2RTFB

Streptavidin-biotin complex, ph 2.00, space group i222
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 25
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2rtfB00
2MF6A 1HQQA 1NQNA 1VWJB 1SLDB 4I60A 1N4JA 1NQMA 1NDJA 1SRGA 1AVEA 3T6LA 3RDSA 3EW1A 2OF8A 2RTPB 2FHLA 4CPHB 3WYPA 4U46A 1SLFB 2IZJA 2RTCB 2Y3FA 4GDAA 5F2BA 5IRAA 5CSEA 1SWPA 3RE6A 1VWDB 2IZLB 1Y52X 2OFAA 3WZQA 1HY2A 1NC9A 1LDOA 2RTIB 4YVBA 3X00A 1N9YA 4DNEA 2Y3EA 1SWOA 5IRUA 2RTJA 1SWLA 1SWUA 2C1SA 2IZAA 1VWHB 1SWEA 1VWOB 3SZIA 4CPHA 2RTGB 3WYQA 4CPFA 3EW2A 2F01A 2RTOB 1I9HA 4JNJA 1SWDA 4IRWA 1RXJA 2A8GA 4EKVA 2IZDB 5L3YA 1VWAB 1SWBA 2RTRB 4CPEA 1VWKB 4GGTA 1LUQA 1VWBB 2QCBA 4BX6A 4Z2OA 1RAVA 4Z6JA 4Z2VA 3VHHA 1LCVA 3WZPA 4BJ8A 1SRIA 1LDQA 2RTNB 3RE5A 1KL3A 1VWPB 5JD2A 1N7YA 2OF9A 3MM0A 4JHQA 3SZJA 1RXHA 3VGWA 1STRB 1SWKA 5CHKA 3FDCA 2AVIA 1KL4A 1LELA 5K68A 1VWLB 4Z28A 1RSTB 2FHNX 1SWCA 2RTLA 2ZSCA 1N9MA 2RTHB 4BBOA 2IZIA 2RTEB 2WPUA 3RDXA 2RTDB 1HXZA 5B5FA 1SWNA 1VWNB 1DF8A 3T6FA 2RTKA 3VHMA 1MK5A 1SRHA 1SREA 2IZKA 2IZGB 5IRWA 4JO6A 2GH7A 1SWTA 2IZBA 4BX7B 5K67A 1HXLA 4OKAA 1RSUB 1Y53X 1SLEB 1VYOA 3WZNA 5B5GA 1SWSA 3RDOA 1AVDA 1KL5A 3T2WA 1PTSA 1SWGA 1VWEB 3VHIA 2RTMA 2RTAA 1RXKA 1VWIB 1IJ8A 1Y55X 1VWRB 2C4IA 3T2XA 1MEPA 4CPIA 1SLGB 3RDMA 1NBXA 4Y5DA 1SWJA 1VWGB 1MM9A 2UYWA 4BX7A 1VWMB 4BX5B 2IZFB 1SWQA 3RDQA 1SWRA 1VWQB 3WZOA 2CAMA 4Z27A 1LCZA 3PK2A 4Y59A 2JGSA 2Y32A 3RDUA 4GGZA 3RY2A 2IZHB 2UZ2A 1SRFA 1KFFA 1STSB 1SWHA 1SWFA 2RTFB 2OFBA 1MOYA 2G5LA 4GD9A 2BC3A 1STPA 1VWCB 4GJSA 3SZHA 4BCSA 2IZEB 3MG5A 1N43A 4BX6B 1WBIA 4GJVA 4GGRA 2C1QA 2RTBB 4BX5A 3RY1A 1LCWA 1SWAA 2A5BA 2A5CA 2IZCB 2RTQB 1VWFB 4Z2PA 1SRJA
chains in the Genus database with same CATH superfamily
3RKGA 1HQQA 3SLTA 4YFRA 1NQNA 1KT3A 1IFCA 3MBTA 4DQ4A 1ICNA 4YFQA 1OEJA 1JV4A 3O2YA 2Q39A 4ORRA 1JYJA 1AVGI 4AZOA 4CSBA 2OF8A 4M6SA 1A57A 4GK9A 2RTPB 2JN3A 2AT3X 2WQ9A 4GZVA 4MVIA 4CPHB 3HTYA 1SLFB 2RTCB 2Y3FA 2R56A 3CKFA 1EIOA 1A18A 1SWPA 1LICA 1OPAA 1LIDA 1SY2A 1VWDB 2IZLB 2WQAE 1VYGA 4ORXA 1ACDA 1QY2A 2FGSA 2QO4A 1ERXA 3D95A 3RBYA 1NC9A 2Q4NA 1YWDA 1TOUA 3KVNA 5EEEA 2OVAA 4YKMA 4NV7A 1N9YA 3D4RA 1KOIA 1DV9A 1SWOA 2L68A 3APXA 1DFVA 4MVKA 3B2LA 1HMSA 1VWHB 3FLLA 1SWEA 3NP1A 4YFPA 4WBKA 2R74A 3WYQA 5HCEC 2YG2A 3EYCA 2F01A 3TF6A 4U8UN 1SWDA 5LKFA 4Y0SA 1KGLA 4FBVA 2E4JA 3CQRA 2QO5A 2AH7X 4EKVA 4B55A 1VWAB 4HFOA 1HBQA 4BX6A 1AB0A 1FELA 4Z2OA 1CBIA 2Q2PA 2G79A 1S7DA 1X8QA 1EW3A 4Y0PA 2CZTA 1LDQA 3RE5A 4ZHHA 1VWPB 1TXLA 4ORWA 4GE1A 4TNNA 1IKEA 4XMFA 1S44A 2FS7A 3FEPA 3NQ3A 4EEJA 2AT8X 1PMPA 1VWLB 2HKDA 2RTLA 1SWCA 3OE3A 1A2DA 2RTHB 3FR2A 2RTEB 3APUA 3I17A 2OY7A 1HXZA 1QY1A 1VWNB 1HMRA 2JU7A 5D4AA 3T6FA 2R73A 3VHMA 5DPQA 3FW5A 1SREA 2HZQA 2IZGB 3PEDA 1JIWI 5IRWA 2GH7A 4O4SA 1FE3A 4QZTA 3HK1A 4QZUA 2KW1A 4C5PA 5HZ5A 1ZNDA 5K67A 5LJHA 2FT9A 4OKAA 3WOVA 3TZSA 4TKBA 3VG3A 1NP1A 4OMXA 5B5GA 4ZR2A 2OY1O 4CDDA 1CJ5A 1SWGA 2RQ0A 3LHNA 2MHDA 3VHIA 2FLJA 2L5PA 1IJ8A 1B8EA 5H8TA 1JJJA 1T8VA 1LFOA 5DG4A 3FW4A 3VG5A 1PBYA 4MISA 4CPIA 5LJKA 3TGBA 3RDMA 3EC5A 4FBOA 1VWGB 4BX7A 5AJCA 1VWMB 3CMPA 5AJBA 3D9WA 3C78X 4YBPA 3LTWA 5H9LA 1E02A 2IZFB 1JJXA 4FQBB 1QY0A 4U8UO 1SWQA 5H9NA 1VWQB 2AT0X 2CAMA 2FKGA 1U0XA 4Z27A 1LCZA 2L67A 3KQ0A 3VG4A 1SY1A 3PK2A 4ZJ0A 5KHPA 3PP6A 5HZ8A 3AKNA 