2RTPB

Streptavidin-2-iminobiotin complex, ph 3.25, space group i222
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Binding of biotin to streptavidin stabilizes intersubunit salt bridges between Asp61 and His87 at low pH.
pubmed doi rcsb
molecule tags Biotin-binding protein
total genus 24
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2rtpB00
4BX7B 2ZSCA 4I60A 4Z2PA 1NQMA 3RY2A 4BBOA 2RTKA 1N7YA 4GD9A 4GGZA 3WYPA 4JO6A 1LCWA 1VWAB 1SWLA 2GH7A 1SWJA 2UZ2A 4GDAA 4GGTA 2RTMA 2IZFB 2RTCB 2WPUA 2MF6A 1MEPA 3FDCA 2RTGB 2BC3A 5K67A 1RXJA 4OKAA 3VGWA 3SZIA 1SWDA 1KFFA 1SWUA 1I9HA 1SWCA 1VWKB 1SWRA 1SWNA 2RTIB 3RDQA 4YVBA 2FHNX 1RSTB 2OF8A 2RTJA 1KL3A 1SWFA 2C4IA 3EW1A 3WZNA 1HQQA 4BX6A 3RDMA 1LUQA 1SWHA 4BX6B 1HXLA 4BX5A 3SZJA 1VYOA 1PTSA 1KL5A 3RY1A 4BX5B 4GJSA 1VWCB 1SRGA 1VWEB 3WZQA 1LDOA 1VWNB 2OFBA 2IZGB 1NDJA 2RTPB 4Z2OA 1VWLB 2C1SA 2RTRB 1N43A 5L3YA 2RTEB 2C1QA 5CSEA 2RTDB 1SLGB 1AVEA 3MG5A 2A5CA 1Y53X 3RDXA 1SRIA 1VWGB 2IZEB 2IZAA 1STSB 1LCVA 1SWPA 2IZCB 5CHKA 3VHHA 4BCSA 4BJ8A 4CPEA 1SWGA 1SRHA 2A8GA 1NQNA 3X00A 2G5LA 5F2BA 1RAVA 1LDQA 5IRUA 3WZPA 1SWTA 2Y3EA 1SWAA 4Y59A 1Y55X 2Y32A 2QCBA 4GGRA 1Y52X 1SWKA 2RTFB 2RTQB 1HY2A 1N9YA 1VWOB 1VWIB 1VWRB 4Z6JA 2AVIA 3WYQA 1IJ8A 1STRB 1VWHB 2IZIA 1MK5A 2F01A 1RSUB 3RDUA 4DNEA 1VWJB 2RTAA 3RE5A 3VHIA 4CPHA 4JNJA 2FHLA 3RE6A 4Z2VA 1VWPB 3T2XA 4Y5DA 4CPHB 3MM0A 1SLFB 1NC9A 4CPFA 2IZHB 1DF8A 2RTBB 5IRWA 1SLEB 5IRAA 1N4JA 1SREA 2IZJA 2IZDB 5K68A 4U46A 4Z28A 2JGSA 3RDOA 1AVDA 1N9MA 1LELA 2RTNB 1SWSA 4JHQA 1HXZA 1SRFA 1SWEA 1VWBB 1RXKA 5B5FA 3RDSA 2RTHB 4IRWA 1MM9A 1RXHA 2A5BA 2IZLB 3SZHA 3VHMA 2CAMA 2IZBA 1SWQA 1SWBA 1VWQB 5JD2A 1SWOA 1KL4A 1STPA 1SRJA 1SLDB 2UYWA 1LCZA 2Y3FA 2RTOB 3PK2A 4Z27A 1VWFB 3T6FA 1VWMB 3EW2A 2OF9A 4GJVA 1WBIA 1MOYA 3T2WA 4CPIA 2IZKA 4BX7A 4EKVA 2RTLA 3T6LA 1NBXA 1VWDB 2OFAA 5B5GA 3WZOA
chains in the Genus database with same CATH superfamily
1A3YA 2CZTA 4I60A 2OVSA 1GT1A 3HWEA 4XMGA 4O4XA 4OELA 4HPDA 1YUPA 4O4OA 2GTLM 5D47A 1R0UA 1EI5A 2X32A 3RY2A 4IABA 1N7YA 3FW5A 2RCTA 2OL8O 3WYPA 3EC5A 2MHDA 4Y0PA 3P6EA 3LTWA 3HK1A 1I4UA 2W2BA 5L8NA 1LNMA 1YWCA 2UZ2A 2WWPA 3JSQA 4OMXA 2KD2A 4OS0A 4YCEA 2RTMA 4YGZA 1ERBA 3FELA 3NBXX 3UEVA 3ZW0A 3P24A 3BSZE 3PEDA 5AJCA 5F58A 2AF5A 3SOTA 3RKGA 1K24A 1SWCA 1VWKB 3ZQ3A 4EQAC 2AT3X 4BOEA 3ZW0B 3SAOA 5HTEA 4IAXA 2HYSA 4ALBA 2OF8A 1ACDA 4O49A 2Q2MA 1Y9LA 1KL3A 2OFMX 4CDFA 1AQBA 2GJ5A 2BT9A 3WZNA 4GDZA 3T1DA 1EPAA 3VG3A 1X8PA 1PBYA 2X55A 3U9PC 4NNSA 4L3RA 1MVGA 1KZXA 1UYNX 2A3FX 1EPBA 3OE3A 1VWCB 5LJKA 1U18A 3P02A 1B8EA 2IZGB 2RTPB 2L67A 3CWKA 4I95A 4NV7A 5F1EA 4Z2OA 1EIIA 2F09A 2W2AA 2ACOA 3NQ3A 1I06A 1IFBA 2DJFA 1GKAA 2GC9A 2DJGA 2JN3A 3BS2A 1E06A 3P6DA 4NV8A 2A5CA 1YWDA 5H9LA 1SY2A 4D6BA 2FR2A 1GKAB 4KCAA 2JU7A 1SWPA 5CHKA 4YBUA 4BJ8A 3FIQA 5HZ6A 5AEOA 1JMZA 1EW3A 3FA9A 1SRHA 3STMX 1ZNLA 1PMPA 1Y9TA 3P6CA 4XMCA 1T8VA 5IRUA 1LDQA 1ADLA 1KOIA 4YGGA 1SWTA 1E5PA 4QYNA 3EM0A 1Y55X 3CKFA 4IB7A 3ZW2A 5IO7A 4GGRA 4ORWA 2LBVA 5HTDA 1JJJA 4CDCA 2NNQA 4EFGA 1N9YA 1VWOB 1ZNDA 2FWVA 2G79A 4FBVA 5LKEA 3WBGA 2X8TA 3WYQA 4KC7A 1VWHB 1X8OA 3GAQA 1MK5A 4K19A 4ZR2A 1IKJA 5FQ7E 4O4SA 4BGFA 4DNEA 2FGSA 3FENA 4IMOA 4N7DA 1A18A 2OL7A 1I05A 3EMMA 5BVSA 3RE5A 4IB9A 3HOEA 3BRNA 4FGIB 2X4MA 3T2XA 4ML7B 1B0OA 4I3BA 3VG6A 2Q4NA 1A57A 4ID2A 