2RTJA

Streptavidin-glycoluril complex, ph 2.50, space group i4122
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2rtjA00
4CPHB 1VWAB 3X00A 1MM9A 1KFFA 1STPA 1SWRA 3RDSA 1RAVA 4Y59A 1SRHA 2IZCB 2IZLB 2JGSA 1I9HA 4BX7A 1SREA 1SWOA 2IZJA 1VWBB 2RTKA 3WYQA 1NQMA 1SWLA 4BX5A 2RTIB 2FHNX 1KL5A 4JO6A 3MG5A 1NBXA 1LCZA 4BJ8A 1LELA 5B5FA 1SLGB 1MOYA 2UYWA 5IRWA 1SWHA 1VWJB 2A5BA 2RTMA 3RY1A 4DNEA 2FHLA 1WBIA 1Y55X 3EW1A 4EKVA 1N9MA 1LDQA 1SWEA 4GJSA 2RTAA 3WZQA 1SWCA 2C1QA 2MF6A 2Y3FA 4BX6B 1SWPA 2GH7A 3VHHA 1RXHA 3SZHA 1VWOB 1RXKA 1SRFA 4GDAA 3SZIA 3MM0A 2AVIA 1VWMB 1RXJA 1VWDB 2RTEB 5JD2A 1HY2A 4GGZA 1PTSA 4JHQA 5IRUA 1KL4A 1VWRB 1NQNA 1MK5A 2C4IA 3RDMA 1N4JA 3RDOA 4CPFA 1LCWA 1VWCB 2RTHB 1HXZA 1VWEB 1SWUA 2RTLA 3FDCA 5K68A 2RTCB 3PK2A 3VGWA 1NC9A 1SWQA 1SWAA 2IZAA 3WZNA 2A5CA 3T6LA 3T6FA 2IZEB 1SRIA 2WPUA 5F2BA 1VWGB 2RTDB 4JNJA 2Y32A 3RDUA 1AVEA 1VWPB 4I60A 2RTQB 2RTGB 1SWGA 2UZ2A 4BX7B 4Z2VA 1LDOA 4GJVA 3T2XA 3RE5A 1NDJA 2OFAA 4Z28A 1RSTB 5CHKA 4BX5B 1VWIB 1SWBA 1N9YA 4CPHA 1SLFB 4Y5DA 1VYOA 3WZOA 2OF9A 4GD9A 1SRJA 1STSB 2CAMA 2F01A 2IZIA 4BBOA 1SWSA 4CPEA 1SWKA 2RTJA 1VWHB 4OKAA 2IZBA 4Z27A 2C1SA 1KL3A 2QCBA 3EW2A 1AVDA 2A8GA 1N43A 3VHIA 2RTFB 1LUQA 2RTNB 2RTRB 1VWLB 2Y3EA 3RY2A 4GGTA 1SWFA 1MEPA 5L3YA 4GGRA 1Y52X 2IZGB 2IZHB 3SZJA 1SWDA 1SWTA 2RTBB 3WZPA 1STRB 1HQQA 1SWJA 1VWQB 4BCSA 1SRGA 2IZKA 3VHMA 2ZSCA 4BX6A 2RTOB 3RDQA 3T2WA 3WYPA 2OFBA 4CPIA 1DF8A 1RSUB 4Z2OA 4YVBA 2OF8A 1LCVA 2IZDB 1VWFB 2BC3A 1N7YA 2IZFB 1SLDB 2RTPB 4Z6JA 1VWKB 1SWNA 1VWNB 5IRAA 5K67A 1Y53X 4IRWA 3RE6A 4U46A 1HXLA 5B5GA 2G5LA 1SLEB 5CSEA 3RDXA 4Z2PA 1IJ8A
chains in the Genus database with same CATH superfamily
2G79A 1VWAB 1KT6A 1YWCA 5IO7A 1MM9A 1B4MA 1BBPA 1KFFA 1SXWA 5AEOA 5IO5A 2IZLB 3HPEA 4ZHFA 3CQNA 4OMWA 1I9HA 4R0BA 3HWEA 4BX7A 4D6BA 1SWOA 2Q2PA 5D47A 4IABA 1KZWA 5HZ8A 1BLRA 1O1VA 2QOMA 3NX1A 4ID2A 4JO6A 3MG5A 3SLJA 4QQ1A 4YCEA 3BX8A 4KC7A 1LCZA 4BJ8A 1LELA 4QZUA 1SLGB 1MOYA 2RCQA 4LQZA 5EEEA 2CBRA 1A18A 1LNMA 3D96A 3RY1A 1HBPA 2FHLA 1Y55X 4C5PA 1G85A 4ZHHA 4ODDA 4CSBA 3D9WA 4ZH6A 1EI5A 1SWEA 2RTAA 4GJSA 4CDFA 4OS8A 1QY2A 1SXXA 1SWCA 1AQBA 3B2HA 1AVGI 3D97A 3KZAA 2MF6A 3BSZE 2Y3FA 4HWMA 4BX6B 1SWPA 4EQAC 2HZQA 1KXOA 1RXHA 3JSQA 2Q9SA 1VWOB 4ORXA 4TNNA 4YDAA 4XMCA 2HNXA 2AT3X 2Q2MA 5D48A 1ACDA 2AVIA 1RXJA 1VWDB 3APUA 1IFCA 3EM0A 3HTYA 1HY2A 3CWKA 4YH0A 1YWBA 4NYRA 1AELA 3MVFA 5F7GA 1VWRB 4TQ2A 1SXYA 1I06A 3NX2A 1EXSA 1B8EA 1VWCB 1LCWA 1ML7A 1NP4A 1VWEB 2RTHB 1T68X 3FDCA 4ORUA 5EEDA 3TGAA 1UZ2X 3VGWA 4BVMA 4ZHDA 4N7DA 3T6FA 3FA7A 3WZNA 2A5CA 2OVDA 4ZHGA 1Z24A 5KICA 2IZEB 5BVTA 3U03A 1LIBA 3N91A 4UU2A 2VFCA 4DQ3A 1HBQA 4UU3A 3STKA 3V8UA 4L1NA 3VG4A 1SWGA 3B2KA 5B29A 1WUBA 2M4LA 3FW5A 1XKIA 3PQUA 4GJVA 3RE5A 3WJEA 2AMMX 4BX5B 5CHKA 5LKFA 1X71A 1QFVA 3SOTA 5KHPA 3FR2A 1SLFB 1IKJA 1W6FA 3BY0A 2MWHA 1TOWA 1BSOA 1SRJA 2CAMA 2F01A 4M6SA 4CPEA 4ORRA 1BRPA 1SWKA 1SY2A 2ZAGA 3RBYA 4ZGUA 4Y0RA 1GT4A 5HTDA 1MUPA 4ARHA 1JBHA 4PSQA 1EQDA 4GUZA 3P6FA 1E5PA 4BOEA 2QOSC 2QCBA 4IB8A 4XMHA 3UEWA 4KCAA 3VHIA 2RTFB 1QABE 1X89A 1BM5A 2Y3EA 5EZ2A 4GGTA 1SWFA 5FENA 2RA6A 1W5RA 3KFGA 3U9PC 4GGRA 2OL8O 3LV4A 4WHIA 1CBSA 4Y0SA 4BGFA 3FR4A 1SWJA 3TF6A 5HZQA 4EXZA 1ERXA 1PM1X 2ZSCA 1GT3A 3KVNA 2RTOB 3WYPA 2OVAA 2OFBA 1OEJA 2X32A 