60A 2IZJA 2X34A 1WBIA 2WUTA 3OJYC 4OS3A 1B4MA 3PH5A 1I06A 4A1YA 3SLJA 4OS0A 1EW3A 2OFRX 4QNIA 4ON1A 3WOVA 4BGFA 1VWDB 3SZIA 2K62A 1BBPA 3FA7A 2HNXA 1ZNLA 1UZ2X 2QO6A 2R73A 2RTFB 2NP1A 2CM9A 4K19A 4Y0PA 1Y9TA 4KT5A 3ZW1B 1VPRA 1RBPA 1BM5A 4WBKA 1KT4A 1KT3A 3FR2A 4INNA 3PK2A 5HTEA 1D3SA 2HZRA 4YGGA 1SWEA 2ASNX 1JQPA 2OFBA 3PECA 3T6LA 4CDCA 1MM9A 1UYOX 1X8PA 2JOZA 3S60A 1MOYA 2RN4A 4I9SA 1WUBA 3T2XA 3HWDA 2Q39A 4GNWA 5H9KA 1RLBE 1DC9A 4WFUA 1QY0A 1VWPB 5LJGA 1MEPA 2X8SA 1OPBA 1VWMB 4Y0SA 4ORWA 3TGBA 1BRPA 2FTBA 3FW4A 1RSTB 4JNJA 1NGLA 5BVSA 3RKGA 3MBTA 3LTWA 1H91A 4QRLA 1RAVA 2Y32A 5HA0A 2GTLM 5L8OA 3L4RA 1T8VA 2R74A 4CK4A 1VWNB 4O4SA 1KL5A 3O2YA 1IFCA 2RTNB 1HN2A 1DF3A 2FLJA 2G78A 4ALBA 1PBYA 4MVLA 1LELA 1VWGB 1E2TA 1S44A 1SRHA 1ALBA 1VWQB 1SXUA 2MJIA 1RSUB 2HKDA 3P6GA 4GH7A 5HCEC 1XCAA 3HWEA 1E00A 5B5GA 4ZFXA 1U17A 1OSPO 1UYNX 3BX8A 3FR4A 3EW2A 3H3IA 3HOEA 2RTMA 1N7YA 2OL7A 3FEKA 4M7MA 3RWXA 5CE4A 3WZPA 4AZMA 2BHVA 1G5WA 3HK1A 3UAQA 2GH7A 3FDCA 1DZPA 1MDCA 2Q2MA 4GE1A 1RXKA 3SOTA 2MF6A 2IZHB 1GX8A 5D4AA 4CPIA 2FKJA 2X46A 1OEEA 1TXLA 1ZNKA 2Z4IA 3CBCA 1JMZA 4FQBB 1IFBA 4GGTA 5EEEA 4OKAA 3WJCA 5H9NA 5LJCA 1QFVA 3IFBA 4ZR2A 4IBAA 2RTBB 2ZAIA 3I17A 4GGZA 1GX9A 4KH8A 2OFMX 3HPEA 2OF9A 2POAA 5EZ2A 4NNTA 4GJVA 1SLDB 2XKLA 3ZZVA 3RDQA 3STKA 2EU7X 3O22A 2C1QA 4O4XA 5CSEA 2A13A 4DQ3A 5KHPA 3WXQA 1GT4A 2QM9A 5FFHA 4WFVA 5HAEA 3VG3A 2F09A 1KQXA 2A3FX 3GAQA 2MWHA 5FQ7E 5B5FA 4GJSA 1X8NA 4IB8A 5IRAA 2CBSA 1RXJA 1JJJA 1LIFA 3TGAA 4OELA 4FBRA 4XMCA 1VWEB 1Y52X 4CDFA 4ZJ0A 5LJHA 1MX8A 1SWBA 2Q9SA 4GU8A 4LKTA 5JD2A 4XMDA 3U9PC 4TNNA 3WJEA 4CPHB 4GDZA 4D6BA 1R0UA 1QWDA 1HMRA 2OYBO 4Z2VA 2FKGA 4L1NA 2Z4HA 1SREA 2XSTA 4DCBA 1KQWA 3NBXX 5HZ9A 4HWMA 4A1HA 1SWKA 1STSB 2LA7A 4CSBA 4Y0RA 2F73A 2IZEB 2LB6A 4NYQA 2X55A 4I3CA 3U0DA 4YDBA 3WZQA 5BVTA 1EIOA 1MX7A 1SWRA 2Y3FA 2MM3A 3LHNA 3C77X 4TKBA 2ANSA 1STPA 4GETA 3MX7A 1A57A 2HYSA 2RTDB 3K3LA 2OVDA 1BEBA 4JHQA 4U3QA 1NQMA 3FMZA 2AKQA 2F01A 1DZJA 3VE1A 4HFOA 2YMSA 3HWFA 2RTEB 1BSOA 1A3YA 1EALA 4COTA 2IZAA 1JZUA 1PBOA 2QMIA 2R56A 1FELA 1DF8A 4QGVA 3E3CA 4ORXA 2DM5A 2CM4A 1E06A 1O8VA 2FWVA 2HZQA 1SWLA 3F9DA 4U8UN 1SLEB 1VWFB 2X8TA 4YVBA 4M6SA 4EXZA 4Y0QA 2HLVA 5CHKA 1YP6A 1O1VA 2ACPX 3MG5A 4I9RA 3FELA 1YUPA 1ZNHA 2IZCB 2JGSA 4AZNA 2AT6X 2UYWA 2UZ2A 2FHLA 2RTQB 2ZSCA 5F7GA 4TQ2A 4BX6A 1N4JA 2KTDA 3BSZE 3ELZA 3KZAA 2A8GA 4UU3A 1OBUA 2AMMX 2JU8A 3F6ZB 1JYDA 1QY2A 1QFTA 4YBUA 5LJDA 1KL4A 2L5PA 1GT5A 5L3YA 5K68A 1PMPA 3WJGA 4YFPA 4CPFA 1GT3A 5DG4A 3Q6LA 3BRNA 2FRSA 1BLRA 1EI5A 1JMXA 3BS2A 3G7XA 4GZVA 4OEMA 3RY2A 2KD2A 3VG2A 1SY3A 1SWFA 1VWIB 2G7BA 5IO6A 1T68X 1BSYA 1DZMA 2RTAA 1OPAA 4IMOA 1LIDA 2OVAA 2X8FA 2L68A 4BX7B 3GE2A 3RZYA 1G85A 1VWCB 3ZUIA 1SRIA 4TKJA 1A18A 3FA6A 4RUNA 5CYBA 3PPTA 2BS6A 2OF8A 3WYPA 1PEEA 4ZHCA 3MM0A 3U03A 2WR6A 4ZHHA 5HBSA 