2RTIB

Streptavidin-glycoluril complex, ph 2.50, space group i222
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 24
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2rtiB00
3RDOA 1NC9A 1KFFA 3RDUA 3T2XA 2RTOB 3RE6A 1SWKA 5IRUA 4Y5DA 1RXKA 2RTEB 3RY2A 4CPHA 4GGRA 2FHNX 3RDQA 4IRWA 1SWAA 1HXZA 1VYOA 4CPFA 2GH7A 4U46A 4BX7B 1N9MA 3WYPA 1VWLB 2CAMA 1RXJA 2Y32A 4BCSA 4BBOA 2UZ2A 1NDJA 1SLFB 1Y53X 2AVIA 2MF6A 4CPIA 2RTAA 2RTFB 4JNJA 5B5FA 1Y52X 1LELA 5F2BA 5IRWA 2IZDB 2C1SA 2RTRB 4CPEA 1SWOA 1NQNA 1N7YA 3WZNA 5K67A 1VWBB 1VWAB 1SWSA 2JGSA 3SZJA 3X00A 5CSEA 2UYWA 1VWJB 1VWEB 4Z2VA 1KL4A 4DNEA 2A5BA 1LCWA 2RTIB 1LCZA 1MK5A 2C4IA 1SRJA 2IZBA 4BX6B 3RDXA 4Z28A 1Y55X 2RTGB 2RTMA 2RTDB 3VHIA 1STRB 1VWHB 2IZEB 5L3YA 1VWFB 2A8GA 2IZFB 1MM9A 1HY2A 1SWBA 2IZKA 1SREA 4GGZA 2OF8A 4JHQA 1SWEA 1STPA 3WYQA 1KL5A 2IZIA 3VGWA 1LUQA 1N4JA 2F01A 2WPUA 1N43A 1VWIB 1SWUA 2FHLA 1SWJA 5IRAA 1N9YA 1WBIA 1RXHA 3SZHA 3WZOA 2IZCB 3MG5A 1NBXA 3T2WA 1LDOA 1SWRA 1SWLA 4GD9A 2RTLA 1NQMA 2RTPB 1I9HA 1MOYA 4Z27A 1VWKB 1LCVA 4Z2OA 2RTNB 4EKVA 4GDAA 1VWQB 4JO6A 1KL3A 2RTKA 1SWHA 4BX6A 4GJSA 3EW2A 2C1QA 1IJ8A 4BX5B 1SLGB 1SRHA 3EW1A 4BX7A 1SRIA 3PK2A 4Z6JA 1SWNA 1PTSA 1VWCB 4GGTA 4Y59A 1DF8A 1SLEB 3RE5A 1SLDB 1SRGA 2IZJA 1AVDA 2RTQB 5B5GA 1HQQA 1VWDB 3RDMA 1SWDA 1RAVA 1SRFA 3FDCA 2OFAA 2QCBA 2Y3EA 2IZHB 5CHKA 2G5LA 1VWRB 4Z2PA 4CPHB 4GJVA 3MM0A 2RTCB 1SWQA 1VWOB 5JD2A 2ZSCA 1HXLA 2RTBB 4BJ8A 2OF9A 1SWCA 2RTHB 1MEPA 2IZGB 1VWPB 2Y3FA 3WZPA 1VWMB 4OKAA 2A5CA 3T6FA 4YVBA 3VHHA 5K68A 1LDQA 3T6LA 1SWGA 4BX5A 3RDSA 1VWGB 1SWFA 1RSUB 4I60A 2RTJA 2OFBA 2BC3A 3RY1A 1VWNB 3WZQA 2IZLB 1STSB 2IZAA 1RSTB 1SWTA 1AVEA 3SZIA 1SWPA 3VHMA
chains in the Genus database with same CATH superfamily
1DF3A 2MJIA 1ZNDA 1NP1A 3T2XA 1E06A 4Y0PA 1LIEA 2RCTA 3FW4A 4YGZA 2YG2A 3RE6A 5HCDC 4Y5DA 1EIOA 2R74A 3MX7A 2FTBA 5B27A 3EYCA 4XMFA 5HCEC 2JW1A 2PI3O 1SWAA 2X55A 3NBXX 1GX9A 1MDCA 1VYOA 2OY1O 4IRWA 4NYQA 4OEMA 1PM1X 1AB0A 1TVQA 1CBQA 1N9MA 4QNIA 1G85A 4U46A 2CZUA 4AZRA 4C5PA 1VWLB 4KH8A 2Y32A 1KGLA 4O3ZA 2EU7X 2X8SA 4BBOA 2UZ2A 3NR3A 3NX2A 3BU1A 2NNQA 2RA6A 5FQ8E 1U17A 1Z24A 2KTSA 3VG3A 4D6BA 5B5FA 4ORRA 1LELA 4XMCA 1QY1A 4QZUA 1BM5A 2IZDB 2C1SA 1PEEA 2L5PA 4TQ2A 3CQNA 3MVFA 3WJCA 3OE3A 1GKAA 1NQNA 2IFBA 4I3DA 3OJYC 4XMGA 2JU8A 2OVEA 3O22A 4FBVA 1X89A 1X71A 4ORSA 3SZJA 3X00A 4A8ZA 1YIVA 4FBOA 4YBPA 4Z2VA 4ZFXA 3TF6A 2A5BA 1HMRA 2ALLX 1LCZA 4U3QA 4UU2A 4YCEA 5D47A 1SRJA 2IZBA 4BGFA 4BX6B 4Z28A 3EM0A 2Z4IA 1CBIA 1GX3A 1OPBA 2QOMA 3LTWA 5L3YA 5IO5A 3P6HA 1PMPA 1VWFB 2A8GA 2WSJA 2ACOA 5D45A 5HA0A 2R73A 1GT3A 5D8JA 4ZHDA 1A2DA 3S5VA 1HY2A 5F58A 1BSQA 3VG4A 4ML7B 3NADA 1STPA 3KFIA 3U0DA 1KL5A 1NP4A 1KXOA 5IRAA 1N4JA 2K23A 4MVIA 1N43A 1SXUA 3D4RA 4GE1A 2LBVA 4O3WA 2BSZA 4NNTA 3FA7A 5B11O 4TKBA 1NBXA 1ZRYA 4IABA 1JJXA 4I3CA 2OZQA 4I95A 1SWRA 1KQXA 3HWDA 4GKCA 4O4OA 1Y9TA 4AYHA 1JJJA 3FLLA 3T1DA 1NQMA 2G7BA 1JYJA 1VWKB 4I9SA 2QO6A 4EKVA 3CR6A 4O4XA 3RBYA 1KL3A 4NW4A 4O9SA 4M7MA 2X8FA 1HBQA 5LJHA 5BVTA 1HMSA 3WVMA 1G7NA 4KC8A 2VFCA 4QAEA 4AZNA 1T8VA 3RSWA 1BLRA 1EPBA 2WR6A 4O3YA 1TW4A 4I3BA 1BRQA 1X8UA 3G7XA 4NLJA 3STNA 5HTDA 1SWNA 2RQ0A 1PTSA 2GTLN 1SLEB 2XSTA 3MBTA 1SLDB 2AT5X 4O3XB 1AVDA 2Q39A 2CZTA 3STKA 4XMHA 5D48A 3BU9A 5LJKA 2AT3X 1DZJA 2Y3EA 1LPJA 2IZHB 