2RTSA

Chitin binding domain1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
b'GPSTSMENLVSLQNLLVYVNWSSYPKYEPGKEYNQGDIVEYNGKLYKAKYWTTSPPSDDPYGSWEYLGEAEPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitinase
publication title Solution structure of the chitin-binding domain 1 (ChBD1) of a hyperthermophilic chitinase from Pyrococcus furiosus.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2013-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 2rtsA00
1W1YA 4HMEA 4HMDA 1W1VA 1E6ZA 1E6NA 1GOIA 3WD4A 4TX8A 1OGBA 1W1TA 4MB3A 4MB5A 1H0GA 1AIWA 1E6RA 1UR8A 4Z2JA 3WD0A 4Z2HA 2D49A 4Z2GA 4MB4A 1OGGA 1GPFA 1E6PA 4Z2KA 1ED7A 1O6IA 1UR9A 1E15A 1W1PA 4HMCA 3WD2A 4Z2LA 1H0IA 3WD3A 4Z2IA 2RTSA 3WD1A
chains in the Genus database with same CATH superfamily
4NYUA 1W1VA 1E88A 4OJPA 3L28A 1CXWA 3HONA 4IBGA 1OGBA 1YU0A 2JE5A 2Y2OA 2Y2LA 1W1TA 4MB3A 2FN2A 4IBIA 4LG2A 1AIWA 1E6RA 2V5OA 1YUEA 2JCHA 4Z2HA 1KS0A 2XD5A 3FKEA 4NZ5A 1GPFA 3L27A 1QO6A 1E15A 2IOUA 1CK7A 1PDCA 3WD1A 1YU2A 4HMDA 4NYYA 1E6NA 1GOIA 3WD4A 4GHAA 4NZ4A 1EAKA 1YU3A 1H0GA 1UR8A 3L2AA 2UWXA 4IBDA 3L25A 1L6JA 4GHLA 1E6PA 2Y2MA 4Z2KA 3N3FA 3WD2A 1H0IA 3WD3A 2RTSA 2Y2IA 2Y2NA 2BG1A 1E8BA 3HSHA 4IBKA 2XD1A 4IBBA 4TX8A 1YU4A 3L29A 4MB5A 1J7MA 3WD0A 4Z2GA 4MB4A 1OGGA 4IBJA 1GXDA 4NZ1A 4IBCA 4IBFA 2Y2QA 1ED7A 1UR9A 4HMCA 2FFFB 4QNLA 4IJEA 3KS8A 1W1YA 4HMEA 4OJ6A 4OJOA 1E6ZA 2Y2GA 3L26A 4IBEA 3M7PA 4OUIA 4OJLA 1YU1A 2Y2JA 2Y2PA 4Z2JA 3MQLA 4GH9A 4NY2A 2Y2HA 1H8PA 2D49A 3WX7A 3KS4A 5BPVA 4IJFA 2Y2KA 1O6IA 4OJ5A 1W1PA 4Z2LA 4Z2IA 4NZ3A
chains in the Genus database with same CATH topology
1W1YA 4HMEA 4HMDA 1W1VA 1E6ZA 1E6NA 1GOIA 3WD4A 4TX8A 1OGBA 1W1TA 4MB3A 4MB5A 1H0GA 1AIWA 1E6RA 1UR8A 4Z2JA 3WD0A 4Z2HA 2D49A 4Z2GA 4MB4A 1OGGA 1GPFA 1E6PA 4Z2KA 1ED7A 1O6IA 1UR9A 1E15A 1W1PA 4HMCA 3WD2A 4Z2LA 1H0IA 3WD3A 4Z2IA 2RTSA 3WD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1Y A;  4HME A;  4HMD A;  1W1V A;  1E6Z A;  1E6N A;  1GOI A;  3WD4 A;  4TX8 A;  1OGB A;  1W1T A;  4MB3 A;  4MB5 A;  1H0G A;  1AIW A;  1E6R A;  1UR8 A;  4Z2J A;  3WD0 A;  4Z2H A;  2D49 A;  4Z2G A;  4MB4 A;  1OGG A;  1GPF A;  1E6P A;  4Z2K A;  1ED7 A;  1O6I A;  1UR9 A;  1E15 A;  1W1P A;  4HMC A;  3WD2 A;  4Z2L A;  1H0I A;  3WD3 A;  4Z2I A;  2RTS A;  3WD1 A; 
#chains in the Genus database with same CATH topology
 4NYU A;  1W1V A;  1E88 A;  4OJP A;  3L28 A;  1CXW A;  3HON A;  4IBG A;  1OGB A;  1YU0 A;  2JE5 A;  2Y2O A;  2Y2L A;  1W1T A;  4MB3 A;  2FN2 A;  4IBI A;  4LG2 A;  1AIW A;  1E6R A;  2V5O A;  1YUE A;  2JCH A;  4Z2H A;  1KS0 A;  2XD5 A;  3FKE A;  4NZ5 A;  1GPF A;  3L27 A;  1QO6 A;  1E15 A;  2IOU A;  1CK7 A;  1PDC A;  3WD1 A;  1YU2 A;  4HMD A;  4NYY A;  1E6N A;  1GOI A;  3WD4 A;  4GHA A;  4NZ4 A;  1EAK A;  1YU3 A;  1H0G A;  1UR8 A;  3L2A A;  2UWX A;  4IBD A;  3L25 A;  1L6J A;  4GHL A;  1E6P A;  2Y2M A;  4Z2K A;  3N3F A;  3WD2 A;  1H0I A;  3WD3 A;  2RTS A;  2Y2I A;  2Y2N A;  2BG1 A;  1E8B A;  3HSH A;  4IBK A;  2XD1 A;  4IBB A;  4TX8 A;  1YU4 A;  3L29 A;  4MB5 A;  1J7M A;  3WD0 A;  4Z2G A;  4MB4 A;  1OGG A;  4IBJ A;  1GXD A;  4NZ1 A;  4IBC A;  4IBF A;  2Y2Q A;  1ED7 A;  1UR9 A;  4HMC A;  2FFF B;  4QNL A;  4IJE A;  3KS8 A;  1W1Y A;  4HME A;  4OJ6 A;  4OJO A;  1E6Z A;  2Y2G A;  3L26 A;  4IBE A;  3M7P A;  4OUI A;  4OJL A;  1YU1 A;  2Y2J A;  2Y2P A;  4Z2J A;  3MQL A;  4GH9 A;  4NY2 A;  2Y2H A;  1H8P A;  2D49 A;  3WX7 A;  3KS4 A;  5BPV A;  4IJF A;  2Y2K A;  1O6I A;  4OJ5 A;  1W1P A;  4Z2L A;  4Z2I A;  4NZ3 A; 
#chains in the Genus database with same CATH homology
 1W1Y A;  4HME A;  4HMD A;  1W1V A;  1E6Z A;  1E6N A;  1GOI A;  3WD4 A;  4TX8 A;  1OGB A;  1W1T A;  4MB3 A;  4MB5 A;  1H0G A;  1AIW A;  1E6R A;  1UR8 A;  4Z2J A;  3WD0 A;  4Z2H A;  2D49 A;  4Z2G A;  4MB4 A;  1OGG A;  1GPF A;  1E6P A;  4Z2K A;  1ED7 A;  1O6I A;  1UR9 A;  1E15 A;  1W1P A;  4HMC A;  3WD2 A;  4Z2L A;  1H0I A;  3WD3 A;  4Z2I A;  2RTS A;  3WD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...