4DNEA 1I9HA 1I05A 2FT9A 4I60A 4YH0A 3S5XA 2AF5A 2Y3EA 5D48A 2FS7A 1LPJA 4ID2A 1N43A 1JIWI 1FENA 3RE5A 3BX7A 1HQPA 4ES7A 4ZHDA 1VWLB 3NR3A 5F6ZA 1AVGI 1BJ7A 2VDFA 1HMSA 2WWPA 4GRJA 1SWQA 1GKAB 1P6PA 1SWAA 2RTCB 1SA8A 5D45A 1IIUA 1VYFA 5FAZA 4O4OA 3APVA 4GUZA 1VWHB 4AYHA 3PEDA 4BX5B 5BVQA 1YWBA 4CPEA 5HZ6A 4QYPA 1HXLA 3TGCA 1EPBA 2LBAA 4MIRA 1LKEA 1S7DA 4ZGUA 1SWCA 4GK9A 3VG5A 1FJ1E 1LIBA 3VGWA 1ZRYA 2X4MA 3EM0A 4UU2A 1ZNDA 1IJ8A 3WVMA 4ZGFA 3OBLA 4ARHA 4BOEA 3Q34A 1SWPA 2IZLB 1W5RA 5LJEA 3MVFA 1FTPA 2C1SA 4NV7A 4YBPA 1AVEA 5HZQA 3STNA 1LCVA 5FQ8E 4B55A 1LF7A 1KT6A 3ZW0B 4ML7B 2PY1A 5EDCA 1SWHA 1QQSA 4GKCA 3ZW2A 2MHDA 3NADA 4FBOA 5AEOA 1SRJA 4HPDA 5HZ5A 4N7CA 1EXSA 2K23A 4I3DA 4KC7A 3FR5A 4QGXA 2RTLA 4HPBA 4DQ4A 3B2LA 1SWNA 1W4TA 3CWKA 3BU9A 4O3ZA 3WJFA 4EEJA 3FENA 3STMX 2GJ5A 1VWBB 3FA8A 4CV7A 5IO5A 4R0BA 5IRWA 4NLIA 1EPAA 4BBOA 1DV9A 1CRBA 2A2UA 1GX3A 3AKNA 3I0AA 3WBGA 4AZQA 4LZVA 1ERXA 2AT3X 2FR2A 1HQQA 3PQUA 3HTYA 4O3YA 1KFFA 1JBHA 4NW4A 3D9WA 2E4JA 3F8AA 3UEWA 2W2BA 1TOWA 1VWAB 1I4UA 2ACOA 3FYFA 4QGWA 3ZW1A 5IXGA 1EUOA 1SY0A 1SLFB 3NQ9A 1KT5A 3P24A 2KW1A 4C5PA 4CDDA 2RTOB 5D8JA 3RDMA 3AKMA 2RA6A 3RDSA 1ZNGA 3O19A 4AZOA 1SXWA 1LFOA 2IZKA 5IRUA 4IABA 4ZCBA 3RBYA 1NP4A 2A0AA 4Z6JA 2RD7C 1LCZA 2JN3A 1T0VA 3VE2A 1VYGA 2QO4A 5KIDA 1A2DA 1TVQA 3QQ2A 2OFAA 2CZTA 2X45A 4ZH9A 3D95A 3P02A 5KICA 3FIDA 3UEXA 1CBRA 3BU1A 1OBQA 3IA8A 3FA9A 4ORSA 1SRFA 2M4LA 4XMGA 3WYQA 5B3MO 1ACDA 1GGLA 3B2JA 2A5BA 1SWSA 2OY5O 5HTDA 1LCWA 1S2PA 4WHIA 2G5LA 5B2AO 1SXYA 3KFHA 1U0XA 1IKJA 3N91A 1NDJA 3T2WA 4YDAA 1VWJB 2RTHB 2FS6A 5LJBA 3T6FA 3CR6A 1VWKB 3CKFA 1KT7A 1LUQA 1KXOA 1B56A 1SY2A 4I95A 5B27A 3B2KA 4OMWA 2AVIA 1VWRB 4LZUA 4IAWA 1N9MA 4YCEA 1B0OA 3RY1A 1SMPI 3NX1A 3FW5A 5HWZA 1FEMA 4ODDA 4BCSA 5EEDA 3LV4A 5IO7A 4TJZA 4ORYA 1AELA 1ICNA 5FQ6E 4PSQA 5LKFA 1U18A 3D4RA 2CZUA 5AJBA 4EFGA 1G7NA 1SWOA 2G79A 2OVEA 3RSWA 1SWUA 2RTJA 2W2AA 2MO5A 3NPOA 1YWAA 3NQKA 2I5VO 4LQZA 3T1DA 2VFCA 1MUPA 2QOMA 4KIIA 4HPAA 4FBVA 3RDOA 1Y9LA 1VYOA 4U8UM 1E5PA 1HBQA 5F6BA 4BQUA 3WJDA 2OY7A 2RCQA 5BYPA 3EBKA 5K06A 4MISA 3ZI8A 5HCDC 3C76X 4IB9A 1BSQA 2Q2PA 1HMTA 1OEJA 2BC3A 3B2HA 4O3XB 4O3WA 4YCHA 4Z2PA 1I78A 1LDQA 2X32A 4U46A 1JV4A 4KCAA 5L8IA 4AZRA 2OY8A 3CBSA 4ZHGA 3PDFA 4JGLA 5HA1A 1CBQA 3SZJA 2AL0X 1HBPA 1O1UA 4N7DA 3CKGA 4QQ1A 1ADLA 4Z2OA 4LKPA 4U9CA 4YKOA 2IZBA 1BRQA 2GTFX 4RUUA 3WJBA 3P6DA 1PM1X 3B2IA 3S26A 1NC9A 2GTLN 4IMNA 4CPHA 2OL6O 2OY1O 3FEPA 3KFGA 4NV8A 4XMFA 1QY1A 5D47A 3P6FA 3P6CA 3UEUA 5HZ8A 3SLOA 3APXA 4GGRA 2PI3O 4OMXA
chains in the Genus database with same CATH topology