1LNMA 4TKJA 2X55A 3RDUA 4Y0RA 4KH8A 1ICMA 5BVQA 1SWFA 1CRBA 2HLVA 2QM9A 5BYPA 2X4MA 2BT9A 3FA6A 4ZH9A 1KZWA 1VWCB 4GJSA 5F1EA 4QQ1A 1MX8A 3MG5A 4GJVA 4GGRA 2C1QA 2G7BA 2P8GA 1NGLA 2RTBB 3HOEA 3NBXX 4M7MA 3RY1A 4L1NA 3STNA 1PBOA 1SWAA 2A5BA 3BRNA 2ASNX 3KFGA 3PQSA 2VDFA 2OL8O 2QMIA 1X8UA 1O8VA 1ERBA 2OY8A 1T68X 1VWJB 3NPOA 1FJ1E 3FYFA 4KCAA 4TKHA 4LKTA 1EQDA 2FS6A 3F9DA 4D6BA 1SRGA 4ES7A 4ZGUA 2GJ5A 4OEMA 2WEXA 1K24A 1AVEA 2CBSA 2KT4B 2L9CA 2NNDA 3EW1A 5H9KA 2WR6A 5HAEA 2OL7A 4YMYA 4YKOA 3P6HA 5HCCC 1EPAA 2CBRA 1BWYA 4YDBA 1YWCA 2GTLM 3FA9A 4I9SA 1YP7A 4NW4A 3JS1A 1EXSA 1Y52X 2OFAA 2DM5A 2ZAIA 1BLRA 1BM5A 2OZQA 1SXWA 2DJGA 3C77X 3OJYC 4YGHA 1HY2A 1SA8A 2EU7X 3FELA 4OMWA 2RTIB 3WZQA 2X8TA 2IFBA 5BVSA 3VE2A 4AW8A 2VFBA 4YVBA 2LFOA 3EBKA 2BSZA 5HZ9A 2QOSC 4IB6A 5IRUA 3STKA 3PECA 2W2AA 1SWUA 3WJGA 3OD9A 3Q6LA 2GC9A 5B3MO 1I78A 3WJCA 3SZIA 4CPHA 1MVGA 4O49A 3EW2A 4WFVA 4CPFA 1H91A 1IKJA 1I9HA 4IB8A 4JNJA 3CBCA 2LA7A 4O3XB 2QO6A 4IRWA 1RXJA 4ZGFA 5B10O 1CBRA 2Q2MA 1QFVA 3T1DA 3ZUIA 5L3YA 2RTRB 4CPEA 1LUQA 2AMMX 2OVSA 2JW1A 1W5RA 3KFHA 2LKKA 3VG7A 3EBWA 4Z6JA 2CM4A 1SRIA 1DC9A 5JD2A 2WSJA 4JHQA 3SZJA 3VGWA 3ZWEA 1GX3A 3AUMO 3V8UA 3FDCA 5C0NA 1YIVA 1S2PA 5D47A 1KL4A 3ZZVA 4O9SA 4U8UM 2WPUA 1G7NA 5K06A 3UEXA 4YH0A 2OVDA 2W2BA 2HYSA 4ODDA 4ORUA 2RTKA 5HZ6A 3WJEA 3PH6A 2LBAA 1DZJA 1UZ2X 5L8IA 1LF7A 4OELA 5HZQA 5B11O 4AZPA 3BX7A 1HBPA 1SWTA 1JBHA 3VU1A 1D3SA 4QAEA 5F58A 4I3BA 2DJFA 4HPDA 2HNXA 4IAWA 1Y53X 4FGIB 1SWSA 4N7DA 3S5VA 1KL5A 1VWEB 4GKCA 5D8JA 5FQ6E 3CKGA 2RTAA 1RXKA 1I04A 5EEDA 2RCTA 3B2HA 3UEVA 1L6MA 1VWRB 4U3QA 2C4IA 1I06A 3T2XA 1MEPA 4PSQA 2BS5A 1NBXA 3OBLA 1SWJA 4GDZA 2LBVA 4ZH6A 4PJ2A 1ALBA 1U17A 2O62A 4QYPA 2A2GA 3KFFA 1EI5A 1Z24A 3RDQA 2NNEA 3B2IA 4NYRA 2OVEA 4QYNA 3CBSA 4CDCA 5FAZA 4ZHGA 3IA8A 1YWBA 2JOZA 3P02A 1E06A 1W4TA 1SMPI 2JGSA 4Y59A 2F73A 1O1VA 1BSYA 3AKMA 3VG2A 3VG6A 3SAOA 4AZNA 3NR3A 1JMZA 1SRFA 1SY0A 1SWHA 4NLJA 2K23A 1BJ7A 2KTSA 1RBPA 4GD9A 2BC3A 4NP1A 3QQ2A 1STPA 1NP4A 3RZYA 4L3RA 1GX9A 3SZHA 4BCSA 1MX7A 1ZNLA 1N43A 1TOWA 4BX6B 1KXOA 4ZCBA 2FTBA 2OL6O 5HTEA 4XMEA 3FEKA 5FQ8E 3EM0A 4EDEA 2A0AA 3BDRA 5LJBA 1SRJA 4ZHCA 1KT6A 2X45A 3FENA 3MVFA 2X34A 5F7GA 1N4JA 1NQMA 1FENA 1X8NA 1R0UA 2MJIA 3MX7A 4CK4A 2F09A 1BSQA 3T6LA 4IBAA 2XSTA 3PQUA 3U0DA 4D6AA 1BRQA 4AYHA 1X89A 4LZVA 1IW2A 3C76X 4O4OA 2IZJA 1T0VA 3K3LA 3SLOA 5IO7A 3S60A 3RE6A 2G78A 4ZHDA 3BLGA 5HTDA 5IO6A 3GAQA 4GU8A 5CYBA 3ZW1B 4ZFXA 5LKEA 2X46A 4NNTA 2BHVA 1IIUA 1GT5A 5B2AO 2POAA 3Q34A 1HQPA 3WJDA 4KIIA 4XMHA 3X00A 1UYOX 3TGCA 1WUBA 3FR4A 4DNEA 3O19A 5D45A 1G85A 4EQAC 2IZAA 5HCDC 4MVEA 3RWXA 1VWOB 1LIFA 2RTGB 5HA1A 3FMZA 2HZRA 4AZRA 1JMXA 2WUTA 2YMSA 3STMX 4XMDA 1GKAB 4GNWA 3ZW0B 2ANSA 4ORYA 4A8ZA 2IZDB 1DZPA 1GX8A 1K3BA 1Y0GA 1SWBA 3CR6A 3P6EA 3PPTA 2CZUA 4I6SA 4NLIA 4ON1A 1RAVA 2FWVA 5AEOA 4WHIA 4Z2VA 1HN2A 1ZNGA 3E3CA 2RTNB 3WZPA 3TGAA 1KL3A 1N7YA 3MM0A 1B4MA 1I4UA 1KQXA 1STRB 1SWKA 3EMMA 3JSQA 5CHKA 3ZQ3A 4LQZA 4RUUA 4LKPA 2AVIA 4EFGA 5L8NA 1LELA 3GE2A 5K68A 3BX8A 2ZSCA 4BOEA 3RDXA 4O3WA 5B5FA 3P24A 1IFBA 2LB6A 4YCHA 3HWGA 1MK5A 1SRHA 3NADA 2HMBA 3N91A 2RN4A 2IZKA 3P6CA 1GGLA 1JYDA 2BLGA 2MWHA 4IB9A 1FDQA 4CV7A 1EALA 1GT4A 1JZUA 4QNIA 1P6PA 1I05A 3APVA 2FKJA 1EIIA 1GM6A 5EDCA 4UU3A 1BEBA 1HXLA 3H3IA 1ZNKA 1Y9LA 1VYOA 