2RTTA

Solution structure of the chitin-binding domain of chi18ac from streptomyces coelicolor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
105
structure length
105
Chain Sequence
ATSATATFAKTSDWGTGFGGSWTVKNTGTTSLSSWTVEWDFPTGTKVTSAWDATVTNSGDHWTAKNVGWNGTLAPGASVSFGFNGSGPGSPSNCKLNGGSCDGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Chitin-binding domain of chitinase Chi18aC from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
molecule keywords ChiC
total genus 12
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rttA00
2CWRA 1C7SA 3NDZE 1C7TA 1E5CA 1EXGA 5DHDA 1E5BA 1XBDA 1EXHA 1QBAA 5DHEA 1HEHC 2CZNA 2XBDA 1QBBA 3NDYE 1HEJC 2RTTA
chains in the Genus database with same CATH superfamily
1Q9WA 1G9ML 4D7PA 1S9YB 2J71A 2VH5L 4OT1H 4W9FC 5AEAA 3EDJA 3T0ED 1BVNP 2EDQA 2F54E 4I48B 4CGTA 4BSWB 3SKNB 3RL1A 2OMBA 2LW3A 3L08A 3ARGB 5FS5A 4P23D 4RFEB 5DHMC 5ADPL 4LO9A 1IVTA 1NAML 1JHTB 1XO8A 1PYWB 5I9QC 4ZX4A 2HX9A 1XGPB 2V5RA 4LBEB 3IGAA 3IMBA 4H88L 3BVTA 4IBSA 3JWNH 3CZGA 2CDGB 4U31A 2FSEA 4JREC 2GPZA 4TQEH 4KY1L 2VB5A 2X9WA 1I1FA 3H55A 1MLBA 3ZE0F 5GJSL 3HRPA 1JF1B 3PP4H 3DA0A 1EAPB 2R4RH 4JB9L 3NIDF 3TT1H 4P9HH 1AS8A 1YUKB 1BBDL 2JIXA 1HYSD 3MRLA 5T5FL 2WLKA 3U0WH 1FFOB 1C7TA 3F58L 5LN8A 1CXFA 4GO9A 1MFAH 1ASPA 4DVBB 2BO0A 2HN7A 3IDMA 4OD1L 3ILPA 5SX5H 1EJOL 3L4VA 2NX5D 2VL4A 3R19A 3AB0C 4F3FA 2VLRE 2CBOA 3H7LA 2R0ZL 2EDJA 1DBJH 1B90A 3O3BA 4YX2L 1NMAH 2FB4L 2WBJA 4MJJA 3L2LA 1JXGA 3HZKB 1PNDA 3F7VB 3E80A 1RQ5A 4KK9D 4L4TE 2F18A 1NGYA 2EYRB 3QS2A 4W9DC 3HHSB 2EUZA 2R2EA 5IFAL 2P8PA 4N2IA 4DUVA 2G3NA 4KJWC 5CU9A 4ZMPA 3FRPA 3H3BC 4RAVB 4X6CA 5KSBF 4KRNA 4BCZA 2FYYA 5EF2A 1K2DA 1BD2A 2EVIA 1ZXKA 3HI1A 3WTXA 2C8NA 3ZU8A 5HHOB 5B8CC 5TPWL 4F91B 4ANWA 3ZSTA 1QI3A 1IM3A 3H1ZA 2B15A 1O5PA 2OJZH 3PP3K 1JBJA 2Y7QA 3GD1C 3U7WL 2F74B 3FS9A 1V3MA 1FL5A 3UTTD 4BZ1L 5I0YA 4P5TC 1NDGB 1Q9LB 3VI3E 3JQOB 1CFSB 1OL0A 3NIGF 3T0AA 5L2KA 5SWSE 4LDEB 1XR8B 4WHCA 2IH8A 4JFOA 5L7XL 4FQLH 3BUIA 4JCLA 3GK8H 3SKJL 1A2YB 2E74C 2PPCA 4U1GC 4JKNA 2C7UA 2FQEA 5HGBB 4ZK8A 2IEPA 3OKMA 5AOLA 2HLEB 2B9AA 2UY7A 4ZYKA 3N85L 1IGFL 4YHIB 1ZTMA 3KLDA 4HJ0C 3E2HB 1TNMA 3WN6A 1H15B 2H26B 2VXVH 3F83A 5KS9A 5GRUH 1MFNA 3ML9A 2OI9B 3PHOB 3FKUS 1OSEA 4LEBA 4NI6A 5IREA 4QY8B 2XY1A 3C60D 1IX2A 5FUCC 4WF7A 3L17A 3FRPB 5B39B 1QEWA 4K0OA 5DC2A 5FYLE 1YEIH 4HKXA 4DKTA 1XF3B 1GZPA 5AW6B 4U0RB 12E8H 5HDBE 3Q2NA 4WTZG 2YN5A 2HXAA 3AU0A 2D7QA 4KFMA 4KKRA 4UM8A 1TTRA 5JW4Q 1G84A 3K2UL 4GS7B 1C5BH 1CYWA 1ZWIA 3QR1A 2N7BA 4PV9B 5EPMB 3UH8A 3IMTA 1W0VB 3MV7D 4PJFF 2PXYB 5BVJB 1KB5A 4GQ9L 5C2BH 3BWAA 2WKOA 4A66A 1FIGH 4JFOB 1MVYA 4G9DB 3ZYOA 1JGIA 4Y19E 2FO8A 1AP2A 2NY5H 4HXBH 1OB0A 3P4OA 1F11B 4P3CH 5J9PB 1L9SA 3OKMB 4AIXA 5EN2B 5KW9H 4P2QD 5BO1L 4G1MA 4M9OA 2NX5B 4XE0A 5E95B 5KTEL 4PB0H 3K1DA 2GJZA 2MTAA 3BSZH 5AAPA 4G72B 4HSAC 2XX1A 2C1OB 4O51A 2N56A 4NUJA 5CINH 4BZ1A 3ULUH 5HGAB 2VSMB 4BSVA 4KI5E 4HZAA 1H19A 2BZ7A 5BW7C 1ZLSH 2Q10A 1KB9J 5I74B 5AG8A 4QXWA 1JZ3A 1QFWM 1THAA 3PWPD 2R1XA 2A99A 3KXFD 3DUUB 3LMJL 1LE5B 1MDAA 3NIDE 1MFDH 4HS6A 1NM4A 1YNKL 3BWSA 1IAIM 3B3BA 3UP6A 4YBHA 2R69L 2JQMA 5CZXC 1YSOA 3RWDB 1M6OA 2IH1A 5FLVA 1HILB 2D7TH 5FGRA 2NQDA 3VB9A 3UCRA 4B96A 3K0YA 4TUJA 3B1UA 5AG9A 3GUTA 5IMKA 4KU1A 4OD1H 2CPCA 4P2OC 5I0VA 1OP5H 2DM2A 2YEVB 5D96B 4LCUB 5MI0C 4AT6B 2LLNA 1H6FA 2ZUQB 3TF7C 3ARGD 4BE5A 3KBFA 3IETB 1JZGA 3K6SA 1FVDB 3K5RA 5J9PA 2VJ0A 4KC3B 4P9HL 4NO5B 4EEEA 1PLCA 5DJ2A 5FB8B 2YGQA 2Z34A 3BJ91 2X5PA 1J1OL 2JCCF 5FGSA 5E1AA 5F7DB 4PJHF 4H1LB 3KLHC 4M1GH 