2RTLA 3RDUA 1STPA 1SWNA 2CAMA 2RTDB 3X00A 4JHQA 1STRB 1NQMA 1VWBB 2IZJA 1WBIA 5IRWA 4BBOA 2F01A 2RTEB 1HXZA 1VWDB 3SZIA 1HQQA 2IZAA 1KFFA 3VHIA 4Z28A 2RTFB 2RTKA 1N9YA 1SRGA 1VWAB 1DF8A 3PK2A 1SLFB 1SWLA 4Z27A 2RTOB 3RDMA 1SLEB 1SWEA 1Y53X 2OFBA 1VWFB 3RDSA 4YVBA 3T6LA 1MM9A 2IZKA 5IRUA 5CHKA 1MOYA 3MG5A 3T2XA 4Z6JA 1LCZA 2IZCB 4BX6B 2JGSA 2UYWA 1VWPB 1PTSA 2UZ2A 2OFAA 1MEPA 2FHLA 2RTQB 2ZSCA 4BX6A 2RTRB 1VWMB 1N4JA 2A5CA 5F2BA 2A8GA 2FHNX 3WZOA 1SRFA 2Y3FA 1RSTB 4JNJA 3WYQA 2A5BA 1SWSA 2IZDB 1LCWA 1KL4A 1RAVA 2Y32A 4GD9A 2G5LA 1SWDA 5L3YA 5K68A 2QCBA 3RDXA 1VWNB 1KL5A 1NDJA 3T2WA 4CPFA 2RTGB 2RTNB 1VWJB 2RTHB 4IRWA 3T6FA 1VWKB 3RY2A 3RE6A 1VWGB 1LELA 2IZGB 1VWQB 1SRHA 1LUQA 1SWFA 1VWIB 1RSUB 1RXHA 2AVIA 1VWRB 2RTAA 5B5GA 1N9MA 1SLGB 3RY1A 3EW2A 2WPUA 2RTMA 1N7YA 4GDAA 4BCSA 3VHHA 4BX7B 3WZPA 1VWCB 1SRIA 4Y5DA 2GH7A 3FDCA 2OF8A 1RXKA 3WYPA 4BX7A 2MF6A 2IZHB 1SWOA 3MM0A 1SWJA 3WZNA 4CPIA 4DNEA 1I9HA 4GGTA 2C4IA 4I60A 4OKAA 1SWUA 2RTJA 2Y3EA 2RTBB 1N43A 3RE5A 4GGZA 4JO6A 1NQNA 1HY2A 1VWLB 2OF9A 3RDOA 1NBXA 1MK5A 1VYOA 1SWQA 1SWAA 4GJVA 1SLDB 2RTCB 3RDQA 1LDOA 4BJ8A 5CSEA 2C1QA 1VWHB 4BX5B 4CPEA 2IZIA 5B5FA 2BC3A 1HXLA 4GJSA 4Z2PA 5IRAA 1RXJA 1LDQA 1SWTA 1KL3A 1SWGA 1SWCA 4U46A 4BX5A 3VGWA 1VWEB 3SZJA 1Y52X 1IJ8A 2RTIB 1SWBA 4CPHB 5JD2A 1AVDA 4Y59A 1SWPA 2IZLB 4Z2OA 1Y55X 2C1SA 3EW1A 2IZBA 4EKVA 2IZFB 4Z2VA 3VHMA 1SREA 5K67A 1AVEA 4CPHA 1NC9A 1LCVA 1SWKA 1STSB 2IZEB 1SWHA 2RTPB 3WZQA 1VWOB 4GGRA 1SWRA 1SRJA 3SZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RTL A;  3RDU A;  1STP A;  1SWN A;  2CAM A;  2RTD B;  3X00 A;  4JHQ A;  1STR B;  1NQM A;  1VWB B;  2IZJ A;  1WBI A;  5IRW A;  4BBO A;  2F01 A;  2RTE B;  1HXZ A;  1VWD B;  3SZI A;  1HQQ A;  2IZA A;  1KFF A;  3VHI A;  4Z28 A;  2RTF B;  2RTK A;  1N9Y A;  1SRG A;  1VWA B;  1DF8 A;  3PK2 A;  1SLF B;  1SWL A;  4Z27 A;  2RTO B;  3RDM A;  1SLE B;  1SWE A;  1Y53 X;  2OFB A;  1VWF B;  3RDS A;  4YVB A;  3T6L A;  1MM9 A;  2IZK A;  5IRU A;  5CHK A;  1MOY A;  3MG5 A;  3T2X A;  4Z6J A;  1LCZ A;  2IZC B;  4BX6 B;  2JGS A;  2UYW A;  1VWP B;  1PTS A;  2UZ2 A;  2OFA A;  1MEP A;  2FHL A;  2RTQ B;  2ZSC A;  4BX6 A;  2RTR B;  1VWM B;  1N4J A;  2A5C A;  5F2B A;  2A8G A;  2FHN X;  3WZO A;  1SRF A;  2Y3F A;  1RST B;  4JNJ A;  3WYQ A;  2A5B A;  1SWS A;  2IZD B;  1LCW A;  1KL4 A;  1RAV A;  2Y32 A;  4GD9 A;  2G5L A;  1SWD A;  5L3Y A;  5K68 A;  2QCB A;  3RDX A;  1VWN B;  1KL5 A;  1NDJ A;  3T2W A;  4CPF A;  2RTG B;  2RTN B;  1VWJ B;  2RTH B;  4IRW A;  3T6F A;  1VWK B;  3RY2 A;  3RE6 A;  1VWG B;  1LEL A;  2IZG B;  1VWQ B;  1SRH A;  1LUQ A;  1SWF A;  1VWI B;  1RSU B;  1RXH A;  2AVI A;  1VWR B;  2RTA A;  5B5G A;  1N9M A;  1SLG B;  3RY1 A;  3EW2 A;  2WPU A;  2RTM A;  1N7Y A;  4GDA A;  4BCS A;  3VHH A;  4BX7 B;  3WZP A;  1VWC B;  1SRI A;  4Y5D A;  2GH7 A;  3FDC A;  2OF8 A;  1RXK A;  3WYP A;  4BX7 A;  2MF6 A;  2IZH B;  1SWO A;  3MM0 A;  1SWJ A;  3WZN A;  4CPI A;  4DNE A;  1I9H A;  4GGT A;  2C4I A;  4I60 A;  4OKA A;  1SWU A;  2RTJ A;  2Y3E A;  2RTB B;  1N43 