4FQBB 2Q2PA 3VG7A 2CBSA 1VWRB 3CBCA 2X8TA 4HPCA 3NQ9A 3V8UA 1U18A 4IAXA 5EDBA 4MEEA 4OMXA 1SWQA 3QQ2A 2ZSCA 3LHNA 5JD2A 5L8OA 2RTBB 4BJ8A 5HWZA 1E2TA 3FMZA 1ERXA 1DFVA 2WUTA 3FELA 4FBRA 1OBQA 2KT4B 2Y3FA 3FEPA 3P6DA 1BBPA 1DZKA 1U0XA 3DSZA 5L8IA 5LJBA 4LZUA 3T6FA 3VHHA 3T6LA 4TNNA 4YFRA 4BX5A 1S7DA 3VG5A 1VWGB 5HZ8A 1RSUB 3HWEA 1I78A 3WOVA 4MISA 3BRNA 3ZW1A 2DM5A 4QYNA 2AF5A 3HOLA 3RY1A 3WZQA 1ADLA 1GM6A 2G8CO 3FA6A 1GKAB 1YP6A 2L68A 4YKMA 1YP7A 3HK1A 1KFFA 1O1UA 2Q2MA 4TKJA 1VPRA 5HZ6A 2JOZA 4Y0SA 4I9RA 3U03A 2I5ZO 2WEWA 2JMBA 1FTPA 1KT7A 2FHNX 2ACPX 3NQKA 4L3RA 4QZTA 2WQ9A 2X46A 4RUNA 5EEDA 4LQZA 2A13A 4D6AA 4GUZA 2HYSA 1PBYA 2GH7A 2R56A 5AJCA 4BX7B 4DQ3A 5FENA 4YKOA 1OBPA 2FS6A 1ACDA 3CKFA 1HBPA 2AVIA 2HMBA 1Y53X 4O4UA 3S26A 2A2UA 5HTEA 4AZOA 4AW8A 2RTFB 3PQUA 1Y52X 3ZI8A 5IRWA 2HKDA 4ORYA 5KICA 2RTRB 4O49A 4QQ1A 4QYPA 4Y0RA 3CMPA 4ZHFA 1N7YA 4IMNA 4OS8A 4EQAC 4MVLA 4NYRA 2L67A 5CSEA 1SY0A 4ORWA 5LJDA 1KL4A 1UREA 1X8NA 2CM4A 4DNEA 2RTIB 2WWPA 2RCQA 1JJUA 1BSOA 4HPAA 3UEVA 1Y55X 2RTGB 2RTDB 2X56A 3P24A 1STRB 3KFGA 3SOTA 5LJEA 2BHVA 2I5VO 2MO5A 4LKTA 2GJ5A 1W4TA 4QGXA 4N7CA 2QMIA 4IMOA 1MM9A 1E02A 1SWBA 2IZKA 4ZGFA 2OF8A 4JHQA 1SWEA 2LBAA 4ALBA 3WYQA 4COTA 3NX1A 2JU3A 1FELA 3VGWA 3SLOA 1W6FA 4BOEA 1JMZA 3SZHA 1RXHA 1K3BA 2IZCB 2GTLO 3U9PC 2VDFA 2AH7X 1QABE 4KCAA 1EW3A 1SY1A 3JSQA 1EQDA 3CKGA 1G74A 4ZHGA 1LICA 4NLIA 1MOYA 3FYFA 3QKGA 4OMWA 3OBLA 4WFUA 1SA8A 2RTNB 1JV4A 1DC9A 2AL0X 4GDAA 5IO6A 1VWQB 1I04A 4ZCBA 4BVMA 4WBKA 3FIDA 2RTKA 1XCAA 1OEJA 3AKNA 3S5XA 3D95A 4ZJ0A 3UEUA 3KQ0A 2VFBA 3Q6LA 1LFOA 1IJ8A 1YWAA 1N0SA 1TXLA 1SLGB 3EW1A 4BX5B 2AT8X 1SRIA 1GT4A 4BX7A 4M6SA 4MVKA 3ZW1B 1GGLA 5F6BA 1KOIA 1BJ7A 4DQ4A 2FLJA 1DF8A 2Q9SA 2JN3A 2HZRA 2RN4A 5FFHA 5B29A 2G78A 3APWA 2IZJA 3NP1A 2RTQB 5H9KA 2A3FX 2O62A 1IW2A 2ZAGA 3WBGA 1GX8A 2QO4A 4ORUA 5HAEA 4IB8A 3SAOA 2AT6X 3HWGA 1VYFA 2GTLM 3Q34A 5EZ2A 4GETA 1XKIA 4AZQA 3ZWEA 5CHKA 1YWDA 2G5LA 3H3IA 3TGAA 1O8VA 1YWCA 2MM3A 1EPAA 3P6GA 2RTCB 4YH0A 1IKEA 1QFTA 3HWFA 3PH5A 1QWDA 4CDFA 4MIRA 3BX8A 1OPAA 1GXAA 1P6PA 4KC7A 3CWKA 1D3SA 5F1EA 1ZNEA 1BEBA 1FEMA 1MEPA 2IZGB 2RTHB 2W2BA 3APUA 3IFBA 3JQOA 2A5CA 1LIDA 4O4SA 4HFOA 5KIDA 2OL6O 1SWGA 1I06A 2W2AA 3D96A 3K3LA 1W5RA 2X45A 2DJGA 2HNXA 2LFOA 1PBOA 5H9NA 3NQ3A 2BC3A 1AQBA 1Y0GA 3CQRA 5HZ9A 2IZAA 4JGLA 1SWTA 4YCHA 3SZIA 1SWPA 3VHMA 2FRSA 1H91A 3N91A 5C0NA 1FDQA 2QO5A 3D97A 3HOEA 4YFPA 2POAA 3I0AA 2RTOB 2FKGA 4NP1A 1IIUA 5EDCA 1UZ2X 3C77X 4CPHA 4EXZA 4ES7A 3FA9A 4GGRA 3TZSA 4XMDA 5DG4A 2OYBO 3RDQA 3SLJA 1HXZA 1KT4A 1EALA 3APXA 5CYBA 3WYPA 4ODDA 4A1HA 4QGWA 3P6FA 2FGSA 3C78X 1HN2A 2FS7A 1O1VA 3TGBA 4IB6A 1CBSA 4ZHCA 2LKKA 3VU1A 1NDJA 2MF6A 1OEEA 4CPIA 4LZVA 4JNJA 3VE1A 1MVGA 3B2KA 2A0AA 5LKEA 5B10O 1MX8A 3BLGA 3ELXA 1G5WA 3STMX 1KZXA 1TOWA 4GNYA 3OD9A 4CPEA 1SWOA 1CBRA 3B2JA 1T68X 5CE4A 3WZNA 1KT5A 1L6MA 2GTFX 1VWAB 1SWSA 4QGVA 4TLJA 2RD7C 2UYWA 1VWJB 1SXWA 3B2HA 4YBUA 3SLTA 2WEXA 5FQ6E 1LF7A 1LCWA 3FEKA 2P8GA 5BVQA 4YDAA 2C4IA 2HLVA 3KFHA 2BS5A 1QFVA 1VYGA 3PPTA 3PQSA 3VHIA 2XKLA 1K24A 1SXYA 3DTQA 4R0BA 2IZEB 4YDBA 3E3CA 1GT5A 4IBAA 2YMSA 4GRJA 2KW1A 1Y9LA 4GK9A 4ALOA 5HBSA 4MVEA 2QM9A 1HMTA 1ICNA 4YMYA 1JMXA 1QQSA 1LUQA 2GC9A 2AMMX 3BY0A 1VWIB 4GNWA 1SWUA 4CDEA 3PECA 5LJGA 1N9YA 1WBIA 1IKJA 1ZNGA 5H9AA 1LIBA 