1JQPA 3AEHA 4ARHA 1AVDA 3B2KA 3T2WA 2GTLN 1PTSA 2NNQA 3G7XA 4NNSA 4YBUA 3UAQA 3NQ9A 2RTMA 1VWIB 3F8AA 1KT4A 2W2FA 4YCEA 5B29A 2JU3A 3ZI8A 1XCAA 2Z4IA 4I3DA 1XKIA 1SLGB 1Y9TA 4A1YA 4Y5DA 1MM9A 2UYWA 3CWKA 2AKQA 2A13A 3WXQA 4AZQA 4IMOA 4BX5B 2OFMX 1UREA 3ZW2A 2N93A 2JMBA 3U9PC 2BS6A 2FRSA 3S26A 5EDBA 1KZXA 3P6GA 2Y32A 3JQOA 4GGZA 3RY2A 5IO5A 3PH5A 2WWPA 1KFFA 3HWDA 5F6BA 2K62A 2RTFB 1EPBA 3HPEA 4O4XA 1MOYA 5CE4A 2ALLX 1GT3A 1MDCA 1LIBA 2QOMA 1KQWA 2AF5A 2ZAGA 1RLBE 1E00A 1ZRYA 2Q9SA 4KC8A 2A2UA 4BGFA 1SXUA 2IZCB 2RTQB 3BS2A 4OS0A 4TLJA 1VWFB 2G8CO 1AQBA 2MO5A 3FIQA 1BSOA 2MF6A 1ZNHA 5FENA 3F6ZB 4YGZA 5KIDA 1FTPA 1SLDB 3NX2A 4I60A 2AT6X 5H9AA 1NDJA 3NX1A 2PY1A 3P6DA 1A3YA 5KICA 1DF3A 3SLJA 4DQ3A 3FA8A 3RDSA 4HPBA 4LZUA 4MVLA 4CDEA 3HOLA 4FBRA 1G74A 3ELZA 3VE1A 2M4LA 4NYQA 2MM3A 2FHLA 4K19A 3WYPA 1QQSA 3NQKA 4GDAA 4I9RA 4MEEA 4U46A 5F2BA 5IRAA 5CSEA 4AZMA 4I3CA 1VYFA 2X32A 1OBUA 4O4UA 4GRJA 4I95A 5HWZA 2GTLO 1LDOA 4BVMA 1SXYA 5LJGA 1SY3A 4GNYA 4ML7B 2Z4HA 5LJCA 1E2TA 2JU8A 2Y3EA 3BU1A 3LV4A 2RTJA 1SWLA 4HPAA 2C1SA 3BY0A 3PDFA 2GTFX 1OSPO 3QKGA 4QGXA 3RSWA 1UYNX 3IFBA 1OPBA 1YP6A 2AT5X 1KT7A 1GT1A 1EUOA 1DZKA 1X8PA 2ACOA 4IAXA 2OY5O 2RTOB 3CQNA 4COTA 1OBPA 2A8GA 4HWMA 3FIDA 3ZW1A 1QWDA 1BBPA 1SXXA 4ID2A 4NV8A 1D2UA 1VWKB 4GGTA 1VWBB 2QCBA 3S5XA 1FEMA 3BSZE 4ZHFA 2X8SA 4MIRA 1O1UA 1VPRA 2I5ZO 5D48A 1QG5A 5JR8A 3VHHA 1LCVA 1LKEA 2XKLA 2PI3O 3SOTA 1ML7A 4BJ8A 2CM9A 2KTDA 5L8OA 2OF9A 4IMNA 1RXHA 4A60A 4GH7A 1TW4A 4HPCA 4R0BA 4YGGA 3WJBA 1JJUA 2AL0X 4RUNA 1GXAA 4UU2A 4O3ZA 4Z28A 1GKAA 1RSTB 2FHNX 3BU9A 3ZW0A 1DZMA 1N9MA 3ELXA 4TJZA 2IZIA 1MUPA 4BBOA 4IABA 2RTDB 1PEEA 3APWA 1SWNA 1DF8A 3WVMA 5LJDA 1YUPA 4O3YA 4ORSA 3HWEA 2RCQA 4KT5A 5AQ6A 5EPQA 1TVQA 2FR2A 4OS3A 1LIEA 3WJFA 2WEWA 3UEWA 1OEKA 3U03A 4JO6A 1ZNEA 2RA6A 2IZBA 1QFTA 1U18A 4A1HA 4BX7B 1KT5A 3DTQA 1E5PA 1N0SA 1OEEA 4QRLA 1G5WA 3ZUOA 2FR3A 2OYBO 4Y0QA 1RSUB 2KD2A 1SLEB 3WZNA 5LJEA 3KFIA 3RDOA 4QGVA 2OFRX 3L4RA 5B27A 4BQUA 1AELA 3VPJE 3FA7A 2A3FX 4GETA 1HMTA 4OS8A 3P6FA 1Y55X 1YWAA 1X8OA 1LPJA 2VFCA 4N7CA 5FQ7E 1B56A 4JGLA 4ALBA 5IXGA 2X56A 3KZAA 3O22A 3DSZA 1CBSA 5HBSA 3HWFA 4U9CA 1ADLA 2X8FA 4IB7A 1B0OA 1SWRA 4XMCA 3WZOA 4ALOA 3B2JA 4XMGA 4EXZA 1X71A 4DCBA 2I5VO 2IZHB 2UZ2A 4QGWA 1STSB 5F6ZA 3I0AA 2OFBA 5HA0A 4TQ2A 2G5LA 2ACPX 4INNA 3WBGA 5EZ2A 4WFUA 1W6FA 1BRPA 2IZEB 3UEUA 1OBQA 1WBIA 3FR5A 5BVTA 1PM1X 1QABE 3D97A 4BX5A 2RD7C 1LCWA 1CBQA 2A5CA 2NP1A 4YDAA 3D96A 4GUZA 4KC7A 5FFHA 4CDFA 4Z2PA
chains in the Genus database with same CATH topology
2MF6A 1HQQA 1NQNA 1VWJB 1SLDB 4I60A 1N4JA 1NQMA 1NDJA 1SRGA 1AVEA 3T6LA 3RDSA 3EW1A 2OF8A 2RTPB 2FHLA 4CPHB 3WYPA 4U46A 1SLFB 2IZJA 2RTCB 2Y3FA 4GDAA 5F2BA 5IRAA 5CSEA 1SWPA 3RE6A 1VWDB 2IZLB 1Y52X 2OFAA 3WZQA 1HY2A 1NC9A 1LDOA 2RTIB 4YVBA 3X00A 1N9YA 4DNEA 2Y3EA 1SWOA 5IRUA 2RTJA 1SWLA 1SWUA 2C1SA 2IZAA 1VWHB 1SWEA 1VWOB 3SZIA 4CPHA 2RTGB 3WYQA 4CPFA 3EW2A 2F01A 2RTOB 1I9HA 4JNJA 1SWDA 4IRWA 1RXJA 2A8GA 4EKVA 2IZDB 5L3YA 1VWAB 1SWBA 2RTRB 4CPEA 1VWKB 4GGTA 1LUQA 1VWBB 2QCBA 4BX6A 4Z2OA 1RAVA 4Z6JA 4Z2VA 3VHHA 1LCVA 3WZPA 4BJ8A 1SRIA 1LDQA 2RTNB 3RE5A 1KL3A 1VWPB 5JD2A 1N7YA 2OF9A 3MM0A 4JHQA 3SZJA 1RXHA 3VGWA 1STRB 1SWKA 5CHKA 3FDCA 2AVIA 1KL4A 1LELA 5K68A 1VWLB 4Z28A 1RSTB 2FHNX 1SWCA 2RTLA 2ZSCA 1N9MA 