A;  3RE5 A;  4GGZ A;  4JO6 A;  1NQN A;  1HY2 A;  1VWL B;  2OF9 A;  3RDO A;  1NBX A;  1MK5 A;  1VYO A;  1SWQ A;  1SWA A;  4GJV A;  1SLD B;  2RTC B;  3RDQ A;  1LDO A;  4BJ8 A;  5CSE A;  2C1Q A;  1VWH B;  4BX5 B;  4CPE A;  2IZI A;  5B5F A;  2BC3 A;  1HXL A;  4GJS A;  4Z2P A;  5IRA A;  1RXJ A;  1LDQ A;  1SWT A;  1KL3 A;  1SWG A;  1SWC A;  4U46 A;  4BX5 A;  3VGW A;  1VWE B;  3SZJ A;  1Y52 X;  1IJ8 A;  2RTI B;  1SWB A;  4CPH B;  5JD2 A;  1AVD A;  4Y59 A;  1SWP A;  2IZL B;  4Z2O A;  1Y55 X;  2C1S A;  3EW1 A;  2IZB A;  4EKV A;  2IZF B;  4Z2V A;  3VHM A;  1SRE A;  5K67 A;  1AVE A;  4CPH A;  1NC9 A;  1LCV A;  1SWK A;  1STS B;  2IZE B;  1SWH A;  2RTP B;  3WZQ A;  1VWO B;  4GGR A;  1SWR A;  1SRJ A;  3SZH A; 
#chains in the Genus database with same CATH topology
 1TW4 A;  3EMM A;  4I3B A;  3RDU A;  1B8E A;  1SXX A;  4ALO A;  2CAM A;  5EPQ A;  1X8O A;  1X8U A;  1K3B A;  2JW1 A;  5LKE A;  4YKM A;  3AUM O;  3OD9 A;  3UEV A;  4ZHF A;  3P6H A;  4ORU A;  1X89 A;  1XKI A;  3VG6 A;  4D6A A;  3FIQ A;  1OBP A;  1HXZ A;  1SY1 A;  2L9C A;  3NP1 A;  4YGH A;  5AQ6 A;  3AEH A;  2BSZ A;  4ORR A;  5H9A A;  4AZP A;  3VHI A;  4TKH A;  1X8Q A;  4Z28 A;  1OEK A;  2RTK A;  1N9Y A;  2O62 A;  1SRG A;  4KC8 A;  3SAO A;  3BY0 A;  4EDE A;  1ML7 A;  3JQO A;  2NND A;  2ALL X;  3BDR A;  1D2U A;  2OVS A;  4Z27 A;  4QYN A;  3DTQ A;  1Y53 X;  2DJF A;  1LNM A;  3PP6 A;  2DJG A;  2X56 A;  3C78 X;  1KZW A;  3ZUO A;  3NX2 A;  4BX6 B;  3VU1 A;  2KTS A;  2FR3 A;  4ZH6 A;  1PTS A;  4AW8 A;  1Z24 A;  2BS5 A;  3HWG A;  2IFB A;  2RTR B;  4QZU A;  3P6E A;  3TF6 A;  1JJX A;  2A5C A;  2BLG A;  2WSJ A;  2YG2 A;  2FHN X;  2ZAG A;  3EBW A;  3FLL A;  1QG5 A;  5F2B A;  3WZO A;  2RCT A;  4MVK A;  5H9L A;  2WEX A;  2IZD B;  3APU A;  1LIE A;  4FGI B;  4GD9 A;  4HPC A;  4PJ2 A;  1ICM A;  5JR8 A;  1SWD A;  2QCB A;  3RDX A;  4O4U A;  4IB7 A;  3JS1 A;  2BT9 A;  1DFV A;  1AQB A;  1GT1 A;  2RTG B;  4MEE A;  3DSZ A;  2AT5 X;  2QOS C;  3SLT A;  1YIV A;  3CQR A;  4IRW A;  2LBV A;  4EQA C;  5FEN A;  4IAX A;  4U8U O;  3PH6 A;  1KGL A;  5C0N A;  2RQ0 A;  3RE6 A;  2IZG B;  1URE A;  3EC5 A;  3KFF A;  4NYR A;  1W6F A;  1I04 A;  5H8T A;  1RXH A;  1G74 A;  4YFR A;  1SLG B;  1TOU A;  5B29 A;  1FE3 A;  2AH7 X;  3BLG A;  1ZNE A;  2WPU A;  3ZQ3 A;  4GDA A;  3ZWE A;  1KZX A;  3VHH A;  3APW A;  4O9S A;  3PQS A;  4Y5D A;  5DPQ A;  2GC9 A;  5EDB A;  2WQ9 A;  4BX7 A;  2CBR A;  2WEW A;  2A2G A;  1SWJ A;  3KVN A;  3WZN A;  1KOI A;  2FGS A;  4YGZ A;  4NNS A;  4YFQ A;  2C4I A;  2I5Z O;  2W2F A;  3CQN A;  1IW2 A;  3KQ0 A;  1CBI A;  4OS8 A;  4YMY A;  1BWY A;  4MVE A;  1EII A;  2N93 A;  1N0S A;  2L67 A;  5LJK A;  4JO6 A;  1NQN A;  1HY2 A;  5B11 O;  4CDE A;  2Q4N A;  1CJ5 A;  2LKK A;  1NBX A;  1MK5 A;  2AT0 X;  3EYC A;  2OZQ A;  1GM6 A;  1NP1 A;  4XMH A;  2JU3 