3L16A 5JW4R 4TV3A 4BGDA 1KLGA 1JNHA 1E9PB 3KGUA 4AL8H 5KVDH 3NUKA 5E5MB 5JTWA 3P4NB 4XH2A 4HAGA 2F58H 1D7CA 4KY2A 2PYFA 5AL0A 3VXME 4F93B 2Y7LA 4PW9A 1CFBA 3CWGA 1PCSA 1SM3H 5IROC 4Q56A 2Q8BL 3RRQA 3MRBA 1JZ5A 1CGSL 2FEEI 1K8DA 2ZOKA 4UMGA 3VWKC 4JAMB 1NGZB 2P48B 2VR9A 4A7GA 3P2DA 3TPKA 1QPPA 3ARXA 3S96A 2YWZA 4G59C 3L4YA 1XMWA 5AAWA 1LP9F 2ZWNA 3LIZH 2F0CA 4P3DB 1UM5L 3CSPA 4PRAB 2D7OA 3B9AA 4OJAA 4BCXA 4JY4A 1N8ZB 2NR6A 3LH2L 4Y4FB 2UXFA 4E68A 3MBEB 1F45A 4LRIA 4XMLH 2WHVA 4GUPB 3S6CA 5ABDE 3NESA 4KXZI 1T1YB 3D4ZA 1SQMA 4L3CB 3B5HA 1A6ZB 3VA2C 1U92B 3PE9A 1CU4L 3QW9A 1NANI 4LSQL 3MI6A 1SYVB 2D7TL 3PNWA 1AHWA 1DJXA 2RACA 4M6OL 4FTVB 4Z7VB 1EDYA 3F12A 3CIQA 1T3FA 2HAZA 2ZUUA 3MLUH 4OSUL 2DWEA 4QTIL 2CD0A 4V1DE 1DP0A 1R5WA 1DQJB 1TOXA 5L6YL 3RGVA 4DCQA 1P7QA 1QFUL 5I24A 4RA3A 2G5BB 2QEJA 4Y1SA 5GPRA 3VD3A 1RUAH 3CN0A 1PD1A 1KENH 1KTCA 2DJSA 4ETQB 4JGMA 3BFQG 2VN4A 5D70H 5D4HA 4NRZB 5CNHA 4M7JL 1SY6H 4I7ZC 5E1QA 3SBWA 3ZDYE 3G5ZB 4R96A 4LDLB 3ISYA 2CJUH 5EU6A 1NPJA 3WFDL 3OF6A 1T04A 1ECZA 1SXCA 4PWGA 5IV2B 1BVKB 3WFHA 2QELA 4WV1A 3PGCA 1XF5A 2V7HA 1KIQA 3DIDA 1N5AB 1ZHNA 4FEIA 4OLYH 2OA9A 3WE6B 1S7TA 4NSKB 1QAWA 3MCYA 2G2RB 2CK2A 5I2IA 2J5WA 3FSWA 5A2AA 1G7IB 3KBHE 1TITA 2XVBA 3K4AA 4OLWL 4XAWL 4E5XG 2VWEE 5B38G 1OE3A 1TEFA 5E99L 1GIGH 1AHWB 1QVOA 2FQDA 5IW3A 1I31A 4E9LA 3OVUB 4IOFD 2PTVA 4GSUA 4PEEA 4XBPB 4X9IA 5I5IA 1NUFA 2YRZA 5E56A 4PJCE 2CQVA 1RJZB 1X5AA 1XGYH 2ICWI 3BKJL 4PRIA 4WJ5A 4AEHH 1UKTA 5D1ZB 3SY0A 2VDKH 4RQQB 2VLJA 1UQSA 4PJFE 4ZO7A 3V6OE 4LSQH 1EFXD 4WO4A 1QZ1A 4I0PC 4N4YB 2WNXA 4AYSA 4M61B 3O2DA 3PABA 4XTRC 2A6DA 1KCUH 5FYLD 2OJEB 2HH0H 4PTTA 4NB7A 1J5DA 2OJ1A 2V5MA 1WD8A 2BINA 3IK2A 3LIZL 4JDZB 4MXWL 4ZMZA 4JQVA 2HTKC 3EH3B 1FNEB 1AI1L 1OAQH 3V4LA 3B2MA 1MN4A 2V5SA 5JPMA 1G7IA 5GZNA 4CSTA 4GH7B 4RMQA 4BHUA 4P06A 3AW5A 4WUKL 4XP6L 1AE6L 1PSKH 2X89D 3CSYB 3I9AA 4LLDB 2P8MB 3WMSA 2V6HA 2ISDA 5I1KH 4NQDD 5CIPB 4JRXB 4D9LH 1CBJA 1G9EA 4QHUA 4NWUH 4UTAH 2LABA 4QHMA 1ILSA 2ZG3A 4DIXA 2EKSA 4LSSL 3QNFA 5CKGA 4F7PA 3IFLL 4G8EB 3WUWB 3HC4H 4Z7QE 4NRYB 1SLXA 1AGFB 4I8DA 3BKML 4LHUA 4EZLA 1LNUA 2FATL 3BZFA 2IH3A 4HHAB 2BK8A 2EIEA 4HT1H 1HINL 3O45B 8FABB 3GSVA 5AKRA 3E6FB 5TDOA 1BQSA 2NY6C 3LRHA 1D9KC 4MS8C 3VJ6A 3QHTC 4P9ML 4DP1X 4RDQF 3PGDA 1I1AD 1T4WA 2N7SA 4N0CC 4TVSa 5G5DB 4TPRH 3O4LE 4FULA 5ICXB 4Y4KB 1NUNB 2IANA 1U2CA 2WSPA 1QMUA 1NL0L 4OI9A 1DO6A 2ZCHH 3VFPB 4WDIA 4HWZB 3NAAH 3UAJD 3I50H 1Z2KA 2YEZA 2BS9A 4NHUB 1M7XA 2EDBA 1K9TA 1D5MB 1LK3L 3RTQD 2WOYA 4B97A 1YY8B 2XKNA 2DLGA 2YHGA 5I1GL 4IIZA 1LVEA 1YEEL 3ARWA 4LSUH 2E6PA 4XO5A 3MA7B 2EZ0C 3WFEH 2CZNA 1AZVA 4H20L 1ZLEA 5T3ZL 2ZOLB 1MW3A 3FU7B 4XMZA 3MJ7B 2C4FU 3V4VB 5J1TC 4MMXA 4JFFE 5DA4A 2OMWB 3UTZB 4JPQA 4PJ6A 5IVOA 4AGOA 4CU6A 4PJ8B 1NGWB 2WNKA 5BXFA 5JIQA 5KSAC 4OFYA 3IN2A 5K1VA 4GP8B 5DZAA 5F9WC 1JPTL 1MCNA 2R39A 3UZQA 3O81A 4XWOC 1L3WA 4EPSA 3RBSA 3N1FC 5IEHB 1ERNA 4UBDD 3I84A 5D55A 1PSKL 2ATAA 1KJ2B 3WKMH 4PMFA 1T5XA 1THCA 2XPGA 5DS2A 3QDMB 4M9PA 4Z7NE 3IDGB 4OR1A 1JPFB 1A7QH 1SOQA 3POHA 4BZ1H 4YHZH 2R29A 4HWEL 5AWNH 4WNSA 1MRCH 2QSQA 4JFEB 4WEBH 4JDTL 3LS5H 2AKRA 2Y6SC 1S2EA 3KVPA 1LO2H 4NQQA 3SDCD 5JIPA 3HHRB 1CFVL 5E6IB 4PRDA 5FM5M 2R7EA 3AREB 1H0DB 3S5LB 4N8VB 1XGTA 3O6ML 5K69A 1MSPA 4AV0A 3VQ1C 4DP6X 2C9RA 4UQ3A 4O02B 4DPRA 2GK2A 3DVNB 3T2LA 5AUMB 1I3RA 1AZNA 5JZ7D 1E65A 1OIOA 3VVWA 2V8MA 5MHSD 3TO2A 1BLIA 5AVXB 3OZLA 2WO3B 3MRJB 2DWYA 2CUMA 4LT7A 2FBRA 3NEOA 1HXYB 4FQQA 1GSKA 3VSUA 4OBSA 4HK3N 1SQ2N 3HS8A 4EI5B 1HYRC 5IEHA 3ZN6A 3VGAC 3LNIA 4MDRA 1FE8H 2VUKA 