2BS5A 4OS3A 3WBGA 1JJUA 3BU1A 4GDZA 4CPIA 4YVBA 2VFBA 2X8FA 2IZFB 1N7YA 2FS6A 3NQKA 4KT5A 3UEVA 5FFHA 1SWNA 3RSWA 3P6HA 1FENA 1VWNB 4ZR2A 3H3IA 2LBAA 4EDEA 1Y9TA 1X8OA 2LKKA 4IRWA 5L8OA 3RZYA 1X8QA 3VG5A 1BSQA 1D2UA 1S7DA 2G5LA 4PJ2A 1JYJA 1IJ8A 2X46A 5F1EA 3VU1A 1OPBA 3JQOA 4OEMA 4A60A 1PBYA 2WSJA 1PEEA 2NNQA 4TKBA 1FEMA 1ZNLA 1O8VA 1ZNDA 2AT0X 2HKDA 2L9CA 2I5VO 4Y59A 4LZVA 1BEBA 2IZJA 4CDCA 1VWBB 1MDCA 1NQMA 3NQ9A 1EUOA 3C76X 4XMGA 3IA8A 4AYHA 4ZFXA 5B3MO 2R74A 1LPJA 3NPOA 2ALLX 1L6MA 1NBXA 2DJFA 2JW1A 4ORSA 5L8IA 4HPAA 5IRWA 2W2AA 1OBPA 2X34A 1VWJB 4IBAA 2A5BA 4QGXA 4YKOA 1JYDA 3ZUOA 3ZWEA 4ALOA 3ELZA 1PMPA 3EW1A 1DZJA 1SY1A 4EKVA 3F8AA 5IO6A 1LDQA 4LKTA 4DQ4A 5HAEA 1O1UA 5B10O 4NW4A 2RD7C 4GE1A 2CBSA 2CM9A 5DG4A 5FAZA 4NLIA 5HZ5A 2X55A 1YP6A 3DTQA 2LBVA 3VHHA 3AUMO 4A1HA 1KT7A 2FWVA 1RXKA 3EBKA 1GXAA 1SRFA 4MEEA 5HZ6A 3SZIA 1A2DA 3BDRA 2FKJA 1VWMB 3HOLA 1H91A 1DF3A 2G8CO 2XSTA 3VG7A 4JHQA 5FQ6E 3APWA 3NQ3A 1FTPA 1NQNA 4O3ZA 1BSYA 3RDOA 1NP1A 3K3LA 1OEKA 3PDFA 4N7CA 2X4MA 1S44A 2AT8X 1SWQA 5B27A 3UEXA 1FDQA 4O9SA 3SLTA 3APXA 1SRIA 5F6BA 4KIIA 3UAQA 4IAXA 3NR3A 2Y32A 3FA8A 4YMYA 3O2YA 1N0SA 4YFPA 4EFGA 3ZW1A 4YGZA 3D95A 1TOUA 2X8TA 1LDOA 5LJBA 1QWDA 2G7BA 4Z28A 1HQPA 2OYBO 1GKAB 1SWBA 2F73A 2RN4A 1G74A 4MISA 1VYOA 1K24A 2OF9A 4I9RA 4NV7A 2RCTA 4Y5DA 4COTA 5L3YA 1E06A 2PI3O 2BSZA 2AH7X 5AJCA 1CRBA 2RTJA 1GGLA 1Y9LA 4FBOA 2IZBA 1OPAA 3TGBA 5HTEA 2L67A 1KT4A 2WEXA 2MO5A 5H9LA 4Z27A 2C1SA 3B2JA 1KL3A 5LKEA 1AVDA 2WUTA 2FS7A 2A8GA 2JU7A 3F9DA 1JQPA 3STMX 1BJ7A 2HLVA 1UREA 4TLJA 3WJCA 1JMZA 1VPRA 3ELXA 4ORYA 4QYPA 5FQ7E 3RY2A 2AF5A 3FW4A 1MEPA 2ACOA 4EEJA 4QRLA 3WJDA 1A57A 2IZGB 2AT5X 1AB0A 1YP7A 4GNYA 1DZMA 4Y0PA 5IXGA 4LKPA 2JMBA 2K62A 2X45A 1HQQA 3WZPA 5BVSA 3PPTA 3G7XA 4I3DA 1KZXA 5D4AA 1GX9A 2BS6A 2CM4A 3VHMA 3FIQA 3P6EA 4BX6A 4MVLA 1S2PA 3T2WA 3PP6A 5LJDA 1CJ5A 4Z2OA 4QGWA 2OF8A 3MBTA 1LIFA 4FBRA 2G78A 4CDDA 3FMZA 4Z6JA 1G5WA 5HCEC 2Q4NA 2ANSA 1KQWA 1OBQA 2P8GA 1VWKB 2FLJA 3WJBA 3O19A 3FA9A 3FYFA 5IRAA 1UYOX 3GE2A 5K67A 5L8NA 2QMIA 1ZRYA 1Y53X 2QM9A 4GNWA 1HXLA 1IKEA 4YFRA 3WJFA 3AKMA 1I4UA 5CSEA 3VE2A 4HPDA 4Z2PA 3PQSA 1QG5A 4CPHB 1U18A 3PECA 1D3SA 4AZNA 4ML7B 4YKMA 2GC9A 3RDSA 2E4JA 1EPBA 2L5PA 2IZCB 4RUUA 2L68A 1HN2A 1SREA 4BX5A 1YWAA 5AQ6A 1FE3A 3PH5A 5F6ZA 1OBUA 1SY3A 1JJXA 5FQ8E 2R56A 1I05A 2A0AA 1MX8A 3F6ZB 4GK9A 4I95A 4B55A 5DPQA 4ZH9A 2UYWA 4HPCA 4XMFA 4NV8A 4OMXA 4I6SA 2RTMA 1E2TA 1ZNEA 4ES7A 4WFVA 4FQBB 1YWDA 1ICMA 4JGLA 3AKNA 3HWDA 2F09A 2I5ZO 3WZQA 3WXQA 3P02A 1SA8A 2C1QA 2OFMX 5H8TA 5F58A 1EIOA 2W2BA 4QZTA 4FGIB 2GH7A 4YCHA 5HZ9A 1JZUA 1Y0GA 2YG2A 2HMBA 5D8JA 2WQ9A 3WVMA 4O49A 3MM0A 1MVGA 1A3YA 2BLGA 4XMDA 3QKGA 3BS2A 4GETA 4KC8A 1OEEA 4GGZA 2QO4A 4AZRA 4YGGA 5IRUA 5H9AA 1KL4A 4IMOA 3ZW0B 3RDMA 2C4IA 1FELA 2FR2A 3HWFA 1GX8A 2RTLA 1HXZA 2A3FX 1SWUA 3FEPA 1CBQA 2GJ5A 4ZJ0A 3PK2A 1DZKA 1NC9A 1SWAA 2IZAA 3T6LA 4O3XB 3S5VA 3KQ0A 4NP1A 1VWGB 2RTDB 2DM5A 3DSZA 5K06A 2HYSA 1PBOA 1AVEA 3C77X 3PH6A 2UZ2A 4BX7B 4Z2VA 1SMPI 1KT5A 3EYCA 2X56A 4LZUA 1ICNA 1ALBA 1NDJA 2OFAA 2RQ0A 3OJYC 4FBVA 5C0NA 1LIEA 4Y0QA 4U8UM 3C78X 1VWIB 2A2GA 2LFOA 3ZW2A 2MHDA 4D6AA 1KT3A 2A13A 3WZOA 4AZMA 1U0XA 3T1DA 3ZI8A 4WBKA 5B11O 4BBOA 1ZNKA 2DJGA 4GH7A 2KTDA 2OVSA 3ZUIA 2ACPX 1KGLA 1SXUA 5HBSA 3LHNA 5EDCA 