1P6PA 1NC9A 3STNA 3SLTA 1HN2A 2OVAA 3APWA 1ZNEA 3FEKA 1XKIA 5L8IA 1SMPI 1CBQA 3S26A 1GT5A 4LZUA 5EEDA 2IZDB 1SREA 2A2GA 2NNDA 3B2LA 4KT5A 4U46A 4Z28A 5K68A 3RSWA 4LQZA 3TZSA 5B10O 1SWSA 3FMZA 4JHQA 4YFPA 1QABE 1HXZA 3FW4A 3BLGA 3WJEA 2L68A 2ZAIA 1SA8A 5FQ6E 1U0XA 4MVKA 4XMFA 2RTHB 4FBRA 2A5BA 5B5FA 2IZLB 2LKKA 4UU2A 2QOSC 5JD2A 2G7BA 1FDQA 1STPA 4O3ZA 5F7GA 3VG7A 2RN4A 3KFIA 3VU1A 2L9CA 2Y3FA 4CV7A 1HMSA 1JZUA 4QGXA 4YGHA 4TJZA 4GJVA 1AELA 1EALA 4U8UO 2IZKA 3B2JA 4EKVA 1D2UA 5K06A 1W5RA 2GTFX 4I3DA 3PECA 4ZHFA 2X8SA 3WZOA 1KXOA 1BM5A 1GXAA 3VG5A 2AT8X 5CE4A 1FEMA 2RCQA 3B2IA 3OJYC 4QZTA 1G74A 4QGVA 1OPAA 4KIIA 5HCDC 1O1UA 3L4RA 1JIWI 1OBQA 3LHNA 3B2KA 1PEEA 1QFTA 4NYRA 4GGTA 5B11O 3RBYA 2QOMA 4TKBA 2RTCB 1I78A 2NP1A 2WPUA 1B4MA 3SLJA 3PH5A 5JR8A 1L6MA 3VGWA 3FYFA 5KICA 3SZIA 1KFFA 2HNXA 3BDRA 2RTJA 1JJXA 1OPBA 4BVMA 2OYBO 1JMXA 1E2TA 3EW1A 3S60A 3NR3A 3FR5A 4EXZA 3VPJE 1LUQA 2A2UA 4BX5A 4UU3A 3I0AA 2AMMX 1MX7A 4BX5B 1VPRA 1XCAA 4QYPA 1SRGA 4YCHA 1G5WA 2OFBA 5AQ6A 1D3SA 1OEEA 4GNYA 2G8CO 1DC9A 1G85A 2RTEB 2C1QA 3CQRA 2RTDB 4M7MA 4TKJA 4YKMA 5CSEA 3ELXA 4GNWA 1DV9A 3MG5A 1S2PA 3S5VA 3HTYA 2BHVA 1VWGB 2Q9SA 2IZEB 3APUA 2IZAA 3VHHA 3KZAA 3N91A 2OY7A 3UEUA 2JU8A 1E00A 1SXYA 4BCSA 5H8TA 4CPEA 4DCBA 3E3CA 1EQDA 1GX8A 3WZPA 1RAVA 1ZNKA 2WQ9A 4O3WA 4XMEA 1WUBA 4PJ2A 5F6BA 5BVQA 1SWKA 3STKA 2WQAE 4XMDA 3P6FA 1VWRB 1EXSA 2MWHA 1BRQA 2IZIA 2AKQA 3CKGA 1RSUB 5FENA 3RDUA 5HZQA 3BX7A 1RLBE 4Y0QA 2FHLA 1ICMA 1HQPA 2KTDA 2FLJA 4NLJA 4ARHA 3F6ZB 3S5XA 1SXXA 2X56A 4JGLA 4O9SA 5FQ8E 3U03A 1TW4A 5IRWA 1SLEB 1GGLA 2JMBA 5IRAA 4ES7A 1KT7A 4XMHA 4EEJA 4Y0SA 4ZHHA 2OVEA 1CBRA 1MX8A 1DZJA 1VYGA 1IW2A 1FTPA 1YWAA 2OFRX 1X8UA 2GTLN 3NX2A 3K3LA 3C78X 4LKTA 5IO6A 1EIOA 3RDSA 2M4LA 1FE3A 2FRSA 4QGWA 2E4JA 3KVNA 2CAMA 3VHMA 2PY1A 1SWBA 1SWOA 2FTBA 5L8OA 1KL4A 1KT3A 5EEEA 3H3IA 3D9WA 3I17A 1VWFB 3FR4A 1IFCA 2R73A 3FEPA 4IBAA 5HWZA 1ML7A 1MOYA 2L5PA 3KFFA 4KH8A 4U9CA 4BX7A 4CPIA 5HCCC 1JV4A 1AVGI 2HLVA 2IFBA 4OS8A 1VWDB 5B5GA 4BX7B 2ZSCA 5B3MO 1NP4A 5KHPA 4ZJ0A 1G7NA 2MM3A 2AL0X 1RBPA 4BBOA 3CQNA 4U8UM 2RTKA 3PQSA 4YKOA 5LJBA 2HZQA 3NX1A 3MVFA 4IMNA 2KTSA 1E02A 1VWAB 3RZYA 3VG4A 1PBOA 4GK9A 4GDAA 4R0BA 4YMYA 4I9SA 1BBPA 5HBSA 4AZNA 4YDAA 4HPCA 1DZMA 1MEPA 1O1VA 2MJIA 5FAZA 2BC3A 2OY5O 4FQBB 5K67A 1RXJA 3DTQA 3FA7A 4MIRA 4YFRA 3Q34A 4IB6A 4N7CA 5H9AA 3RDQA 3NPOA 1SWNA 1LPJA 2RTIB 3VE1A 3WOVA 2FKJA 2X46A 4GETA 4ZGUA 1RSTB 2CBRA 3FLLA 3ZUOA 3D95A 2QO4A 1VYFA 4IB8A 3U0DA 1HQQA 1CBSA 5BVTA 2FKGA 3PQUA 2ANSA 3RDMA 2VFCA 1KT6A 1OEKA 1SWHA 1HXLA 1U17A 2HKDA 1LICA 1Y0GA 2X34A 3SZJA 1TOUA 1N0SA 1VYOA 2Q39A 5DPQA 5HZ5A 1KL5A 1HBPA 2ASNX 3WXQA 4QAEA 2P8GA 4GE1A 4ALOA 2EU7X 1QY1A 1ZNHA 1GX3A 1X89A 1VWLB 2C1SA 2KW1A 2ZAGA 1GX9A 3Q6LA 3ZWEA 3JS1A 2CM9A 2MO5A 3F9DA 1SLGB 2R56A 4GUZA 1AVEA 3NP1A 3OD9A 4TKHA 3PP6A 4O4UA 2AT6X 2ALLX 3NQ9A 1SRIA 2VFBA 3O19A 1LCVA 3VE2A 1MDCA 1UREA 5LJCA 2K62A 3TGAA 2BS5A 2RA6A 5IO5A 1HMRA 2Q2PA 5D8JA 3P6GA 4A1YA 1YWBA 2AT5X 5HCEC 3TF6A 1S7DA 3UAQA 3JQOA 3FR2A 3IFBA 3CMPA 1BSOA 1KT5A 3X00A 2CZUA 4ZHCA 5LJEA 3NQKA 2WEXA 1IIUA 4GKCA 3ZW1A 1QQSA 4FBOA 1DZPA 2Y32A 1Y52X 1KZWA 2FR3A 3D4RA 3ZW1B 1LIEA 1AB0A 2RTQB 1HY2A 1VWIB 4INNA 4AZMA 1HMTA 3O22A 3PDFA 2AVIA 1I04A 4NNTA 4ZCBA 3WJDA 4DQ4A 1JBHA 1IJ8A 1GT3A 1OBUA 1STRB 2OY8A 1DZKA 1GT4A 1JQPA 