2RTHB 4BBOA 2IZIA 2RTEB 2WPUA 3RDXA 2RTDB 1HXZA 5B5FA 1SWNA 1VWNB 1DF8A 3T6FA 2RTKA 3VHMA 1MK5A 1SRHA 1SREA 2IZKA 2IZGB 5IRWA 4JO6A 2GH7A 1SWTA 2IZBA 4BX7B 5K67A 1HXLA 4OKAA 1RSUB 1Y53X 1SLEB 1VYOA 3WZNA 5B5GA 1SWSA 3RDOA 1AVDA 1KL5A 3T2WA 1PTSA 1SWGA 1VWEB 3VHIA 2RTMA 2RTAA 1RXKA 1VWIB 1IJ8A 1Y55X 1VWRB 2C4IA 3T2XA 1MEPA 4CPIA 1SLGB 3RDMA 1NBXA 4Y5DA 1SWJA 1VWGB 1MM9A 2UYWA 4BX7A 1VWMB 4BX5B 2IZFB 1SWQA 3RDQA 1SWRA 1VWQB 3WZOA 2CAMA 4Z27A 1LCZA 3PK2A 4Y59A 2JGSA 2Y32A 3RDUA 4GGZA 3RY2A 2IZHB 2UZ2A 1SRFA 1KFFA 1STSB 1SWHA 1SWFA 2RTFB 2OFBA 1MOYA 2G5LA 4GD9A 2BC3A 1STPA 1VWCB 4GJSA 3SZHA 4BCSA 2IZEB 3MG5A 1N43A 4BX6B 1WBIA 4GJVA 4GGRA 2C1QA 2RTBB 4BX5A 3RY1A 1LCWA 1SWAA 2A5BA 2A5CA 2IZCB 2RTQB 1VWFB 4Z2PA 1SRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF6 A;  1HQQ A;  1NQN A;  1VWJ B;  1SLD B;  4I60 A;  1N4J A;  1NQM A;  1NDJ A;  1SRG A;  1AVE A;  3T6L A;  3RDS A;  3EW1 A;  2OF8 A;  2RTP B;  2FHL A;  4CPH B;  3WYP A;  4U46 A;  1SLF B;  2IZJ A;  2RTC B;  2Y3F A;  4GDA A;  5F2B A;  5IRA A;  5CSE A;  1SWP A;  3RE6 A;  1VWD B;  2IZL B;  1Y52 X;  2OFA A;  3WZQ A;  1HY2 A;  1NC9 A;  1LDO A;  2RTI B;  4YVB A;  3X00 A;  1N9Y A;  4DNE A;  2Y3E A;  1SWO A;  5IRU A;  2RTJ A;  1SWL A;  1SWU A;  2C1S A;  2IZA A;  1VWH B;  1SWE A;  1VWO B;  3SZI A;  4CPH A;  2RTG B;  3WYQ A;  4CPF A;  3EW2 A;  2F01 A;  2RTO B;  1I9H A;  4JNJ A;  1SWD A;  4IRW A;  1RXJ A;  2A8G A;  4EKV A;  2IZD B;  5L3Y A;  1VWA B;  1SWB A;  2RTR B;  4CPE A;  1VWK B;  4GGT A;  1LUQ A;  1VWB B;  2QCB A;  4BX6 A;  4Z2O A;  1RAV A;  4Z6J A;  4Z2V A;  3VHH A;  1LCV A;  3WZP A;  4BJ8 A;  1SRI A;  1LDQ A;  2RTN B;  3RE5 A;  1KL3 A;  1VWP B;  5JD2 A;  1N7Y A;  2OF9 A;  3MM0 A;  4JHQ A;  3SZJ A;  1RXH A;  3VGW A;  1STR B;  1SWK A;  5CHK A;  3FDC A;  2AVI A;  1KL4 A;  1LEL A;  5K68 A;  1VWL B;  4Z28 A;  1RST B;  2FHN X;  1SWC A;  2RTL A;  2ZSC A;  1N9M A;  2RTH B;  4BBO A;  2IZI A;  2RTE B;  2WPU A;  3RDX A;  2RTD B;  1HXZ A;  5B5F A;  1SWN A;  1VWN B;  1DF8 A;  3T6F A;  2RTK A;  3VHM A;  1MK5 A;  1SRH A;  1SRE A;  2IZK A;  2IZG B;  5IRW A;  4JO6 A;  2GH7 A;  1SWT A;  2IZB A;  4BX7 B;  5K67 A;  1HXL A;  4OKA A;  1RSU B;  1Y53 X;  1SLE B;  1VYO A;  3WZN A;  5B5G A;  1SWS A;  3RDO A;  1AVD A;  1KL5 A;  3T2W A;  1PTS A;  1SWG A;  1VWE B;  3VHI A;  2RTM A;  2RTA A;  1RXK A;  1VWI B;  1IJ8 A;  1Y55 X;  1VWR B;  2C4I A;  3T2X A;  1MEP A;  4CPI A;  1SLG B;  3RDM A;  1NBX A;  4Y5D A;  1SWJ A;  1VWG B;  1MM9 A;  2UYW A;  4BX7 A;  1VWM B;  4BX5 B;  2IZF B;  1SWQ A;  3RDQ A;  1SWR A;  1VWQ B;  3WZO A;  2CAM A;  4Z27 A;  1LCZ A;  3PK2 A;  4Y59 A;  2JGS A;  2Y32 A;  3RDU A;  4GGZ A;  3RY2 A;  2IZH B;  2UZ2 A;  1SRF A;  1KFF A;  1STS B;  1SWH A;  1SWF A;  2RTF B;  2OFB A;  1MOY A;  2G5L A;  4GD9 A;  2BC3 A;  1STP A;  1VWC B;  4GJS A;  3SZH A;  4BCS A;  2IZE B;  3MG5 A;  1N43 A;  4BX6 B;  1WBI A;  4GJV A;  4GGR A;  2C1Q A;  2RTB B;  4BX5 A;  3RY1 A;  1LCW A;  1SWA A;  2A5B A;  2A5C A;  2IZC B;  2RTQ B;  1VWF B;  4Z2P A;  1SRJ A; 
#chains in the Genus database with same CATH topology
