2RTCB

Apostreptavidin, ph 3.60, space group i222
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 24
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2rtcB00
2C1QA 2IZGB 1NDJA 4EKVA 4CPHB 4CPIA 1VWPB 2OFAA 5JD2A 4U46A 5B5GA 4Z6JA 3RE6A 1NQNA 1MM9A 4Y5DA 3RDUA 1SWQA 1VWBB 3RDOA 2RTEB 3RE5A 2FHLA 2OF9A 1SWFA 1SWUA 1KFFA 1SWNA 1Y52X 2RTKA 2RTQB 3RDMA 1VWNB 2RTHB 1SWPA 3WZPA 4BX5B 1LDOA 1VWIB 1N9YA 1SWEA 1VWJB 3WZQA 4YVBA 2G5LA 2IZEB 4BX7A 2RTRB 2Y32A 1VWRB 1SWRA 4IRWA 4BX5A 2C1SA 1SWOA 2OFBA 3VHHA 1VWKB 1SLGB 1VWDB 2CAMA 1HY2A 2BC3A 4GDAA 2IZHB 1SLEB 3SZJA 5L3YA 1KL3A 2A8GA 5CHKA 3FDCA 1SWAA 1SWTA 2QCBA 3RDQA 4GJVA 4GJSA 3T6LA 5IRUA 2IZJA 4BBOA 2Y3FA 4BX7B 1N7YA 2IZKA 2RTPB 4BCSA 1KL5A 1VWCB 4CPFA 5K67A 4BX6A 4GGZA 1SWLA 2UZ2A 1VWEB 5K68A 3SZHA 1DF8A 1SLFB 1HXZA 1AVDA 1N9MA 2IZAA 3EW2A 2RTIB 2RTMA 4CPEA 1VWFB 1VWHB 2RTAA 2F01A 1SWKA 1RSUB 2RTBB 1RAVA 2RTDB 1I9HA 1SRGA 4DNEA 1NQMA 1STSB 1STPA 4Z27A 2WPUA 1VWLB 1RSTB 4BX6B 3RY1A 1LDQA 1MOYA 1SWBA 2A5BA 3T6FA 2RTCB 4GD9A 4GGRA 3WYQA 4JO6A 1SREA 4Z2VA 1N43A 1NC9A 1STRB 5IRAA 2AVIA 1VWOB 1LELA 1RXHA 2RTFB 1RXKA 1SRHA 3WYPA 1MK5A 2RTJA 1Y55X 1N4JA 2IZDB 4Z28A 3VHMA 3MM0A 1NBXA 2Y3EA 1SRIA 3RDSA 3SZIA 4OKAA 1SWGA 1LCWA 2FHNX 2IZCB 4JNJA 1SRJA 1AVEA 2RTGB 3RDXA 2MF6A 4Z2PA 1LCVA 5IRWA 3VGWA 1MEPA 3X00A 4Z2OA 1SWJA 1SLDB 2C4IA 4JHQA 1SRFA 2RTLA 2IZFB 3WZNA 2IZIA 2A5CA 5B5FA 3MG5A 4Y59A 4BJ8A 1HQQA 1RXJA 1VWGB 1LCZA 1VWMB 1HXLA 4GGTA 1KL4A 5F2BA 4CPHA 1IJ8A 1VWQB 1PTSA 1WBIA 2RTOB 2JGSA 1SWHA 1SWCA 1Y53X 4I60A 2IZBA 2GH7A 1LUQA 3WZOA 1SWSA 1VYOA 5CSEA 3T2WA 3PK2A 1SWDA 1VWAB 3VHIA 2OF8A 2UYWA 3EW1A 2RTNB 3RY2A 3T2XA 2ZSCA 2IZLB
chains in the Genus database with same CATH superfamily
4XMFA 1R0UA 1CJ5A 3S60A 1AELA 4Z6JA 4CPIA 1VWPB 2X4MA 1EALA 5B5GA 4O3YA 5B3MO 1ERXA 3RE6A 1OEKA 2BLGA 5D48A 1ADLA 2I5ZO 5LJKA 2W2FA 3P02A 4XMGA 1KT4A 2A0AA 2X55A 4COTA 4HPAA 2ZAIA 1SWFA 5D47A 4NYQA 3RDMA 1KZXA 4EXZA 4BX5B 1VWIB 2LB6A 1ZNKA 4GUZA 4N7CA 4OS3A 1SWEA 1VWJB 5DPQA 2G5LA 2IZEB 4BX7A 4QYPA 4UU2A 2Q2MA 2WUTA 4ORYA 4AZRA 4YBPA 4NW4A 1SWOA 3VHHA 1VWKB 1SLGB 1LKEA 1OEJA 3F9DA 1HY2A 4HPCA 5B29A 5IO7A 5AJCA 1GT1A 2IZHB 4XMEA 5HTDA 2VDFA 4I95A 3FW4A 3ZW0A 4O4OA 1KL3A 2A8GA 2Q9SA 4ZR2A 1ML7A 3PQUA 2O62A 1GT4A 5C0NA 3PH6A 2VFBA 3RSWA 2IZJA 4YCHA 1G7NA 1PEEA 2Y3FA 1O8VA 2GTLN 5AEOA 1FJ1E 3EC5A 4BX7B 1N7YA 3T1DA 5HZ8A 4AW8A 3BU9A 3BY0A 1SWLA 1SXWA 3RWXA 1VWEB 5K68A 5IO5A 4TNNA 4UU3A 3N91A 5D45A 3ZWEA 5LJDA 1FEMA 2IZAA 2RTMA 2ZAGA 4MVIA 2BSZA 1I4UA 2P8GA 5B11O 5H8TA 3UEUA 3ZW0B 1UZ2X 4M7MA 1RSUB 2G8CO 2RA6A 1LIFA 3FR4A 2RTBB 4LZUA 4ZH6A 1RAVA 3P6GA 5HA1A 1JJJA 1EPBA 1KT7A 2LKKA 4U8UN 4ZHFA 1STSB 2NNDA 1ZNEA 1XKIA 4YKOA 2WQ9A 2R56A 1N0SA 4IMNA 3RY1A 1OBPA 3P6HA 5DG4A 3T6FA 2G78A 1YWAA 1X8UA 2OZQA 2Q4NA 2OL8O 3O19A 3HOEA 4GU8A 4JO6A 4WBKA 3SLJA 3WYQA 1DF3A 2AMMX 2PI3O 3ZQ3A 1VWOB 2LA7A 3V8UA 4A1HA 1MK5A 1X89A 4IAWA 1LFOA 1D2UA 1Y55X 3TGCA 3CWKA 1GX9A 2X8TA 4A8ZA 2QO5A 2YMSA 1GM6A 4OEMA 1IFCA 1VPRA 2POAA 4Y0QA 3RDSA 1SWGA 1A18A 1LCWA 3SZIA 2FHNX 2BHVA 5IRWA 4NV8A 3FYFA 4WHIA 3VGWA 2WR6A 1MEPA 1X8OA 2HYSA 3X00A 3U03A 1Y0GA 1SLDB 5H9NA 1E2TA 3APUA 2IZFB 3NX2A 4KT5A 3P6CA 1LCZA 1VWMB 3PEDA 4GGTA 1KL4A 1G85A 4CPHA 5BVTA 4M6SA 1PTSA 4I60A 1DFVA 2KTDA 4DCBA 5EDBA 2QOSC 5KICA 