A;  4QAE A;  1LDO A;  4GNY A;  4BJ8 A;  1QAB E;  1GKA A;  2NNQ A;  2IZI A;  2P8G A;  3KFI A;  4L3R A;  2WQA E;  2AT8 X;  3TZS A;  3HOL A;  1FDQ A;  1SWT A;  4BX5 A;  1GXA A;  1KL3 A;  1L6M A;  1SWG A;  1CBS A;  2LFO A;  1LIC A;  1YWC A;  3QKG A;  4QZT A;  3V8U A;  4O49 A;  1IKE A;  5HCC C;  4I6S A;  3D96 A;  2RTI B;  1YWD A;  3VPJ E;  3ELX A;  1AVD A;  5AJC A;  2VFB A;  4Y59 A;  5F58 A;  4XME A;  5L8N A;  1Y55 X;  3EW1 A;  5K67 A;  2JU7 A;  1MVG A;  2IZF B;  1JJU A;  3S5V A;  3VHM A;  2GTL O;  4EKV A;  1K24 A;  1AB0 A;  1E02 A;  3VG7 A;  2QO5 A;  2G8C O;  5F1E A;  1DZK A;  1ERB A;  2OL8 O;  4NP1 A;  3D97 A;  3JSQ A;  3OE3 A;  2RTP B;  2JMB A;  4BVM A;  1VWO B;  1EQD A;  3ZW0 A;  3SZH A;  2HMB A;  1JYJ A;  4IB6 A;  2NNE A;  3CMP A;  1X71 A;  1Y0G A;  4MVI A;  1YP7 A;  4A8Z A;  5B10 O;  3NQ3 A;  4NLJ A;  2KT4 B;  3VG4 A;  3X00 A;  4TLJ A;  1STR B;  4A60 A;  2IZJ A;  2X34 A;  1WBI A;  2WUT A;  3OJY C;  4OS3 A;  1B4M A;  3PH5 A;  1I06 A;  4A1Y A;  3SLJ A;  4OS0 A;  1EW3 A;  2OFR X;  4QNI A;  4ON1 A;  3WOV A;  4BGF A;  1VWD B;  3SZI A;  2K62 A;  1BBP A;  3FA7 A;  2HNX A;  1ZNL A;  1UZ2 X;  2QO6 A;  2R73 A;  2RTF B;  2NP1 A;  2CM9 A;  4K19 A;  4Y0P A;  1Y9T A;  4KT5 A;  3ZW1 B;  1VPR A;  1RBP A;  1BM5 A;  4WBK A;  1KT4 A;  1KT3 A;  3FR2 A;  4INN A;  3PK2 A;  5HTE A;  1D3S A;  2HZR A;  4YGG A;  1SWE A;  2ASN X;  1JQP A;  2OFB A;  3PEC A;  3T6L A;  4CDC A;  1MM9 A;  1UYO X;  1X8P A;  2JOZ A;  3S60 A;  1MOY A;  2RN4 A;  4I9S A;  1WUB A;  3T2X A;  3HWD A;  2Q39 A;  4GNW A;  5H9K A;  1RLB E;  1DC9 A;  4WFU A;  1QY0 A;  1VWP B;  5LJG A;  1MEP A;  2X8S A;  1OPB A;  1VWM B;  4Y0S A;  4ORW A;  3TGB A;  1BRP A;  2FTB A;  3FW4 A;  1RST B;  4JNJ A;  1NGL A;  5BVS A;  3RKG A;  3MBT A;  3LTW A;  1H91 A;  4QRL A;  1RAV A;  2Y32 A;  5HA0 A;  2GTL M;  5L8O A;  3L4R A;  1T8V A;  2R74 A;  4CK4 A;  1VWN B;  4O4S A;  1KL5 A;  3O2Y A;  1IFC A;  2RTN B;  1HN2 A;  1DF3 A;  2FLJ A;  2G78 A;  4ALB A;  1PBY A;  4MVL A;  1LEL A;  1VWG B;  1E2T A;  1S44 A;  1SRH A;  1ALB A;  1VWQ B;  1SXU A;  2MJI A;  1RSU B;  2HKD A;  3P6G A;  4GH7 A;  5HCE C;  1XCA A;  3HWE A;  1E00 A;  5B5G A;  4ZFX A;  1U17 A;  1OSP O;  1UYN X;  3BX8 A;  3FR4 A;  3EW2 A;  3H3I A;  3HOE A;  2RTM A;  1N7Y A;  2OL7 A;  3FEK A;  4M7M A;  3RWX A;  5CE4 A;  3WZP A;  4AZM A;  2BHV A;  1G5W A;  3HK1 A;  3UAQ A;  2GH7 A;  3FDC A;  1DZP A;  1MDC A;  2Q2M A;  4GE1 A;  1RXK A;  3SOT A;  2MF6 A;  2IZH B;  1GX8 A;  5D4A A;  4CPI A;  2FKJ A;  2X46 A;  1OEE A;  1TXL A;  1ZNK A;  2Z4I A;  3CBC A;  1JMZ A;  4FQB B;  1IFB A;  4GGT A;  5EEE A;  4OKA A;  3WJC A;  5H9N A;  5LJC A;  1QFV A;  3IFB A;  4ZR2 A;  4IBA A;  2RTB B;  2ZAI A;  3I17 A;  4GGZ A;  1GX9 A;  4KH8 A;  2OFM X;  3HPE A;  2OF9 A;  2POA A;  5EZ2 A;  4NNT A;  4GJV A;  1SLD B;  