 3RKG A;  1HQQ A;  3SLT A;  4YFR A;  1NQN A;  1KT3 A;  1IFC A;  3MBT A;  4DQ4 A;  1ICN A;  4YFQ A;  1OEJ A;  1JV4 A;  3O2Y A;  2Q39 A;  4ORR A;  1JYJ A;  1AVG I;  4AZO A;  4CSB A;  2OF8 A;  4M6S A;  1A57 A;  4GK9 A;  2RTP B;  2JN3 A;  2AT3 X;  2WQ9 A;  4GZV A;  4MVI A;  4CPH B;  3HTY A;  1SLF B;  2RTC B;  2Y3F A;  2R56 A;  3CKF A;  1EIO A;  1A18 A;  1SWP A;  1LIC A;  1OPA A;  1LID A;  1SY2 A;  1VWD B;  2IZL B;  2WQA E;  1VYG A;  4ORX A;  1ACD A;  1QY2 A;  2FGS A;  2QO4 A;  1ERX A;  3D95 A;  3RBY A;  1NC9 A;  2Q4N A;  1YWD A;  1TOU A;  3KVN A;  5EEE A;  2OVA A;  4YKM A;  4NV7 A;  1N9Y A;  3D4R A;  1KOI A;  1DV9 A;  1SWO A;  2L68 A;  3APX A;  1DFV A;  4MVK A;  3B2L A;  1HMS A;  1VWH B;  3FLL A;  1SWE A;  3NP1 A;  4YFP A;  4WBK A;  2R74 A;  3WYQ A;  5HCE C;  2YG2 A;  3EYC A;  2F01 A;  3TF6 A;  4U8U N;  1SWD A;  5LKF A;  4Y0S A;  1KGL A;  4FBV A;  2E4J A;  3CQR A;  2QO5 A;  2AH7 X;  4EKV A;  4B55 A;  1VWA B;  4HFO A;  1HBQ A;  4BX6 A;  1AB0 A;  1FEL A;  4Z2O A;  1CBI A;  2Q2P A;  2G79 A;  1S7D A;  1X8Q A;  1EW3 A;  4Y0P A;  2CZT A;  1LDQ A;  3RE5 A;  4ZHH A;  1VWP B;  1TXL A;  4ORW A;  4GE1 A;  4TNN A;  1IKE A;  4XMF A;  1S44 A;  2FS7 A;  3FEP A;  3NQ3 A;  4EEJ A;  2AT8 X;  1PMP A;  1VWL B;  2HKD A;  2RTL A;  1SWC A;  3OE3 A;  1A2D A;  2RTH B;  3FR2 A;  2RTE B;  3APU A;  3I17 A;  2OY7 A;  1HXZ A;  1QY1 A;  1VWN B;  1HMR A;  2JU7 A;  5D4A A;  3T6F A;  2R73 A;  3VHM A;  5DPQ A;  3FW5 A;  1SRE A;  2HZQ A;  2IZG B;  3PED A;  1JIW I;  5IRW A;  2GH7 A;  4O4S A;  1FE3 A;  4QZT A;  3HK1 A;  4QZU A;  2KW1 A;  4C5P A;  5HZ5 A;  1ZND A;  5K67 A;  5LJH A;  2FT9 A;  4OKA A;  3WOV A;  3TZS A;  4TKB A;  3VG3 A;  1NP1 A;  4OMX A;  5B5G A;  4ZR2 A;  2OY1 O;  4CDD A;  1CJ5 A;  1SWG A;  2RQ0 A;  3LHN A;  2MHD A;  3VHI A;  2FLJ A;  2L5P A;  1IJ8 A;  1B8E A;  5H8T A;  1JJJ A;  1T8V A;  1LFO A;  5DG4 A;  3FW4 A;  3VG5 A;  1PBY A;  4MIS A;  4CPI A;  5LJK A;  3TGB A;  3RDM A;  3EC5 A;  4FBO A;  1VWG B;  4BX7 A;  5AJC A;  1VWM B;  3CMP A;  5AJB A;  3D9W A;  3C78 X;  4YBP A;  3LTW A;  5H9L A;  1E02 A;  2IZF B;  1JJX A;  4FQB B;  1QY0 A;  4U8U O;  1SWQ A;  5H9N A;  1VWQ B;  2AT0 X;  2CAM A;  2FKG A;  1U0X A;  4Z27 A;  1LCZ A;  2L67 A;  3KQ0 A;  3VG4 A;  1SY1 A;  3PK2 A;  4ZJ0 A;  5KHP A;  3PP6 A;  5HZ8 A;  3AKN A;  1LNM A;  4TKJ A;  2X55 A;  3RDU A;  4Y0R A;  4KH8 A;  1ICM A;  5BVQ A;  1SWF A;  1CRB A;  2HLV A;  2QM9 A;  5BYP A;  2X4M A;  2BT9 A;  3FA6 A;  4ZH9 A;  1KZW A;  1VWC B;  4GJS A;  5F1E A;  4QQ1 A;  1MX8 A;  3MG5 A;  4GJV A;  4GGR A;  2C1Q A;  2G7B A;  2P8G A;  1NGL A;  2RTB B;  3HOE A;  3NBX X;  4M7M A;  3RY1 A;  4L1N A;  3STN A;  1PBO A;  1SWA A;  2A5B A;  3BRN A;  2ASN X;  3KFG A;  3PQS A;  2VDF A;  2OL8 O;  2QMI A;  1X8U A;  1O8V A;  1ERB A;  2OY8 A;  1T68 X;  1VWJ B;  3NPO A;  1FJ1 E;  3FYF A;  4KCA A;  4TKH A;  4LKT A;  1EQD A;  2FS6 A;  3F9D A;  4D6B A;  1SRG A;  4ES7 A;  4ZGU A;  2GJ5 A;  4OEM A;  2WEX A;  1K24 A;  1AVE A;  2CBS A;  2KT4 B;  2L9C A;  2NND A;  3EW1 A;  5H9K A;  2WR6 A;  5HAE A;  2OL7 A;  4YMY A;  4YKO A;  3P6H A;  5HCC C;  1EPA A;  2CBR A;  1BWY A;  4YDB A;  1YWC A;  2GTL M;  3FA9 A;  4I9S A;  1YP7 A;  4NW4 A;  3JS1 A;  1EXS A;  1Y52 X;  2OFA A;  2DM5 A;  2ZAI A;  1BLR A;  1BM5 A;  2OZQ A;  1SXW A;  2DJG A;  3C77 X;  3OJY C;  4YGH A;  1HY2 A;  1SA8 A;  2EU7 X;  3FEL A;  4OMW A;  2RTI B;  3WZQ A;  2X8T A;  2IFB A;  5BVS A;  3VE2 A;  4AW8 A;  2VFB A;  4YVB A;  2LFO