1UREA 5LJCA 2OY7A 1LF7A 3S5VA 4CK4A 1SWSA 4O9SA 1UYNX 1VYOA 3ELXA 3P24A 2Z4HA 3APWA 3PK2A 1X8PA 1HMRA 2LBVA 3VG3A 2UYWA 1ZNDA 3HWDA 3FIDA 3LHNA 5EPQA 3RY2A 1P6PA 3BX8A 3HWFA 4WFUA 2QMIA 3TF6A 5KHPA 4QQ1A 1AB0A 5F7GA 4AZOA 3RKGA 2RN4A 2HZQA 1NDJA 4EKVA 3NP1A 2X8SA 4CPHB 2OVEA 4TLJA 5JD2A 2OYBO 3SOTA 1G5WA 4OS0A 4Y0PA 3VPJE 3B2JA 1NQNA 1GXAA 2JW1A 1SXUA 2FTBA 1E06A 4GNYA 2Q2PA 4HPDA 1GT3A 1VWBB 4O4UA 4U9CA 4BOEA 1DZPA 1YWDA 2Z4IA 3BS2A 4LQZA 3ELZA 1BRPA 1LIEA 3PECA 4FBRA 5B27A 1Y52X 2RTQB 2MO5A 4IMOA 5HA0A 3FA6A 3WZPA 1DZKA 2K62A 3WZQA 4YVBA 4RUUA 3K3LA 5L8IA 2WEWA 1YWCA 2FGSA 3P6EA 1TVQA 3APVA 3ZI8A 4FBOA 3IA8A 3KQ0A 1JIWI 3GAQA 4OMWA 1NP1A 1MDCA 2OL7A 2AT5X 5LKFA 4BX5A 5HZ5A 4KIIA 4QGXA 1O1UA 2BC3A 3F6ZB 3WJCA 5EEDA 2OY8A 2DJGA 1I06A 5HCCC 3SZJA 5L3YA 1U18A 4ON1A 1EPAA 1QY2A 5CHKA 3TZSA 4GNWA 3VU1A 5HWZA 1JQPA 2AKQA 2GTLO 4GJVA 1BSOA 1LNMA 5IRUA 2X32A 4ZH9A 3S26A 3T6LA 1NP4A 1MUPA 4I9SA 4LKTA 4Y0RA 1B56A 3BX7A 1BBPA 4L3RA 5FQ7E 2AT8X 4GH7A 5K67A 1SA8A 2L5PA 1CBIA 2RQ0A 3MX7A 3TGAA 3D96A 3E3CA 3SZHA 2NP1A 1BSYA 1HXZA 2G79A 3JSQA 4KC8A 3HPEA 4YFQA 1NGLA 5H9LA 3NR3A 1GX8A 4CPEA 2RTIB 5FQ6E 1VWHB 2KD2A 1QABE 2RTAA 2F01A 2OFRX 4ALBA 1A57A 2FKGA 2HNXA 3FA8A 2HMBA 4O3XB 4QYNA 4XMCA 3FR2A 4U8UO 4WFVA 4U3QA 4FQBB 4BQUA 5L8NA 3AUMO 5K06A 3AKMA 2WPUA 1VWLB 1RSTB 3VE2A 4O4XA 3VG7A 1SWBA 4ZHCA 1QWDA 3VG2A 2A2GA 4B55A 1YP6A 1GKAA 3FEKA 4Z2VA 2Q39A 1NC9A 1STRB 4ORWA 5CYBA 2AVIA 3FR5A 4TKBA 1LELA 3WYPA 1KT5A 3ZUIA 1PBYA 2G7BA 3KFHA 2CM9A 3DTQA 4CDEA 4Z28A 4ZHHA 5CE4A 3FA7A 3H3IA 1NBXA 1U17A 4YDBA 4NNTA 1YP7A 4IABA 1OSPO 2DM5A 4YDAA 4ORSA 4CDDA 2MF6A 3KZAA 1LCVA 1OPBA 3O2YA 2GJ5A 4LKPA 5FFHA 1QQSA 4CDFA 4ZJ0A 2BS5A 2AT0X 2CM4A 1DZMA 1GKAB 3VG5A 1I05A 5KIDA 4ZHDA 3MG5A 1HQQA 4K19A 1ZNLA 3MVFA 3IFBA 3S5XA 4RUNA 3F8AA 5F2BA 2QO4A 3WJDA 1IJ8A 4N7DA 4CSBA 1SY1A 2CBRA 1HMSA 3U0DA 3C78X 4GE1A 2AT6X 4XMHA 1S7DA 1SWCA 3L4RA 4OELA 3CR6A 3ZUOA 1SY2A 4I3DA 3D95A 1LIDA 1ZNGA 4KH8A 3HK1A 5D4AA 1S2PA 5F6ZA 3WZOA 1DV9A 4INNA 1JMXA 5CSEA 1JBHA 1HBQA 1W5RA 1MVGA 1E02A 2VFCA 3WXQA 2RCTA 3EMMA 5LJHA 1OBUA 2CZUA 3D97A 1BLRA 2F09A 2ANSA 2ZSCA 4MVKA 3FIQA 2AT3X 4NYRA 1L6MA 3D9WA 2C1QA 3EBKA 4HFOA 1UYOX 5AQ6A 3NADA 2OFAA 4QRLA 4U46A 1Y9TA 3CMPA 4NP1A 4XMDA 3B2HA 3KFGA 3KVNA 3NX1A 4AYHA 3OJYC 1MM9A 3RDUA 1PM1X 4GDZA 1GGLA 1SWQA 2KT4B 1BRQA 3EYCA 4O4SA 1TW4A 3CBCA 3Q34A 3U9PC 1IKEA 1ALBA 3FEPA 2JN3A 1SWUA 2WWPA 4NV7A 1KFFA 1SWNA 4QGWA 4YGGA 4BGFA 4TQ2A 5LJEA 2RTHB 4GRJA 4GK9A 4I3CA 1BSQA 4CV7A 5BVQA 3P6FA 4O3WA 2FT9A 1VYFA 2RTRB 1BWYA 1VWRB 3CQNA 1SWRA 1TOUA 3O22A 2FWVA 4IRWA 3UAQA 3BSZE 5JR8A 2MJIA 3B2KA 1VWDB 3VG4A 4IBAA 1SLEB 5F6BA 2A13A 1LPJA 1RLBE 3VE1A 1X71A 3PP6A 1EIOA 2PY1A 4ZFXA 3FDCA 2R74A 1JV4A 2GC9A 1S44A 2QCBA 3NQ3A 3RDQA 4GJSA 1QFVA 4BBOA 2ALLX 5LJBA 1KGLA 3FLLA 1QFTA 5FQ8E 3I0AA 3FELA 4YKMA 2IZKA 4QNIA 4YGZA 2OVDA 2RTPB 1K24A 4BCSA 1KL5A 1VWCB 1KQWA 2OFMX 2X56A 4MISA 4QZUA 4NLIA 4CPFA 1OPAA 5B2AO 2CBSA 1SLFB 4YCEA 4QGVA 1D3SA 3ZW2A 2EU7X 1MX8A 3I17A 1BM5A 1K3BA 1VWFB 2ASNX 5H9AA 2QO6A 5HTEA 1ERBA 1QY0A 2WSJA 4O3ZA 2JU8A 2X34A 1SRGA 2OVSA 3APXA 4I3BA 5IXGA 1E5PA 1STPA 2NNQA 1JZUA 1WUBA 3CKGA 5FAZA 1LDQA 1MOYA 3BRNA 4TJZA 4DQ3A 2RTCB 3ZW1A 1IW2A 2R73A 1EXSA 2OY5O 5HBSA 4ORRA 1LICA 3P6DA 5IRAA 2FKJA 1T68X 1RXHA 1SRHA 2N93A 