1JXDA 3BPOB 4OLWH 4NQCA 4XAWH 2GHWB 1FGNH 1X9RA 2EYRA 3ZW3A 1CT8B 4LOFA 1D6EA 1JUFB 3T3PF 1FZKB 2Y36H 1R3IL 4TUUA 1ZHBA 1BZ8A 4N0YL 2OI9C 5AAWC 1A7RL 1XCTA 3ME0A 3P73B 4LSSH 4ZAKD 5FC9A 4EQ3A 2FGZA 3CDYA 4M1CD 4WK0B 2YPVH 3RIFF 4Z7NB 3CFEB 5CJXA 3PP3H 3ATDA 3DX1A 4LAQL 5C0BA 3CK0L 2QMJA 4MX7A 3VRLE 2BW5A 4DNLA 4EN3B 4LPXA 5I1IH 2KQNA 4XNAA 2HLAB 4HH9B 3DUSB 4CUCA 3N43F 2VDKB 4NC1C 2BOBA 5DQ9A 2FCBA 3PHAA 3HG1E 2WXRA 4U1SB 1MEXH 4Y2OB 4NZTL 2YA2A 4O58L 4NC0B 2VABA 4XI5D 3B9VA 4OIAA 5DMGC 5IUSA 5D7LE 2UXTA 3V0HA 2R4SH 4LMQE 2A5UA 1OW0A 5CO1A 4XNBA 2BSTB 4DKEH 1QWNA 3NACL 3V5HB 1U3HC 3MOAH 2W60B 2E7LA 4GBXA 4FQQB 4L8SC 3S36X 2LU4A 4HHWA 1CFQB 2OR8A 4PY7B 3T4AB 1S5HA 5EA0L 1KIPB 2GBAA 5F3HB 3MRIA 4QRTA 4HAKA 4O2CA 4D9RE 1JPSL 4KQ4H 3MUJA 4JRFA 3TA3D 3WHXA 1QRND 3OJVC 3N5AA 3UBGA 3U6XA 3TGXA 3FT4B 1I8LA 2XVGA 1KPRA 3D3VA 4X6BA 3TO4D 4WJKB 3VD4A 4R90H 3KH3A 5I8CB 4QKTA 3ML8A 1R3LA 4Z18A 1QEWB 5J6SA 3U83A 2VW6A 1BEXA 4GW1A 4ENZA 1HYSC 4JHVA 3SKNA 4I0PA 1M1SA 1FFPB 4OGZA 1UCBH 2YPLE 3L3HA 5BQ7A 4MBRA 2DQCH 4FI6A 1YNTB 5ALCH 2YS4A 3EFOB 4BFBD 2HJFA 4CMMA 1MCFA 5SWZD 3P9LA 1CFNA 1JGEA 3FUJA 4X80H 1EDHA 5DJ6A 5GGSB 3CZEA 2B2XH 1G6RB 3BEWA 4JJ5B 2P8LB 4FADA 1H3PH 5F7EL 2ZX8A 3C5ZD 4AQAB 5BV7B 2NY0B 1OLZA 2NY7L 5C0GA 1JPFA 4X98A 1NMBL 3BWAB 2XZZA 2BSTA 3CVDA 2WAQA 1NLDH 4Z0BH 1E2VA 3O2WL 4J3WA 3TA3B 4GBXB 2EP6A 4YEEA 2ZUQC 1N10A 4F9PC 2BOCB 1KSRA 1DUZA 4I88A 2BX5A 3ASOB 4PJ7B 4U6TA 2J25A 3ZHDA 3ULUC 3SZKC 3D4CA 5FM4A 3DTXA 1WA1X 4P2RB 4XPHL 2PWDA 2B77A 3P2TA 2FH6A 2WKGA 1TQCC 2CMRL 4O02A 2BNRD 1DQLL 4OLUL 4EI0A 4G6JH 4JANB 3NH7L 5E03A 3BT0A 1JP5A 1KN4L 1A7PL 3HS0A 5I1EL 1XCQB 4W6XB 1SMOA 4Z7WF 2Z1PA 3LD8C 5D5ME 4OGQC 4X0KB 1XZWA 1D5IL 2ITCB 2JKXA 5K9JH 3M17A 1JPGB 2E0PA 2NXZC 1KGUA 2BS71 4AOFA 4UOW0 2AV1B 1G7LB 2D2OA 2A6IA 1WGVA 2P5EB 3GZKA 5B8CB 1X9UA 3WAKA 4NBZB 1OGAB 2OL3L 2XV0A 5FW7A 3L4CA 2XSKA 2VDRB 2YZ8A 3SGDI 1I3GH 4WFHE 1U8OA 5MEND 4Y4HB 4BXSV 4DCQB 3TBTA 1QSEE 1CE6B 5CSBA 5F7UA 3EDDA 1Q1JL 2OXHB 4RESB 1LEKA 2VDQB 1K8IA 1RL1A 4PBVC 3Q2LA 3KGTA 4FRWA 1CYGA 4Y4FC 1QABA 3H42H 5E2VL 3DJ9A 3QFJA 3HPLB 3AABA 1WK0A 2GK0B 5I1CH 1XCWA 1A3RH 4DPCX 4EI5D 3T8XB 2F7RA 3L4XA 4YBQD 5FOBB 3GXMA 5DQJB 3OWEA 2OMTA 3BQUD 1FVEB 2QQKH 4EI6A 1F3RB 1BREA 1SUHA 4YE4H 5SV3A 4CC4A 3ZHKA 2BXYA 1D5ZB 3V2AR 1FIGL 1P4LA 1VEOA 4HKZA 4ZUUB 1LK2A 4FP8H 2WXOA 3MRPA 5GSVB 3WGVB 1O6SA 5AOMA 3RVVD 2A77L 1G7QB 2FLRT 4UTAL 1OGTB 3QDGE 4HEME 4WEUD 1QEXA 3SQOH 1U3JA 2APVA 4J6RH 4LXFA 5EORL 5GS1C 3TLRA 3VYPA 5C0CD 4FA7B 4WWKD 5EZJA 4PCSA 5DRZB 2P5EA 2XA3A 2PW2B 5F3HA 4KMTL 1D5XB 1N0XL 2DKUA 5BPPA 3BQUB 4JFQB 1S9XA 1PVHA 5IJVA 5GS2H 5BMFH 1C16B 2EVFA 2BDNH 4F9PA 2UVFA 4QXGL 3ARFC 3ILPB 3VFWA 3NFNA 3G04A 3SE6A 4D8PA 3QEQA 1YECH 3QUYD 3UP1A 4NP4L 3ULVF 4WLCA 1I8KA 1UB5A 5KAQF 2RGSA 2XWJA 2X9YA 5JQIB 1N3NB 4F7KA 1OE1A 1WGOA 3PDGA 3NIFB 4YSUA 3LIUA 2EQDA 3L9RA 5DO8A 5B3SB 2AJ3B 4A7SA 5CEZL 4KZEL 5J13B 3ZE1F 1YMME 4Q2ZB 5MENB 1I1CA 4F1SA 3OBAA 4NP9A 2JJTA 4L9LB 4JQXC 3CLEH 1MRFL 3IFOB 1ZE3H 3JWDL 4UTBL 2YUZA 3HG1A 3NSJA 1HQ4B 1J0IA 1IGTB 4RMRA 3T0BA 4F58H 2E75C 4AYDC 2QADB 1OQOA 3QIWD 1ZKAA 3BUYA 3BVUA 4X98B 5DK0B 4A2FA 2X10A 2YIHA 3SDXA 3CFDB 2ZAIA 1JRHI 4UT6A 3AU1A 4HC1A 4N0UB 4X7EC 4WI9A 4Z7OF 4JY5L 5D1ZC 5GGSY 2YARA 1XIWA 1EERB 1FNGA 3TX4A 4DGVL 2NY5C 3GMRA 5J1AB 1S7VA 4W81A 3VI4E 3VI3F 4ELKB 3C2AH 4WKXA 1T2QL 4AE1A 5CJBA 5I0XA 4NUJB 3G6AB 1ZLUH 1CL7L 3ES6A 3HE7B 2BJMH 1A6TB 2LVCA 2B20A 4NXSA 4JMXA 1AH1A 1ZGLP 3VFWB 4FQHB 8CGTA 4J8RA 1A6WL 4FI7A 5I2IB 3JV5A 1KV3A 3MNVB 3QUXD 