A;  3EBK A;  2BSZ A;  5HZ9 A;  2QOS C;  4IB6 A;  5IRU A;  3STK A;  3PEC A;  2W2A A;  1SWU A;  3WJG A;  3OD9 A;  3Q6L A;  2GC9 A;  5B3M O;  1I78 A;  3WJC A;  3SZI A;  4CPH A;  1MVG A;  4O49 A;  3EW2 A;  4WFV A;  4CPF A;  1H91 A;  1IKJ A;  1I9H A;  4IB8 A;  4JNJ A;  3CBC A;  2LA7 A;  4O3X B;  2QO6 A;  4IRW A;  1RXJ A;  4ZGF A;  5B10 O;  1CBR A;  2Q2M A;  1QFV A;  3T1D A;  3ZUI A;  5L3Y A;  2RTR B;  4CPE A;  1LUQ A;  2AMM X;  2OVS A;  2JW1 A;  1W5R A;  3KFH A;  2LKK A;  3VG7 A;  3EBW A;  4Z6J A;  2CM4 A;  1SRI A;  1DC9 A;  5JD2 A;  2WSJ A;  4JHQ A;  3SZJ A;  3VGW A;  3ZWE A;  1GX3 A;  3AUM O;  3V8U A;  3FDC A;  5C0N A;  1YIV A;  1S2P A;  5D47 A;  1KL4 A;  3ZZV A;  4O9S A;  4U8U M;  2WPU A;  1G7N A;  5K06 A;  3UEX A;  4YH0 A;  2OVD A;  2W2B A;  2HYS A;  4ODD A;  4ORU A;  2RTK A;  5HZ6 A;  3WJE A;  3PH6 A;  2LBA A;  1DZJ A;  1UZ2 X;  5L8I A;  1LF7 A;  4OEL A;  5HZQ A;  5B11 O;  4AZP A;  3BX7 A;  1HBP A;  1SWT A;  1JBH A;  3VU1 A;  1D3S A;  4QAE A;  5F58 A;  4I3B A;  2DJF A;  4HPD A;  2HNX A;  4IAW A;  1Y53 X;  4FGI B;  1SWS A;  4N7D A;  3S5V A;  1KL5 A;  1VWE B;  4GKC A;  5D8J A;  5FQ6 E;  3CKG A;  2RTA A;  1RXK A;  1I04 A;  5EED A;  2RCT A;  3B2H A;  3UEV A;  1L6M A;  1VWR B;  4U3Q A;  2C4I A;  1I06 A;  3T2X A;  1MEP A;  4PSQ A;  2BS5 A;  1NBX A;  3OBL A;  1SWJ A;  4GDZ A;  2LBV A;  4ZH6 A;  4PJ2 A;  1ALB A;  1U17 A;  2O62 A;  4QYP A;  2A2G A;  3KFF A;  1EI5 A;  1Z24 A;  3RDQ A;  2NNE A;  3B2I A;  4NYR A;  2OVE A;  4QYN A;  3CBS A;  4CDC A;  5FAZ A;  4ZHG A;  3IA8 A;  1YWB A;  2JOZ A;  3P02 A;  1E06 A;  1W4T A;  1SMP I;  2JGS A;  4Y59 A;  2F73 A;  1O1V A;  1BSY A;  3AKM A;  3VG2 A;  3VG6 A;  3SAO A;  4AZN A;  3NR3 A;  1JMZ A;  1SRF A;  1SY0 A;  1SWH A;  4NLJ A;  2K23 A;  1BJ7 A;  2KTS A;  1RBP A;  4GD9 A;  2BC3 A;  4NP1 A;  3QQ2 A;  1STP A;  1NP4 A;  3RZY A;  4L3R A;  1GX9 A;  3SZH A;  4BCS A;  1MX7 A;  1ZNL A;  1N43 A;  1TOW A;  4BX6 B;  1KXO A;  4ZCB A;  2FTB A;  2OL6 O;  5HTE A;  4XME A;  3FEK A;  5FQ8 E;  3EM0 A;  4EDE A;  2A0A A;  3BDR A;  5LJB A;  1SRJ A;  4ZHC A;  1KT6 A;  2X45 A;  3FEN A;  3MVF A;  2X34 A;  5F7G A;  1N4J A;  1NQM A;  1FEN A;  1X8N A;  1R0U A;  2MJI A;  3MX7 A;  4CK4 A;  2F09 A;  1BSQ A;  3T6L A;  4IBA A;  2XST A;  3PQU A;  3U0D A;  4D6A A;  1BRQ A;  4AYH A;  1X89 A;  4LZV A;  1IW2 A;  3C76 X;  4O4O A;  2IZJ A;  1T0V A;  3K3L A;  3SLO A;  5IO7 A;  3S60 A;  3RE6 A;  2G78 A;  4ZHD A;  3BLG A;  5HTD A;  5IO6 A;  3GAQ A;  4GU8 A;  5CYB A;  3ZW1 B;  4ZFX A;  5LKE A;  2X46 A;  4NNT A;  2BHV A;  1IIU A;  1GT5 A;  5B2A O;  2POA A;  3Q34 A;  1HQP A;  3WJD A;  4KII A;  4XMH A;  3X00 A;  1UYO X;  3TGC A;  1WUB A;  3FR4 A;  4DNE A;  3O19 A;  5D45 A;  1G85 A;  4EQA C;  2IZA A;  5HCD C;  4MVE A;  3RWX A;  1VWO B;  1LIF A;  2RTG B;  5HA1 A;  3FMZ A;  2HZR A;  4AZR A;  1JMX A;  2WUT A;  2YMS A;  3STM X;  4XMD A;  1GKA B;  4GNW A;  3ZW0 B;  2ANS A;  4ORY A;  4A8Z A;  2IZD B;  1DZP A;  1GX8 A;  1K3B A;  1Y0G A;  1SWB A;  3CR6 A;  3P6E A;  3PPT A;  2CZU A;  4I6S A;  4NLI A;  4ON1 A;  1RAV A;  2FWV A;  5AEO A;  4WHI A;  4Z2V A;  1HN2 A;  1ZNG A;  3E3C A;  2RTN B;  3WZP A;  3TGA A;  1KL3 A;  1N7Y A;  3MM0 A;  1B4M A;  1I4U A;  1KQX A;  1STR B;  1SWK A;  3EMM A;  3JSQ A;  5CHK A;  3ZQ3 A;  4LQZ A;  4RUU A;  4LKP A;  2AVI A;  4EFG A;  5L8N A;  1LEL A;  3GE2 A;  5K68 A;  3BX8 A;  2ZSC A;  4BOE A;  3RDX A;  4O3W A;  5B5F A;  3P24 A;  1IFB A;  2LB6 A;  4YCH A;  3HWG A;  1MK5 A;  1SRH A;  3NAD A;  2HMB A;  3N91 A;  2RN4 A;  2IZK A;  3P6C A;  1GGL A;  1JYD A;  2BLG A;  2MWH A;  4IB9 A;  1FDQ A;  4CV7 A;  1EAL A;  1GT4 A;  1JZU A;  4QNI A;  1P6P A;  1I05 A;  3APV A;  2FKJ A;  1EII A;  1GM6 A;  5EDC A;  4UU3 A;  1BEB A;  1HXL A;  3H3I A;  1ZNK A;  1Y9L A;  1VYO A;  1JQP A;  3AEH A;  4ARH A;  1AVD A;  3B2K A;  3T2W A;  2GTL N;  1PTS A;  2NNQ A;  3G7X A;  4NNS A;  4YBU A;  3UAQ A;  3NQ9 A;  2RTM A;  1VWI B;  3F8A A;  1KT4 A;  2W2F A;  4YCE A;  5B29 A;  2JU3 A;  3ZI8 A;  1XCA A;  2Z4I A;  4I3D A;  1XKI A;  1SLG B;  1Y9T A;  4A1Y A;  4Y5D A;  1MM9 A;  2UYW A;  3CWK A;  2AKQ A;  2A13 A;  3WXQ A;  4AZQ A;  4IMO A;  4BX5 B;  2OFM X;  1URE A;  3ZW2 A;  2N93 A;  2JMB A;  3U9P C;  2BS6 A;  2FRS A;  3S26 A;  5EDB A;  1KZX A;  3P6G A;  2Y32 A;  3JQO A;  4GGZ A;  3RY2 A;  5IO5 A;  3PH5 A;  2WWP A;  1KFF A;  3HWD A;  5F6B A;  2K62 A;  2RTF B;  1EPB A;  3HPE A;  4O4X A;  1MOY A;  5CE4 A;  2ALL X;  1GT3 A;  1MDC A;  1LIB A;  2QOM A;  1KQW A;  2AF5 A;  2ZAG A;  1RLB E;  1E00 A;  1ZRY A;  2Q9S A;  4KC8 A;  2A2U A;  4BGF A;  1SXU A;  2IZC B;  2RTQ B;  3BS2 A;  4OS0 A;  4TLJ A;  1VWF B;  2G8C O;  1AQB A;  2MO5 A;  3FIQ A;  1BSO A;  2MF6 A;  1ZNH A;  5FEN A;  3F6Z B;  4YGZ A;  5KID A;  1FTP A;  1SLD B;  3NX2 A;  4I60 A;  2AT6 X;  5H9A A;  1NDJ A;  3NX1 A;  2PY1 A;  3P6D A;  1A3Y A;  5KIC A;  1DF3 A;  3SLJ A;  4DQ3 A;  3FA8 A;  3RDS A;  4HPB A;  4LZU A;  4MVL A;  4CDE A;  3HOL A;  4FBR A;  1G74 A;  3ELZ A;  3VE1 A;  2M4L A;  4NYQ A;  2MM3 A;  2FHL A;  4K19 A;  3WYP A;  1QQS A;  3NQK A;  4GDA A;  4I9R A;  4MEE A;  4U46 A;  5F2B A;  5IRA A;  5CSE A;  4AZM A;  4I3C A;  1VYF A;  2X32 A;  1OBU A;  4O4U A;  4GRJ A;  4I95 A;  5HWZ A;  2GTL O;  1LDO A;  4BVM A;  1SXY A;  5LJG A;  1SY3 A;  4GNY A;  4ML7 B;  2Z4H A;  5LJC A;  1E2T A;  2JU8 A;  2Y3E A;  3BU1 A;  3LV4 A;  2RTJ A;  1SWL A;  4HPA A;  2C1S A;  3BY0 A;  3PDF A;  2GTF X;  1OSP O;  3QKG A;  4QGX A;  3RSW A;  1UYN X;  3IFB A;  1OPB A;  1YP6 A;  2AT5 X;  1KT7 A;  1GT1 A;  1EUO A;  1DZK A;  1X8P A;  2ACO A;  4IAX A;  2OY5 O;  2RTO B;  3CQN A;  4COT A;  1OBP A;  2A8G A;  4HWM A;  3FID A;  3ZW1 A;  1QWD A;  1BBP A;  1SXX A;  4ID2 A;  4NV8 A;  1D2U A;  1VWK B;  4GGT A;  1VWB B;  2QCB A;  3S5X A;  1FEM A;  3BSZ E;  4ZHF A;  2X8S A;  4MIR A;  1O1U A;  1VPR A;  2I5Z O;  5D48 A;  1QG5 A;  5JR8 A;  3VHH A;  1LCV A;  1LKE A;  2XKL A;  2PI3 O;  3SOT A;  1ML7 A;  4BJ8 A;  2CM9 A;  2KTD A;  5L8O A;  2OF9 A;  4IMN A;  1RXH A;  4A60 A;  4GH7 A;  1TW4 A;  4HPC A;  4R0B A;  4YGG A;  3WJB A;  1JJU A;  2AL0 X;  4RUN A;  1GXA A;  4UU2 A;  4O3Z A;  4Z28 A;  1GKA A;  1RST B;  2FHN X;  3BU9 A;  3ZW0 A;  1DZM A;  1N9M A;  3ELX A;  4TJZ A;  2IZI A;  1MUP A;  4BBO A;  4IAB A;  2RTD B;  1PEE A;  3APW A;  1SWN A;  1DF8 A;  3WVM A;  5LJD A;  1YUP A;  4O3Y A;  4ORS A;  3HWE A;  2RCQ A;  4KT5 A;  5AQ6 A;  5EPQ A;  1TVQ A;  2FR2 A;  4OS3 A;  1LIE A;  3WJF A;  2WEW A;  3UEW A;  1OEK A;  3U03 A;  4JO6 A;  1ZNE A;  2RA6 A;  2IZB A;  1QFT A;  1U18 A;  4A1H A;  4BX7 B;  1KT5 A;  3DTQ A;  1E5P A;  1N0S