1DZJA 2LFOA 2RTFB 1PMPA 3NPOA 3STMX 3STKA 3WJGA 4C5PA 4FGIB 5EZ2A 3PQSA 1DC9A 3HTYA 5HZQA 3VHMA 2ACPX 3BU1A 3LTWA 2E4JA 1SRJA 3EBWA 4BVMA 2AL0X 2RTGB 4ZHGA 4Z2PA 4AZPA 1EUOA 1OBQA 1SY0A 3KFFA 3PPTA 5FENA 3ZW1B 1HQPA 1IFBA 3HOLA 4I6SA 1SRFA 1T8VA 2IFBA 1G74A 3WZNA 1SMPI 2A5CA 2JMBA 1IKJA 1VWGB 4KCAA 1B0OA 1CBRA 2AF5A 2DJFA 1HXLA 1PBOA 2BS6A 3Q6LA 1VWQB 2K23A 1WBIA 1B8EA 2RTOB 1SY3A 1W4TA 2JGSA 1T0VA 4IAXA 2OVAA 2IZBA 2GH7A 3EM0A 1LUQA 3OD9A 5HCEC 1GX3A 3HWEA 1U0XA 1AVGI 4MVLA 1CBSA 2NNEA 4FBVA 4I9RA 3SAOA 3FENA 1SWDA 2L9CA 5HZ9A 5D8JA 1IIUA 3EW1A 2L68A 1FE3A 1O1VA 3AEHA 3CKFA 3JS1A 4KC7A 4EQAC 2FR3A 3OE3A 3FA9A 2IZLB 2OL6O 4YGHA 4ES7A 1TXLA 1Y9LA 2KW1A 3NQ9A 2IZGB 1A2DA 1E00A 4ML7B 1ZNHA 1BJ7A 3WBGA 2ACOA 2L67A 4Y5DA 1X8NA 1YUPA 3MBTA 3RDOA 2RTEB 3B2LA 2HLVA 4HWMA 5LJGA 3RE5A 2FRSA 2FHLA 2OF9A 2WEXA 4AZQA 4ALOA 1X8QA 2HKDA 2FR2A 2RTKA 1CRBA 4PJ2A 3RZYA 2MWHA 4ID2A 1VWNB 4HPBA 1SWPA 1SXYA 5AJBA 1LDOA 4QZTA 3GE2A 3KFIA 3NQKA 1N9YA 4TKHA 3BDRA 4IB7A 1JMZA 2W2AA 2Y32A 4ODDA 1HN2A 2A3FX 2LBAA 1ICMA 2OY1O 1ICNA 5EDCA 4ORXA 5BVSA 2C1SA 2OFBA 1B4MA 2CAMA 2FS7A 1OEEA 1W6FA 3QQ2A 4GDAA 4AZMA 1EIIA 3RBYA 4A1YA 3UEXA 4OMXA 5EEEA 1FELA 1KXOA 4GZVA 2JU7A 1CBQA 3QKGA 1SWAA 1SWTA 2CZTA 3OBLA 4GETA 4OS8A 5F58A 3STNA 4ORUA 3HWGA 4AZNA 2X46A 4IB6A 3G7XA 5IO6A 4BX6A 1GT5A 4GGZA 1SXXA 3CQRA 2BT9A 2UZ2A 4ARHA 4YFRA 4CDCA 3WJFA 1MX7A 1DF8A 4O49A 1FDQA 4IB8A 1JYJA 1AVDA 1N9MA 2F73A 1HMTA 1ZRYA 3EW2A 1AQBA 2W2BA 5H9KA 4ZCBA 1YIVA 3ZZVA 4D6BA 2FLJA 4DQ4A 1BEBA 2X45A 3LV4A 1SWKA 2GTLM 5B10O 1FENA 2I5VO 5HZ6A 5BYPA 2RTDB 1I9HA 3FMZA 4NNSA 2RD7C 4DNEA 3CBSA 1NQMA 4PSQA 4GKCA 4R0BA 4Z27A 5LKEA 2AH7X 1I04A 1KOIA 1KT6A 1QG5A 1RBPA 4BX6B 3B2IA 3PH5A 2A5BA 3WJBA 1VYGA 4YFPA 4GD9A 4GGRA 1I78A 4YMYA 4MVEA 4EFGA 1KZWA 1SREA 3TGBA 3WVMA 1N43A 4JGLA 3NBXX 2YG2A 5HAEA 1TOWA 2JU3A 2FS6A 1KT3A 1RXKA 2XKLA 2RTJA 1JJUA 2KTSA 1EI5A 2M4LA 3FW5A 1N4JA 4ZGFA 2IZDB 4QAEA 4U8UM 3SLOA 3MM0A 3WOVA 2Y3EA 4Y0SA 5HCDC 1SRIA 2QM9A 3AKNA 1HBPA 2MHDA 4OKAA 2IZCB 4JNJA 3C76X 1AVEA 4LZVA 5F1EA 3PDFA 3RDXA 1XCAA 1H91A 4A60A 4ZGUA 2QOMA 3DSZA 4Z2OA 1KQXA 1SWJA 2C4IA 2XSTA 4JHQA 3VG6A 2RTLA 2JOZA 1A3YA 2IZIA 2X8FA 4IB9A 4BJ8A 4MEEA 4Y59A 4YBUA 1RXJA 5B5FA 5L8OA 1JJXA 1EQDA 4EDEA 2GTFX 1Z24A 3BLGA 3JQOA 1YWBA 1SWHA 2RCQA 3D4RA 1Y53X 2WQAE 1LIBA 4TKJA 4EEJA 2A2UA 1EW3A 4D6AA 2HZRA 4L1NA 4MIRA 4NLJA 3UEWA 1JYDA 3T2WA 1FTPA 1VWAB 3C77X 3VHIA 2MM3A 1ACDA 2OF8A 2RTNB 3UEVA 1QY1A 3SLTA 3WJEA 3T2XA 4YH0A
chains in the Genus database with same CATH topology
2C1QA 2IZGB 1NDJA 4EKVA 4CPHB 4CPIA 1VWPB 2OFAA 5JD2A 4U46A 5B5GA 4Z6JA 3RE6A 1NQNA 1MM9A 4Y5DA 3RDUA 1SWQA 1VWBB 3RDOA 2RTEB 3RE5A 2FHLA 2OF9A 1SWFA 1SWUA 1KFFA 1SWNA 1Y52X 2RTKA 2RTQB 3RDMA 1VWNB 2RTHB 1SWPA 3WZPA 4BX5B 1LDOA 1VWIB 1N9YA 1SWEA 1VWJB 3WZQA 4YVBA 2G5LA 2IZEB 4BX7A 2RTRB 2Y32A 1VWRB 1SWRA 4IRWA 4BX5A 2C1SA 1SWOA 2OFBA 3VHHA 1VWKB 1SLGB 1VWDB 2CAMA 1HY2A 2BC3A 4GDAA 2IZHB 1SLEB 3SZJA 5L3YA 1KL3A 2A8GA 5CHKA 3FDCA 1SWAA 1SWTA 2QCBA 3RDQA 4GJVA 4GJSA 3T6LA 5IRUA 2IZJA 4BBOA 2Y3FA 4BX7B 1N7YA 2IZKA 2RTPB 4BCSA 1KL5A 1VWCB 4CPFA 5K67A 4BX6A 4GGZA 1SWLA 2UZ2A 1VWEB 5K68A 3SZHA 1DF8A 1SLFB 1HXZA 1AVDA 1N9MA 2IZAA 3EW2A 2RTIB 2RTMA 4CPEA 1VWFB 1VWHB 2RTAA 2F01A 1SWKA 1RSUB 2RTBB 1RAVA 2RTDB 1I9HA 1SRGA 