3O19A 5HZ5A 1RBPA 1MX7A 3T2WA 5FAZA 5FQ7E 1SWLA 2OFRX 3RKGA 2RTLA 1D2UA 3FIQA 1I9HA 1LCVA 1KZWA 1FJ1E 1QY0A 3KVNA 3BX7A 1QG5A 4U8UN 3WJGA 3B2LA 2OFMX 3AKMA 4ZGUA 1SY3A 3VE2A 1B8EA 3AEHA 1X8PA 3EMMA 4A1YA 3WJEA 4BQUA 1QY2A 2ASNX 1SXXA 3EW2A 2C1QA 3F8AA 1ML7A 1BSYA 2CBRA 3FA8A 3GE2A 1UYOX 4Z6JA 3PEDA 5IO7A 5HA1A 5B2AO 5K06A 1B0OA 1ZNLA 3RE5A 3C76X 2CM9A 1HQQA 1VWDB 1ZNKA 2W2FA 1RAVA 3I17A 4ZR2A 4FGIB 5HCCC 1SRFA 2QCBA 2FT9A 1NGLA 2KTDA 3F6ZB 3ZW2A 4CSBA 2A2GA 3WJFA 3NPOA 5AQ6A 4Z2PA 4CPHB 3HPEA 3MM0A 3JS1A 4YFQA 3S60A 3ZUOA 1CJ5A 1HXLA 3ZW0B 2KD2A 2OF9A 1SWCA 5DPQA 4I6SA 5B3MO 1LKEA 3WJBA 4L1NA 1VWMB 4OKAA 4LKPA 3ZUIA 3BSZE 1OBUA 4YVBA 4TJZA 2LB6A 4TKHA 5K68A 1I4UA 3B2IA 2DJFA 1OSPO 2RTJA 1VWNB 1R0UA 1STSB 1GT1A 2OY7A 3PP6A 4B55A 1AVGI 4RUUA 4A60A 1JBHA 3RDOA 5H8TA 1NC9A 3RDUA 2NNDA 3WJDA 4HPDA 1SWKA 4DCBA 1JQPA 2HZQA 5IRUA 1RXKA 2RTEB 3O2YA 5LKFA 3RY2A 4ON1A 4ZHHA 3HTYA 2ZAIA 2K62A 2OVDA 4IB9A 3ZZVA 1S2PA 4CPFA 2PY1A 4NV7A 2CAMA 3P6CA 4EFGA 3LV4A 1RXJA 4PSQA 3TGCA 4BCSA 4ORXA 1JIWI 2X32A 2Z4HA 1SLFB 3AUMO 3F9DA 4EEJA 3GAQA 2MHDA 2FKJA 1EXSA 2MWHA 2RTAA 2OVSA 5F2BA 4GDZA 3PDFA 4K19A 1JYDA 1RLBE 1SY2A 2M4LA 1IFBA 3L4RA 1AELA 4AZPA 4IAWA 3UAQA 4Z2OA 3FR2A 3P6EA 1DZMA 5K67A 1VWBB 1EUOA 2JGSA 4OS0A 2OY5O 2E4JA 1S44A 1VWEB 1MUPA 4XMEA 1DZPA 4GU8A 1JZUA 4INNA 5JR8A 1MK5A 5F7GA 1DV9A 3RDXA 2OL7A 2NP1A 3FR5A 5H9LA 2Q4NA 2OVAA 1B56A 4QRLA 1LNMA 1VWHB 3FENA 3ZW0A 5HZQA 1SMPI 3ELZA 4PJ2A 4U8UO 2IZFB 1YUPA 2QOSC 3P02A 4KIIA 4GGZA 1SREA 1X8QA 3EBKA 2BLGA 5L8NA 2G79A 1FE3A 2ANSA 2IZIA 4ZH9A 1A57A 2F01A 2WPUA 1HQPA 1X8OA 2BS6A 2FHLA 1SWJA 3UEWA 3WZOA 3BS2A 1YWBA 2OY8A 3APVA 3EBWA 1WUBA 3BDRA 1ICMA 3KFFA 3MG5A 4HWMA 2JU7A 4IB7A 4ID2A 4N7DA 5D4AA 5EEEA 3EC5A 3VPJE 4WFVA 4CDDA 1LDOA 1ZNHA 4EDEA 4GD9A 1BRPA 2X4MA 4YGGA 2AKQA 2RTPB 3IA8A 4GH7A 4Z27A 1EIIA 3D9WA 2L9CA 5BYPA 2BT9A 4CK4A 1E00A 1E5PA 4CDCA 1ERBA 5AJBA 1IFCA 1SWHA 4BX6A 4OS3A 4GJSA 5BVSA 4GZVA 1SRHA 4NV8A 3PK2A 4U8UM 3FW5A 4YGHA 2FR2A 1KT3A 1VWCB 4GGTA 1I05A 4Y59A 3KZAA 4HPBA 4U9CA 5F6ZA 1KQWA 4CV7A 2FR3A 1T0VA 2AT0X 1SRGA 2FWVA 1KT6A 1A18A 2X34A 5B5GA 3RZYA 3UEXA 2WQAE 3RDMA 4OELA 1EI5A 1SWDA 3ZQ3A 1LIFA 3FDCA 2OFAA 5EPQA 1FENA 1ALBA 1OEKA 4NNSA 3VG2A 3PH6A 4GJVA 5KHPA 5LJCA 2LA7A 3WXQA 1A3YA 1VWOB 3FR4A 5IXGA 1TOUA 1CRBA 4ZH6A 2OL8O 5AEOA 3CBSA 1VWPB 4WHIA 3WZPA 4AZMA 4KT5A 1LDQA 1UYNX 2F09A 4ARHA 3RDSA 1B4MA 3VG6A 1SWFA 4I60A 2F73A 2N93A 2OFBA 3RWXA 4Y0QA 2IZLB 2NNEA 4UU3A 1RSTB 4JO6A 1AVEA 1BWYA 2RTMA
chains in the Genus database with same CATH topology
3RDOA 1NC9A 1KFFA 3RDUA 3T2XA 2RTOB 3RE6A 1SWKA 5IRUA 4Y5DA 1RXKA 2RTEB 3RY2A 4CPHA 4GGRA 2FHNX 3RDQA 4IRWA 1SWAA 1HXZA 1VYOA 4CPFA 2GH7A 4U46A 4BX7B 1N9MA 3WYPA 1VWLB 2CAMA 1RXJA 2Y32A 4BCSA 4BBOA 2UZ2A 1NDJA 1SLFB 1Y53X 2AVIA 2MF6A 4CPIA 2RTAA 2RTFB 4JNJA 5B5FA 1Y52X 1LELA 5F2BA 5IRWA 2IZDB 2C1SA 2RTRB 4CPEA 1SWOA 1NQNA 1N7YA 3WZNA 5K67A 1VWBB 1VWAB 1SWSA 2JGSA 3SZJA 3X00A 5CSEA 2UYWA 1VWJB 1VWEB 4Z2VA 1KL4A 4DNEA 2A5BA 1LCWA 2RTIB 1LCZA 1MK5A 2C4IA 1SRJA 2IZBA 4BX6B 3RDXA 4Z28A 1Y55X 2RTGB 2RTMA 2RTDB 3VHIA 1STRB 1VWHB 2IZEB 5L3YA 1VWFB 2A8GA 2IZFB 1MM9A 1HY2A 1SWBA 2IZKA 1SREA 4GGZA 2OF8A 4JHQA 1SWEA 1STPA 3WYQA 1KL5A 2IZIA 3VGWA 1LUQA 1N4JA 2F01A 2WPUA 1N43A 1VWIB 1SWUA 2FHLA 1SWJA 5IRAA 1N9YA 1WBIA 