2QR0A 2R0KH 4KK6C 4GW5A 1B6DA 5CEYB 2VKWA 4W9IC 3FTSA 5AW1B 3TP4A 3F62A 4JHAH 2OTPA 4XNQA 1DQDH 3GUFA 1DYZA 2KZWA 3NJKA 3VWJD 5I30H 5ITBL 1I1AB 4KZEH 4RX4A 1WBYB 2XJKA 3SPGA 4A6YL 1FWXA 2UY6B 3MV7E 4J7RA 1Q9KB 5E8OA 5FYKL 1GGIH 4PWJA 4F15B 3NZHL 4B41A 3ISRA 4YGVA 1ONQA 1E28B 5DJ2B 4U49A 2VLJB 4WVRA 1W72B 2ICEC 1NIBA 3D48R 2WLMA 3J27A 5MERA 3BYTA 4W6YB 3B8SA 4X50A 5AW9B 5HDOA 3FFCB 5D2NB 3I6GB 4HIHB 4KMTH 1EXUB 3QJFA 4XN7A 2I07B 1JZJA 5GJSH 1DBBH 3C09B 4WY7L 4CL7A 1E0OB 3NJIA 3QC5X 4OIBA 4YR6B 2WTRA 3EYSH 4WKZB 2ZXEB 2BCKA 1DDHB 1JXJA 4PVBA 2YQ3A 1DJIA 2KH2B 3HR6A 4P07A 3RA7H 1JGLH 4ZFGH 1KYDA 5DVPA 4YHMH 1G7QA 1IC1A 1B3IA 1D5BB 3PXHA 3MKKA 4NKMA 5EZLA 4BFFA 2JJSC 4HC1L 5C0EA 1JF1A 3EH5B 4HD5A 3S96B 5IB4A 4TRPL 1LHZA 2R69H 4GG8B 4XPBL 4R7NA 3IMUA 4NOBA 4P3DA 3V7AG 3U79A 3WLBA 3FTWA 3IDIA 3NVQA 3DVGA 4MJ6A 4ZDHB 2H0PA 2IPTL 5T33L 1NBVH 2WQXA 3KLKA 3VD5A 3EH1A 5JMRA 1ZANL 3Q5TA 2Y06L 2AEOA 3PXJA 2ZYRA 5L8JB 1R17A 1QFWL 4XWOD 4K71B 4WZ9A 2IO5A 1AQ8A 2DLTA 3LN4A 2DYRB 2NXYC 3FBQA 1XH0A 5EUKA 4H25A 4GW4A 5IFHL 3FBKA 3PV6B 5HI3C 3B6SA 5I1AA 3PWUB 4XC3L 4MQXD 3II2A 1KTLB 5F89A 3BE1L 3RWJB 3ZDWA 3CAFA 4ZMYA 2H9GB 4GMTL 4NCC1 4M4RA 4FFWC 1RURL 4RWYL 3HMXL 1GOFA 3H4FA 4ZT1A 3GHBH 4Y9CA 5C6TH 4B7LA 1TPXC 4WHDA 3WL9B 5C0JB 3WHE1 1ND0A 4OVVA 2SEBA 4K9EH 4KDVA 3IPBA 1MCOL 1T2JA 3RTLA 1DZ0A 4JFPA 2IGLA 1QUPA 1PPIA 2R1WB 5FYJE 5EIVA 5E6UB 5GISL 4QCIA 1BIHA 2AITA 1KTBA 1UH3A 1MFDL 1UGKA 3A6OA 3BUQA 3F64A 4OZGB 2YGPA 3K74B 1NEZB 5HVHB 3G6JF 4JG5A 5CFHA 3ARED 2R2BA 3NFPB 2PCPA 3HG2A 5DLMH 3DUUA 3SDCB 3CZSA 1P7KA 4JFTA 3S3PA 2F7IA 3GMQA 4ICXA 4MA8L 5EU3A 2AK4E 3MJ8B 4LPVA 3T2NH 5I6NA 2IBBA 1A2YA 3B8YA 3ZDZF 4L4TB 2JELH 3V4VA 1DANT 1DBAH 1JVKA 4NM8L 5E9DB 3T65A 4W9EC 1KTLA 4HF5L 3TT3L 3LHAA 4RIRA 2IFGA 3C6SB 3HOGA 3OD3A 2AJXL 2J2ZA 3QDMD 2MKWA 4HK0B 4PP2A 4AK1A 5I18L 5IW1A 3IKCB 3H56A 4TL4A 5DJCA 1RUMH 4KUCF 3JXAA 3DDFA 2B0SL 1A6VH 5GRWA 4ABUA 4BUQA 1CVRA 3FCGA 3FFCD 3WEMA 4NO5A 4IM8A 5CZKA 4LIQE 4U6VL 3AS3A 2XQYK 5C0ND 2R0KL 2QKIA 1C08A 2XN9B 4MNQE 4N5EC 1D6VL 3RAJH 4HUWA 1Y07A 3VFUA 1RZPA 2WQ8A 4ELDA 1QSVA 4EI5C 4ES9A 1AYOA 4JZJB 4M48L 3UEQA 5I71C 5LGKA 3VFVA 1IBFA 2PYEA 1AIFB 3GGWB 3MBED 4HU2A 2Y07L 2O30A 4UT7L 3VG0L 4F8QA 15C8H 4NBYB 4N26A 4TQPA 1ED3A 1R3KA 1QA9A 4GRWF 2DQUH 4N0UE 4D0DB 4Y89A 5KVMC 2J6WA 1XSKA 1XTMA 2VXSL 1AO7D 3STZB 1EXHA 1BG9A 4L4VA 4IS6B 4R7VA 4U1MB 4JM2D 2VDKL 2X41A 3C60C 4EZKA 5KYYA 2YD4A 1HNGA 3RTQB 4AZ8A 2YOAA 1PL3A 4XPFH 1BVLA 4FGMA 2HT3D 1U91B 2W95A 3AG4B 3QUKB 4G6AC 4LVNB 5I1IL 2AW2A 1VADA 1RK1B 1NDMA 3MBEC 2WLHA 1FF5A 1AKJB 4F7PB 1LE9A 5GS0L 4P4KA 1NLBH 3QH3A 1ADQH 5ESVA 4ZDHA 2FJFA 3ZKQD 4XGZB 2KUTA 3EF7A 1W6LA 1IZJA 1AGDB 2X70A 2ZJSL 4ZTPH 2Q6WA 4CMMB 3GHEL 3WG7B 1U41A 3DSFH 3KDPB 5LXGH 1XEUA 4ODVL 2G0LA 4U1LA 2XA8L 1MAMH 2ZUSA 5IUCA 1S78C 3GM8A 1IAOA 4M6NH 3UIYA 3FULA 2X9XA 1KWGA 1VZIA 2ADJB 1DZBA 1BYPA 4PI0A 4YXLL 1LXMA 3V4VL 3LKRB 1E6JH 1KGXA 4EO5A 1HCZA 1N59B 1U8CA 2Y36L 1DE4A 1HAWA 4KJYA 4JKLA 4BELD 1MF2H 5LGHH 1AIZA 5DK3A 3Q43A 5DEGB 1NMCC 5KZCD 4JVUA 5CIPH 3PL6C 3FFDB 3WIAA 2OCFD 4EXKA 4DP7X 2EE3A 2XKUA 2Y1VA 5CILL 3AT0A 2EXYC 3HC2A 2Q7NA 2ENJA 1NCDL 1WRFA 4QXTB 2FIRT 4K5LA 2R59A 1DLFH 3K0WA 3KXFB 2DMGA 2EEBA 4AEIH 3QUYB 2R1WA 3VH8A 2BP8B 2QQNL 5K9QG 1J9SA 4NQDB 1F58H 1XF4A 4GI8A 1FL3A 4RFOL 5DQDL 1TZGL 4DVBA 3FQTA 3PYCA 5G4MA 3X17A 1GTFA 2CM5A 4Z23A 5A40E 4K8RL 4WWPA 1BMZA 1BOGB 5ISZE 3VXOB 2NY0C 4X0KA 3QHZH 1OPOA 5EBWA 1JNLH 2AK4A 2DH2A 2DV6A 4LNRB 2NXZD 5SX5K 3VXQA 1G9MH 2H6PA 3DSFL 3HE6B 3CDZA 1A1NB 1SEQH 