4DNEA 1NQMA 1STSB 1STPA 4Z27A 2WPUA 1VWLB 1RSTB 4BX6B 3RY1A 1LDQA 1MOYA 1SWBA 2A5BA 3T6FA 2RTCB 4GD9A 4GGRA 3WYQA 4JO6A 1SREA 4Z2VA 1N43A 1NC9A 1STRB 5IRAA 2AVIA 1VWOB 1LELA 1RXHA 2RTFB 1RXKA 1SRHA 3WYPA 1MK5A 2RTJA 1Y55X 1N4JA 2IZDB 4Z28A 3VHMA 3MM0A 1NBXA 2Y3EA 1SRIA 3RDSA 3SZIA 4OKAA 1SWGA 1LCWA 2FHNX 2IZCB 4JNJA 1SRJA 1AVEA 2RTGB 3RDXA 2MF6A 4Z2PA 1LCVA 5IRWA 3VGWA 1MEPA 3X00A 4Z2OA 1SWJA 1SLDB 2C4IA 4JHQA 1SRFA 2RTLA 2IZFB 3WZNA 2IZIA 2A5CA 5B5FA 3MG5A 4Y59A 4BJ8A 1HQQA 1RXJA 1VWGB 1LCZA 1VWMB 1HXLA 4GGTA 1KL4A 5F2BA 4CPHA 1IJ8A 1VWQB 1PTSA 1WBIA 2RTOB 2JGSA 1SWHA 1SWCA 1Y53X 4I60A 2IZBA 2GH7A 1LUQA 3WZOA 1SWSA 1VYOA 5CSEA 3T2WA 3PK2A 1SWDA 1VWAB 3VHIA 2OF8A 2UYWA 3EW1A 2RTNB 3RY2A 3T2XA 2ZSCA 2IZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1Q A;  2IZG B;  1NDJ A;  4EKV A;  4CPH B;  4CPI A;  1VWP B;  2OFA A;  5JD2 A;  4U46 A;  5B5G A;  4Z6J A;  3RE6 A;  1NQN A;  1MM9 A;  4Y5D A;  3RDU A;  1SWQ A;  1VWB B;  3RDO A;  2RTE B;  3RE5 A;  2FHL A;  2OF9 A;  1SWF A;  1SWU A;  1KFF A;  1SWN A;  1Y52 X;  2RTK A;  2RTQ B;  3RDM A;  1VWN B;  2RTH B;  1SWP A;  3WZP A;  4BX5 B;  1LDO A;  1VWI B;  1N9Y A;  1SWE A;  1VWJ B;  3WZQ A;  4YVB A;  2G5L A;  2IZE B;  4BX7 A;  2RTR B;  2Y32 A;  1VWR B;  1SWR A;  4IRW A;  4BX5 A;  2C1S A;  1SWO A;  2OFB A;  3VHH A;  1VWK B;  1SLG B;  1VWD B;  2CAM A;  1HY2 A;  2BC3 A;  4GDA A;  2IZH B;  1SLE B;  3SZJ A;  5L3Y A;  1KL3 A;  2A8G A;  5CHK A;  3FDC A;  1SWA A;  1SWT A;  2QCB A;  3RDQ A;  4GJV A;  4GJS A;  3T6L A;  5IRU A;  2IZJ A;  4BBO A;  2Y3F A;  4BX7 B;  1N7Y A;  2IZK A;  2RTP B;  4BCS A;  1KL5 A;  1VWC B;  4CPF A;  5K67 A;  4BX6 A;  4GGZ A;  1SWL A;  2UZ2 A;  1VWE B;  5K68 A;  3SZH A;  1DF8 A;  1SLF B;  1HXZ A;  1AVD A;  1N9M A;  2IZA A;  3EW2 A;  2RTI B;  2RTM A;  4CPE A;  1VWF B;  1VWH B;  2RTA A;  2F01 A;  1SWK A;  1RSU B;  2RTB B;  1RAV A;  2RTD B;  1I9H A;  1SRG A;  4DNE A;  1NQM A;  1STS B;  1STP A;  4Z27 A;  2WPU A;  1VWL B;  1RST B;  4BX6 B;  3RY1 A;  1LDQ A;  1MOY A;  1SWB A;  2A5B A;  3T6F A;  2RTC B;  4GD9 A;  4GGR A;  3WYQ A;  4JO6 A;  1SRE A;  4Z2V A;  1N43 A;  1NC9 A;  1STR B;  5IRA A;  2AVI A;  1VWO B;  1LEL A;  1RXH A;  2RTF B;  1RXK A;  1SRH A;  3WYP A;  1MK5 A;  2RTJ A;  1Y55 X;  1N4J A;  2IZD B;  4Z28 A;  3VHM A;  3MM0 A;  1NBX A;  2Y3E A;  1SRI A;  3RDS A;  3SZI A;  4OKA A;  1SWG A;  1LCW A;  2FHN X;  2IZC B;  4JNJ A;  1SRJ A;  1AVE A;  2RTG B;  3RDX A;  2MF6 A;  4Z2P A;  1LCV A;  5IRW A;  3VGW A;  1MEP A;  3X00 A;  4Z2O A;  1SWJ A;  1SLD B;  2C4I A;  4JHQ A;  1SRF A;  2RTL A;  2IZF B;  3WZN A;  2IZI A;  2A5C A;  5B5F A;  3MG5 A;  4Y59 A;  4BJ8 A;  1HQQ A;  1RXJ A;  1VWG B;  1LCZ A;  1VWM B;  1HXL A;  4GGT A;  1KL4 A;  5F2B A;  4CPH A;  1IJ8 A;  1VWQ B;  1PTS A;  1WBI A;  2RTO B;  2JGS A;  1SWH A;  1SWC A;  1Y53 X;  4I60 A;  2IZB A;  2GH7 A;  1LUQ A;  3WZO A;  1SWS A;  1VYO A;  5CSE A;  3T2W A;  3PK2 A;  1SWD A;  1VWA B;  3VHI A;  2OF8 A;  2UYW A;  3EW1 A;  2RTN B;  3RY2 A;  3T2X A;  2ZSC A;  2IZL B; 
#chains in the Genus database with same CATH topology