1RXHA 3SZHA 3WZOA 2IZCB 3MG5A 1NBXA 3T2WA 1LDOA 1SWRA 1SWLA 4GD9A 2RTLA 1NQMA 2RTPB 1I9HA 1MOYA 4Z27A 1VWKB 1LCVA 4Z2OA 2RTNB 4EKVA 4GDAA 1VWQB 4JO6A 1KL3A 2RTKA 1SWHA 4BX6A 4GJSA 3EW2A 2C1QA 1IJ8A 4BX5B 1SLGB 1SRHA 3EW1A 4BX7A 1SRIA 3PK2A 4Z6JA 1SWNA 1PTSA 1VWCB 4GGTA 4Y59A 1DF8A 1SLEB 3RE5A 1SLDB 1SRGA 2IZJA 1AVDA 2RTQB 5B5GA 1HQQA 1VWDB 3RDMA 1SWDA 1RAVA 1SRFA 3FDCA 2OFAA 2QCBA 2Y3EA 2IZHB 5CHKA 2G5LA 1VWRB 4Z2PA 4CPHB 4GJVA 3MM0A 2RTCB 1SWQA 1VWOB 5JD2A 2ZSCA 1HXLA 2RTBB 4BJ8A 2OF9A 1SWCA 2RTHB 1MEPA 2IZGB 1VWPB 2Y3FA 3WZPA 1VWMB 4OKAA 2A5CA 3T6FA 4YVBA 3VHHA 5K68A 1LDQA 3T6LA 1SWGA 4BX5A 3RDSA 1VWGB 1SWFA 1RSUB 4I60A 2RTJA 2OFBA 2BC3A 3RY1A 1VWNB 3WZQA 2IZLB 1STSB 2IZAA 1RSTB 1SWTA 1AVEA 3SZIA 1SWPA 3VHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RDO A;  1NC9 A;  1KFF A;  3RDU A;  3T2X A;  2RTO B;  3RE6 A;  1SWK A;  5IRU A;  4Y5D A;  1RXK A;  2RTE B;  3RY2 A;  4CPH A;  4GGR A;  2FHN X;  3RDQ A;  4IRW A;  1SWA A;  1HXZ A;  1VYO A;  4CPF A;  2GH7 A;  4U46 A;  4BX7 B;  1N9M A;  3WYP A;  1VWL B;  2CAM A;  1RXJ A;  2Y32 A;  4BCS A;  4BBO A;  2UZ2 A;  1NDJ A;  1SLF B;  1Y53 X;  2AVI A;  2MF6 A;  4CPI A;  2RTA A;  2RTF B;  4JNJ A;  5B5F A;  1Y52 X;  1LEL A;  5F2B A;  5IRW A;  2IZD B;  2C1S A;  2RTR B;  4CPE A;  1SWO A;  1NQN A;  1N7Y A;  3WZN A;  5K67 A;  1VWB B;  1VWA B;  1SWS A;  2JGS A;  3SZJ A;  3X00 A;  5CSE A;  2UYW A;  1VWJ B;  1VWE B;  4Z2V A;  1KL4 A;  4DNE A;  2A5B A;  1LCW A;  2RTI B;  1LCZ A;  1MK5 A;  2C4I A;  1SRJ A;  2IZB A;  4BX6 B;  3RDX A;  4Z28 A;  1Y55 X;  2RTG B;  2RTM A;  2RTD B;  3VHI A;  1STR B;  1VWH B;  2IZE B;  5L3Y A;  1VWF B;  2A8G A;  2IZF B;  1MM9 A;  1HY2 A;  1SWB A;  2IZK A;  1SRE A;  4GGZ A;  2OF8 A;  4JHQ A;  1SWE A;  1STP A;  3WYQ A;  1KL5 A;  2IZI A;  3VGW A;  1LUQ A;  1N4J A;  2F01 A;  2WPU A;  1N43 A;  1VWI B;  1SWU A;  2FHL A;  1SWJ A;  5IRA A;  1N9Y A;  1WBI A;  1RXH A;  3SZH A;  3WZO A;  2IZC B;  3MG5 A;  1NBX A;  3T2W A;  1LDO A;  1SWR A;  1SWL A;  4GD9 A;  2RTL A;  1NQM A;  2RTP B;  1I9H A;  1MOY A;  4Z27 A;  1VWK B;  1LCV A;  4Z2O A;  2RTN B;  4EKV A;  4GDA A;  1VWQ B;  4JO6 A;  1KL3 A;  2RTK A;  1SWH A;  4BX6 A;  4GJS A;  3EW2 A;  2C1Q A;  1IJ8 A;  4BX5 B;  1SLG B;  1SRH A;  3EW1 A;  4BX7 A;  1SRI A;  3PK2 A;  4Z6J A;  1SWN A;  1PTS A;  1VWC B;  4GGT A;  4Y59 A;  1DF8 A;  1SLE B;  3RE5 A;  1SLD B;  1SRG A;  2IZJ A;  1AVD A;  2RTQ B;  5B5G A;  1HQQ A;  1VWD B;  3RDM A;  1SWD A;  1RAV A;  1SRF A;  3FDC A;  2OFA A;  2QCB A;  2Y3E A;  2IZH B;  5CHK A;  2G5L A;  1VWR B;  4Z2P A;  4CPH B;  4GJV A;  3MM0 A;  2RTC B;  1SWQ A;  1VWO B;  5JD2 A;  2ZSC A;  1HXL A;  2RTB B;  4BJ8 A;  2OF9 A;  1SWC A;  2RTH B;  1MEP A;  2IZG B;  1VWP B;  2Y3F A;  3WZP A;  1VWM B;  4OKA A;  2A5C A;  3T6F A;  4YVB A;  3VHH A;  5K68 A;  1LDQ A;  3T6L A;  1SWG A;  4BX5 A;  3RDS A;  1VWG B;  1SWF A;  1RSU B;  4I60 A;  2RTJ A;  2OFB A;  2BC3 A;  3RY1 A;  1VWN B;  3WZQ A;  2IZL B;  1STS B;  2IZA A;  1RST B;  1SWT A;  1AVE A;  3SZI A;  1SWP A;  3VHM A; 
#chains in the Genus database with same CATH topology