1VGKA 2BPBA 2KC0A 3H4HA 4DO4A 4GSDL 3RAJL 5GGVL 3FUDA 3PL6D 5ID1A 2XG5B 3L81A 3CBKB 4DGYL 1GMEA 4LLYA 3KEHA 1MJ8H 3DX9A 5EC1A 4IMLA 4ZUVA 2EH7L 3HG0A 4Y1AD 1YMMA 4HWNA 4YWGL 4YHZL 3AACA 1S7SB 3LSOA 1ORQA 2XTLA 4MAUL 5HVGB 3H9SD 4OFKA 3HG3A 5GRVL 3V8CA 1TDQA 4OQ1A 1CDUA 3QORA 3W3BA 3MRMA 5DJXB 3LQZB 4JR9H 3SYPA 4PJGE 1HCFX 2I60H 3U4BL 2N01B 3PV7A 1HSAB 4ADJA 3QUGA 3N1GC 1INDL 4PUBL 5L6YH 3VD0A 3E1ZA 1HEJC 3U4AA 2WK2A 4U1IA 5JPMC 5DQJA 3KPSA 2CMRH 2E8YA 4FQXC 1XF4B 3IE9A 3T6XA 1KCRH 3L3IB 5F7BA 1FNEA 4N5UA 2P8LA 2PWFA 4LQ1A 2VE6B 4WUUB 5E00B 1K4CA 1UB6A 4P48A 4L5FH 4LOEA 3US0A 1RULH 3O9WD 1OGAD 7FABL 4KHXL 2IDSA 4AG4H 5F7FA 1IM9D 5T1MA 2J8OA 3AJ7A 1BGXL 3CSBA 1BA9A 2K6YA 3SGDH 5CLZA 4L4VB 3X11A 3DVNA 3MXVH 3RWFA 2WN3A 5T1JA 2E4TA 1FFQA 1MI5E 3FU3A 4AYFB 5F93C 2COVD 4UAOB 3BXNB 2OX5B 3FONA 4O4YL 5AD0B 2BNRB 3LZRA 2WQUA 3TURA 3ZGHA 1VFBB 4H0IA 3OXRA 1MJUL 3FF7A 4TNVF 4CMHB 4Q74A 5C2UB 3JTTB 4X6FA 4QRQB 1E2ZA 5FYJD 4S1RH 1U93B 1XXFC 3C75A 1A0QH 4G6ML 2K78A 4JQIL 2WZPD 1GPOL 4XGZA 1MFEH 2Q7YA 3FSAA 4PR5A 3X14B 4RGNE 2YBRA 2DB8A 3UTTE 3UAFA 1GOHA 1IAIH 1X5FA 1WZKA 5HHOD 2HRPH 2ICWB 4FL4C 4Y7OC 3WDJA 1EO7A 2O6PA 3QDAA 1UXWA 2F5AH 3KS0J 3WTSA 4EOWL 1ZRUA 4WUUA 3CU7A 1FFTB 2K1MA 1KXHA 5CEZE 3K6SB 1XF3A 4HZ1A 3MMEA 4F8NA 1ZY9A 2EJ1A 1WD9A 5CN2A 5ALBL 5SWZE 2ZICA 1CGVA 1P1VA 4JMNA 1JCVA 1J18A 5FHAL 3SN6N 4Y4FD 1R24B 5EUOB 3CPLA 1U3HB 3MOAL 1S3RA 4AE0A 1X6LA 1ZWIB 3ATEA 3QG6A 1INDH 1I9RL 2AHIA 3T8XA 3CH1B 2R51A 1XR8A 2J3SA 4ODTH 1MIML 4MCNA 2O93L 2J5LB 2IBZX 3T4YA 3MZGB 2Z0UA 3V6ZB 2OZ4L 4JZOA 2ENQA 4Y1AA 4FYQA 5INDB 4FQHA 1LLAA 1VCAA 4WSGA 2X05A 2W9LA 4CC4C 2V7NA 2Z91B 1WFMA 2VMJA 3LPFA 4ZS6C 4DH2A 4FMFA 1R6VA 3PL6A 1T7YA 2N0KA 1AANA 4M6MH 3H85A 5AYQA 1OVZA 2YPVL 1NIAA 3WIHH 3KYNA 1IT9H 1R3HB 4HGWA 1NEUA 4M7ZC 4NERA 1U30A 2FD6H 1IM9B 1KEGL 1O75A 1R46A 1XGUA 2HMIC 2DQJL 4IHOA 2DLEA 4OUUB 5DD3H 1CTNA 1UYWH 1FHGA 3RIKA 4ZRGA 1TMQA 4UDTA 3EYQC 2V2TA 1E43A 4NZFA 2DM4A 1DUYA 3KH4A 1TG8A 1WITA 1Y18B 3SYAA 4YGVB 5B7EA 2CO3A 2UWEE 3H0TA 3HE7C 3QEQB 3QNYB 4NHCL 3U25A 3NIFF 4A6YH 3JSSA 5HHME 2AK1L 1VSCA 5FAAA 4OV5A 4F80A 1BOYA 3QORB 4UINH 3RVWC 5EU7C 2NY3D 4DETA 2EC9U 2FT7A 3I6GA 3CFCH 4WW2C 4FKEA 4FTVE 3QQXA 8FABA 1OP4A 5I1DB 3I02A 3BAKA 2CHWA 4BQ8A 2BRQA 4ELMB 1QR1A 1ZVSA 4NOFA 5DI8B 4RGMC 4YR6A 3QQ3B 4LU5L 1NGQL 4U4BA 4GAFB 4RZCB 2DTML 4YAQB 5E6IC 3RPBA 5KYXB 2ATKA 1TLMA 3AREC 1NUDA 3CFEA 3D50A 3PWPB 4UNTA 4Y4KA 5CGTA 3EGSB 4N8CL 1AD9A 2CKBB 3OG6B 3PGFL 3S4SG 2APXA 4JRYD 4KQ3L 4F2EA 2NXZB 4G11A 4X6DF 5JHLA 3DX7B 3QZWA 1TJHH 2X4RA 4OD2A 2B3RA 4P4KD 3RWFB 1URZA 2YBGA 1ACXA 3QDGB 5FX3A 1HL9A 2AEQL 4IBYA 4N90D 1MUJB 3U46B 5A3IC 3COOA 5IFJA 1TTBA 2UZIH 5EEUA 3E3QC 1IGFH 4PJDE 4UI2A 5CGYD 1XXDC 3FRUA 4J3VA 3LN4B 2GSMB 3O0RH 1HIMH 1MZYA 3UIZA 4GAJL 1B4LA 4WHYH 1ZVNA 3S34L 4JPIB 1Y0LA 4Z7OE 4JAMA 5EBMB 1AO7A 2ICWJ 2V9TA 1PMYA 2AXGB 5KZCB 1IO4C 4JFED 4N25A 5F9OH 2PW1B 2R8SH 4OCRL 1MIMH 3U9UA 3A67L 4F7CA 2BHUA 2BSRA 3C2SA 2IWKA 4TSCL 3OX8B 2CCVA 2VDOL 1RJZA 1HE8A 4IBVA 2VDNH 3JV4B 4KDWA 3JVFC 2GSGA 3EZJB 2QQLL 3HZYA 3NCJH 2MH4A 3UBXI 3IXTB 5IKCB 2VLKD 3HC3H 4GMTH 4KBPA 1HH6A 1VDGA 3Q1SL 2IPKA 5JXEA 3L2MA 5KVEL 4EDXB 1T03L 2TSAA 3SE3C 2RBLA 3VI3A 3ILEA 2BOBB 4Y5VA 5DQ9B 4MZRA 1UH2A 3QJHA 3C6LB 5JXAH 4JO1L 2AGJH 1TEGA 4Y9BA 1XZ0B 2HFEA 1R3JB 3V0WL 3CH1A 4OZGA 4PWIA 2DIAA 3MNDA 2MPAL 2PYFB 1I1YB 1E5CA 3STLA 1KBBA 2PP8A 4HKZB 4ZUUA 5IGXH 3AROA 5EB9A 2KT6A 4C47A 4B53A 1HQRB 4FQPA 4S1SL 5EWIL 4WFGD 4AMKH 3MRBB 3S97C 1J1PL 3M6DA 3BP7B 4GKSB 2VW4A 3ESUF 3P1VA 5EU3B 3CVCA 