 4XMF A;  1R0U A;  1CJ5 A;  3S60 A;  1AEL A;  4Z6J A;  4CPI A;  1VWP B;  2X4M A;  1EAL A;  5B5G A;  4O3Y A;  5B3M O;  1ERX A;  3RE6 A;  1OEK A;  2BLG A;  5D48 A;  1ADL A;  2I5Z O;  5LJK A;  2W2F A;  3P02 A;  4XMG A;  1KT4 A;  2A0A A;  2X55 A;  4COT A;  4HPA A;  2ZAI A;  1SWF A;  5D47 A;  4NYQ A;  3RDM A;  1KZX A;  4EXZ A;  4BX5 B;  1VWI B;  2LB6 A;  1ZNK A;  4GUZ A;  4N7C A;  4OS3 A;  1SWE A;  1VWJ B;  5DPQ A;  2G5L A;  2IZE B;  4BX7 A;  4QYP A;  4UU2 A;  2Q2M A;  2WUT A;  4ORY A;  4AZR A;  4YBP A;  4NW4 A;  1SWO A;  3VHH A;  1VWK B;  1SLG B;  1LKE A;  1OEJ A;  3F9D A;  1HY2 A;  4HPC A;  5B29 A;  5IO7 A;  5AJC A;  1GT1 A;  2IZH B;  4XME A;  5HTD A;  2VDF A;  4I95 A;  3FW4 A;  3ZW0 A;  4O4O A;  1KL3 A;  2A8G A;  2Q9S A;  4ZR2 A;  1ML7 A;  3PQU A;  2O62 A;  1GT4 A;  5C0N A;  3PH6 A;  2VFB A;  3RSW A;  2IZJ A;  4YCH A;  1G7N A;  1PEE A;  2Y3F A;  1O8V A;  2GTL N;  5AEO A;  1FJ1 E;  3EC5 A;  4BX7 B;  1N7Y A;  3T1D A;  5HZ8 A;  4AW8 A;  3BU9 A;  3BY0 A;  1SWL A;  1SXW A;  3RWX A;  1VWE B;  5K68 A;  5IO5 A;  4TNN A;  4UU3 A;  3N91 A;  5D45 A;  3ZWE A;  5LJD A;  1FEM A;  2IZA A;  2RTM A;  2ZAG A;  4MVI A;  2BSZ A;  1I4U A;  2P8G A;  5B11 O;  5H8T A;  3UEU A;  3ZW0 B;  1UZ2 X;  4M7M A;  1RSU B;  2G8C O;  2RA6 A;  1LIF A;  3FR4 A;  2RTB B;  4LZU A;  4ZH6 A;  1RAV A;  3P6G A;  5HA1 A;  1JJJ A;  1EPB A;  1KT7 A;  2LKK A;  4U8U N;  4ZHF A;  1STS B;  2NND A;  1ZNE A;  1XKI A;  4YKO A;  2WQ9 A;  2R56 A;  1N0S A;  4IMN A;  3RY1 A;  1OBP A;  3P6H A;  5DG4 A;  3T6F A;  2G78 A;  1YWA A;  1X8U A;  2OZQ A;  2Q4N A;  2OL8 O;  3O19 A;  3HOE A;  4GU8 A;  4JO6 A;  4WBK A;  3SLJ A;  3WYQ A;  1DF3 A;  2AMM X;  2PI3 O;  3ZQ3 A;  1VWO B;  2LA7 A;  3V8U A;  4A1H A;  1MK5 A;  1X89 A;  4IAW A;  1LFO A;  1D2U A;  1Y55 X;  3TGC A;  3CWK A;  1GX9 A;  2X8T A;  4A8Z A;  2QO5 A;  2YMS A;  1GM6 A;  4OEM A;  1IFC A;  1VPR A;  2POA A;  4Y0Q A;  3RDS A;  1SWG A;  1A18 A;  1LCW A;  3SZI A;  2FHN X;  2BHV A;  5IRW A;  4NV8 A;  3FYF A;  4WHI A;  3VGW A;  2WR6 A;  1MEP A;  1X8O A;  2HYS A;  3X00 A;  3U03 A;  1Y0G A;  1SLD B;  5H9N A;  1E2T A;  3APU A;  2IZF B;  3NX2 A;  4KT5 A;  3P6C A;  1LCZ A;  1VWM B;  3PED A;  4GGT A;  1KL4 A;  1G85 A;  4CPH A;  5BVT A;  4M6S A;  1PTS A;  4I60 A;  1DFV A;  2KTD A;  4DCB A;  5EDB A;  2QOS C;  5KIC A;  1URE A;  5LJC A;  2OY7 A;  1LF7 A;  3S5V A;  4CK4 A;  1SWS A;  4O9S A;  1UYN X;  1VYO A;  3ELX A;  3P24 A;  2Z4H A;  3APW A;  3PK2 A;  1X8P A;  1HMR A;  2LBV A;  3VG3 A;  2UYW A;  1ZND A;  3HWD A;  3FID A;  3LHN A;  5EPQ A;  3RY2 A;  1P6P A;  3BX8 A;  3HWF A;  4WFU A;  2QMI A;  3TF6 A;  5KHP A;  4QQ1 A;  1AB0 A;  5F7G A;  4AZO A;  3RKG A;  2RN4 A;  2HZQ A;  1NDJ A;  4EKV A;  3NP1 A;  2X8S A;  4CPH B;  2OVE A;  4TLJ A;  5JD2 A;  2OYB O;  3SOT A;  1G5W A;  4OS0 A;  4Y0P A;  3VPJ E;  3B2J A;  1NQN A;  1GXA A;  2JW1 A;  1SXU A;  2FTB A;  1E06 A;  4GNY A;  2Q2P A;  4HPD A;  1GT3 A;  1VWB B;  4O4U A;  4U9C A;  4BOE A;  1DZP A;  1YWD A;  2Z4I A;  3BS2 A;  4LQZ A;  3ELZ A;  1BRP A;  1LIE A;  3PEC A;  4FBR A;  5B27 A;  1Y52 X;  2RTQ B;  2MO5 A;  4IMO A;  5HA0 A;  3FA6 A;  3WZP A;  1DZK A;  2K62 A;  3WZQ A;  4YVB A;  4RUU A;  3K3L A;  5L8I A;  2WEW A;  1YWC A;  2FGS A;  3P6E A;  1TVQ A;  3APV A;  3ZI8 A;  4FBO A;  3IA8 A;  3KQ0 A;  1JIW I;  3GAQ A;  4OMW A;  1NP1 A;  1MDC A;  2OL7 A;  2AT5 X;  5LKF A;  4BX5 A;  5HZ5 A;  4KII A;  4QGX A;  1O1U A;  2BC3 A;  3F6Z B;  3WJC A;  5EED A;  2OY8 A;  2DJG A;  1I06 A;  5HCC C;  3SZJ A;  5L3Y A;  1U18 A;  4ON1 A;  1EPA A;  1QY2 A;  5CHK A;  3TZS A;  4GNW A;  3VU1 A;  5HWZ A;  1JQP A;  2AKQ A;  2GTL O;  4GJV A;  1BSO A;  1LNM A;  5IRU A;  2X32 A;  4ZH9 A;  3S26 A;  3T6L A;  1NP4 A;  1MUP A;  4I9S A;  4LKT A;  4Y0R A;  1B56 A;  3BX7 A;  1BBP A;  4L3R A;  5FQ7 E;  2AT8 X;  4GH7 A;  5K67 A;  1SA8 A;  2L5P A;  1CBI A;  2RQ0 A;  3MX7 A;  3TGA A;  3D96 A;  3E3C A;  3SZH A;  2NP1 A;  1BSY A;  1HXZ A;  2G79 A;  3JSQ A;  4KC8 A;  3HPE A;  4YFQ A;  1NGL A;  5H9L A;  3NR3 A;  1GX8 A;  4CPE A;  2RTI B;  5FQ6 E;  1VWH B;  2KD2 A;  1QAB E;  2RTA A;  2F01 A;  2OFR X;  4ALB A;  1A57 A;  2FKG A;  2HNX A;  3FA8 A;  2HMB A;  4O3X B;  4QYN A;  4XMC A;  3FR2 A;  4U8U O;  4WFV A;  4U3Q A;  4FQB B;  4BQU A;  5L8N A;  3AUM O;  5K06 A;  3AKM A;  2WPU A;  1VWL B;  1RST B;  3VE2 A;  4O4X A;  3VG7 A;  1SWB A;  4ZHC A;  1QWD A;  3VG2 A;  2A2G A;  4B55 A;  1YP6 A;  1GKA A;  3FEK A;  4Z2V A;  2Q39 A;  1NC9 A;  1STR B;  4ORW A;  5CYB A;  2AVI A;  3FR5 A;  4TKB A;  1LEL A;  3WYP A;  1KT5 A;  3ZUI A;  1PBY A;  2G7B A;  3KFH A;  2CM9 A;  3DTQ A;  4CDE A;  4Z28 A;  4ZHH A;  5CE4 A;  3FA7 A;  3H3I A;  1NBX A;  1U17 A;  4YDB A;  4NNT A;  1YP7 A;  4IAB A;  1OSP O;  2DM5 A;  4YDA A;  4ORS A;  4CDD A;  2MF6 A;  3KZA A;  1LCV A;  1OPB A;  3O2Y A;  2GJ5 A;  4LKP A;  5FFH A;  1QQS A;  4CDF A;  4ZJ0 A;  2BS5 A;  2AT0 X;  2CM4 A;  1DZM A;  1GKA B;  3VG5 A;  1I05 A;  5KID A;  4ZHD A;  3MG5 A;  1HQQ A;  4K19 A;  1ZNL A;  3MVF A;  3IFB A;  3S5X A;  4RUN A;  3F8A A;  5F2B A;  2QO4 A;  3WJD A;  1IJ8 A;  4N7D A;  4CSB A;  1SY1 A;  2CBR A;  1HMS A;  3U0D A;  3C78 X;  4GE1 A;  2AT6 X;  4XMH A;  1S7D A;  1SWC A;  3L4R A;  4OEL A;  3CR6 A;  3ZUO A;  1SY2 A;  4I3D A;  3D95 A;  1LID A;  1ZNG A;  4KH8 A;  3HK1 A;  5D4A A;  1S2P A;  5F6Z A;  3WZO A;  1DV9 A;  4INN A;  1JMX A;  5CSE A;  1JBH A;  1HBQ A;  1W5R A;  1MVG A;  1E02 A;  2VFC A;  3WXQ A;  2RCT A;  3EMM A;  5LJH A;  1OBU A;  2CZU A;  3D97 A;  1BLR A;  2F09 A;  2ANS A;  2ZSC A;  4MVK A;  3FIQ A;  2AT3 X;  4NYR A;  1L6M A;  3D9W A;  2C1Q A;  3EBK A;  4HFO A;  1UYO X;  5AQ6 A;  3NAD A;  2OFA A;  4QRL A;  4U46 A;  1Y9T A;  3CMP A;  4NP1 A;  4XMD A;  3B2H A;  3KFG A;  3KVN A;  3NX1 A;  4AYH A;  3OJY C;  1MM9 A;  3RDU A;  1PM1 X;  4GDZ A;  1GGL A;  1SWQ A;  2KT4 B;  1BRQ A;  3EYC A;  4O4S A;  1TW4 A;  3CBC A;  3Q34 A;  3U9P C;  1IKE A;  1ALB A;  3FEP A;  2JN3 A;  1SWU A;  2WWP A;  4NV7 A;  1KFF A;  1SWN A;  4QGW A;  4YGG A;  4BGF A;  4TQ2 A;  5LJE A;  2RTH B;  4GRJ A;  4GK9 A;  4I3C A;  1BSQ A;  4CV7 A;  5BVQ A;  3P6F A;  4O3W A;  2FT9 A;  1VYF A;  2RTR B;  1BWY A;  1VWR B;  3CQN A;  1SWR A;  1TOU A;  3O22 A;  2FWV A;  4IRW A;  3UAQ A;  3BSZ E;  5JR8 A;  2MJI A;  3B2K A;  1VWD B;  3VG4 A;  4IBA A;  1SLE B;  5F6B A;  2A13 A;  1LPJ A;  1RLB E;  3VE1 A;  1X71 A;  3PP6 A;  1EIO A;  2PY1 A;  4ZFX A;  3FDC A;  2R74 A;  1JV4 A;  2GC9 A;  1S44 A;  2QCB A;  3NQ3 A;  3RDQ A;  4GJS A;  1QFV A;  4BBO A;  2ALL X;  5LJB A;  1KGL A;  3FLL A;  1QFT A;  5FQ8 E;  3I0A A;  3FEL A;  4YKM A;  2IZK A;  4QNI A;  4YGZ A;  2OVD A;  2RTP B;  1K24 A;  4BCS A;  1KL5 A;  1VWC B;  1KQW A;  2OFM X;  2X56 A;  4MIS A;  4QZU A;  4NLI A;  4CPF A;  1OPA A;  5B2A O;  2CBS A;  1SLF B;  