2XKL A;  3ZZV A;  3RDQ A;  3STK A;  2EU7 X;  3O22 A;  2C1Q A;  4O4X A;  5CSE A;  2A13 A;  4DQ3 A;  5KHP A;  3WXQ A;  1GT4 A;  2QM9 A;  5FFH A;  4WFV A;  5HAE A;  3VG3 A;  2F09 A;  1KQX A;  2A3F X;  3GAQ A;  2MWH A;  5FQ7 E;  5B5F A;  4GJS A;  1X8N A;  4IB8 A;  5IRA A;  2CBS A;  1RXJ A;  1JJJ A;  1LIF A;  3TGA A;  4OEL A;  4FBR A;  4XMC A;  1VWE B;  1Y52 X;  4CDF A;  4ZJ0 A;  5LJH A;  1MX8 A;  1SWB A;  2Q9S A;  4GU8 A;  4LKT A;  5JD2 A;  4XMD A;  3U9P C;  4TNN A;  3WJE A;  4CPH B;  4GDZ A;  4D6B A;  1R0U A;  1QWD A;  1HMR A;  2OYB O;  4Z2V A;  2FKG A;  4L1N A;  2Z4H A;  1SRE A;  2XST A;  4DCB A;  1KQW A;  3NBX X;  5HZ9 A;  4HWM A;  4A1H A;  1SWK A;  1STS B;  2LA7 A;  4CSB A;  4Y0R A;  2F73 A;  2IZE B;  2LB6 A;  4NYQ A;  2X55 A;  4I3C A;  3U0D A;  4YDB A;  3WZQ A;  5BVT A;  1EIO A;  1MX7 A;  1SWR A;  2Y3F A;  2MM3 A;  3LHN A;  3C77 X;  4TKB A;  2ANS A;  1STP A;  4GET A;  3MX7 A;  1A57 A;  2HYS A;  2RTD B;  3K3L A;  2OVD A;  1BEB A;  4JHQ A;  4U3Q A;  1NQM A;  3FMZ A;  2AKQ A;  2F01 A;  1DZJ A;  3VE1 A;  4HFO A;  2YMS A;  3HWF A;  2RTE B;  1BSO A;  1A3Y A;  1EAL A;  4COT A;  2IZA A;  1JZU A;  1PBO A;  2QMI A;  2R56 A;  1FEL A;  1DF8 A;  4QGV A;  3E3C A;  4ORX A;  2DM5 A;  2CM4 A;  1E06 A;  1O8V A;  2FWV A;  2HZQ A;  1SWL A;  3F9D A;  4U8U N;  1SLE B;  1VWF B;  2X8T A;  4YVB A;  4M6S A;  4EXZ A;  4Y0Q A;  2HLV A;  5CHK A;  1YP6 A;  1O1V A;  2ACP X;  3MG5 A;  4I9R A;  3FEL A;  1YUP A;  1ZNH A;  2IZC B;  2JGS A;  4AZN A;  2AT6 X;  2UYW A;  2UZ2 A;  2FHL A;  2RTQ B;  2ZSC A;  5F7G A;  4TQ2 A;  4BX6 A;  1N4J A;  2KTD A;  3BSZ E;  3ELZ A;  3KZA A;  2A8G A;  4UU3 A;  1OBU A;  2AMM X;  2JU8 A;  3F6Z B;  1JYD A;  1QY2 A;  1QFT A;  4YBU A;  5LJD A;  1KL4 A;  2L5P A;  1GT5 A;  5L3Y A;  5K68 A;  1PMP A;  3WJG A;  4YFP A;  4CPF A;  1GT3 A;  5DG4 A;  3Q6L A;  3BRN A;  2FRS A;  1BLR A;  1EI5 A;  1JMX A;  3BS2 A;  3G7X A;  4GZV A;  4OEM A;  3RY2 A;  2KD2 A;  3VG2 A;  1SY3 A;  1SWF A;  1VWI B;  2G7B A;  5IO6 A;  1T68 X;  1BSY A;  1DZM A;  2RTA A;  1OPA A;  4IMO A;  1LID A;  2OVA A;  2X8F A;  2L68 A;  4BX7 B;  3GE2 A;  3RZY A;  1G85 A;  1VWC B;  3ZUI A;  1SRI A;  4TKJ A;  1A18 A;  3FA6 A;  4RUN A;  5CYB A;  3PPT A;  2BS6 A;  2OF8 A;  3WYP A;  1PEE A;  4ZHC A;  3MM0 A;  3U03 A;  2WR6 A;  4ZHH A;  5HBS A;  4DNE A;  1I9H A;  1I05 A;  2FT9 A;  4I60 A;  4YH0 A;  3S5X A;  2AF5 A;  2Y3E A;  5D48 A;  2FS7 A;  1LPJ A;  4ID2 A;  1N43 A;  1JIW I;  1FEN A;  3RE5 A;  3BX7 A;  1HQP A;  4ES7 A;  4ZHD A;  1VWL B;  3NR3 A;  5F6Z A;  1AVG I;  1BJ7 A;  2VDF A;  1HMS A;  2WWP A;  4GRJ A;  1SWQ A;  1GKA B;  1P6P A;  1SWA A;  2RTC B;  1SA8 A;  5D45 A;  1IIU A;  1VYF A;  5FAZ A;  4O4O A;  3APV A;  4GUZ A;  1VWH B;  4AYH A;  3PED A;  4BX5 B;  5BVQ A;  1YWB A;  4CPE A;  5HZ6 A;  4QYP A;  1HXL A;  3TGC A;  