1UXLA 1UFUA 2W9EH 4IRZA 1D5XA 3LV3A 1N0LA 3BI9X 2HPTA 1R3HA 3DIFA 2FT6A 1ZGLB 3T8MA 4TSAL 2DAVA 3BW9B 5JHLL 1M71B 2ZSVA 3JUZA 3U9PH 5L9DL 2VXQA 4Z9KB 4Z7WE 4TLSA 4QAMB 2J6EL 4Y2LA 3HZYB 4LBAA 1SRDA 1ZK9A 3BGMA 3MLXH 4M1GL 4OD3L 1U92A 3CVHL 1JYVA 3P9MB 2WQRA 4OAWA 3QWOA 3HC4L 5AOKA 4OJEH 3FQXA 3O4LD 2W81C 3SBPA 1OAXH 1JZHA 1P9MA 1KYUA 5T1DH 3GMNB 4XPAH 3SQOL 1VFMA 1AD0A 4LOUD 4H88H 2A6JB 4B7IA 4QJ4B 5DEZA 3T04D 1P1ZA 3QIUC 1Z3RA 1AR2A 3QFJE 1H8SA 4UNIA 3NCMA 1AGEA 2FJSA 4BDVB 3ZLQC 3CUPA 2IANB 4XNUL 3NA9H 3SY0B 1XF2A 4MXVE 4BZ2L 2WJ7A 5DD5L 3AU1B 4Z3JA 4R7DA 1JV5A 1QD0A 2CKBL 2H0EA 5ISZA 2PCXA 3HPLA 4MAUH 2O6FA 1A14H 1EIBA 1QWUA 1Z9MA 4FNLH 1MWAH 3CZNA 2R83A 2ZF8A 3F65A 3SOBH 5TDPA 3CFKB 1UM4H 5AAMC 4BK5C 4G82A 2NYYD 1PTZA 4KKLC 4E41B 3SE8H 3AAZB 1SLUA 4FYSA 1U8KB 1ZLVK 1XCXA 1I85A 1KJ3H 3BO8A 2X6CA 3MREA 3ROOB 2XWDA 3NCYP 3VACA 3M46A 3LX9A 3CXDL 1J8RA 3KGRA 4L5FL 5I0ZA 4PB9L 3WXWH 3IXAA 4MSWB 2CHXA 2I25N 3FQ1A 4DFIA 3QP3A 1Q0YL 5JIKA 3NRFA 1LQSR 4U3HA 3T8VA 3TEXA 1NCWL 4ONHA 5I76A 1AZUA 2IWGA 1V7NL 4ZG1A 1I7ZB 4L2YA 2F2HA 1W0YT 4CC1A 1E4JA 3TZVA 2BFGA 5KSUA 1MCJA 1LWRA 2LTQB 1YNLH 5DT1L 5CEZD 1JFQL 5C9JB 1WAEA 3ZDXF 1OT2A 5DWPA 5SX4I 3T2OA 5EOTB 4WSKA 2QSCH 2P26A 2VDOB 3B9EA 1W8OA 1CFNB 1JGEB 2DRUA 5DA0B 4HUUA 1N67A 3RNKB 2BP8A 2F6AA 5J6GA 5EU5B 3MRDA 3EHBD 4G9DA 4AW4A 3HUJF 1AY1L 2EEFA 4NAMA 3MNZA 5LDSA 1DDHA 2DKMA 2P49B 2VDQH 1OTTD 4M02A 3ZRFC 5T3XH 2JTYA 4CU7A 4NO3A 2NW3A 3RHWF 4D0CB 1OO2A 1CICB 5ESAB 5ICXA 3PQYD 5TFSL 5ICYB 3CE1A 1ML0A 1A5FL 1IKFH 1NJ9A 5DFVD 3V6FA 3C5JB 4IRJD 5FDYA 3QEGH 4DK5A 3GJFB 5F6HJ 2DIBA 3CC1A 3O11B 2C9VA 3FO1A 1WEJL 1MJJA 3HUJE 2MKLC 5EF1A 4P5SA 4UYQA 3UDWC 2Y3AA 3KPRE 3ARFB 1KGCE 4XPFL 1K5WA 4H13C 3MV9D 5GGVY 2ZSWA 1SDAB 3EBAA 3N0PB 5DHEA 3S5LG 1IILE 2YJLA 4YPJA 4ZFZB 3NEEA 1M71A 5CHNA 3QO0B 3D18B 1DBMH 2FJFB 1JPGA 4PRBA 2NDFA 5CZVH 1XIWD 3PDOA 4A2DA 1M57B 4AYBA 2NOYA 3DMMD 2B3IA 4ZS7L 3QJZA 4LESA 3DHUA 1D6EB 4JHZA 2CSPA 1N70A 3L9YA 2PTTA 4PS8A 2FVNA 4XNQB 4QDGA 1ZV9A 2XA8H 3DMMC 4M4RB 3MJ6A 1FHNA 1UATA 1J7VR 1OLLA 4MVBD 3ZK0A 2AQ1A 1I75A 1ZLWK 4PJIE 3H9SE 4TKWA 2WWMC 3PU7A 4ILDA 4DVRL 3K6FA 3C5XA 4TUOB 1ET8A 1U8OB 4D0CA 2VM3A 3IDYC 3RHWK 3QAZC 2H47C 1K6QL 1YQVL 5BV7H 4BQCA 1AC6A 4GAYB 1FO0H 3GBMH 4R7DB 3TBYB 1FNHA 2J20A 3WTWA 2G4GA 2G75B 2HJKB 1NQBA 3FF8A 1YEKH 4OY9A 1KLUA 4JFFD 4QYOA 1CBVL 4AQ1B 3S3BB 2XG4A 2WN2A 3KHOA 2WP3O 1A6TA 1FVEA 4EI6B 4IRJC 4CN1A 3F84A 2Z65C 1DBAL 4R4FL 1FAIL 2HP4A 1M56B 3BT2H 5FOBA 2VDQL 4JJOA 4H0LC 4GMSH 4K7PL 2HT2C 1IC7L 2CAKA 2OMTB 5LG1A 1YDPB 5CEYA 2YRPA 5DSCA 1ZLVH 2FWSA 2P7TA 1HX0A 1T21B 2O5YH 1I1AC 4LGPB 3TU6A 2W0PA 2P5EE 5IZ7A 3OJDA 2RAMA 1IGCL 4WFGE 3I6SA 4AENA 4MD4B 3WXVL 3GXDA 1WVZA 2OKMA 4OLEA 2I85A 1HHKB 3NPZB 4HYTB 3FOMA 2NRDA 3QVAA 3WTTA 4PGZA 1MCWW 5I6MA 3QULA 1UWXH 3BLBA 4PLKC 4BKTC 3TESA 1FO0A 2XWXA 4RGNB 2Q87A 3GSQA 5C09B 1IKNA 2IADA 4UB0H 1U9KA 4PJGA 1RJCA 3B43A 1TZIB 3NFNB 4XXCC 4G7SB 3QFJD 1MREH 3DYPA 3WXWL 1PZUB 5L8KB 5E2TL 2L04A 4KKAC 5F7AA 1RZKH 4JPVH 4L3EB 4ZD3H 3EO1A 4K3DL 2WLNA 2AGJL 2BWQA 4O4YH 3SB3A 1ZTXL 1KJ2L 1U95B 1KCVH 3LKNA 1OAYH 3SCMC 1FORH 1E4WL 2G9HB 4FXGC 1KNOB 5E23A 3NJMA 3GNMH 4LVNC 1WFNA 4O2FB 4MLSA 3U4EB 2JQAA 1L7IH 3IRPX 3ZZLA 5HVWA 4KNUA 4NQDE 3DTXB 3EBIA 4E42A 4KKLD 2H1LM 5KYYB 4Q0XH 1HTYA 1RIVL 2DEXX 3KPRB 4NENB 2X88A 1G4RA 3D30A 2QHRL 1TTAA 3QI9B 3R1GH 5EIIA 1SEBB 3GM0A 2B4CH 4G7VH 1PQZB 2W0LA 1XCQA 1TKWA 4F1ZA 1WT5A 3QDGD 4O5LH 2A4CA 1JZ4A 2YRBA 4UTCA 2GY5A 2AERT 2BVPA 3CN1A 2JKTM 3IFNH 1A7PH 2XQBL 2YR3A 4NJ9H 1HI6B 1DQLH 