3MX7A 4MVLA 5AJBA 3B2HA 2JW1A 4GH7A 4ZGFA 1VWJB 2FT9A 2RTAA 4KC8A 4ORYA 3VHIA 2QO5A 3BU9A 4QZUA 4AW8A 1OSPO 1VWPB 4Z2VA 3F8AA 2RQ0A 4NW4A 1W6FA 1TOWA 3KFGA 3KQ0A 4TNNA 1YP6A 4Y5DA 3MM0A 1SLFB 2HMBA 1LF7A 2IZHB 4NP1A 1T0VA 1BSYA 3AEHA 3HWFA 3IA8A 4RUUA 3ZUIA 2IZJA 3G7XA 3AKNA 5D4AA 2XKLA 2AH7X 1AVDA 1N9MA 5KIDA 3MBTA 3C76X 3WJFA 1SRFA 1SY3A 2CBSA 3D96A 4IRWA 1MM9A 2BLGA 3DSZA 4ORUA 3V8UA 4A1HA 2O62A 2R74A 1SLDB 3P6HA 4L1NA 4CDEA 1QY0A 4CSBA 1CJ5A 2BSZA 3PK2A 2OY1O 3EW2A 2OF9A 1BJ7A 2GTLO 1WBIA 2Z4IA 5D45A 5HZ9A 2XSTA 4NLIA 2RTLA 3EYCA 3T6LA 5C0NA 2CM4A 1NBXA 2I5ZO 4U3QA 2OVDA 3VG2A 2I5VO 4EDEA 2LB6A 4HPBA 2WEWA 5EDCA 4ZH9A 4C5PA 4Z2PA 1HBQA 3WVMA 3EBKA 1Z24A 2YMSA 1CBIA 1NQMA 2AT0X 2RD7C 3CBCA 1NGLA 4ORSA 5EDBA 1DF3A 4O3YA 4GD9A 4GGZA 3O2YA 1FENA 5HA1A 3HOLA 4CDDA 3TGCA 4JO6A 1LCWA 4QQ1A 2FS7A 4ORRA 4WHIA 5H9NA 1SWLA 1ZRYA 2GH7A 1SWJA 3APXA 3WJBA 4D6AA 4ZFXA 4YBPA 3FIDA 1NP1A 2IZFB 4ZHGA 2QM9A 1QG5A 1W4TA 3WJCA 3FDCA 2MF6A 2RTGB 2LBAA 4ORXA 4OKAA 2BS6A 1SWDA 5B27A 1SWUA 1I9HA 4YVBA 1SWRA 1KT4A 1YIVA 2K23A 2F73A 4ON1A 1T68X 4TLJA 2FHNX 1BWYA 2FS6A 1LFOA 2Z4HA 5H9KA 1SWFA 1CRBA 2C4IA 4IAWA 1SXUA 4OMWA 4MVIA 5LJHA 4BX6A 5LJDA 3AKMA 1JYJA 4HPAA 4BQUA 4LZVA 4Y0RA 3ZZVA 4AZOA 1ICNA 3T6FA 3PPTA 4BX6B 1EUOA 3KFHA 1UYOX 2G78A 2ACPX 1UZ2X 3GE2A 4A8ZA 4COTA 1PTSA 2DM5A 2LA7A 3RY1A 1H91A 2QMIA 3QQ2A 1YP7A 2N93A 4GJSA 3NADA 1VWEB 5CYBA 1LDOA 1VWNB 2JU3A 3BX8A 3WZQA 1NDJA 4AZPA 2RTRB 4OEMA 2JOZA 4GRJA 1BRPA 1N43A 5B2AO 5D48A 5L3YA 2KT4B 3UEWA 4CK4A 3WJGA 3D97A 3UEXA 5BYPA 1Y53X 3FA6A 3LV4A 2NNEA 3RDXA 4DQ3A 5HAEA 4ODDA 4QNIA 1STSB 2IZCB 2PI3O 3FA8A 4OS3A 5B29A 1ERXA 2OZQA 3PH6A 4YH0A 1MUPA 4NYQA 1SWGA 4O3XB 1SY0A 1FJ1E 4MVEA 2A8GA 1NQNA 2G5LA 5F2BA 3ELZA 1ALBA 1X8NA 2Y3EA 1SWAA 2A13A 4Y59A 5IXGA 1GM6A 1OEJA 2QCBA 4PSQA 1QFVA 4ZHDA 2QO6A 2RTFB 4HWMA 5HZ8A 5HA0A 1JJUA 4Z6JA 1JYDA 4YDBA 1QY2A 4M6SA 5LJGA 3CBSA 1KQWA 3BY0A 3QKGA 3EBWA 4I3CA 2F01A 1IKEA 2A0AA 1X71A 3C77X 4YFQA 4AZQA 1ZNGA 4CPHA 4JNJA 3RE6A 3ZI8A 1KGLA 4GZVA 1FELA 4ZH6A 2HZRA 4CPHB 1SY1A 4GU8A 4LKPA 1OBPA 4CPFA 4Z27A 3OBLA 1DF8A 2RTBB 4TQ2A 1DFVA 1O8VA 1N4JA 1TVQA 4WFUA 3CR6A 4HFOA 2JGSA 2X45A 3RDOA 3AUMO 2X8FA 1LELA 5EPQA 2RTNB 1LIBA 3HWGA 4I9RA 4WFVA 3TGBA 1SWEA 3HWDA 1SXWA 1VWBB 4U8UN 5EZ2A 4B55A 1BLRA 1RXKA 3BU1A 1RXHA 3SZHA 2IZBA 1LKEA 1SWQA 1VWQB 4I6SA 2WSJA 4MEEA 5DG4A 1X8QA 3SLOA 3HPEA 1SRJA 2UYWA 4RUNA 1LCZA 2WUTA 1PM1X 2YG2A 1LIFA 4WBKA 2RTOB 3RWXA 4AYHA 2OL6O 1A2DA 1QWDA 1TXLA 1VWMB 4MISA 4AZRA 2WR6A 3APVA 5LKFA 1B56A 3T2WA 2VDFA 1BSQA 1K3BA 2LFOA 2W2FA 5F6ZA 5FFHA 1KQXA 1BEBA 1LIDA 2POAA 4A60A 4QRLA 1S44A 2OFAA
chains in the Genus database with same CATH topology
4BX7B 2ZSCA 4I60A 4Z2PA 1NQMA 3RY2A 4BBOA 2RTKA 1N7YA 4GD9A 4GGZA 3WYPA 4JO6A 1LCWA 1VWAB 1SWLA 2GH7A 1SWJA 2UZ2A 4GDAA 4GGTA 2RTMA 2IZFB 2RTCB 2WPUA 2MF6A 1MEPA 3FDCA 2RTGB 2BC3A 5K67A 1RXJA 4OKAA 3VGWA 3SZIA 1SWDA 1KFFA 1SWUA 1I9HA 1SWCA 1VWKB 1SWRA 1SWNA 2RTIB 3RDQA 4YVBA 2FHNX 1RSTB 2OF8A 2RTJA 1KL3A 1SWFA 2C4IA 3EW1A 3WZNA 1HQQA 4BX6A 3RDMA 1LUQA 1SWHA 4BX6B 1HXLA 4BX5A 3SZJA 1VYOA 1PTSA 1KL5A 3RY1A 4BX5B 4GJSA 1VWCB 1SRGA 1VWEB 3WZQA 1LDOA 1VWNB 2OFBA 2IZGB 1NDJA 2RTPB 4Z2OA 1VWLB 2C1SA 2RTRB 1N43A 5L3YA 2RTEB 2C1QA 5CSEA 2RTDB 1SLGB 1AVEA 3MG5A 2A5CA 1Y53X 3RDXA 1SRIA 1VWGB 2IZEB 2IZAA 1STSB 