3S60A 1EW3A 2BHVA 1U17A 1CBIA 1DV9A 1LIDA 1RLBE 1IFBA 1I78A 1QFTA 3BU9A 4O3WA 4O4XA 1LUQA 2RTNB 1HMTA 2RTRB 3P6CA 4GZVA 4DCBA 2FTBA 2PY1A 4L3RA 4IAWA 4QNIA 1B56A 2KTSA 5H9KA 4CK4A 1E02A 4QGVA 2NNEA 2AL0X 3CBCA 2W2FA 3FA6A 3IFBA 4GKCA 5HA1A 3SZJA 2LA7A 4U3QA 3FEKA 1SWDA 1SWTA 2RTBB 3KFHA 4IB7A 5EDBA 5B2AO 5LJCA 1VWQB 2GTLO 3I0AA 4NNTA 2OY7A 2OZQA 3AEHA 2IZKA 2XKLA 1JJJA 1TXLA 1RSUB 3WOVA 4AZPA 4AW8A 1P6PA 1W4TA 2CZTA 3TZSA 3D4RA 1X8UA 5BVQA 4NNSA 2Q39A 1SLDB 4A8ZA 5LJHA 4MIRA 3O22A 4GU8A 5CYBA 1IW2A 1MX7A 5CE4A 1GT5A 2POAA 2JU3A 4MVKA 1GT1A 1B0OA 4CV7A 2BT9A 1YUPA 5AJBA 2MJIA 1QY0A 2QO6A 4I9SA 3B2IA 1FJ1E 3RE6A 4ZGFA 1QY1A 1TW4A 1VWFB 1SLEB 3FIDA 3SLOA 1QQSA 5HCCC 3FELA 3HOEA 3RWXA 1GM6A 3RKGA 3U0DA 3NP1A 5BYPA 1NGLA 3X00A 2QO5A 1STPA 1SWRA 4TKHA 1RAVA 3APVA 1SRHA 4INNA 2Z4HA 2JGSA 2OY5O 3CKFA 5LJGA 2VDFA 4U8UN 1VYGA 2RTKA 3WYQA 5LJEA 1SWLA 2RTIB 1GKAA 1KL5A 2FHNX 3NADA 2X8SA 4YBPA 3I17A 3BLGA 1LICA 2OY1O 1YIVA 5B5FA 2ASNX 1SWHA 1RBPA 3FR5A 2WQAE 4QYNA 2FR3A 4OELA 4DNEA 2FRSA 3NBXX 5H9NA 3Q6LA 2KT4B 2YMSA 1WBIA 4YFQA 2O62A 4U8UO 4GRJA 1N9MA 3S26A 3ZZVA 4MVIA 3TGCA 1LFOA 3VG3A 4ALBA 1SY0A 3ZQ3A 3SZHA 2NP1A 4GDAA 2EU7X 2FKGA 2FGSA 1CBRA 4IB9A 3KFIA 3HWGA 3OBLA 2RTEB 5JD2A 1PTSA 4CDEA 1ADLA 4O4UA 4ZHCA 3CKGA 1MK5A 2AT6X 1N4JA 4M7MA 1KQXA 2JOZA 4HFOA 4KH8A 2GTLM 4NLJA 5K68A 2JN3A 3CMPA 2RTCB 1HMRA 3FENA 2CZUA 1G7NA 1EALA 1JV4A 4QAEA 1EIIA 4MVEA 1ERBA 2AKQA 2WPUA 2OL6O 3EC5A 3PEDA 1OSPO 1UYNX 4JNJA 4U9CA 5F2BA 1VWPB 2WR6A 4I60A 3RDUA 2RTQB 2Z4IA 2OL7A 3VG6A 1T8VA 2RTGB 3FLLA 1ZNHA 2WEWA 3T2XA 3S5XA 1RSTB 3OD9A 4O4SA 1DC9A 1BWYA 1DFVA 3B2LA 1N9YA 2KD2A 4CPHA 1TVQA 5HWZA 4ORWA 2FT9A 3VE1A 1VYFA 4GD9A 4AZOA 3WJGA 3Q34A 2IZIA 1STSB 3VPJE 1GX3A 1SWSA 3CBSA 4YDBA 2ZAIA 1E00A 1VWHB 3JS1A 3L4RA 2IFBA 2OY8A 3CR6A 4OKAA 4ZCBA 4XMEA 3EW2A 3EMMA 3BX7A 1N43A 2WWPA 2LB6A 3HK1A 3VG2A 4O4OA 1VWLB 3P24A 2KW1A 2A2UA 3QQ2A 5HA0A 3MX7A 4I3CA 4RUNA 3UEUA 1EPAA 3KFFA 1IIUA 4CPFA 3LTWA 3GAQA 1Y52X 4TKJA 2IZHB 1X8NA 4HPBA 5EPQA 2N93A 4I3BA 1STRB 3EBWA 4BCSA 1R0UA 4TJZA 2HZRA 1DZPA 1SRGA 4A1YA 5HCDC 1BRQA 3CQRA 2GTFX 5JR8A 2JU8A 4IMNA 1HMSA 2R73A 4WFUA 2MM3A 3E3CA 3RDQA 3OE3A 3SAOA 5LJKA 1DF8A 4YBUA 3STNA 1JIWI 1LCVA 2IZDB 4K19A 2BC3A 3P6DA 1XCAA 2RTPB 1X8PA 2NNDA 1KOIA 1ZNGA 1K3BA 4BQUA 1LF7A 3P6GA 4O3YA 2OFRX 4ON1A 4YGHA 1JMXA 2GTLN 4OS0A 3ZW1B 1LKEA 5D45A 3ZW0A 5KIDA 1I04A 4U46A 1T0VA 4IB6A 4AZQA 5B5GA 2OVEA 2K23A 3RDXA 4NYQA 3BRNA
chains in the Genus database with same CATH topology
4CPHB 1VWAB 3X00A 1MM9A 1KFFA 1STPA 1SWRA 3RDSA 1RAVA 4Y59A 1SRHA 2IZCB 2IZLB 2JGSA 1I9HA 4BX7A 1SREA 1SWOA 2IZJA 1VWBB 2RTKA 3WYQA 1NQMA 1SWLA 4BX5A 2RTIB 2FHNX 1KL5A 4JO6A 3MG5A 1NBXA 1LCZA 4BJ8A 1LELA 5B5FA 1SLGB 1MOYA 2UYWA 5IRWA 1SWHA 1VWJB 2A5BA 2RTMA 3RY1A 4DNEA 2FHLA 1WBIA 1Y55X 3EW1A 4EKVA 1N9MA 1LDQA 1SWEA 4GJSA 2RTAA 3WZQA 1SWCA 2C1QA 2MF6A 2Y3FA 4BX6B 1SWPA 2GH7A 3VHHA 1RXHA 3SZHA 1VWOB 1RXKA 1SRFA 4GDAA 3SZIA 3MM0A 2AVIA 1VWMB 1RXJA 1VWDB 2RTEB 5JD2A 1HY2A 4GGZA 1PTSA 4JHQA 5IRUA 1KL4A 1VWRB 1NQNA 1MK5A 2C4IA 3RDMA 1N4JA 3RDOA 4CPFA 1LCWA 1VWCB 2RTHB 1HXZA 1VWEB 1SWUA 2RTLA 3FDCA 5K68A 2RTCB 3PK2A 3VGWA 1NC9A 1SWQA 1SWAA 2IZAA 3WZNA 2A5CA 3T6LA 3T6FA 2IZEB 1SRIA 2WPUA 5F2BA 1VWGB 2RTDB 4JNJA 2Y32A 3RDUA 1AVEA 1VWPB 4I60A 