1X5KA 2C26A 1H8OA 1KIPA 1I7UB 1QATA 3HMXH 5JIDA 3BVXA 1WFUA 1MHPH 4Y88A 5D1XE 5EZPA 5D7HA 2LAAA 4HMEA 2E56A 1E42A 1ZHLB 4PJXA 4U6HA 4BINA 1FORL 4JHUA 4MNQD 3TBTB 5HJ3B 1DQKA 2CRIA 1QI4A 2C9XA 3ETTA 3GDBA 4HMDA 2EDFA 4LLQB 4HJ1A 4R4FH 5D1ZA 3F85A 3MRKB 1YN7A 2X7LB 2Y7NA 1RMFH 1UHVA 4Q6IB 2RCSL 2PF6A 5MP6L 3GB7B 5K1NA 1M7IB 4LSRH 3FTGB 1RUKL 3FAWA 2CM6A 4NZJA 4UB0L 5CM1A 4NNXA 4PJ9C 1KGJA 3QQNA 5D71H 4ELME 2E7LC 3IPEA 1RPUA 3GLAA 4CJ0A 5AZ2H 2Z31A 3HLAB 4XPGH 1MW2A 2VQ4A 2J57A 3UPAA 1DVTA 3VM7A 3SKMA 5MI0B 4K8RC 1HL5A 5MERB 4PY8J 1QACA 2AFNA 3TO4A 4OFIA 4OF3A 3JVGC 5INCA 1QKZH 2RFXA 1QRNA 3TA3A 1NPNA 4LLUA 2HX8A 3WO4B 1DUZB 1D3CA 1K72A 4FNTA 5ACMA 1JYNA 4R4BA 5B1CA 3MLZH 2HG5A 3ARDA 4AMWA 1GSMA 4M5YL 4E5XB 4GBXD 3RDTD 5C0AA 5A6LA 5K59E 2WXGA 3AY4A 3RWGB 2DBLH 4ECNA 1RZ8B 5C08E 3QXAA 3MACH 1FRGL 1UURA 4NKQB 3UX9B 1P7HL 2NY0D 2F53D 3EFFA 4UV4L 4FFYL 4X6EB 2DQHH 5TE7H 1F3JA 4I3RL 5IHZA 2OSYA 3UZEC 1DEEB 1B0WA 1INQB 1IIKA 4H8QA 3HZVB 4J6IA 4O58H 4AC4A 5IVXB 5HD8D 4X6CE 4GB9A 2OQJB 3MGTB 1TVHB 4HXAL 5E70A 4QRSA 1MHCA 3PPSA 3JWDH 1C5DA 1L0XA 1WQVT 3DO4A 3IFOA 5C0GB 2EUXA 2HA1A 5HGHA 1U8IA 2ZNXA 1HIML 3CK0H 3CVBA 4ZAKA 4IGBB 2B9BA 4BK4A 1P4BL 5KANI 3BAWA 3SZ6A 4HIEB 2ZUVA 4KMQA 1JHTA 1NM9A 4F24A 4MS8D 1PS3A 4EXPX 5K9QI 3WL9A 5C0JA 3KMDA 5DVLA 3KPPA 3GMLA 2Q1EA 3LRSB 2J44A 3M07A 5H37A 2I7SA 3QJXA 4M7LH 4TQ8A 3NK4A 2DD8L 1H3WM 4GXFA 3OPUA 3SJVD 4QCIB 2VDNB 4M5TA 5I8EB 4APQA 1AFVL 4G8GD 3QPQD 4F2ME 5T5NG 3LS4L 4JGNA 2F7OA 1LE9B 4ZXBA 3SGJC 1GJWA 5MEQB 1KDJA 3I6KA 2WB1A 3TFBA 4U05A 4G6FD 2DWDB 4NM4H 4J4PA 2H6PB 3HE6A 4NNPL 1EJOH 2E59A 4UOJA 5T3XL 4XN1A 3WLWD 1EHKB 1RIVH 5GGUB 5HDBB 3VDCA 1XF1A 2KPNA 2F68X 3ESVF 1WWCA 4OCWH 3BFOA 4OFVA 2TRHA 2AJXH 5ANME 4MKMA 4ZAKB 3SKOB 3ULUD 3GNML 3Q3GB 4HIEA 3U7YL 3QEUA 1CN4A 2X4TB 3MLYL 4KH9A 4ZMLA 1WYJA 4BFIA 3D2TA 2ENPA 4DQOH 5JW3H 3D4YA 4FFYA 3I75B 4WFHD 1RULL 1S7RA 5DYOA 1T1WA 3LQZA 3LNEA 4CBZA 2AXHA 4HX1A 1IT9L 1GY1A 3M8OL 4YXHL 5T1LA 2GBVA 3Q48A 3HPJA 4WTZA 1XZ0A 2K3HA 5DJ0A 3RLSA 5J57B 2IAMB 32C2A 3VFSA 2AKRB 4P4KC 1FL5B 4IRZH 5D2LA 2NUTA 3QDJD 5CCKH 1YMHA 2ITDA 3S5LA 1W8EA 2C4FT 2B59A 4QRPE 5DGQA 3DBXB 2R9HC 1SJHB 4JW3A 2H3NA 4YE4L 3SDDA 3TCTA 5F6IB 1S9XB 3MZTA 4YSCA 4HLZH 3C08H 1KCSH 4I89A 2G60H 2JKWA 3RA7L 1FV1A 4EZJA 2ZCLH 4ATTA 3LH2H 2O1AA 1KMGA 1S7QB 1U3ZA 1IU1A 5I0DA 3BKCL 3L5WB 1TCRA 5FKPA 1JIBA 4KMLB 5T1LD 4JN2B 1AKJA 1OGAE 4XMTA 3RTQA 4JL1A 4TMPA 4AZ8B 5BRZB 3RL2A 1NWOA 2E47A 3BT2L 4J8RB 2UZPA 2AJYH 5IFHH 2YGOA 1T20A 2BHFA 1U93A 2VDLL 1FVCB 2QT6A 2HJLA 3BJLA 1FYHB 3MVSA 4KV5E 4HJUA 3L1GA 5J56B 2NY1D 5D1QE 1GMIA 2IMMA 3BC9A 4L1LA 5TGBA 3QDHA 1FZKA 1QLFB 1RZIB 4BRVA 4HIXH 3CFJA 4MNHB 5HI5D 1XCTB 5DJ0B 1Z9SB 4XHJC 3W11C 4JUSA 4MYPA 5IB3A 5B1AB 3QQ9C 2L7UA 4LFHD 1E7VA 4FKHA 2WM0A 1J5OL 4E2OA 2ROXA 2NQCA 4N2EA 2GY7B 5FDWA 2ENYA 4Y0GA 4J4PD 3OZ9H 1VA9A 4O2EB 1EHAA 5CGBA 4IYKA 4NUMA 5T3XE 1NFIB 1GYUA 4JPKL 2WWNA 2ZT9C 4UQDA 1F11A 3FFDA 4JQVC 4XCFL 3HW7A 1L9RA 1LILA 1Z3GH 1QRKA 4G1MB 1J5IA 3JBG7 4G8GA 4K94H 1X44A 4X5RA 1U8PA 2BCKB 3F7KA 3IDJA 4GXUM 4JO5A 4K7PX 5H8DA 3SJVA 1TUPA 1U8MA 2PPEA 3NPSC 5FEBA 1W0WA 4GO6B 4ETYA 1QSZA 1ACCA 4XB7A 1OSPL 3ZKNC 2XXMB 1KCRL 4E0RA 3T71A 5BS0E 1JGDB 5HGAA 3ESPA 1J48A 3S88H 4ZQKA 2ZF9A 5M94B 5I26A 4G6AD 1NCOA 4JNXA 2HKFL 3IT8D 1WEJH 4GFXA 3A4AA 4X7SL 5GZND 3GMOA 4J3SA 1T6WA 2DLFL 5ICUA 4Q58C 1UUNA 3NZUA 3OAWA 2DWTA 3B9KB 2ZXBA 1KEMH 1A5FH 4U3SA 1I9IH 4TTGA 3I74A 5DZPA 1YMMB 3S35L 3U1PA 4JFUA 4K23L 1CFTB 2YOCA 4LEOA 4NN6B 1RZQA 5DZNA 1CK0H 1LDPH 3C12A 3DPDA 3H2PA 