1EPB A;  2LBA A;  4MIR A;  1LKE A;  1S7D A;  4ZGU A;  1SWC A;  4GK9 A;  3VG5 A;  1FJ1 E;  1LIB A;  3VGW A;  1ZRY A;  2X4M A;  3EM0 A;  4UU2 A;  1ZND A;  1IJ8 A;  3WVM A;  4ZGF A;  3OBL A;  4ARH A;  4BOE A;  3Q34 A;  1SWP A;  2IZL B;  1W5R A;  5LJE A;  3MVF A;  1FTP A;  2C1S A;  4NV7 A;  4YBP A;  1AVE A;  5HZQ A;  3STN A;  1LCV A;  5FQ8 E;  4B55 A;  1LF7 A;  1KT6 A;  3ZW0 B;  4ML7 B;  2PY1 A;  5EDC A;  1SWH A;  1QQS A;  4GKC A;  3ZW2 A;  2MHD A;  3NAD A;  4FBO A;  5AEO A;  1SRJ A;  4HPD A;  5HZ5 A;  4N7C A;  1EXS A;  2K23 A;  4I3D A;  4KC7 A;  3FR5 A;  4QGX A;  2RTL A;  4HPB A;  4DQ4 A;  3B2L A;  1SWN A;  1W4T A;  3CWK A;  3BU9 A;  4O3Z A;  3WJF A;  4EEJ A;  3FEN A;  3STM X;  2GJ5 A;  1VWB B;  3FA8 A;  4CV7 A;  5IO5 A;  4R0B A;  5IRW A;  4NLI A;  1EPA A;  4BBO A;  1DV9 A;  1CRB A;  2A2U A;  1GX3 A;  3AKN A;  3I0A A;  3WBG A;  4AZQ A;  4LZV A;  1ERX A;  2AT3 X;  2FR2 A;  1HQQ A;  3PQU A;  3HTY A;  4O3Y A;  1KFF A;  1JBH A;  4NW4 A;  3D9W A;  2E4J A;  3F8A A;  3UEW A;  2W2B A;  1TOW A;  1VWA B;  1I4U A;  2ACO A;  3FYF A;  4QGW A;  3ZW1 A;  5IXG A;  1EUO A;  1SY0 A;  1SLF B;  3NQ9 A;  1KT5 A;  3P24 A;  2KW1 A;  4C5P A;  4CDD A;  2RTO B;  5D8J A;  3RDM A;  3AKM A;  2RA6 A;  3RDS A;  1ZNG A;  3O19 A;  4AZO A;  1SXW A;  1LFO A;  2IZK A;  5IRU A;  4IAB A;  4ZCB A;  3RBY A;  1NP4 A;  2A0A A;  4Z6J A;  2RD7 C;  1LCZ A;  2JN3 A;  1T0V A;  3VE2 A;  1VYG A;  2QO4 A;  5KID A;  1A2D A;  1TVQ A;  3QQ2 A;  2OFA A;  2CZT A;  2X45 A;  4ZH9 A;  3D95 A;  3P02 A;  5KIC A;  3FID A;  3UEX A;  1CBR A;  3BU1 A;  1OBQ A;  3IA8 A;  3FA9 A;  4ORS A;  1SRF A;  2M4L A;  4XMG A;  3WYQ A;  5B3M O;  1ACD A;  1GGL A;  3B2J A;  2A5B A;  1SWS A;  2OY5 O;  5HTD A;  1LCW A;  1S2P A;  4WHI A;  2G5L A;  5B2A O;  1SXY A;  3KFH A;  1U0X A;  1IKJ A;  3N91 A;  1NDJ A;  3T2W A;  4YDA A;  1VWJ B;  2RTH B;  2FS6 A;  5LJB A;  3T6F A;  3CR6 A;  1VWK B;  3CKF A;  1KT7 A;  1LUQ A;  1KXO A;  1B56 A;  1SY2 A;  4I95 A;  5B27 A;  3B2K A;  4OMW A;  2AVI A;  1VWR B;  4LZU A;  4IAW A;  1N9M A;  4YCE A;  1B0O A;  3RY1 A;  1SMP I;  3NX1 A;  3FW5 A;  5HWZ A;  1FEM A;  4ODD A;  4BCS A;  5EED A;  3LV4 A;  5IO7 A;  4TJZ A;  4ORY A;  1AEL A;  1ICN A;  5FQ6 E;  4PSQ A;  5LKF A;  1U18 A;  3D4R A;  2CZU A;  5AJB A;  4EFG A;  1G7N A;  1SWO A;  2G79 A;  2OVE A;  3RSW A;  1SWU A;  2RTJ A;  2W2A A;  2MO5 A;  3NPO A;  1YWA A;  3NQK A;  2I5V O;  4LQZ A;  3T1D A;  2VFC A;  1MUP A;  2QOM A;  4KII A;  4HPA A;  4FBV A;  3RDO A;  1Y9L A;  1VYO A;  4U8U M;  1E5P A;  1HBQ A;  5F6B A;  4BQU A;  3WJD A;  2OY7 A;  2RCQ A;  5BYP A;  3EBK A;  5K06 A;  4MIS A;  3ZI8 A;  5HCD C;  3C76 X;  4IB9 A;  1BSQ A;  2Q2P A;  1HMT A;  1OEJ A;  2BC3 A;  3B2H A;  4O3X B;  4O3W A;  4YCH A;  4Z2P A;  1I78 A;  1LDQ A;  2X32 A;  4U46 A;  1JV4 A;  4KCA A;  5L8I A;  