 1DF3 A;  2MJI A;  1ZND A;  1NP1 A;  3T2X A;  1E06 A;  4Y0P A;  1LIE A;  2RCT A;  3FW4 A;  4YGZ A;  2YG2 A;  3RE6 A;  5HCD C;  4Y5D A;  1EIO A;  2R74 A;  3MX7 A;  2FTB A;  5B27 A;  3EYC A;  4XMF A;  5HCE C;  2JW1 A;  2PI3 O;  1SWA A;  2X55 A;  3NBX X;  1GX9 A;  1MDC A;  1VYO A;  2OY1 O;  4IRW A;  4NYQ A;  4OEM A;  1PM1 X;  1AB0 A;  1TVQ A;  1CBQ A;  1N9M A;  4QNI A;  1G85 A;  4U46 A;  2CZU A;  4AZR A;  4C5P A;  1VWL B;  4KH8 A;  2Y32 A;  1KGL A;  4O3Z A;  2EU7 X;  2X8S A;  4BBO A;  2UZ2 A;  3NR3 A;  3NX2 A;  3BU1 A;  2NNQ A;  2RA6 A;  5FQ8 E;  1U17 A;  1Z24 A;  2KTS A;  3VG3 A;  4D6B A;  5B5F A;  4ORR A;  1LEL A;  4XMC A;  1QY1 A;  4QZU A;  1BM5 A;  2IZD B;  2C1S A;  1PEE A;  2L5P A;  4TQ2 A;  3CQN A;  3MVF A;  3WJC A;  3OE3 A;  1GKA A;  1NQN A;  2IFB A;  4I3D A;  3OJY C;  4XMG A;  2JU8 A;  2OVE A;  3O22 A;  4FBV A;  1X89 A;  1X71 A;  4ORS A;  3SZJ A;  3X00 A;  4A8Z A;  1YIV A;  4FBO A;  4YBP A;  4Z2V A;  4ZFX A;  3TF6 A;  2A5B A;  1HMR A;  2ALL X;  1LCZ A;  4U3Q A;  4UU2 A;  4YCE A;  5D47 A;  1SRJ A;  2IZB A;  4BGF A;  4BX6 B;  4Z28 A;  3EM0 A;  2Z4I A;  1CBI A;  1GX3 A;  1OPB A;  2QOM A;  3LTW A;  5L3Y A;  5IO5 A;  3P6H A;  1PMP A;  1VWF B;  2A8G A;  2WSJ A;  2ACO A;  5D45 A;  5HA0 A;  2R73 A;  1GT3 A;  5D8J A;  4ZHD A;  1A2D A;  3S5V A;  1HY2 A;  5F58 A;  1BSQ A;  3VG4 A;  4ML7 B;  3NAD A;  1STP A;  3KFI A;  3U0D A;  1KL5 A;  1NP4 A;  1KXO A;  5IRA A;  1N4J A;  2K23 A;  4MVI A;  1N43 A;  1SXU A;  3D4R A;  4GE1 A;  2LBV A;  4O3W A;  2BSZ A;  4NNT A;  3FA7 A;  5B11 O;  4TKB A;  1NBX A;  1ZRY A;  4IAB A;  1JJX A;  4I3C A;  2OZQ A;  4I95 A;  1SWR A;  1KQX A;  3HWD A;  4GKC A;  4O4O A;  1Y9T A;  4AYH A;  1JJJ A;  3FLL A;  3T1D A;  1NQM A;  2G7B A;  1JYJ A;  1VWK B;  4I9S A;  2QO6 A;  4EKV A;  3CR6 A;  4O4X A;  3RBY A;  1KL3 A;  4NW4 A;  4O9S A;  4M7M A;  2X8F A;  1HBQ A;  5LJH A;  5BVT A;  1HMS A;  3WVM A;  1G7N A;  4KC8 A;  2VFC A;  4QAE A;  4AZN A;  1T8V A;  3RSW A;  1BLR A;  1EPB A;  2WR6 A;  4O3Y A;  1TW4 A;  4I3B A;  1BRQ A;  1X8U A;  3G7X A;  4NLJ A;  3STN A;  5HTD A;  1SWN A;  2RQ0 A;  1PTS A;  2GTL N;  1SLE B;  2XST A;  3MBT A;  1SLD B;  2AT5 X;  4O3X B;  1AVD A;  2Q39 A;  2CZT A;  3STK A;  4XMH A;  5D48 A;  3BU9 A;  5LJK A;  2AT3 X;  1DZJ A;  2Y3E A;  1LPJ A;  2IZH B;  4FQB B;  2Q2P A;  3VG7 A;  2CBS A;  1VWR B;  3CBC A;  2X8T A;  4HPC A;  3NQ9 A;  3V8U A;  1U18 A;  4IAX A;  5EDB A;  4MEE A;  4OMX A;  1SWQ A;  3QQ2 A;  2ZSC A;  3LHN A;  5JD2 A;  5L8O A;  2RTB B;  4BJ8 A;  5HWZ A;  1E2T A;  3FMZ A;  1ERX A;  1DFV A;  2WUT A;  3FEL A;  4FBR A;  1OBQ A;  2KT4 B;  2Y3F A;  3FEP A;  3P6D A;  1BBP A;  1DZK A;  1U0X A;  3DSZ A;  5L8I A;  5LJB A;  4LZU A;  3T6F A;  3VHH A;  3T6L A;  4TNN A;  4YFR A;  4BX5 A;  1S7D A;  3VG5 A;  1VWG B;  5HZ8 A;  1RSU B;  3HWE A;  1I78 A;  3WOV A;  4MIS A;  3BRN A;  3ZW1 A;  2DM5 A;  4QYN A;  2AF5 A;  3HOL A;  3RY1 A;  3WZQ A;  1ADL A;  1GM6 A;  2G8C O;  3FA6 A;  1GKA B;  1YP6 A;  2L68 A;  4YKM A;  1YP7 A;  3HK1 A;  1KFF A;  1O1U A;  2Q2M A;  4TKJ A;  1VPR A;  5HZ6 A;  2JOZ A;  4Y0S A;  4I9R A;  3U03 A;  2I5Z O;  2WEW A;  2JMB A;  1FTP A;  1KT7 A;  2FHN X;  2ACP X;  3NQK A;  4L3R A;  4QZT A;  2WQ9 A;  2X46 A;  4RUN A;  5EED A;  4LQZ A;  2A13 A;  4D6A A;  4GUZ A;  2HYS A;  1PBY A;  2GH7 A;  2R56 A;  5AJC A;  4BX7 B;  4DQ3 A;  5FEN A;  4YKO A;  1OBP A;  2FS6 A;  1ACD A;  3CKF A;  1HBP A;  2AVI A;  2HMB A;  1Y53 X;  4O4U A;  3S26 A;  2A2U