2RTQB 2RTGB 1SWGA 2UZ2A 4BX7B 4Z2VA 1LDOA 4GJVA 3T2XA 3RE5A 1NDJA 2OFAA 4Z28A 1RSTB 5CHKA 4BX5B 1VWIB 1SWBA 1N9YA 4CPHA 1SLFB 4Y5DA 1VYOA 3WZOA 2OF9A 4GD9A 1SRJA 1STSB 2CAMA 2F01A 2IZIA 4BBOA 1SWSA 4CPEA 1SWKA 2RTJA 1VWHB 4OKAA 2IZBA 4Z27A 2C1SA 1KL3A 2QCBA 3EW2A 1AVDA 2A8GA 1N43A 3VHIA 2RTFB 1LUQA 2RTNB 2RTRB 1VWLB 2Y3EA 3RY2A 4GGTA 1SWFA 1MEPA 5L3YA 4GGRA 1Y52X 2IZGB 2IZHB 3SZJA 1SWDA 1SWTA 2RTBB 3WZPA 1STRB 1HQQA 1SWJA 1VWQB 4BCSA 1SRGA 2IZKA 3VHMA 2ZSCA 4BX6A 2RTOB 3RDQA 3T2WA 3WYPA 2OFBA 4CPIA 1DF8A 1RSUB 4Z2OA 4YVBA 2OF8A 1LCVA 2IZDB 1VWFB 2BC3A 1N7YA 2IZFB 1SLDB 2RTPB 4Z6JA 1VWKB 1SWNA 1VWNB 5IRAA 5K67A 1Y53X 4IRWA 3RE6A 4U46A 1HXLA 5B5GA 2G5LA 1SLEB 5CSEA 3RDXA 4Z2PA 1IJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPH B;  1VWA B;  3X00 A;  1MM9 A;  1KFF A;  1STP A;  1SWR A;  3RDS A;  1RAV A;  4Y59 A;  1SRH A;  2IZC B;  2IZL B;  2JGS A;  1I9H A;  4BX7 A;  1SRE A;  1SWO A;  2IZJ A;  1VWB B;  2RTK A;  3WYQ A;  1NQM A;  1SWL A;  4BX5 A;  2RTI B;  2FHN X;  1KL5 A;  4JO6 A;  3MG5 A;  1NBX A;  1LCZ A;  4BJ8 A;  1LEL A;  5B5F A;  1SLG B;  1MOY A;  2UYW A;  5IRW A;  1SWH A;  1VWJ B;  2A5B A;  2RTM A;  3RY1 A;  4DNE A;  2FHL A;  1WBI A;  1Y55 X;  3EW1 A;  4EKV A;  1N9M A;  1LDQ A;  1SWE A;  4GJS A;  2RTA A;  3WZQ A;  1SWC A;  2C1Q A;  2MF6 A;  2Y3F A;  4BX6 B;  1SWP A;  2GH7 A;  3VHH A;  1RXH A;  3SZH A;  1VWO B;  1RXK A;  1SRF A;  4GDA A;  3SZI A;  3MM0 A;  2AVI A;  1VWM B;  1RXJ A;  1VWD B;  2RTE B;  5JD2 A;  1HY2 A;  4GGZ A;  1PTS A;  4JHQ A;  5IRU A;  1KL4 A;  1VWR B;  1NQN A;  1MK5 A;  2C4I A;  3RDM A;  1N4J A;  3RDO A;  4CPF A;  1LCW A;  1VWC B;  2RTH B;  1HXZ A;  1VWE B;  1SWU A;  2RTL A;  3FDC A;  5K68 A;  2RTC B;  3PK2 A;  3VGW A;  1NC9 A;  1SWQ A;  1SWA A;  2IZA A;  3WZN A;  2A5C A;  3T6L A;  3T6F A;  2IZE B;  1SRI A;  2WPU A;  5F2B A;  1VWG B;  2RTD B;  4JNJ A;  2Y32 A;  3RDU A;  1AVE A;  1VWP B;  4I60 A;  2RTQ B;  2RTG B;  1SWG A;  2UZ2 A;  4BX7 B;  4Z2V A;  1LDO A;  4GJV A;  3T2X A;  3RE5 A;  1NDJ A;  2OFA A;  4Z28 A;  1RST B;  5CHK A;  4BX5 B;  1VWI B;  1SWB A;  1N9Y A;  4CPH A;  1SLF B;  4Y5D A;  1VYO A;  3WZO A;  2OF9 A;  4GD9 A;  1SRJ A;  1STS B;  2CAM A;  2F01 A;  2IZI A;  4BBO A;  1SWS A;  4CPE A;  1SWK A;  2RTJ A;  1VWH B;  4OKA A;  2IZB A;  4Z27 A;  2C1S A;  1KL3 A;  2QCB A;  3EW2 A;  1AVD A;  2A8G A;  1N43 A;  3VHI A;  2RTF B;  1LUQ A;  2RTN B;  2RTR B;  1VWL B;  2Y3E A;  3RY2 A;  4GGT A;  1SWF A;  1MEP A;  5L3Y A;  4GGR A;  1Y52 X;  2IZG B;  2IZH B;  3SZJ A;  1SWD A;  1SWT A;  2RTB B;  3WZP A;  1STR B;  1HQQ A;  1SWJ A;  1VWQ B;  4BCS A;  1SRG A;  2IZK A;  3VHM A;  2ZSC A;  4BX6 A;  2RTO B;  3RDQ A;  3T2W A;  3WYP A;  2OFB A;  4CPI A;  1DF8 A;  1RSU B;  4Z2O A;  4YVB A;  2OF8 A;  1LCV A;  2IZD B;  1VWF B;  2BC3 A;  1N7Y A;  2IZF B;  1SLD B;  2RTP B;  4Z6J A;  1VWK B;  1SWN A;  1VWN B;  5IRA A;  5K67 A;  1Y53 X;  4IRW A;  3RE6 A;  4U46 A;  1HXL A;  5B5G A;  2G5L A;  1SLE B;  5CSE A;  3RDX A;  4Z2P A;  1IJ8 A; 
#chains in the Genus database with same CATH topology