4AZR A;  2OY8 A;  3CBS A;  4ZHG A;  3PDF A;  4JGL A;  5HA1 A;  1CBQ A;  3SZJ A;  2AL0 X;  1HBP A;  1O1U A;  4N7D A;  3CKG A;  4QQ1 A;  1ADL A;  4Z2O A;  4LKP A;  4U9C A;  4YKO A;  2IZB A;  1BRQ A;  2GTF X;  4RUU A;  3WJB A;  3P6D A;  1PM1 X;  3B2I A;  3S26 A;  1NC9 A;  2GTL N;  4IMN A;  4CPH A;  2OL6 O;  2OY1 O;  3FEP A;  3KFG A;  4NV8 A;  4XMF A;  1QY1 A;  5D47 A;  3P6F A;  3P6C A;  3UEU A;  5HZ8 A;  3SLO A;  3APX A;  4GGR A;  2PI3 O;  4OMX A; 
#chains in the Genus database with same CATH homology
 2RTL A;  3RDU A;  1STP A;  1SWN A;  2CAM A;  2RTD B;  3X00 A;  4JHQ A;  1STR B;  1NQM A;  1VWB B;  2IZJ A;  1WBI A;  5IRW A;  4BBO A;  2F01 A;  2RTE B;  1HXZ A;  1VWD B;  3SZI A;  1HQQ A;  2IZA A;  1KFF A;  3VHI A;  4Z28 A;  2RTF B;  2RTK A;  1N9Y A;  1SRG A;  1VWA B;  1DF8 A;  3PK2 A;  1SLF B;  1SWL A;  4Z27 A;  2RTO B;  3RDM A;  1SLE B;  1SWE A;  1Y53 X;  2OFB A;  1VWF B;  3RDS A;  4YVB A;  3T6L A;  1MM9 A;  2IZK A;  5IRU A;  5CHK A;  1MOY A;  3MG5 A;  3T2X A;  4Z6J A;  1LCZ A;  2IZC B;  4BX6 B;  2JGS A;  2UYW A;  1VWP B;  1PTS A;  2UZ2 A;  2OFA A;  1MEP A;  2FHL A;  2RTQ B;  2ZSC A;  4BX6 A;  2RTR B;  1VWM B;  1N4J A;  2A5C A;  5F2B A;  2A8G A;  2FHN X;  3WZO A;  1SRF A;  2Y3F A;  1RST B;  4JNJ A;  3WYQ A;  2A5B A;  1SWS A;  2IZD B;  1LCW A;  1KL4 A;  1RAV A;  2Y32 A;  4GD9 A;  2G5L A;  1SWD A;  5L3Y A;  5K68 A;  2QCB A;  3RDX A;  1VWN B;  1KL5 A;  1NDJ A;  3T2W A;  4CPF A;  2RTG B;  2RTN B;  1VWJ B;  2RTH B;  4IRW A;  3T6F A;  1VWK B;  3RY2 A;  3RE6 A;  1VWG B;  1LEL A;  2IZG B;  1VWQ B;  1SRH A;  1LUQ A;  1SWF A;  1VWI B;  1RSU B;  1RXH A;  2AVI A;  1VWR B;  2RTA A;  5B5G A;  1N9M A;  1SLG B;  3RY1 A;  3EW2 A;  2WPU A;  2RTM A;  1N7Y A;  4GDA A;  4BCS A;  3VHH A;  4BX7 B;  3WZP A;  1VWC B;  1SRI A;  4Y5D A;  2GH7 A;  3FDC A;  2OF8 A;  1RXK A;  3WYP A;  4BX7 A;  2MF6 A;  2IZH B;  1SWO A;  3MM0 A;  1SWJ A;  3WZN A;  4CPI A;  4DNE A;  1I9H A;  4GGT A;  2C4I A;  4I60 A;  4OKA A;  1SWU A;  2RTJ A;  2Y3E A;  2RTB B;  1N43 A;  3RE5 A;  4GGZ A;  4JO6 A;  1NQN A;  1HY2 A;  1VWL B;  2OF9 A;  3RDO A;  1NBX A;  1MK5 A;  1VYO A;  1SWQ A;  1SWA A;  4GJV A;  1SLD B;  2RTC B;  3RDQ A;  1LDO A;  4BJ8 A;  5CSE A;  2C1Q A;  1VWH B;  4BX5 B;  4CPE A;  2IZI A;  5B5F A;  2BC3 A;  1HXL A;  4GJS A;  4Z2P A;  5IRA A;  1RXJ A;  1LDQ A;  1SWT A;  1KL3 A;  1SWG A;  1SWC A;  4U46 A;  4BX5 A;  3VGW A;  1VWE B;  3SZJ A;  1Y52 X;  1IJ8 A;  2RTI B;  1SWB A;  4CPH B;  5JD2 A;  1AVD A;  4Y59 A;  1SWP A;  2IZL B;  4Z2O A;  1Y55 X;  2C1S A;  3EW1 A;  2IZB A;  4EKV A;  2IZF B;  4Z2V A;  3VHM A;  1SRE A;  5K67 A;  1AVE A;  4CPH A;  1NC9 A;  1LCV A;  1SWK A;  1STS B;  2IZE B;  1SWH A;  2RTP B;  3WZQ A;  1VWO B;  4GGR A;  1SWR A;  1SRJ A;  3SZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...