A;  5HTE A;  4AZO A;  4AW8 A;  2RTF B;  3PQU A;  1Y52 X;  3ZI8 A;  5IRW A;  2HKD A;  4ORY A;  5KIC A;  2RTR B;  4O49 A;  4QQ1 A;  4QYP A;  4Y0R A;  3CMP A;  4ZHF A;  1N7Y A;  4IMN A;  4OS8 A;  4EQA C;  4MVL A;  4NYR A;  2L67 A;  5CSE A;  1SY0 A;  4ORW A;  5LJD A;  1KL4 A;  1URE A;  1X8N A;  2CM4 A;  4DNE A;  2RTI B;  2WWP A;  2RCQ A;  1JJU A;  1BSO A;  4HPA A;  3UEV A;  1Y55 X;  2RTG B;  2RTD B;  2X56 A;  3P24 A;  1STR B;  3KFG A;  3SOT A;  5LJE A;  2BHV A;  2I5V O;  2MO5 A;  4LKT A;  2GJ5 A;  1W4T A;  4QGX A;  4N7C A;  2QMI A;  4IMO A;  1MM9 A;  1E02 A;  1SWB A;  2IZK A;  4ZGF A;  2OF8 A;  4JHQ A;  1SWE A;  2LBA A;  4ALB A;  3WYQ A;  4COT A;  3NX1 A;  2JU3 A;  1FEL A;  3VGW A;  3SLO A;  1W6F A;  4BOE A;  1JMZ A;  3SZH A;  1RXH A;  1K3B A;  2IZC B;  2GTL O;  3U9P C;  2VDF A;  2AH7 X;  1QAB E;  4KCA A;  1EW3 A;  1SY1 A;  3JSQ A;  1EQD A;  3CKG A;  1G74 A;  4ZHG A;  1LIC A;  4NLI A;  1MOY A;  3FYF A;  3QKG A;  4OMW A;  3OBL A;  4WFU A;  1SA8 A;  2RTN B;  1JV4 A;  1DC9 A;  2AL0 X;  4GDA A;  5IO6 A;  1VWQ B;  1I04 A;  4ZCB A;  4BVM A;  4WBK A;  3FID A;  2RTK A;  1XCA A;  1OEJ A;  3AKN A;  3S5X A;  3D95 A;  4ZJ0 A;  3UEU A;  3KQ0 A;  2VFB A;  3Q6L A;  1LFO A;  1IJ8 A;  1YWA A;  1N0S A;  1TXL A;  1SLG B;  3EW1 A;  4BX5 B;  2AT8 X;  1SRI A;  1GT4 A;  4BX7 A;  4M6S A;  4MVK A;  3ZW1 B;  1GGL A;  5F6B A;  1KOI A;  1BJ7 A;  4DQ4 A;  2FLJ A;  1DF8 A;  2Q9S A;  2JN3 A;  2HZR A;  2RN4 A;  5FFH A;  5B29 A;  2G78 A;  3APW A;  2IZJ A;  3NP1 A;  2RTQ B;  5H9K A;  2A3F X;  2O62 A;  1IW2 A;  2ZAG A;  3WBG A;  1GX8 A;  2QO4 A;  4ORU A;  5HAE A;  4IB8 A;  3SAO A;  2AT6 X;  3HWG A;  1VYF A;  2GTL M;  3Q34 A;  5EZ2 A;  4GET A;  1XKI A;  4AZQ A;  3ZWE A;  5CHK A;  1YWD A;  2G5L A;  3H3I A;  3TGA A;  1O8V A;  1YWC A;  2MM3 A;  1EPA A;  3P6G A;  2RTC B;  4YH0 A;  1IKE A;  1QFT A;  3HWF A;  3PH5 A;  1QWD A;  4CDF A;  4MIR A;  3BX8 A;  1OPA A;  1GXA A;  1P6P A;  4KC7 A;  3CWK A;  1D3S A;  5F1E A;  1ZNE A;  1BEB A;  1FEM A;  1MEP A;  2IZG B;  2RTH B;  2W2B A;  3APU A;  3IFB A;  3JQO A;  2A5C A;  1LID A;  4O4S A;  4HFO A;  5KID A;  2OL6 O;  1SWG A;  1I06 A;  2W2A A;  3D96 A;  3K3L A;  1W5R A;  2X45 A;  2DJG A;  2HNX A;  2LFO A;  1PBO A;  5H9N A;  3NQ3 A;  2BC3 A;  1AQB A;  1Y0G A;  3CQR A;  5HZ9 A;  2IZA A;  4JGL A;  1SWT A;  4YCH A;  3SZI A;  1SWP A;  3VHM A;  2FRS A;  1H91 A;  3N91 A;  5C0N A;  1FDQ A;  2QO5 A;  3D97 A;  3HOE A;  4YFP A;  2POA A;  3I0A A;  2RTO B;  2FKG A;  4NP1 A;  1IIU A;  5EDC A;  1UZ2 X;  3C77 X;  4CPH A;  4EXZ A;  4ES7 A;  3FA9 A;  4GGR A;  3TZS A;  4XMD A;  5DG4 A;  2OYB O;  3RDQ A;  3SLJ A;  1HXZ A;  1KT4 A;  1EAL A;  3APX A;  5CYB A;  3WYP A;  4ODD A;  4A1H A;  4QGW A;  3P6F A;  2FGS A;  3C78 X;  1HN2 A;  2FS7 A;  1O1V A;  3TGB A;  4IB6 A;  1CBS A;  4ZHC A;  2LKK A;  3VU1 A;  1NDJ A;  2MF6 A;  1OEE A;  4CPI A;  4LZV A;  4JNJ A;  3VE1 A;  1MVG A;  3B2K A;  2A0A A;  5LKE A;  5B10 O;  1MX8 A;  3BLG A;  3ELX A;  1G5W A;  3STM X;  1KZX A;  1TOW A;  4GNY A;  3OD9 A;  4CPE A;  1SWO A;  1CBR A;  3B2J A;  1T68 X;  5CE4 A;  3WZN A;  1KT5 A;  1L6M A;  2GTF X;  1VWA B;  1SWS A;  4QGV A;  4TLJ A;  2RD7 C;  2UYW A;  1VWJ B;  1SXW A;  3B2H A;  4YBU A;  3SLT A;  2WEX A;  5FQ6 E;  1LF7 A;  1LCW A;  3FEK A;  2P8G