 2G79 A;  1VWA B;  1KT6 A;  1YWC A;  5IO7 A;  1MM9 A;  1B4M A;  1BBP A;  1KFF A;  1SXW A;  5AEO A;  5IO5 A;  2IZL B;  3HPE A;  4ZHF A;  3CQN A;  4OMW A;  1I9H A;  4R0B A;  3HWE A;  4BX7 A;  4D6B A;  1SWO A;  2Q2P A;  5D47 A;  4IAB A;  1KZW A;  5HZ8 A;  1BLR A;  1O1V A;  2QOM A;  3NX1 A;  4ID2 A;  4JO6 A;  3MG5 A;  3SLJ A;  4QQ1 A;  4YCE A;  3BX8 A;  4KC7 A;  1LCZ A;  4BJ8 A;  1LEL A;  4QZU A;  1SLG B;  1MOY A;  2RCQ A;  4LQZ A;  5EEE A;  2CBR A;  1A18 A;  1LNM A;  3D96 A;  3RY1 A;  1HBP A;  2FHL A;  1Y55 X;  4C5P A;  1G85 A;  4ZHH A;  4ODD A;  4CSB A;  3D9W A;  4ZH6 A;  1EI5 A;  1SWE A;  2RTA A;  4GJS A;  4CDF A;  4OS8 A;  1QY2 A;  1SXX A;  1SWC A;  1AQB A;  3B2H A;  1AVG I;  3D97 A;  3KZA A;  2MF6 A;  3BSZ E;  2Y3F A;  4HWM A;  4BX6 B;  1SWP A;  4EQA C;  2HZQ A;  1KXO A;  1RXH A;  3JSQ A;  2Q9S A;  1VWO B;  4ORX A;  4TNN A;  4YDA A;  4XMC A;  2HNX A;  2AT3 X;  2Q2M A;  5D48 A;  1ACD A;  2AVI A;  1RXJ A;  1VWD B;  3APU A;  1IFC A;  3EM0 A;  3HTY A;  1HY2 A;  3CWK A;  4YH0 A;  1YWB A;  4NYR A;  1AEL A;  3MVF A;  5F7G A;  1VWR B;  4TQ2 A;  1SXY A;  1I06 A;  3NX2 A;  1EXS A;  1B8E A;  1VWC B;  1LCW A;  1ML7 A;  1NP4 A;  1VWE B;  2RTH B;  1T68 X;  3FDC A;  4ORU A;  5EED A;  3TGA A;  1UZ2 X;  3VGW A;  4BVM A;  4ZHD A;  4N7D A;  3T6F A;  3FA7 A;  3WZN A;  2A5C A;  2OVD A;  4ZHG A;  1Z24 A;  5KIC A;  2IZE B;  5BVT A;  3U03 A;  1LIB A;  3N91 A;  4UU2 A;  2VFC A;  4DQ3 A;  1HBQ A;  4UU3 A;  3STK A;  3V8U A;  4L1N A;  3VG4 A;  1SWG A;  3B2K A;  5B29 A;  1WUB A;  2M4L A;  3FW5 A;  1XKI A;  3PQU A;  4GJV A;  3RE5 A;  3WJE A;  2AMM X;  4BX5 B;  5CHK A;  5LKF A;  1X71 A;  1QFV A;  3SOT A;  5KHP A;  3FR2 A;  1SLF B;  1IKJ A;  1W6F A;  3BY0 A;  2MWH A;  1TOW A;  1BSO A;  1SRJ A;  2CAM A;  2F01 A;  4M6S A;  4CPE A;  4ORR A;  1BRP A;  1SWK A;  1SY2 A;  2ZAG A;  3RBY A;  4ZGU A;  4Y0R A;  1GT4 A;  5HTD A;  1MUP A;  4ARH A;  1JBH A;  4PSQ A;  1EQD A;  4GUZ A;  3P6F A;  1E5P A;  4BOE A;  2QOS C;  2QCB A;  4IB8 A;  4XMH A;  3UEW A;  4KCA A;  3VHI A;  2RTF B;  1QAB E;  1X89 A;  1BM5 A;  2Y3E A;  5EZ2 A;  4GGT A;  1SWF A;  5FEN A;  2RA6 A;  1W5R A;  3KFG A;  3U9P C;  4GGR A;  2OL8 O;  3LV4 A;  4WHI A;  1CBS A;  4Y0S A;  4BGF A;  3FR4 A;  1SWJ A;  3TF6 A;  5HZQ A;  4EXZ A;  1ERX A;  1PM1 X;  2ZSC A;  1GT3 A;  3KVN A;  2RTO B;  3WYP A;  2OVA A;  2OFB A;  1OEJ A;  2X32 A;  2BS5 A;  4OS3 A;  3WBG A;  1JJU A;  3BU1 A;  4GDZ A;  4CPI A;  4YVB A;  2VFB A;  2X8F A;  2IZF B;  1N7Y A;  2FS6 A;  3NQK A;  4KT5 A;  3UEV A;  5FFH A;  1SWN A;  3RSW A;  3P6H A;  1FEN A;  1VWN B;  4ZR2 A;  3H3I A;  2LBA A;  4EDE A;  1Y9T A;  1X8O A;  2LKK A;  4IRW A;  5L8O A;  3RZY A;  1X8Q A;  3VG5 A;  1BSQ A;  1D2U A;  1S7D A;  2G5L A;  4PJ2 A;  1JYJ A;  1IJ8 A;  2X46 A;  5F1E A;  3VU1 A;  1OPB A;  3JQO A;  4OEM A;  4A60 A;  1PBY A;  2WSJ A;  1PEE A;  2NNQ A;  4TKB A;  1FEM A;  1ZNL A;  1O8V A;  1ZND A;  2AT0 X;  2HKD A;  2L9C A;  2I5V O;  4Y59 A;  4LZV A;  1BEB A;  2IZJ A;  4CDC A;  1VWB B;  1MDC A;  1NQM A;  3NQ9 A;  1EUO A;  3C76 X;  4XMG A;  3IA8 A;  4AYH A;  4ZFX A;  5B3M O;  2R74 A;  1LPJ A;  3NPO A;  2ALL X;  1L6M A;  1NBX A;  2DJF A;  2JW1 A;  4ORS A;  5L8I A;  4HPA A;  5IRW A;  2W2A A;  1OBP A;  2X34 A;  1VWJ B;  4IBA A;  2A5B A;  4QGX A;  4YKO A;  1JYD A;  3ZUO A;  3ZWE A;  4ALO A;  3ELZ A;  1PMP A;  3EW1 A;  1DZJ A;  1SY1 A;  4EKV A;  3F8A A;  5IO6 A;  1LDQ A;  4LKT A;  4DQ4 A;  5HAE A;  1O1U A;  5B10 O;  4NW4 A;  2RD7 C;  4GE1 