1LCVA 1SWPA 2IZCB 5CHKA 3VHHA 4BCSA 4BJ8A 4CPEA 1SWGA 1SRHA 2A8GA 1NQNA 3X00A 2G5LA 5F2BA 1RAVA 1LDQA 5IRUA 3WZPA 1SWTA 2Y3EA 1SWAA 4Y59A 1Y55X 2Y32A 2QCBA 4GGRA 1Y52X 1SWKA 2RTFB 2RTQB 1HY2A 1N9YA 1VWOB 1VWIB 1VWRB 4Z6JA 2AVIA 3WYQA 1IJ8A 1STRB 1VWHB 2IZIA 1MK5A 2F01A 1RSUB 3RDUA 4DNEA 1VWJB 2RTAA 3RE5A 3VHIA 4CPHA 4JNJA 2FHLA 3RE6A 4Z2VA 1VWPB 3T2XA 4Y5DA 4CPHB 3MM0A 1SLFB 1NC9A 4CPFA 2IZHB 1DF8A 2RTBB 5IRWA 1SLEB 5IRAA 1N4JA 1SREA 2IZJA 2IZDB 5K68A 4U46A 4Z28A 2JGSA 3RDOA 1AVDA 1N9MA 1LELA 2RTNB 1SWSA 4JHQA 1HXZA 1SRFA 1SWEA 1VWBB 1RXKA 5B5FA 3RDSA 2RTHB 4IRWA 1MM9A 1RXHA 2A5BA 2IZLB 3SZHA 3VHMA 2CAMA 2IZBA 1SWQA 1SWBA 1VWQB 5JD2A 1SWOA 1KL4A 1STPA 1SRJA 1SLDB 2UYWA 1LCZA 2Y3FA 2RTOB 3PK2A 4Z27A 1VWFB 3T6FA 1VWMB 3EW2A 2OF9A 4GJVA 1WBIA 1MOYA 3T2WA 4CPIA 2IZKA 4BX7A 4EKVA 2RTLA 3T6LA 1NBXA 1VWDB 2OFAA 5B5GA 3WZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BX7 B;  2ZSC A;  4I60 A;  4Z2P A;  1NQM A;  3RY2 A;  4BBO A;  2RTK A;  1N7Y A;  4GD9 A;  4GGZ A;  3WYP A;  4JO6 A;  1LCW A;  1VWA B;  1SWL A;  2GH7 A;  1SWJ A;  2UZ2 A;  4GDA A;  4GGT A;  2RTM A;  2IZF B;  2RTC B;  2WPU A;  2MF6 A;  1MEP A;  3FDC A;  2RTG B;  2BC3 A;  5K67 A;  1RXJ A;  4OKA A;  3VGW A;  3SZI A;  1SWD A;  1KFF A;  1SWU A;  1I9H A;  1SWC A;  1VWK B;  1SWR A;  1SWN A;  2RTI B;  3RDQ A;  4YVB A;  2FHN X;  1RST B;  2OF8 A;  2RTJ A;  1KL3 A;  1SWF A;  2C4I A;  3EW1 A;  3WZN A;  1HQQ A;  4BX6 A;  3RDM A;  1LUQ A;  1SWH A;  4BX6 B;  1HXL A;  4BX5 A;  3SZJ A;  1VYO A;  1PTS A;  1KL5 A;  3RY1 A;  4BX5 B;  4GJS A;  1VWC B;  1SRG A;  1VWE B;  3WZQ A;  1LDO A;  1VWN B;  2OFB A;  2IZG B;  1NDJ A;  2RTP B;  4Z2O A;  1VWL B;  2C1S A;  2RTR B;  1N43 A;  5L3Y A;  2RTE B;  2C1Q A;  5CSE A;  2RTD B;  1SLG B;  1AVE A;  3MG5 A;  2A5C A;  1Y53 X;  3RDX A;  1SRI A;  1VWG B;  2IZE B;  2IZA A;  1STS B;  1LCV A;  1SWP A;  2IZC B;  5CHK A;  3VHH A;  4BCS A;  4BJ8 A;  4CPE A;  1SWG A;  1SRH A;  2A8G A;  1NQN A;  3X00 A;  2G5L A;  5F2B A;  1RAV A;  1LDQ A;  5IRU A;  3WZP A;  1SWT A;  2Y3E A;  1SWA A;  4Y59 A;  1Y55 X;  2Y32 A;  2QCB A;  4GGR A;  1Y52 X;  1SWK A;  2RTF B;  2RTQ B;  1HY2 A;  1N9Y A;  1VWO B;  1VWI B;  1VWR B;  4Z6J A;  2AVI A;  3WYQ A;  1IJ8 A;  1STR B;  1VWH B;  2IZI A;  1MK5 A;  2F01 A;  1RSU B;  3RDU A;  4DNE A;  1VWJ B;  2RTA A;  3RE5 A;  3VHI A;  4CPH A;  4JNJ A;  2FHL A;  3RE6 A;  4Z2V A;  1VWP B;  3T2X A;  4Y5D A;  4CPH B;  3MM0 A;  1SLF B;  1NC9 A;  4CPF A;  2IZH B;  1DF8 A;  2RTB B;  5IRW A;  1SLE B;  5IRA A;  1N4J A;  1SRE A;  2IZJ A;  2IZD B;  5K68 A;  4U46 A;  4Z28 A;  2JGS A;  3RDO A;  1AVD A;  1N9M A;  1LEL A;  2RTN B;  1SWS A;  4JHQ A;  1HXZ A;  1SRF A;  1SWE A;  1VWB B;  1RXK A;  5B5F A;  3RDS A;  2RTH B;  4IRW A;  1MM9 A;  1RXH A;  2A5B A;  2IZL B;  3SZH A;  3VHM A;  2CAM A;  2IZB A;  1SWQ A;  1SWB A;  1VWQ B;  5JD2 A;  1SWO A;  1KL4 A;  1STP A;  1SRJ A;  1SLD B;  2UYW A;  1LCZ A;  2Y3F A;  2RTO B;  3PK2 A;  4Z27 A;  1VWF B;  3T6F A;  1VWM B;  3EW2 A;  2OF9 A;  4GJV A;  1WBI A;  1MOY A;  3T2W A;  4CPI A;  2IZK A;  4BX7 A;  4EKV A;  2RTL A;  3T6L A;  1NBX A;  1VWD B;  2OFA A;  5B5G A;  3WZO A; 
#chains in the Genus database with same CATH topology