A;  5BVQ A;  4YDA A;  2C4I A;  2HLV A;  3KFH A;  2BS5 A;  1QFV A;  1VYG A;  3PPT A;  3PQS A;  3VHI A;  2XKL A;  1K24 A;  1SXY A;  3DTQ A;  4R0B A;  2IZE B;  4YDB A;  3E3C A;  1GT5 A;  4IBA A;  2YMS A;  4GRJ A;  2KW1 A;  1Y9L A;  4GK9 A;  4ALO A;  5HBS A;  4MVE A;  2QM9 A;  1HMT A;  1ICN A;  4YMY A;  1JMX A;  1QQS A;  1LUQ A;  2GC9 A;  2AMM X;  3BY0 A;  1VWI B;  4GNW A;  1SWU A;  4CDE A;  3PEC A;  5LJG A;  1N9Y A;  1WBI A;  1IKJ A;  1ZNG A;  5H9A A;  1LIB A;  3O19 A;  5HZ5 A;  1RBP A;  1MX7 A;  3T2W A;  5FAZ A;  5FQ7 E;  1SWL A;  2OFR X;  3RKG A;  2RTL A;  1D2U A;  3FIQ A;  1I9H A;  1LCV A;  1KZW A;  1FJ1 E;  1QY0 A;  3KVN A;  3BX7 A;  1QG5 A;  4U8U N;  3WJG A;  3B2L A;  2OFM X;  3AKM A;  4ZGU A;  1SY3 A;  3VE2 A;  1B8E A;  3AEH A;  1X8P A;  3EMM A;  4A1Y A;  3WJE A;  4BQU A;  1QY2 A;  2ASN X;  1SXX A;  3EW2 A;  2C1Q A;  3F8A A;  1ML7 A;  1BSY A;  2CBR A;  3FA8 A;  3GE2 A;  1UYO X;  4Z6J A;  3PED A;  5IO7 A;  5HA1 A;  5B2A O;  5K06 A;  1B0O A;  1ZNL A;  3RE5 A;  3C76 X;  2CM9 A;  1HQQ A;  1VWD B;  1ZNK A;  2W2F A;  1RAV A;  3I17 A;  4ZR2 A;  4FGI B;  5HCC C;  1SRF A;  2QCB A;  2FT9 A;  1NGL A;  2KTD A;  3F6Z B;  3ZW2 A;  4CSB A;  2A2G A;  3WJF A;  3NPO A;  5AQ6 A;  4Z2P A;  4CPH B;  3HPE A;  3MM0 A;  3JS1 A;  4YFQ A;  3S60 A;  3ZUO A;  1CJ5 A;  1HXL A;  3ZW0 B;  2KD2 A;  2OF9 A;  1SWC A;  5DPQ A;  4I6S A;  5B3M O;  1LKE A;  3WJB A;  4L1N A;  1VWM B;  4OKA A;  4LKP A;  3ZUI A;  3BSZ E;  1OBU A;  4YVB A;  4TJZ A;  2LB6 A;  4TKH A;  5K68 A;  1I4U A;  3B2I A;  2DJF A;  1OSP O;  2RTJ A;  1VWN B;  1R0U A;  1STS B;  1GT1 A;  2OY7 A;  3PP6 A;  4B55 A;  1AVG I;  4RUU A;  4A60 A;  1JBH A;  3RDO A;  5H8T A;  1NC9 A;  3RDU A;  2NND A;  3WJD A;  4HPD A;  1SWK A;  4DCB A;  1JQP A;  2HZQ A;  5IRU A;  1RXK A;  2RTE B;  3O2Y A;  5LKF A;  3RY2 A;  4ON1 A;  4ZHH A;  3HTY A;  2ZAI A;  2K62 A;  2OVD A;  4IB9 A;  3ZZV A;  1S2P A;  4CPF A;  2PY1 A;  4NV7 A;  2CAM A;  3P6C A;  4EFG A;  3LV4 A;  1RXJ A;  4PSQ A;  3TGC A;  4BCS A;  4ORX A;  1JIW I;  2X32 A;  2Z4H A;  1SLF B;  3AUM O;  3F9D A;  4EEJ A;  3GAQ A;  2MHD A;  2FKJ A;  1EXS A;  2MWH A;  2RTA A;  2OVS A;  5F2B A;  4GDZ A;  3PDF A;  4K19 A;  1JYD A;  1RLB E;  1SY2 A;  2M4L A;  1IFB A;  3L4R A;  1AEL A;  4AZP A;  4IAW A;  3UAQ A;  4Z2O A;  3FR2 A;  3P6E A;  1DZM A;  5K67 A;  1VWB B;  1EUO A;  2JGS A;  4OS0 A;  2OY5 O;  2E4J A;  1S44 A;  1VWE B;  1MUP A;  4XME A;  1DZP A;  4GU8 A;  1JZU A;  4INN A;  5JR8 A;  1MK5 A;  5F7G A;  1DV9 A;  3RDX A;  2OL7 A;  2NP1 A;  3FR5 A;  5H9L A;  2Q4N A;  2OVA A;  1B56 A;  4QRL A;  1LNM A;  1VWH B;  3FEN A;  3ZW0 A;  5HZQ A;  1SMP I;  3ELZ A;  4PJ2 A;  4U8U O;  2IZF B;  1YUP A;  2QOS C;  3P02 A;  4KII A;  4GGZ A;  1SRE A;  1X8Q A;  3EBK A;  2BLG A;  5L8N A;  2G79 A;  1FE3 A;  2ANS A;  2IZI A;  4ZH9 A;  1A57 A;  2F01 A;  2WPU A;  1HQP A;  1X8O A;  2BS6 A;  2FHL A;  1SWJ A;  3UEW A;  3WZO A;  3BS2 A;  1YWB A;  2OY8 A;  3APV A;  3EBW A;  1WUB A;  3BDR A;  1ICM A;  3KFF A;  3MG5 A;  4HWM A;  2JU7 A;  4IB7 A;  4ID2 A;  4N7D A;  5D4A A;  5EEE A;  3EC5 A;  3VPJ E;  4WFV A;  4CDD A;  1LDO A;  1ZNH A;  4EDE A;  4GD9 A;  1BRP A;  2X4M A;  4YGG A;  2AKQ A;  2RTP B;  3IA8 A;  4GH7 A;  4Z27 A;  1EII A;  3D9W A;  2L9C A;  5BYP A;  2BT9 A;  4CK4 