A;  2CBS A;  2CM9 A;  5DG4 A;  5FAZ A;  4NLI A;  5HZ5 A;  2X55 A;  1YP6 A;  3DTQ A;  2LBV A;  3VHH A;  3AUM O;  4A1H A;  1KT7 A;  2FWV A;  1RXK A;  3EBK A;  1GXA A;  1SRF A;  4MEE A;  5HZ6 A;  3SZI A;  1A2D A;  3BDR A;  2FKJ A;  1VWM B;  3HOL A;  1H91 A;  1DF3 A;  2G8C O;  2XST A;  3VG7 A;  4JHQ A;  5FQ6 E;  3APW A;  3NQ3 A;  1FTP A;  1NQN A;  4O3Z A;  1BSY A;  3RDO A;  1NP1 A;  3K3L A;  1OEK A;  3PDF A;  4N7C A;  2X4M A;  1S44 A;  2AT8 X;  1SWQ A;  5B27 A;  3UEX A;  1FDQ A;  4O9S A;  3SLT A;  3APX A;  1SRI A;  5F6B A;  4KII A;  3UAQ A;  4IAX A;  3NR3 A;  2Y32 A;  3FA8 A;  4YMY A;  3O2Y A;  1N0S A;  4YFP A;  4EFG A;  3ZW1 A;  4YGZ A;  3D95 A;  1TOU A;  2X8T A;  1LDO A;  5LJB A;  1QWD A;  2G7B A;  4Z28 A;  1HQP A;  2OYB O;  1GKA B;  1SWB A;  2F73 A;  2RN4 A;  1G74 A;  4MIS A;  1VYO A;  1K24 A;  2OF9 A;  4I9R A;  4NV7 A;  2RCT A;  4Y5D A;  4COT A;  5L3Y A;  1E06 A;  2PI3 O;  2BSZ A;  2AH7 X;  5AJC A;  1CRB A;  2RTJ A;  1GGL A;  1Y9L A;  4FBO A;  2IZB A;  1OPA A;  3TGB A;  5HTE A;  2L67 A;  1KT4 A;  2WEX A;  2MO5 A;  5H9L A;  4Z27 A;  2C1S A;  3B2J A;  1KL3 A;  5LKE A;  1AVD A;  2WUT A;  2FS7 A;  2A8G A;  2JU7 A;  3F9D A;  1JQP A;  3STM X;  1BJ7 A;  2HLV A;  1URE A;  4TLJ A;  3WJC A;  1JMZ A;  1VPR A;  3ELX A;  4ORY A;  4QYP A;  5FQ7 E;  3RY2 A;  2AF5 A;  3FW4 A;  1MEP A;  2ACO A;  4EEJ A;  4QRL A;  3WJD A;  1A57 A;  2IZG B;  2AT5 X;  1AB0 A;  1YP7 A;  4GNY A;  1DZM A;  4Y0P A;  5IXG A;  4LKP A;  2JMB A;  2K62 A;  2X45 A;  1HQQ A;  3WZP A;  5BVS A;  3PPT A;  3G7X A;  4I3D A;  1KZX A;  5D4A A;  1GX9 A;  2BS6 A;  2CM4 A;  3VHM A;  3FIQ A;  3P6E A;  4BX6 A;  4MVL A;  1S2P A;  3T2W A;  3PP6 A;  5LJD A;  1CJ5 A;  4Z2O A;  4QGW A;  2OF8 A;  3MBT A;  1LIF A;  4FBR A;  2G78 A;  4CDD A;  3FMZ A;  4Z6J A;  1G5W A;  5HCE C;  2Q4N A;  2ANS A;  1KQW A;  1OBQ A;  2P8G A;  1VWK B;  2FLJ A;  3WJB A;  3O19 A;  3FA9 A;  3FYF A;  5IRA A;  1UYO X;  3GE2 A;  5K67 A;  5L8N A;  2QMI A;  1ZRY A;  1Y53 X;  2QM9 A;  4GNW A;  1HXL A;  1IKE A;  4YFR A;  3WJF A;  3AKM A;  1I4U A;  5CSE A;  3VE2 A;  4HPD A;  4Z2P A;  3PQS A;  1QG5 A;  4CPH B;  1U18 A;  3PEC A;  1D3S A;  4AZN A;  4ML7 B;  4YKM A;  2GC9 A;  3RDS A;  2E4J A;  1EPB A;  2L5P A;  2IZC B;  4RUU A;  2L68 A;  1HN2 A;  1SRE A;  4BX5 A;  1YWA A;  5AQ6 A;  1FE3 A;  3PH5 A;  5F6Z A;  1OBU A;  1SY3 A;  1JJX A;  5FQ8 E;  2R56 A;  1I05 A;  2A0A A;  1MX8 A;  3F6Z B;  4GK9 A;  4I95 A;  4B55 A;  5DPQ A;  4ZH9 A;  2UYW A;  4HPC A;  4XMF A;  4NV8 A;  4OMX A;  4I6S A;  2RTM A;  1E2T A;  1ZNE A;  4ES7 A;  4WFV A;  4FQB B;  1YWD A;  1ICM A;  4JGL A;  3AKN A;  3HWD A;  2F09 A;  2I5Z O;  3WZQ A;  3WXQ A;  3P02 A;  1SA8 A;  2C1Q A;  2OFM X;  5H8T A;  5F58 A;  1EIO A;  2W2B A;  4QZT A;  4FGI B;  2GH7 A;  4YCH A;  5HZ9 A;  1JZU A;  1Y0G A;  2YG2 A;  2HMB A;  5D8J A;  2WQ9 A;  3WVM A;  4O49 A;  3MM0 A;  1MVG A;  1A3Y A;  2BLG A;  4XMD A;  3QKG A;  3BS2 A;  4GET A;  4KC8 A;  1OEE A;  4GGZ A;  2QO4 A;  4AZR A;  4YGG A;  5IRU A;  5H9A A;  1KL4 A;  4IMO A;  3ZW0 B;  3RDM A;  2C4I A;  1FEL A;  2FR2 A;  3HWF A;  1GX8 A;  2RTL A;  1HXZ A;  2A3F X;  1SWU A;  3FEP A;  1CBQ A;  2GJ5 A;  4ZJ0 A;  3PK2 A;  1DZK A;  1NC9 A;  1SWA A;  2IZA A;  3T6L A;  4O3X B;  3S5V A;  3KQ0 A;  4NP1 A;  1VWG B;  