A;  1OEE A;  4QRL A;  1G5W A;  3ZUO A;  2FR3 A;  2OYB O;  4Y0Q A;  1RSU B;  2KD2 A;  1SLE B;  3WZN A;  5LJE A;  3KFI A;  3RDO A;  4QGV A;  2OFR X;  3L4R A;  5B27 A;  4BQU A;  1AEL A;  3VPJ E;  3FA7 A;  2A3F X;  4GET A;  1HMT A;  4OS8 A;  3P6F A;  1Y55 X;  1YWA A;  1X8O A;  1LPJ A;  2VFC A;  4N7C A;  5FQ7 E;  1B56 A;  4JGL A;  4ALB A;  5IXG A;  2X56 A;  3KZA A;  3O22 A;  3DSZ A;  1CBS A;  5HBS A;  3HWF A;  4U9C A;  1ADL A;  2X8F A;  4IB7 A;  1B0O A;  1SWR A;  4XMC A;  3WZO A;  4ALO A;  3B2J A;  4XMG A;  4EXZ A;  1X71 A;  4DCB A;  2I5V O;  2IZH B;  2UZ2 A;  4QGW A;  1STS B;  5F6Z A;  3I0A A;  2OFB A;  5HA0 A;  4TQ2 A;  2G5L A;  2ACP X;  4INN A;  3WBG A;  5EZ2 A;  4WFU A;  1W6F A;  1BRP A;  2IZE B;  3UEU A;  1OBQ A;  1WBI A;  3FR5 A;  5BVT A;  1PM1 X;  1QAB E;  3D97 A;  4BX5 A;  2RD7 C;  1LCW A;  1CBQ A;  2A5C A;  2NP1 A;  4YDA A;  3D96 A;  4GUZ A;  4KC7 A;  5FFH A;  4CDF A;  4Z2P A; 
#chains in the Genus database with same CATH homology
 2MF6 A;  1HQQ A;  1NQN A;  1VWJ B;  1SLD B;  4I60 A;  1N4J A;  1NQM A;  1NDJ A;  1SRG A;  1AVE A;  3T6L A;  3RDS A;  3EW1 A;  2OF8 A;  2RTP B;  2FHL A;  4CPH B;  3WYP A;  4U46 A;  1SLF B;  2IZJ A;  2RTC B;  2Y3F A;  4GDA A;  5F2B A;  5IRA A;  5CSE A;  1SWP A;  3RE6 A;  1VWD B;  2IZL B;  1Y52 X;  2OFA A;  3WZQ A;  1HY2 A;  1NC9 A;  1LDO A;  2RTI B;  4YVB A;  3X00 A;  1N9Y A;  4DNE A;  2Y3E A;  1SWO A;  5IRU A;  2RTJ A;  1SWL A;  1SWU A;  2C1S A;  2IZA A;  1VWH B;  1SWE A;  1VWO B;  3SZI A;  4CPH A;  2RTG B;  3WYQ A;  4CPF A;  3EW2 A;  2F01 A;  2RTO B;  1I9H A;  4JNJ A;  1SWD A;  4IRW A;  1RXJ A;  2A8G A;  4EKV A;  2IZD B;  5L3Y A;  1VWA B;  1SWB A;  2RTR B;  4CPE A;  1VWK B;  4GGT A;  1LUQ A;  1VWB B;  2QCB A;  4BX6 A;  4Z2O A;  1RAV A;  4Z6J A;  4Z2V A;  3VHH A;  1LCV A;  3WZP A;  4BJ8 A;  1SRI A;  1LDQ A;  2RTN B;  3RE5 A;  1KL3 A;  1VWP B;  5JD2 A;  1N7Y A;  2OF9 A;  3MM0 A;  4JHQ A;  3SZJ A;  1RXH A;  3VGW A;  1STR B;  1SWK A;  5CHK A;  3FDC A;  2AVI A;  1KL4 A;  1LEL A;  5K68 A;  1VWL B;  4Z28 A;  1RST B;  2FHN X;  1SWC A;  2RTL A;  2ZSC A;  1N9M A;  2RTH B;  4BBO A;  2IZI A;  2RTE B;  2WPU A;  3RDX A;  2RTD B;  1HXZ A;  5B5F A;  1SWN A;  1VWN B;  1DF8 A;  3T6F A;  2RTK A;  3VHM A;  1MK5 A;  1SRH A;  1SRE A;  2IZK A;  2IZG B;  5IRW A;  4JO6 A;  2GH7 A;  1SWT A;  2IZB A;  4BX7 B;  5K67 A;  1HXL A;  4OKA A;  1RSU B;  1Y53 X;  1SLE B;  1VYO A;  3WZN A;  5B5G A;  1SWS A;  3RDO A;  1AVD A;  1KL5 A;  3T2W A;  1PTS A;  1SWG A;  1VWE B;  3VHI A;  2RTM A;  2RTA A;  1RXK A;  1VWI B;  1IJ8 A;  1Y55 X;  1VWR B;  2C4I A;  3T2X A;  1MEP A;  4CPI A;  1SLG B;  3RDM A;  1NBX A;  4Y5D A;  1SWJ A;  1VWG B;  1MM9 A;  2UYW A;  4BX7 A;  1VWM B;  4BX5 B;  2IZF B;  1SWQ A;  3RDQ A;  1SWR A;  1VWQ B;  3WZO A;  2CAM A;  4Z27 A;  1LCZ A;  3PK2 A;  4Y59 A;  2JGS A;  2Y32 A;  3RDU A;  4GGZ A;  3RY2 A;  2IZH B;  2UZ2 A;  1SRF A;  1KFF A;  1STS B;  1SWH A;  1SWF A;  2RTF B;  2OFB A;  1MOY A;  2G5L A;  4GD9 A;  2BC3 A;  1STP A;  1VWC B;  4GJS A;  3SZH A;  4BCS A;  2IZE B;  3MG5 A;  1N43 A;  4BX6 B;  1WBI A;  4GJV A;  4GGR A;  2C1Q A;  2RTB B;  4BX5 A;  3RY1 A;  1LCW A;  1SWA A;  2A5B A;  2A5C A;  2IZC B;  2RTQ B;  1VWF B;  4Z2P A;  1SRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...