4YCE A;  4QGV A;  1D3S A;  3ZW2 A;  2EU7 X;  1MX8 A;  3I17 A;  1BM5 A;  1K3B A;  1VWF B;  2ASN X;  5H9A A;  2QO6 A;  5HTE A;  1ERB A;  1QY0 A;  2WSJ A;  4O3Z A;  2JU8 A;  2X34 A;  1SRG A;  2OVS A;  3APX A;  4I3B A;  5IXG A;  1E5P A;  1STP A;  2NNQ A;  1JZU A;  1WUB A;  3CKG A;  5FAZ A;  1LDQ A;  1MOY A;  3BRN A;  4TJZ A;  4DQ3 A;  2RTC B;  3ZW1 A;  1IW2 A;  2R73 A;  1EXS A;  2OY5 O;  5HBS A;  4ORR A;  1LIC A;  3P6D A;  5IRA A;  2FKJ A;  1T68 X;  1RXH A;  1SRH A;  2N93 A;  1DZJ A;  2LFO A;  2RTF B;  1PMP A;  3NPO A;  3STM X;  3STK A;  3WJG A;  4C5P A;  4FGI B;  5EZ2 A;  3PQS A;  1DC9 A;  3HTY A;  5HZQ A;  3VHM A;  2ACP X;  3BU1 A;  3LTW A;  2E4J A;  1SRJ A;  3EBW A;  4BVM A;  2AL0 X;  2RTG B;  4ZHG A;  4Z2P A;  4AZP A;  1EUO A;  1OBQ A;  1SY0 A;  3KFF A;  3PPT A;  5FEN A;  3ZW1 B;  1HQP A;  1IFB A;  3HOL A;  4I6S A;  1SRF A;  1T8V A;  2IFB A;  1G74 A;  3WZN A;  1SMP I;  2A5C A;  2JMB A;  1IKJ A;  1VWG B;  4KCA A;  1B0O A;  1CBR A;  2AF5 A;  2DJF A;  1HXL A;  1PBO A;  2BS6 A;  3Q6L A;  1VWQ B;  2K23 A;  1WBI A;  1B8E A;  2RTO B;  1SY3 A;  1W4T A;  2JGS A;  1T0V A;  4IAX A;  2OVA A;  2IZB A;  2GH7 A;  3EM0 A;  1LUQ A;  3OD9 A;  5HCE C;  1GX3 A;  3HWE A;  1U0X A;  1AVG I;  4MVL A;  1CBS A;  2NNE A;  4FBV A;  4I9R A;  3SAO A;  3FEN A;  1SWD A;  2L9C A;  5HZ9 A;  5D8J A;  1IIU A;  3EW1 A;  2L68 A;  1FE3 A;  1O1V A;  3AEH A;  3CKF A;  3JS1 A;  4KC7 A;  4EQA C;  2FR3 A;  3OE3 A;  3FA9 A;  2IZL B;  2OL6 O;  4YGH A;  4ES7 A;  1TXL A;  1Y9L A;  2KW1 A;  3NQ9 A;  2IZG B;  1A2D A;  1E00 A;  4ML7 B;  1ZNH A;  1BJ7 A;  3WBG A;  2ACO A;  2L67 A;  4Y5D A;  1X8N A;  1YUP A;  3MBT A;  3RDO A;  2RTE B;  3B2L A;  2HLV A;  4HWM A;  5LJG A;  3RE5 A;  2FRS A;  2FHL A;  2OF9 A;  2WEX A;  4AZQ A;  4ALO A;  1X8Q A;  2HKD A;  2FR2 A;  2RTK A;  1CRB A;  4PJ2 A;  3RZY A;  2MWH A;  4ID2 A;  1VWN B;  4HPB A;  1SWP A;  1SXY A;  5AJB A;  1LDO A;  4QZT A;  3GE2 A;  3KFI A;  3NQK A;  1N9Y A;  4TKH A;  3BDR A;  4IB7 A;  1JMZ A;  2W2A A;  2Y32 A;  4ODD A;  1HN2 A;  2A3F X;  2LBA A;  1ICM A;  2OY1 O;  1ICN A;  5EDC A;  4ORX A;  5BVS A;  2C1S A;  2OFB A;  1B4M A;  2CAM A;  2FS7 A;  1OEE A;  1W6F A;  3QQ2 A;  4GDA A;  4AZM A;  1EII A;  3RBY A;  4A1Y A;  3UEX A;  4OMX A;  5EEE A;  1FEL A;  1KXO A;  4GZV A;  2JU7 A;  1CBQ A;  3QKG A;  1SWA A;  1SWT A;  2CZT A;  3OBL A;  4GET A;  4OS8 A;  5F58 A;  3STN A;  4ORU A;  3HWG A;  4AZN A;  2X46 A;  4IB6 A;  3G7X A;  5IO6 A;  4BX6 A;  1GT5 A;  4GGZ A;  1SXX A;  3CQR A;  2BT9 A;  2UZ2 A;  4ARH A;  4YFR A;  4CDC A;  3WJF A;  1MX7 A;  1DF8 A;  4O49 A;  1FDQ A;  4IB8 A;  1JYJ A;  1AVD A;  1N9M A;  2F73 A;  1HMT A;  1ZRY A;  3EW2 A;  1AQB A;  2W2B A;  5H9K A;  4ZCB A;  1YIV A;  3ZZV A;  4D6B A;  2FLJ A;  4DQ4 A;  1BEB A;  2X45 A;  3LV4 A;  1SWK A;  2GTL M;  5B10 O;  1FEN A;  2I5V O;  5HZ6 A;  5BYP A;  2RTD B;  1I9H A;  3FMZ A;  4NNS A;  2RD7 C;  4DNE A;  3CBS A;  1NQM A;  4PSQ A;  4GKC A;  4R0B A;  4Z27 A;  5LKE A;  2AH7 X;  1I04 A;  1KOI A;  1KT6 A;  1QG5 A;  1RBP A;  4BX6 B;  3B2I A;  3PH5 A;  2A5B A;  3WJB A;  1VYG A;  4YFP A;  4GD9 A;  4GGR A;  1I78 A;  4YMY A;  4MVE A;  4EFG A;  1KZW A;  1SRE A;  3TGB A;  3WVM A;  1N43 A;  4JGL A;  3NBX X;  2YG2 A;  5HAE A;  1TOW A;  2JU3 A;  2FS6 A;  1KT3 A;  