2RTD B;  2DM5 A;  3DSZ A;  5K06 A;  2HYS A;  1PBO A;  1AVE A;  3C77 X;  3PH6 A;  2UZ2 A;  4BX7 B;  4Z2V A;  1SMP I;  1KT5 A;  3EYC A;  2X56 A;  4LZU A;  1ICN A;  1ALB A;  1NDJ A;  2OFA A;  2RQ0 A;  3OJY C;  4FBV A;  5C0N A;  1LIE A;  4Y0Q A;  4U8U M;  3C78 X;  1VWI B;  2A2G A;  2LFO A;  3ZW2 A;  2MHD A;  4D6A A;  1KT3 A;  2A13 A;  3WZO A;  4AZM A;  1U0X A;  3T1D A;  3ZI8 A;  4WBK A;  5B11 O;  4BBO A;  1ZNK A;  2DJG A;  4GH7 A;  2KTD A;  2OVS A;  3ZUI A;  2ACP X;  1KGL A;  1SXU A;  5HBS A;  3LHN A;  5EDC A;  3S60 A;  1EW3 A;  2BHV A;  1U17 A;  1CBI A;  1DV9 A;  1LID A;  1RLB E;  1IFB A;  1I78 A;  1QFT A;  3BU9 A;  4O3W A;  4O4X A;  1LUQ A;  2RTN B;  1HMT A;  2RTR B;  3P6C A;  4GZV A;  4DCB A;  2FTB A;  2PY1 A;  4L3R A;  4IAW A;  4QNI A;  1B56 A;  2KTS A;  5H9K A;  4CK4 A;  1E02 A;  4QGV A;  2NNE A;  2AL0 X;  3CBC A;  2W2F A;  3FA6 A;  3IFB A;  4GKC A;  5HA1 A;  3SZJ A;  2LA7 A;  4U3Q A;  3FEK A;  1SWD A;  1SWT A;  2RTB B;  3KFH A;  4IB7 A;  5EDB A;  5B2A O;  5LJC A;  1VWQ B;  2GTL O;  3I0A A;  4NNT A;  2OY7 A;  2OZQ A;  3AEH A;  2IZK A;  2XKL A;  1JJJ A;  1TXL A;  1RSU B;  3WOV A;  4AZP A;  4AW8 A;  1P6P A;  1W4T A;  2CZT A;  3TZS A;  3D4R A;  1X8U A;  5BVQ A;  4NNS A;  2Q39 A;  1SLD B;  4A8Z A;  5LJH A;  4MIR A;  3O22 A;  4GU8 A;  5CYB A;  1IW2 A;  1MX7 A;  5CE4 A;  1GT5 A;  2POA A;  2JU3 A;  4MVK A;  1GT1 A;  1B0O A;  4CV7 A;  2BT9 A;  1YUP A;  5AJB A;  2MJI A;  1QY0 A;  2QO6 A;  4I9S A;  3B2I A;  1FJ1 E;  3RE6 A;  4ZGF A;  1QY1 A;  1TW4 A;  1VWF B;  1SLE B;  3FID A;  3SLO A;  1QQS A;  5HCC C;  3FEL A;  3HOE A;  3RWX A;  1GM6 A;  3RKG A;  3U0D A;  3NP1 A;  5BYP A;  1NGL A;  3X00 A;  2QO5 A;  1STP A;  1SWR A;  4TKH A;  1RAV A;  3APV A;  1SRH A;  4INN A;  2Z4H A;  2JGS A;  2OY5 O;  3CKF A;  5LJG A;  2VDF A;  4U8U N;  1VYG A;  2RTK A;  3WYQ A;  5LJE A;  1SWL A;  2RTI B;  1GKA A;  1KL5 A;  2FHN X;  3NAD A;  2X8S A;  4YBP A;  3I17 A;  3BLG A;  1LIC A;  2OY1 O;  1YIV A;  5B5F A;  2ASN X;  1SWH A;  1RBP A;  3FR5 A;  2WQA E;  4QYN A;  2FR3 A;  4OEL A;  4DNE A;  2FRS A;  3NBX X;  5H9N A;  3Q6L A;  2KT4 B;  2YMS A;  1WBI A;  4YFQ A;  2O62 A;  4U8U O;  4GRJ A;  1N9M A;  3S26 A;  3ZZV A;  4MVI A;  3TGC A;  1LFO A;  3VG3 A;  4ALB A;  1SY0 A;  3ZQ3 A;  3SZH A;  2NP1 A;  4GDA A;  2EU7 X;  2FKG A;  2FGS A;  1CBR A;  4IB9 A;  3KFI A;  3HWG A;  3OBL A;  2RTE B;  5JD2 A;  1PTS A;  4CDE A;  1ADL A;  4O4U A;  4ZHC A;  3CKG A;  1MK5 A;  2AT6 X;  1N4J A;  4M7M A;  1KQX A;  2JOZ A;  4HFO A;  4KH8 A;  2GTL M;  4NLJ A;  5K68 A;  2JN3 A;  3CMP A;  2RTC B;  1HMR A;  3FEN A;  2CZU A;  1G7N A;  1EAL A;  1JV4 A;  4QAE A;  1EII A;  4MVE A;  1ERB A;  2AKQ A;  2WPU A;  2OL6 O;  3EC5 A;  3PED A;  1OSP O;  1UYN X;  4JNJ A;  4U9C A;  5F2B A;  1VWP B;  2WR6 A;  4I60 A;  3RDU A;  2RTQ B;  2Z4I A;  2OL7 A;  3VG6 A;  1T8V A;  2RTG B;  3FLL A;  1ZNH A;  2WEW A;  3T2X A;  3S5X A;  1RST B;  3OD9 A;  4O4S A;  1DC9 A;  1BWY A;  1DFV A;  3B2L A;  1N9Y A;  2KD2 A;  4CPH A;  1TVQ A;  5HWZ A;  4ORW A;  2FT9 A;  3VE1 A;  1VYF A;  4GD9 A;  4AZO A;  3WJG A;  3Q34 A;  2IZI A;  1STS B;  3VPJ E;  1GX3 A;  1SWS A;  3CBS A;  4YDB A;  2ZAI A;  1E00 A;  1VWH B;  3JS1 A;  3L4R A;  2IFB A;  2OY8 A;  3CR6 A;  4OKA A;  4ZCB A;  4XME A;  3EW2 A;  3EMM