 1A3Y A;  2CZT A;  4I60 A;  2OVS A;  1GT1 A;  3HWE A;  4XMG A;  4O4X A;  4OEL A;  4HPD A;  1YUP A;  4O4O A;  2GTL M;  5D47 A;  1R0U A;  1EI5 A;  2X32 A;  3RY2 A;  4IAB A;  1N7Y A;  3FW5 A;  2RCT A;  2OL8 O;  3WYP A;  3EC5 A;  2MHD A;  4Y0P A;  3P6E A;  3LTW A;  3HK1 A;  1I4U A;  2W2B A;  5L8N A;  1LNM A;  1YWC A;  2UZ2 A;  2WWP A;  3JSQ A;  4OMX A;  2KD2 A;  4OS0 A;  4YCE A;  2RTM A;  4YGZ A;  1ERB A;  3FEL A;  3NBX X;  3UEV A;  3ZW0 A;  3P24 A;  3BSZ E;  3PED A;  5AJC A;  5F58 A;  2AF5 A;  3SOT A;  3RKG A;  1K24 A;  1SWC A;  1VWK B;  3ZQ3 A;  4EQA C;  2AT3 X;  4BOE A;  3ZW0 B;  3SAO A;  5HTE A;  4IAX A;  2HYS A;  4ALB A;  2OF8 A;  1ACD A;  4O49 A;  2Q2M A;  1Y9L A;  1KL3 A;  2OFM X;  4CDF A;  1AQB A;  2GJ5 A;  2BT9 A;  3WZN A;  4GDZ A;  3T1D A;  1EPA A;  3VG3 A;  1X8P A;  1PBY A;  2X55 A;  3U9P C;  4NNS A;  4L3R A;  1MVG A;  1KZX A;  1UYN X;  2A3F X;  1EPB A;  3OE3 A;  1VWC B;  5LJK A;  1U18 A;  3P02 A;  1B8E A;  2IZG B;  2RTP B;  2L67 A;  3CWK A;  4I95 A;  4NV7 A;  5F1E A;  4Z2O A;  1EII A;  2F09 A;  2W2A A;  2ACO A;  3NQ3 A;  1I06 A;  1IFB A;  2DJF A;  1GKA A;  2GC9 A;  2DJG A;  2JN3 A;  3BS2 A;  1E06 A;  3P6D A;  4NV8 A;  2A5C A;  1YWD A;  5H9L A;  1SY2 A;  4D6B A;  2FR2 A;  1GKA B;  4KCA A;  2JU7 A;  1SWP A;  5CHK A;  4YBU A;  4BJ8 A;  3FIQ A;  5HZ6 A;  5AEO A;  1JMZ A;  1EW3 A;  3FA9 A;  1SRH A;  3STM X;  1ZNL A;  1PMP A;  1Y9T A;  3P6C A;  4XMC A;  1T8V A;  5IRU A;  1LDQ A;  1ADL A;  1KOI A;  4YGG A;  1SWT A;  1E5P A;  4QYN A;  3EM0 A;  1Y55 X;  3CKF A;  4IB7 A;  3ZW2 A;  5IO7 A;  4GGR A;  4ORW A;  2LBV A;  5HTD A;  1JJJ A;  4CDC A;  2NNQ A;  4EFG A;  1N9Y A;  1VWO B;  1ZND A;  2FWV A;  2G79 A;  4FBV A;  5LKE A;  3WBG A;  2X8T A;  3WYQ A;  4KC7 A;  1VWH B;  1X8O A;  3GAQ A;  1MK5 A;  4K19 A;  4ZR2 A;  1IKJ A;  5FQ7 E;  4O4S A;  4BGF A;  4DNE A;  2FGS A;  3FEN A;  4IMO A;  4N7D A;  1A18 A;  2OL7 A;  1I05 A;  3EMM A;  5BVS A;  3RE5 A;  4IB9 A;  3HOE A;  3BRN A;  4FGI B;  2X4M A;  3T2X A;  4ML7 B;  1B0O A;  4I3B A;  3VG6 A;  2Q4N A;  1A57 A;  4ID2 A;  1P6P A;  1NC9 A;  3STN A;  3SLT A;  1HN2 A;  2OVA A;  3APW A;  1ZNE A;  3FEK A;  1XKI A;  5L8I A;  1SMP I;  1CBQ A;  3S26 A;  1GT5 A;  4LZU A;  5EED A;  2IZD B;  1SRE A;  2A2G A;  2NND A;  3B2L A;  4KT5 A;  4U46 A;  4Z28 A;  5K68 A;  3RSW A;  4LQZ A;  3TZS A;  5B10 O;  1SWS A;  3FMZ A;  4JHQ A;  4YFP A;  1QAB E;  1HXZ A;  3FW4 A;  3BLG A;  3WJE A;  2L68 A;  2ZAI A;  1SA8 A;  5FQ6 E;  1U0X A;  4MVK A;  4XMF A;  2RTH B;  4FBR A;  2A5B A;  5B5F A;  2IZL B;  2LKK A;  4UU2 A;  2QOS C;  5JD2 A;  2G7B A;  1FDQ A;  1STP A;  4O3Z A;  5F7G A;  3VG7 A;  2RN4 A;  3KFI A;  3VU1 A;  2L9C A;  2Y3F A;  4CV7 A;  1HMS A;  1JZU A;  4QGX A;  4YGH A;  4TJZ A;  4GJV A;  1AEL A;  1EAL A;  4U8U O;  2IZK A;  3B2J A;  4EKV A;  1D2U A;  5K06 A;  1W5R A;  2GTF X;  4I3D A;  3PEC A;  4ZHF A;  2X8S A;  3WZO A;  1KXO A;  1BM5 A;  1GXA A;  3VG5 A;  2AT8 X;  5CE4 A;  1FEM A;  2RCQ A;  3B2I A;  3OJY C;  4QZT A;  1G74 A;  4QGV A;  1OPA A;  4KII A;  5HCD C;  1O1U A;  3L4R A;  1JIW I;  1OBQ A;  3LHN A;  3B2K A;  1PEE A;  1QFT A;  4NYR A;  4GGT A;  5B11 O;  3RBY A;  2QOM A;  4TKB A;  2RTC B;  1I78 A;  2NP1 A;  2WPU A;  1B4M A;  3SLJ A;  3PH5 A;  5JR8 A;  1L6M A;  3VGW A;  3FYF A;  5KIC A;  3SZI A;  1KFF A;  2HNX A;  3BDR A;  2RTJ A;  1JJX A;  1OPB A;  4BVM A;  2OYB O;  1JMX A;  1E2T A;  