1RXK A;  2XKL A;  2RTJ A;  1JJU A;  2KTS A;  1EI5 A;  2M4L A;  3FW5 A;  1N4J A;  4ZGF A;  2IZD B;  4QAE A;  4U8U M;  3SLO A;  3MM0 A;  3WOV A;  2Y3E A;  4Y0S A;  5HCD C;  1SRI A;  2QM9 A;  3AKN A;  1HBP A;  2MHD A;  4OKA A;  2IZC B;  4JNJ A;  3C76 X;  1AVE A;  4LZV A;  5F1E A;  3PDF A;  3RDX A;  1XCA A;  1H91 A;  4A60 A;  4ZGU A;  2QOM A;  3DSZ A;  4Z2O A;  1KQX A;  1SWJ A;  2C4I A;  2XST A;  4JHQ A;  3VG6 A;  2RTL A;  2JOZ A;  1A3Y A;  2IZI A;  2X8F A;  4IB9 A;  4BJ8 A;  4MEE A;  4Y59 A;  4YBU A;  1RXJ A;  5B5F A;  5L8O A;  1JJX A;  1EQD A;  4EDE A;  2GTF X;  1Z24 A;  3BLG A;  3JQO A;  1YWB A;  1SWH A;  2RCQ A;  3D4R A;  1Y53 X;  2WQA E;  1LIB A;  4TKJ A;  4EEJ A;  2A2U A;  1EW3 A;  4D6A A;  2HZR A;  4L1N A;  4MIR A;  4NLJ A;  3UEW A;  1JYD A;  3T2W A;  1FTP A;  1VWA B;  3C77 X;  3VHI A;  2MM3 A;  1ACD A;  2OF8 A;  2RTN B;  3UEV A;  1QY1 A;  3SLT A;  3WJE A;  3T2X A;  4YH0 A; 
#chains in the Genus database with same CATH homology
 2C1Q A;  2IZG B;  1NDJ A;  4EKV A;  4CPH B;  4CPI A;  1VWP B;  2OFA A;  5JD2 A;  4U46 A;  5B5G A;  4Z6J A;  3RE6 A;  1NQN A;  1MM9 A;  4Y5D A;  3RDU A;  1SWQ A;  1VWB B;  3RDO A;  2RTE B;  3RE5 A;  2FHL A;  2OF9 A;  1SWF A;  1SWU A;  1KFF A;  1SWN A;  1Y52 X;  2RTK A;  2RTQ B;  3RDM A;  1VWN B;  2RTH B;  1SWP A;  3WZP A;  4BX5 B;  1LDO A;  1VWI B;  1N9Y A;  1SWE A;  1VWJ B;  3WZQ A;  4YVB A;  2G5L A;  2IZE B;  4BX7 A;  2RTR B;  2Y32 A;  1VWR B;  1SWR A;  4IRW A;  4BX5 A;  2C1S A;  1SWO A;  2OFB A;  3VHH A;  1VWK B;  1SLG B;  1VWD B;  2CAM A;  1HY2 A;  2BC3 A;  4GDA A;  2IZH B;  1SLE B;  3SZJ A;  5L3Y A;  1KL3 A;  2A8G A;  5CHK A;  3FDC A;  1SWA A;  1SWT A;  2QCB A;  3RDQ A;  4GJV A;  4GJS A;  3T6L A;  5IRU A;  2IZJ A;  4BBO A;  2Y3F A;  4BX7 B;  1N7Y A;  2IZK A;  2RTP B;  4BCS A;  1KL5 A;  1VWC B;  4CPF A;  5K67 A;  4BX6 A;  4GGZ A;  1SWL A;  2UZ2 A;  1VWE B;  5K68 A;  3SZH A;  1DF8 A;  1SLF B;  1HXZ A;  1AVD A;  1N9M A;  2IZA A;  3EW2 A;  2RTI B;  2RTM A;  4CPE A;  1VWF B;  1VWH B;  2RTA A;  2F01 A;  1SWK A;  1RSU B;  2RTB B;  1RAV A;  2RTD B;  1I9H A;  1SRG A;  4DNE A;  1NQM A;  1STS B;  1STP A;  4Z27 A;  2WPU A;  1VWL B;  1RST B;  4BX6 B;  3RY1 A;  1LDQ A;  1MOY A;  1SWB A;  2A5B A;  3T6F A;  2RTC B;  4GD9 A;  4GGR A;  3WYQ A;  4JO6 A;  1SRE A;  4Z2V A;  1N43 A;  1NC9 A;  1STR B;  5IRA A;  2AVI A;  1VWO B;  1LEL A;  1RXH A;  2RTF B;  1RXK A;  1SRH A;  3WYP A;  1MK5 A;  2RTJ A;  1Y55 X;  1N4J A;  2IZD B;  4Z28 A;  3VHM A;  3MM0 A;  1NBX A;  2Y3E A;  1SRI A;  3RDS A;  3SZI A;  4OKA A;  1SWG A;  1LCW A;  2FHN X;  2IZC B;  4JNJ A;  1SRJ A;  1AVE A;  2RTG B;  3RDX A;  2MF6 A;  4Z2P A;  1LCV A;  5IRW A;  3VGW A;  1MEP A;  3X00 A;  4Z2O A;  1SWJ A;  1SLD B;  2C4I A;  4JHQ A;  1SRF A;  2RTL A;  2IZF B;  3WZN A;  2IZI A;  2A5C A;  5B5F A;  3MG5 A;  4Y59 A;  4BJ8 A;  1HQQ A;  1RXJ A;  1VWG B;  1LCZ A;  1VWM B;  1HXL A;  4GGT A;  1KL4 A;  5F2B A;  4CPH A;  1IJ8 A;  1VWQ B;  1PTS A;  1WBI A;  2RTO B;  2JGS A;  1SWH A;  1SWC A;  1Y53 X;  4I60 A;  2IZB A;  2GH7 A;  1LUQ A;  3WZO A;  1SWS A;  1VYO A;  5CSE A;  3T2W A;  3PK2 A;  1SWD A;  1VWA B;  3VHI A;  2OF8 A;  2UYW A;  3EW1 A;  2RTN B;  3RY2 A;  3T2X A;  2ZSC A;  2IZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...