A;  1E00 A;  1E5P A;  4CDC A;  1ERB A;  5AJB A;  1IFC A;  1SWH A;  4BX6 A;  4OS3 A;  4GJS A;  5BVS A;  4GZV A;  1SRH A;  4NV8 A;  3PK2 A;  4U8U M;  3FW5 A;  4YGH A;  2FR2 A;  1KT3 A;  1VWC B;  4GGT A;  1I05 A;  4Y59 A;  3KZA A;  4HPB A;  4U9C A;  5F6Z A;  1KQW A;  4CV7 A;  2FR3 A;  1T0V A;  2AT0 X;  1SRG A;  2FWV A;  1KT6 A;  1A18 A;  2X34 A;  5B5G A;  3RZY A;  3UEX A;  2WQA E;  3RDM A;  4OEL A;  1EI5 A;  1SWD A;  3ZQ3 A;  1LIF A;  3FDC A;  2OFA A;  5EPQ A;  1FEN A;  1ALB A;  1OEK A;  4NNS A;  3VG2 A;  3PH6 A;  4GJV A;  5KHP A;  5LJC A;  2LA7 A;  3WXQ A;  1A3Y A;  1VWO B;  3FR4 A;  5IXG A;  1TOU A;  1CRB A;  4ZH6 A;  2OL8 O;  5AEO A;  3CBS A;  1VWP B;  4WHI A;  3WZP A;  4AZM A;  4KT5 A;  1LDQ A;  1UYN X;  2F09 A;  4ARH A;  3RDS A;  1B4M A;  3VG6 A;  1SWF A;  4I60 A;  2F73 A;  2N93 A;  2OFB A;  3RWX A;  4Y0Q A;  2IZL B;  2NNE A;  4UU3 A;  1RST B;  4JO6 A;  1AVE A;  1BWY A;  2RTM A; 
#chains in the Genus database with same CATH homology
 3RDO A;  1NC9 A;  1KFF A;  3RDU A;  3T2X A;  2RTO B;  3RE6 A;  1SWK A;  5IRU A;  4Y5D A;  1RXK A;  2RTE B;  3RY2 A;  4CPH A;  4GGR A;  2FHN X;  3RDQ A;  4IRW A;  1SWA A;  1HXZ A;  1VYO A;  4CPF A;  2GH7 A;  4U46 A;  4BX7 B;  1N9M A;  3WYP A;  1VWL B;  2CAM A;  1RXJ A;  2Y32 A;  4BCS A;  4BBO A;  2UZ2 A;  1NDJ A;  1SLF B;  1Y53 X;  2AVI A;  2MF6 A;  4CPI A;  2RTA A;  2RTF B;  4JNJ A;  5B5F A;  1Y52 X;  1LEL A;  5F2B A;  5IRW A;  2IZD B;  2C1S A;  2RTR B;  4CPE A;  1SWO A;  1NQN A;  1N7Y A;  3WZN A;  5K67 A;  1VWB B;  1VWA B;  1SWS A;  2JGS A;  3SZJ A;  3X00 A;  5CSE A;  2UYW A;  1VWJ B;  1VWE B;  4Z2V A;  1KL4 A;  4DNE A;  2A5B A;  1LCW A;  2RTI B;  1LCZ A;  1MK5 A;  2C4I A;  1SRJ A;  2IZB A;  4BX6 B;  3RDX A;  4Z28 A;  1Y55 X;  2RTG B;  2RTM A;  2RTD B;  3VHI A;  1STR B;  1VWH B;  2IZE B;  5L3Y A;  1VWF B;  2A8G A;  2IZF B;  1MM9 A;  1HY2 A;  1SWB A;  2IZK A;  1SRE A;  4GGZ A;  2OF8 A;  4JHQ A;  1SWE A;  1STP A;  3WYQ A;  1KL5 A;  2IZI A;  3VGW A;  1LUQ A;  1N4J A;  2F01 A;  2WPU A;  1N43 A;  1VWI B;  1SWU A;  2FHL A;  1SWJ A;  5IRA A;  1N9Y A;  1WBI A;  1RXH A;  3SZH A;  3WZO A;  2IZC B;  3MG5 A;  1NBX A;  3T2W A;  1LDO A;  1SWR A;  1SWL A;  4GD9 A;  2RTL A;  1NQM A;  2RTP B;  1I9H A;  1MOY A;  4Z27 A;  1VWK B;  1LCV A;  4Z2O A;  2RTN B;  4EKV A;  4GDA A;  1VWQ B;  4JO6 A;  1KL3 A;  2RTK A;  1SWH A;  4BX6 A;  4GJS A;  3EW2 A;  2C1Q A;  1IJ8 A;  4BX5 B;  1SLG B;  1SRH A;  3EW1 A;  4BX7 A;  1SRI A;  3PK2 A;  4Z6J A;  1SWN A;  1PTS A;  1VWC B;  4GGT A;  4Y59 A;  1DF8 A;  1SLE B;  3RE5 A;  1SLD B;  1SRG A;  2IZJ A;  1AVD A;  2RTQ B;  5B5G A;  1HQQ A;  1VWD B;  3RDM A;  1SWD A;  1RAV A;  1SRF A;  3FDC A;  2OFA A;  2QCB A;  2Y3E A;  2IZH B;  5CHK A;  2G5L A;  1VWR B;  4Z2P A;  4CPH B;  4GJV A;  3MM0 A;  2RTC B;  1SWQ A;  1VWO B;  5JD2 A;  2ZSC A;  1HXL A;  2RTB B;  4BJ8 A;  2OF9 A;  1SWC A;  2RTH B;  1MEP A;  2IZG B;  1VWP B;  2Y3F A;  3WZP A;  1VWM B;  4OKA A;  2A5C A;  3T6F A;  4YVB A;  3VHH A;  5K68 A;  1LDQ A;  3T6L A;  1SWG A;  4BX5 A;  3RDS A;  1VWG B;  1SWF A;  1RSU B;  4I60 A;  2RTJ A;  2OFB A;  2BC3 A;  3RY1 A;  1VWN B;  3WZQ A;  2IZL B;  1STS B;  2IZA A;  1RST B;  1SWT A;  1AVE A;  3SZI A;  1SWP A;  3VHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...