A;  3BX7 A;  1N43 A;  2WWP A;  2LB6 A;  3HK1 A;  3VG2 A;  4O4O A;  1VWL B;  3P24 A;  2KW1 A;  2A2U A;  3QQ2 A;  5HA0 A;  3MX7 A;  4I3C A;  4RUN A;  3UEU A;  1EPA A;  3KFF A;  1IIU A;  4CPF A;  3LTW A;  3GAQ A;  1Y52 X;  4TKJ A;  2IZH B;  1X8N A;  4HPB A;  5EPQ A;  2N93 A;  4I3B A;  1STR B;  3EBW A;  4BCS A;  1R0U A;  4TJZ A;  2HZR A;  1DZP A;  1SRG A;  4A1Y A;  5HCD C;  1BRQ A;  3CQR A;  2GTF X;  5JR8 A;  2JU8 A;  4IMN A;  1HMS A;  2R73 A;  4WFU A;  2MM3 A;  3E3C A;  3RDQ A;  3OE3 A;  3SAO A;  5LJK A;  1DF8 A;  4YBU A;  3STN A;  1JIW I;  1LCV A;  2IZD B;  4K19 A;  2BC3 A;  3P6D A;  1XCA A;  2RTP B;  1X8P A;  2NND A;  1KOI A;  1ZNG A;  1K3B A;  4BQU A;  1LF7 A;  3P6G A;  4O3Y A;  2OFR X;  4ON1 A;  4YGH A;  1JMX A;  2GTL N;  4OS0 A;  3ZW1 B;  1LKE A;  5D45 A;  3ZW0 A;  5KID A;  1I04 A;  4U46 A;  1T0V A;  4IB6 A;  4AZQ A;  5B5G A;  2OVE A;  2K23 A;  3RDX A;  4NYQ A;  3BRN A; 
#chains in the Genus database with same CATH homology
 4CPH B;  1VWA B;  3X00 A;  1MM9 A;  1KFF A;  1STP A;  1SWR A;  3RDS A;  1RAV A;  4Y59 A;  1SRH A;  2IZC B;  2IZL B;  2JGS A;  1I9H A;  4BX7 A;  1SRE A;  1SWO A;  2IZJ A;  1VWB B;  2RTK A;  3WYQ A;  1NQM A;  1SWL A;  4BX5 A;  2RTI B;  2FHN X;  1KL5 A;  4JO6 A;  3MG5 A;  1NBX A;  1LCZ A;  4BJ8 A;  1LEL A;  5B5F A;  1SLG B;  1MOY A;  2UYW A;  5IRW A;  1SWH A;  1VWJ B;  2A5B A;  2RTM A;  3RY1 A;  4DNE A;  2FHL A;  1WBI A;  1Y55 X;  3EW1 A;  4EKV A;  1N9M A;  1LDQ A;  1SWE A;  4GJS A;  2RTA A;  3WZQ A;  1SWC A;  2C1Q A;  2MF6 A;  2Y3F A;  4BX6 B;  1SWP A;  2GH7 A;  3VHH A;  1RXH A;  3SZH A;  1VWO B;  1RXK A;  1SRF A;  4GDA A;  3SZI A;  3MM0 A;  2AVI A;  1VWM B;  1RXJ A;  1VWD B;  2RTE B;  5JD2 A;  1HY2 A;  4GGZ A;  1PTS A;  4JHQ A;  5IRU A;  1KL4 A;  1VWR B;  1NQN A;  1MK5 A;  2C4I A;  3RDM A;  1N4J A;  3RDO A;  4CPF A;  1LCW A;  1VWC B;  2RTH B;  1HXZ A;  1VWE B;  1SWU A;  2RTL A;  3FDC A;  5K68 A;  2RTC B;  3PK2 A;  3VGW A;  1NC9 A;  1SWQ A;  1SWA A;  2IZA A;  3WZN A;  2A5C A;  3T6L A;  3T6F A;  2IZE B;  1SRI A;  2WPU A;  5F2B A;  1VWG B;  2RTD B;  4JNJ A;  2Y32 A;  3RDU A;  1AVE A;  1VWP B;  4I60 A;  2RTQ B;  2RTG B;  1SWG A;  2UZ2 A;  4BX7 B;  4Z2V A;  1LDO A;  4GJV A;  3T2X A;  3RE5 A;  1NDJ A;  2OFA A;  4Z28 A;  1RST B;  5CHK A;  4BX5 B;  1VWI B;  1SWB A;  1N9Y A;  4CPH A;  1SLF B;  4Y5D A;  1VYO A;  3WZO A;  2OF9 A;  4GD9 A;  1SRJ A;  1STS B;  2CAM A;  2F01 A;  2IZI A;  4BBO A;  1SWS A;  4CPE A;  1SWK A;  2RTJ A;  1VWH B;  4OKA A;  2IZB A;  4Z27 A;  2C1S A;  1KL3 A;  2QCB A;  3EW2 A;  1AVD A;  2A8G A;  1N43 A;  3VHI A;  2RTF B;  1LUQ A;  2RTN B;  2RTR B;  1VWL B;  2Y3E A;  3RY2 A;  4GGT A;  1SWF A;  1MEP A;  5L3Y A;  4GGR A;  1Y52 X;  2IZG B;  2IZH B;  3SZJ A;  1SWD A;  1SWT A;  2RTB B;  3WZP A;  1STR B;  1HQQ A;  1SWJ A;  1VWQ B;  4BCS A;  1SRG A;  2IZK A;  3VHM A;  2ZSC A;  4BX6 A;  2RTO B;  3RDQ A;  3T2W A;  3WYP A;  2OFB A;  4CPI A;  1DF8 A;  1RSU B;  4Z2O A;  4YVB A;  2OF8 A;  1LCV A;  2IZD B;  1VWF B;  2BC3 A;  1N7Y A;  2IZF B;  1SLD B;  2RTP B;  4Z6J A;  1VWK B;  1SWN A;  1VWN B;  5IRA A;  5K67 A;  1Y53 X;  4IRW A;  3RE6 A;  4U46 A;  1HXL A;  5B5G A;  2G5L A;  1SLE B;  5CSE A;  3RDX A;  4Z2P A;  1IJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...