3EW1 A;  3S60 A;  3NR3 A;  3FR5 A;  4EXZ A;  3VPJ E;  1LUQ A;  2A2U A;  4BX5 A;  4UU3 A;  3I0A A;  2AMM X;  1MX7 A;  4BX5 B;  1VPR A;  1XCA A;  4QYP A;  1SRG A;  4YCH A;  1G5W A;  2OFB A;  5AQ6 A;  1D3S A;  1OEE A;  4GNY A;  2G8C O;  1DC9 A;  1G85 A;  2RTE B;  2C1Q A;  3CQR A;  2RTD B;  4M7M A;  4TKJ A;  4YKM A;  5CSE A;  3ELX A;  4GNW A;  1DV9 A;  3MG5 A;  1S2P A;  3S5V A;  3HTY A;  2BHV A;  1VWG B;  2Q9S A;  2IZE B;  3APU A;  2IZA A;  3VHH A;  3KZA A;  3N91 A;  2OY7 A;  3UEU A;  2JU8 A;  1E00 A;  1SXY A;  4BCS A;  5H8T A;  4CPE A;  4DCB A;  3E3C A;  1EQD A;  1GX8 A;  3WZP A;  1RAV A;  1ZNK A;  2WQ9 A;  4O3W A;  4XME A;  1WUB A;  4PJ2 A;  5F6B A;  5BVQ A;  1SWK A;  3STK A;  2WQA E;  4XMD A;  3P6F A;  1VWR B;  1EXS A;  2MWH A;  1BRQ A;  2IZI A;  2AKQ A;  3CKG A;  1RSU B;  5FEN A;  3RDU A;  5HZQ A;  3BX7 A;  1RLB E;  4Y0Q A;  2FHL A;  1ICM A;  1HQP A;  2KTD A;  2FLJ A;  4NLJ A;  4ARH A;  3F6Z B;  3S5X A;  1SXX A;  2X56 A;  4JGL A;  4O9S A;  5FQ8 E;  3U03 A;  1TW4 A;  5IRW A;  1SLE B;  1GGL A;  2JMB A;  5IRA A;  4ES7 A;  1KT7 A;  4XMH A;  4EEJ A;  4Y0S A;  4ZHH A;  2OVE A;  1CBR A;  1MX8 A;  1DZJ A;  1VYG A;  1IW2 A;  1FTP A;  1YWA A;  2OFR X;  1X8U A;  2GTL N;  3NX2 A;  3K3L A;  3C78 X;  4LKT A;  5IO6 A;  1EIO A;  3RDS A;  2M4L A;  1FE3 A;  2FRS A;  4QGW A;  2E4J A;  3KVN A;  2CAM A;  3VHM A;  2PY1 A;  1SWB A;  1SWO A;  2FTB A;  5L8O A;  1KL4 A;  1KT3 A;  5EEE A;  3H3I A;  3D9W A;  3I17 A;  1VWF B;  3FR4 A;  1IFC A;  2R73 A;  3FEP A;  4IBA A;  5HWZ A;  1ML7 A;  1MOY A;  2L5P A;  3KFF A;  4KH8 A;  4U9C A;  4BX7 A;  4CPI A;  5HCC C;  1JV4 A;  1AVG I;  2HLV A;  2IFB A;  4OS8 A;  1VWD B;  5B5G A;  4BX7 B;  2ZSC A;  5B3M O;  1NP4 A;  5KHP A;  4ZJ0 A;  1G7N A;  2MM3 A;  2AL0 X;  1RBP A;  4BBO A;  3CQN A;  4U8U M;  2RTK A;  3PQS A;  4YKO A;  5LJB A;  2HZQ A;  3NX1 A;  3MVF A;  4IMN A;  2KTS A;  1E02 A;  1VWA B;  3RZY A;  3VG4 A;  1PBO A;  4GK9 A;  4GDA A;  4R0B A;  4YMY A;  4I9S A;  1BBP A;  5HBS A;  4AZN A;  4YDA A;  4HPC A;  1DZM A;  1MEP A;  1O1V A;  2MJI A;  5FAZ A;  2BC3 A;  2OY5 O;  4FQB B;  5K67 A;  1RXJ A;  3DTQ A;  3FA7 A;  4MIR A;  4YFR A;  3Q34 A;  4IB6 A;  4N7C A;  5H9A A;  3RDQ A;  3NPO A;  1SWN A;  1LPJ A;  2RTI B;  3VE1 A;  3WOV A;  2FKJ A;  2X46 A;  4GET A;  4ZGU A;  1RST B;  2CBR A;  3FLL A;  3ZUO A;  3D95 A;  2QO4 A;  1VYF A;  4IB8 A;  3U0D A;  1HQQ A;  1CBS A;  5BVT A;  2FKG A;  3PQU A;  2ANS A;  3RDM A;  2VFC A;  1KT6 A;  1OEK A;  1SWH A;  1HXL A;  1U17 A;  2HKD A;  1LIC A;  1Y0G A;  2X34 A;  3SZJ A;  1TOU A;  1N0S A;  1VYO A;  2Q39 A;  5DPQ A;  5HZ5 A;  1KL5 A;  1HBP A;  2ASN X;  3WXQ A;  4QAE A;  2P8G A;  4GE1 A;  4ALO A;  2EU7 X;  1QY1 A;  1ZNH A;  1GX3 A;  1X89 A;  1VWL B;  2C1S A;  2KW1 A;  2ZAG A;  1GX9 A;  3Q6L A;  3ZWE A;  3JS1 A;  2CM9 A;  2MO5 A;  3F9D A;  1SLG B;  2R56 A;  4GUZ A;  1AVE A;  3NP1 A;  3OD9 A;  4TKH A;  3PP6 A;  4O4U A;  2AT6 X;  2ALL X;  3NQ9 A;  1SRI A;  2VFB A;  3O19 A;  1LCV A;  3VE2 A;  1MDC A;  1URE A;  5LJC A;  2K62 A;  3TGA A;  2BS5 A;  2RA6 A;  5IO5 A;  1HMR A;  2Q2P A;  5D8J A;  3P6G A;  4A1Y A;  1YWB A;  2AT5 X;  5HCE C;  3TF6 A;  1S7D A;  3UAQ A;  3JQO A;  3FR2 A;  3IFB A;  3CMP A;  1BSO A;  1KT5 A;  3X00 A;  2CZU A;  4ZHC A;  5LJE A;  3NQK A;  2WEX A;  1IIU A;  4GKC