2RTSA

Chitin binding domain1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
GPSTSMENLVSLQNLLVYVNWSSYPKYEPGKEYNQGDIVEYNGKLYKAKYWTTSPPSDDPYGSWEYLGEAEPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitinase
publication title Solution structure of the chitin-binding domain 1 (ChBD1) of a hyperthermophilic chitinase from Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 2rtsA00
1E6ZA 1E6NA 1W1TA 1W1YA 2RTSA 4HMCA 4HMEA 4Z2JA 1GPFA 1GOIA 1H0GA 1UR9A 4HMDA 4Z2LA 4Z2GA 3WD1A 1H0IA 4MB5A 3WD4A 1E6RA 2D49A 3WD2A 1AIWA 1E15A 4TX8A 1OGGA 1O6IA 4Z2HA 1W1VA 1E6PA 4MB4A 4MB3A 4Z2KA 3WD0A 1UR8A 1W1PA 1ED7A 3WD3A 1OGBA 4Z2IA
chains in the Genus database with same CATH superfamily
1PDCA 2IOUA 3L25A 4LG2A 2RTSA 4GHAA 3HONA 2FN2A 1GOIA 2Y2OA 1YU4A 2Y2IA 2Y2PA 2V5OA 4MB5A 4NZ1A 3WD4A 1YU2A 3WD2A 4IJFA 4NYUA 3KS4A 2Y2QA 4TX8A 1E6PA 1W1VA 3L26A 1YU0A 1CXWA 1ED7A 4IBFA 4IBGA 4OJPA 1E6NA 1W1TA 1KS0A 2JE5A 1W1YA 4HMCA 4IBDA 1YU1A 4HMDA 4IBCA 4IBEA 4IBBA 4Z2GA 4NY2A 1H0IA 3FKEA 1E6RA 2D49A 1AIWA 2Y2JA 1E15A 2Y2KA 2Y2GA 2Y2MA 4OJ6A 4MB4A 4MB3A 1GXDA 1W1PA 3HSHA 3WD3A 4QNLA 5BPVA 2BG1A 1E6ZA 4NZ4A 1E8BA 4HMEA 4Z2JA 1GPFA 3M7PA 1H0GA 1UR9A 1EAKA 3MQLA 4OJLA 3L29A 4OJOA 2XD5A 2JCHA 2Y2HA 3KS8A 1YU3A 4Z2HA 4Z2KA 3WD0A 3L27A 2UWXA 1OGBA 1QO6A 4Z2IA 3L2AA 4NZ5A 3N3FA 1H8PA 4NZ3A 2Y2LA 4Z2LA 2XD1A 1J7MA 4OJ5A 1E88A 3WD1A 3WX7A 1L6JA 4IJEA 1YUEA 1OGGA 1O6IA 3L28A 4IBIA 4IBJA 4GH9A 4OUIA 1UR8A 1CK7A 4NYYA 2FFFB 2Y2NA 4IBKA 4GHLA
chains in the Genus database with same CATH topology
1E6ZA 1E6NA 1W1TA 1W1YA 2RTSA 4HMCA 4HMEA 4Z2JA 1GPFA 1GOIA 1H0GA 1UR9A 4HMDA 4Z2LA 4Z2GA 3WD1A 1H0IA 4MB5A 3WD4A 1E6RA 2D49A 3WD2A 1AIWA 1E15A 4TX8A 1OGGA 1O6IA 4Z2HA 1W1VA 1E6PA 4MB4A 4MB3A 4Z2KA 3WD0A 1UR8A 1W1PA 1ED7A 3WD3A 1OGBA 4Z2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6Z A;  1E6N A;  1W1T A;  1W1Y A;  2RTS A;  4HMC A;  4HME A;  4Z2J A;  1GPF A;  1GOI A;  1H0G A;  1UR9 A;  4HMD A;  4Z2L A;  4Z2G A;  3WD1 A;  1H0I A;  4MB5 A;  3WD4 A;  1E6R A;  2D49 A;  3WD2 A;  1AIW A;  1E15 A;  4TX8 A;  1OGG A;  1O6I A;  4Z2H A;  1W1V A;  1E6P A;  4MB4 A;  4MB3 A;  4Z2K A;  3WD0 A;  1UR8 A;  1W1P A;  1ED7 A;  3WD3 A;  1OGB A;  4Z2I A; 
#chains in the Genus database with same CATH topology
 1PDC A;  2IOU A;  3L25 A;  4LG2 A;  2RTS A;  4GHA A;  3HON A;  2FN2 A;  1GOI A;  2Y2O A;  1YU4 A;  2Y2I A;  2Y2P A;  2V5O A;  4MB5 A;  4NZ1 A;  3WD4 A;  1YU2 A;  3WD2 A;  4IJF A;  4NYU A;  3KS4 A;  2Y2Q A;  4TX8 A;  1E6P A;  1W1V A;  3L26 A;  1YU0 A;  1CXW A;  1ED7 A;  4IBF A;  4IBG A;  4OJP A;  1E6N A;  1W1T A;  1KS0 A;  2JE5 A;  1W1Y A;  4HMC A;  4IBD A;  1YU1 A;  4HMD A;  4IBC A;  4IBE A;  4IBB A;  4Z2G A;  4NY2 A;  1H0I A;  3FKE A;  1E6R A;  2D49 A;  1AIW A;  2Y2J A;  1E15 A;  2Y2K A;  2Y2G A;  2Y2M A;  4OJ6 A;  4MB4 A;  4MB3 A;  1GXD A;  1W1P A;  3HSH A;  3WD3 A;  4QNL A;  5BPV A;  2BG1 A;  1E6Z A;  4NZ4 A;  1E8B A;  4HME A;  4Z2J A;  1GPF A;  3M7P A;  1H0G A;  1UR9 A;  1EAK A;  3MQL A;  4OJL A;  3L29 A;  4OJO A;  2XD5 A;  2JCH A;  2Y2H A;  3KS8 A;  1YU3 A;  4Z2H A;  4Z2K A;  3WD0 A;  3L27 A;  2UWX A;  1OGB A;  1QO6 A;  4Z2I A;  3L2A A;  4NZ5 A;  3N3F A;  1H8P A;  4NZ3 A;  2Y2L A;  4Z2L A;  2XD1 A;  1J7M A;  4OJ5 A;  1E88 A;  3WD1 A;  3WX7 A;  1L6J A;  4IJE A;  1YUE A;  1OGG A;  1O6I A;  3L28 A;  4IBI A;  4IBJ A;  4GH9 A;  4OUI A;  1UR8 A;  1CK7 A;  4NYY A;  2FFF B;  2Y2N A;  4IBK A;  4GHL A; 
#chains in the Genus database with same CATH homology
 1E6Z A;  1E6N A;  1W1T A;  1W1Y A;  2RTS A;  4HMC A;  4HME A;  4Z2J A;  1GPF A;  1GOI A;  1H0G A;  1UR9 A;  4HMD A;  4Z2L A;  4Z2G A;  3WD1 A;  1H0I A;  4MB5 A;  3WD4 A;  1E6R A;  2D49 A;  3WD2 A;  1AIW A;  1E15 A;  4TX8 A;  1OGG A;  1O6I A;  4Z2H A;  1W1V A;  1E6P A;  4MB4 A;  4MB3 A;  4Z2K A;  3WD0 A;  1UR8 A;  1W1P A;  1ED7 A;  3WD3 A;  1OGB A;  4Z2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...