A;  3ZW1 A;  1QQS A;  4FBO A;  1DZP A;  2Y32 A;  1Y52 X;  1KZW A;  2FR3 A;  3D4R A;  3ZW1 B;  1LIE A;  1AB0 A;  2RTQ B;  1HY2 A;  1VWI B;  4INN A;  4AZM A;  1HMT A;  3O22 A;  3PDF A;  2AVI A;  1I04 A;  4NNT A;  4ZCB A;  3WJD A;  4DQ4 A;  1JBH A;  1IJ8 A;  1GT3 A;  1OBU A;  1STR B;  2OY8 A;  1DZK A;  1GT4 A;  1JQP A;  3MX7 A;  4MVL A;  5AJB A;  3B2H A;  2JW1 A;  4GH7 A;  4ZGF A;  1VWJ B;  2FT9 A;  2RTA A;  4KC8 A;  4ORY A;  3VHI A;  2QO5 A;  3BU9 A;  4QZU A;  4AW8 A;  1OSP O;  1VWP B;  4Z2V A;  3F8A A;  2RQ0 A;  4NW4 A;  1W6F A;  1TOW A;  3KFG A;  3KQ0 A;  4TNN A;  1YP6 A;  4Y5D A;  3MM0 A;  1SLF B;  2HMB A;  1LF7 A;  2IZH B;  4NP1 A;  1T0V A;  1BSY A;  3AEH A;  3HWF A;  3IA8 A;  4RUU A;  3ZUI A;  2IZJ A;  3G7X A;  3AKN A;  5D4A A;  2XKL A;  2AH7 X;  1AVD A;  1N9M A;  5KID A;  3MBT A;  3C76 X;  3WJF A;  1SRF A;  1SY3 A;  2CBS A;  3D96 A;  4IRW A;  1MM9 A;  2BLG A;  3DSZ A;  4ORU A;  3V8U A;  4A1H A;  2O62 A;  2R74 A;  1SLD B;  3P6H A;  4L1N A;  4CDE A;  1QY0 A;  4CSB A;  1CJ5 A;  2BSZ A;  3PK2 A;  2OY1 O;  3EW2 A;  2OF9 A;  1BJ7 A;  2GTL O;  1WBI A;  2Z4I A;  5D45 A;  5HZ9 A;  2XST A;  4NLI A;  2RTL A;  3EYC A;  3T6L A;  5C0N A;  2CM4 A;  1NBX A;  2I5Z O;  4U3Q A;  2OVD A;  3VG2 A;  2I5V O;  4EDE A;  2LB6 A;  4HPB A;  2WEW A;  5EDC A;  4ZH9 A;  4C5P A;  4Z2P A;  1HBQ A;  3WVM A;  3EBK A;  1Z24 A;  2YMS A;  1CBI A;  1NQM A;  2AT0 X;  2RD7 C;  3CBC A;  1NGL A;  4ORS A;  5EDB A;  1DF3 A;  4O3Y A;  4GD9 A;  4GGZ A;  3O2Y A;  1FEN A;  5HA1 A;  3HOL A;  4CDD A;  3TGC A;  4JO6 A;  1LCW A;  4QQ1 A;  2FS7 A;  4ORR A;  4WHI A;  5H9N A;  1SWL A;  1ZRY A;  2GH7 A;  1SWJ A;  3APX A;  3WJB A;  4D6A A;  4ZFX A;  4YBP A;  3FID A;  1NP1 A;  2IZF B;  4ZHG A;  2QM9 A;  1QG5 A;  1W4T A;  3WJC A;  3FDC A;  2MF6 A;  2RTG B;  2LBA A;  4ORX A;  4OKA A;  2BS6 A;  1SWD A;  5B27 A;  1SWU A;  1I9H A;  4YVB A;  1SWR A;  1KT4 A;  1YIV A;  2K23 A;  2F73 A;  4ON1 A;  1T68 X;  4TLJ A;  2FHN X;  1BWY A;  2FS6 A;  1LFO A;  2Z4H A;  5H9K A;  1SWF A;  1CRB A;  2C4I A;  4IAW A;  1SXU A;  4OMW A;  4MVI A;  5LJH A;  4BX6 A;  5LJD A;  3AKM A;  1JYJ A;  4HPA A;  4BQU A;  4LZV A;  4Y0R A;  3ZZV A;  4AZO A;  1ICN A;  3T6F A;  3PPT A;  4BX6 B;  1EUO A;  3KFH A;  1UYO X;  2G78 A;  2ACP X;  1UZ2 X;  3GE2 A;  4A8Z A;  4COT A;  1PTS A;  2DM5 A;  2LA7 A;  3RY1 A;  1H91 A;  2QMI A;  3QQ2 A;  1YP7 A;  2N93 A;  4GJS A;  3NAD A;  1VWE B;  5CYB A;  1LDO A;  1VWN B;  2JU3 A;  3BX8 A;  3WZQ A;  1NDJ A;  4AZP A;  2RTR B;  4OEM A;  2JOZ A;  4GRJ A;  1BRP A;  1N43 A;  5B2A O;  5D48 A;  5L3Y A;  2KT4 B;  3UEW A;  4CK4 A;  3WJG A;  3D97 A;  3UEX A;  5BYP A;  1Y53 X;  3FA6 A;  3LV4 A;  2NNE A;  3RDX A;  4DQ3 A;  5HAE A;  4ODD A;  4QNI A;  1STS B;  2IZC B;  2PI3 O;  3FA8 A;  4OS3 A;  5B29 A;  1ERX A;  2OZQ A;  3PH6 A;  4YH0 A;  1MUP A;  4NYQ A;  1SWG A;  4O3X B;  1SY0 A;  1FJ1 E;  4MVE A;  2A8G A;  1NQN A;  2G5L A;  5F2B A;  3ELZ A;  1ALB A;  1X8N A;  2Y3E A;  1SWA A;  2A13 A;  4Y59 A;  5IXG A;  1GM6 A;  1OEJ A;  2QCB A;  4PSQ A;  1QFV A;  4ZHD A;  2QO6 A;  2RTF B;  4HWM A;  5HZ8 A;  5HA0 A;  1JJU A;  4Z6J A;  1JYD A;  4YDB A;  1QY2 A;  4M6S A;  5LJG A;  3CBS A;  1KQW A;  3BY0 A;  3QKG A;  3EBW A;  4I3C A;  2F01 A;  1IKE A;  2A0A A;  1X71 A;  3C77 X;  4YFQ A;  4AZQ A;  1ZNG A;  4CPH A;  4JNJ A;  3RE6 A;  3ZI8 A;  1KGL A;  4GZV A;  1FEL A;  4ZH6 A;  2HZR A;  4CPH B;  1SY1 A;  4GU8 A;  4LKP A;  1OBP A;  4CPF A;  4Z27 A;  3OBL A;  1DF8 A;  2RTB B;  4TQ2 A;  1DFV A;  1O8V A;  1N4J A;  1TVQ A;  4WFU A;  3CR6 A;  4HFO A;  2JGS A;  2X45 A;  3RDO A;  3AUM O;  2X8F A;  1LEL A;  5EPQ A;  2RTN B;  1LIB A;  3HWG A;  4I9R A;  4WFV A;  3TGB A;  1SWE A;  3HWD A;  1SXW A;  1VWB B;  4U8U N;  5EZ2 A;  4B55 A;  1BLR A;  1RXK A;  3BU1 A;  1RXH A;  3SZH A;  2IZB A;  1LKE A;  1SWQ A;  1VWQ B;  4I6S A;  2WSJ A;  4MEE A;  5DG4 A;  1X8Q A;  3SLO A;  3HPE A;  1SRJ A;  2UYW A;  4RUN A;  1LCZ A;  2WUT A;  1PM1 X;  2YG2 A;  1LIF A;  4WBK A;  2RTO B;  3RWX A;  4AYH A;  2OL6 O;  1A2D A;  1QWD A;  1TXL A;  1VWM B;  4MIS A;  4AZR A;  2WR6 A;  3APV A;  5LKF A;  1B56 A;  3T2W A;  2VDF A;  1BSQ A;  1K3B A;  2LFO A;  2W2F A;  5F6Z A;  5FFH A;  1KQX A;  1BEB A;  1LID A;  2POA A;  4A60 A;  4QRL A;  1S44 A;  2OFA A; 
#chains in the Genus database with same CATH homology
 4BX7 B;  2ZSC A;  4I60 A;  4Z2P A;  1NQM A;  3RY2 A;  4BBO A;  2RTK A;  1N7Y A;  4GD9 A;  4GGZ A;  3WYP A;  4JO6 A;  1LCW A;  1VWA B;  1SWL A;  2GH7 A;  1SWJ A;  2UZ2 A;  4GDA A;  4GGT A;  2RTM A;  2IZF B;  2RTC B;  2WPU A;  2MF6 A;  1MEP A;  3FDC A;  2RTG B;  2BC3 A;  5K67 A;  1RXJ A;  4OKA A;  3VGW A;  3SZI A;  1SWD A;  1KFF A;  1SWU A;  1I9H A;  1SWC A;  1VWK B;  1SWR A;  1SWN A;  2RTI B;  3RDQ A;  4YVB A;  2FHN X;  1RST B;  2OF8 A;  2RTJ A;  1KL3 A;  1SWF A;  2C4I A;  3EW1 A;  3WZN A;  1HQQ A;  4BX6 A;  3RDM A;  1LUQ A;  1SWH A;  4BX6 B;  1HXL A;  4BX5 A;  3SZJ A;  1VYO A;  1PTS A;  1KL5 A;  3RY1 A;  4BX5 B;  4GJS A;  1VWC B;  1SRG A;  1VWE B;  3WZQ A;  1LDO A;  1VWN B;  2OFB A;  2IZG B;  1NDJ A;  2RTP B;  4Z2O A;  1VWL B;  2C1S A;  2RTR B;  1N43 A;  5L3Y A;  2RTE B;  2C1Q A;  5CSE A;  2RTD B;  1SLG B;  1AVE A;  3MG5 A;  2A5C A;  1Y53 X;  3RDX A;  1SRI A;  1VWG B;  2IZE B;  2IZA A;  1STS B;  1LCV A;  1SWP A;  2IZC B;  5CHK A;  3VHH A;  4BCS A;  4BJ8 A;  4CPE A;  1SWG A;  1SRH A;  2A8G A;  1NQN A;  3X00 A;  2G5L A;  5F2B A;  1RAV A;  1LDQ A;  5IRU A;  3WZP A;  1SWT A;  2Y3E A;  1SWA A;  4Y59 A;  1Y55 X;  2Y32 A;  2QCB A;  4GGR A;  1Y52 X;  1SWK A;  2RTF B;  2RTQ B;  1HY2 A;  1N9Y A;  1VWO B;  1VWI B;  1VWR B;  4Z6J A;  2AVI A;  3WYQ A;  1IJ8 A;  1STR B;  1VWH B;  2IZI A;  1MK5 A;  2F01 A;  1RSU B;  3RDU A;  4DNE A;  1VWJ B;  2RTA A;  3RE5 A;  3VHI A;  4CPH A;  4JNJ A;  2FHL A;  3RE6 A;  4Z2V A;  1VWP B;  3T2X A;  4Y5D A;  4CPH B;  3MM0 A;  1SLF B;  1NC9 A;  4CPF A;  2IZH B;  1DF8 A;  2RTB B;  5IRW A;  1SLE B;  5IRA A;  1N4J A;  1SRE A;  2IZJ A;  2IZD B;  5K68 A;  4U46 A;  4Z28 A;  2JGS A;  3RDO A;  1AVD A;  1N9M A;  1LEL A;  2RTN B;  1SWS A;  4JHQ A;  1HXZ A;  1SRF A;  1SWE A;  1VWB B;  1RXK A;  5B5F A;  3RDS A;  2RTH B;  4IRW A;  1MM9 A;  1RXH A;  2A5B A;  2IZL B;  3SZH A;  3VHM A;  2CAM A;  2IZB A;  1SWQ A;  1SWB A;  1VWQ B;  5JD2 A;  1SWO A;  1KL4 A;  1STP A;  1SRJ A;  1SLD B;  2UYW A;  1LCZ A;  2Y3F A;  2RTO B;  3PK2 A;  4Z27 A;  1VWF B;  3T6F A;  1VWM B;  3EW2 A;  2OF9 A;  4GJV A;  1WBI A;  1MOY A;  3T2W A;  4CPI A;  2IZK A;  4BX7 A;  4EKV A;  2RTL A;  3T6L A;  1NBX A;  1VWD B;  2OFA A;  5B5G A;  3WZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...