4NX0A 5E6RB 5F3FA 4OZFA 3GUTB 1J10A 5GRYA 5F7MC 2UXVA 4UIKH 1EH9A 3BVDB 2HH0L 1MHHA 4ZS7H 4AXWA 4QF1B 5LAXA 5FO7A 2Y07H 1EFXA 4UT7H 2JXMA 3BP4B 4OQTA 5EV7A 4JO3L 4RCAA 3UO1L 2EE9A 5IEKA 2B7DT 1DBML 4K94L 3MLPA 2YFOA 4TVPE 3DPBA 1YEJH 1JNNH 2GCYA 3O2DH 5DCCA 4JFHE 1EGJH 2MEJB 4Y5XC 1D6VH 5E8DL 3ILDA 4X4ZA 4DERA 5C0AD 2Z8SA 4HCFA 5F9WB 2EDRA 5E1AB 5F7DA 4AKOA 4F2MA 3E8VA 4F9LA 2H6OA 2QTEA 2WINB 4L8CA 3MRRB 1EO5A 4WI0A 4M4PA 1U8MB 1I7RA 1L9TA 3RU8L 1OTUC 1U8QB 2CDEB 3A6BL 3WY4A 1OHQA 3HHMA 3QO1B 5KUKA 1L0PA 5DDHA 4OZHA 3FT2B 4H8PA 3NSDA 5KS9B 3GJFA 1UOLA 3N44B 5J5EA 3RZCB 3IS1X 3CVHB 3P9WB 5KS9E 3HBQA 5TQ2H 2OSWA 3EJQA 1DVYA 2HRGA 4NQEB 3IDIB 1XHHA 2EXYD 5AZ2L 1JK8B 5LVEA 1SM3L 2DY2A 3LKSA 2J1XA 5B39G 1AGCB 1ORSB 1NEZA 2CXGA 4PWKA 1NDTA 1CGUA 2CLRB 3VXSE 2O5XL 2VMDA 2WLJA 3H0TB 3IN0A 2VDRL 3QNYA 3U36B 1QFWI 3V9EA 2CE6A 3WNPA 2X4PA 4POZD 3HS9A 1H5BC 3QIUB 3DXAD 3QXDB 2WWKT 1S9YA 3HC0A 1OSPH 5CEZH 1HXMA 4KGLA 1NFDB 4RNRB 1TTCA 3LQAH 1XX9C 2D3VA 3UG3A 1VFBA 3KWVA 3RWIB 5D72L 3DETD 4TLTA 3BRGC 3L5HA 4FNLL 3BP5A 4PJIF 3O8XC 4B5ZA 1QHPA 4RAUA 4OZFH 5D1ZD 4PSPA 4QKXB 4RGMB 5DI8A 2A74A 4APXA 2GI7A 2OXHA 1CUOA 5L7XH 1TYEB 4UT9A 2VDLB 4X9YA 1XGRB 4BBWA 1NCGA 2NNCA 1VENA 1SOKA 2FYYB 3UTQA 1GW0A 1S9VB 2DM3A 2BHYA 2F8OA 1I9RH 4WW1A 4KV5F 4J3OC 4XP1L 1EX0A 1L9QA 1MFAL 4UV4H 2N4IA 4YSTA 1CQYA 3VFTB 5BUGA 3GI9H 3MLSH 5KSVB 1OARH 3PNRB 3QRFM 4JFEE 3NTCL 3KYMA 4NQXB 4XVTL 5ACZA 3FU9A 4POYA 4ODUB 3X3FH 3U0PA 2Z8VC 1KN4H 2NNAB 1O6SB 1VCBC 4LVHB 1CFVH 4Y9FA 5IF0B 2VDMH 4X8JA 3QQ4B 4I87A 4OQTH 4TLUA 4YUEL 5T3ZH 2E4FA 2YZ1A 3O6KL 3U9PL 2GJPA 4WGKA 1V7ML 3STZA 1IGYB 1PX8A 1LO4L 4JLRA 4I4WB 2DICA 2N1TE 4PB0L 2X2HA 3WE6A 4XTRD 1MOEA 3N44F 3IVKB 3HI5L 4XMKL 1JWUA 1OT4A 1U4EA 3QAQA 1UZ6E 3RX7A 1JWMA 5L4IA 4HUCA 3LXAA 5IQ9A 2GSGB 4J27A 3ETBF 2V3EA 4L8SB 2XETA 1DO5A 4TQHA 3S36H 3HR5A 2E7MA 3FFOA 5FYKE 2X4UA 2FHCA 3V4PB 2BY2A 3D0LB 4QMEA 4IOFC 5E1GA 2NZIA 3UJTL 1BBDH 1RHHA 1OHZA 4XVSL 2WNWA 2E27L 4UQ2B 1FN4B 2FX7L 5H37G 1U6AH 1J1OH 2L4OA 3ORJA 1HQ4A 2V17H 1OM3L 3ARGA 3LRMA 4GSQA 1LP9B 4AJYV 1NDGA 3RKDC 2E6JA 5DRWB 3Q06A 2ZTBA 4MB5A 1XGPA 5IVNA 2FECL 1SXNA 1L9MA 2DQTH 4AQOA 3PFUA 4TSCH 3QUZC 1K8DB 1TJGH 2W0KA 4BHUI 2YC1B 1X4ZA 2GFBA 1GCFA 1OARL 1NLDL 3JUYA 4JKMA 4PJ9B 5FUZL 2J56A 3OC8A 1E5YA 4MNGE 3PWPA 4NWUL 1CBVH 4UDUB 5IW6B 4BYHA 5FKAB 1FL3B 2QHRH 1YUHA 4ABVA 3IAPA 1UA6L 3RVTD 4JHBA 3MV11 5T8IA 4IMKC 1ETA1 5E8NA 2TRYA 4JFFA 5JOFB 1T66C 2R0WL 3P0YH 4Z76A 5DRXB 1ZLUK 3W2DH 1MKFA 2FGWL 3U30B 4JM2F 4K7PY 5IVXA 2WLYA 3A23A 3N40P 4FQIL 4CVUA 1KGYE 1O0VA 2EKSB 2BNQE 3EJYD 3ZY7A 5FXCH 3HNVH 1IIIA 3BSZL 3WO4C 3DX3A 3GRWH 2CPUA 4TQIA 2WANA 1CIUA 3Q1SH 3S8WA 3CLFH 3FMGL 4K4KA 5DJ8A 5IMLA 3HC3L 3F00A 1PLGH 3EHBB 4DGVH 3TIEA 2BVOB 5ANMA 5C0IA 2BIPA 3VTMA 1CF8L 2D31B 1KBGH 3OZKA 2IBZY 1CPUA 4PHXA 3EO9H 4XMPL 3TWCL 2VSDA 3II3A 1T0OA 4MHHI 3IFLH 5C3TA 2PP9A 4GI6A 4MA1C 2ZOWA 3MRMB 4N22A 1UWEH 4KVNH 2IANE 1HDMA 4AJVA 1G0DA 3V4UH 5DC4B 4CBPA 1DSFH 2R56L 4KROB 4UTBH 5JNYA 5MEPA 2WTOA 2K4AA 1CZ8H 1WZMA 3C9NA 2IAAC 3EOYG 3OL2A 4XC1H 5LNGA 4G2AA 4LOUC 3MV9A 4PV8A 1Z5LA 4M3HA 1UT1A 2FAUA 4H8HA 2GITB 2A1WH 4B9PA 3LKOB 3C60A 4F9LC 1NCCH 4DWHA 4DKFH 5DSCB 1OM9A 5F0MB 1A1NA 4LSVH 3DURB 4TUKL 3OM3B 2XN2A 3ZRCC 4Q6KA 35C8L 3KLHD 4EKJA 1F4YL 4XNMB 1YY9C 3AWGA 3KYKL 1EHLH 2APWA 2JSFA 1SFHA 3BAYA 1NSNL 4OCMC 1IEBA 2H8PB 4U1JA 3FT3B 1L5GB 4J3UA 4Y9GA 3DROA 4RGOL 4R5VA 4IOSA 4MJ5B 2ZSWB 3ARTA 3AFLA 4LIQH 5L2KD 3SKJH 3RY6A 3S9DB 5IROD 1FPTL 4PYGA 2PXYD 3AXLA 2DWSA 3MV7B 3V7MA 3UTTA 3CC5A 3FQNA 4CGUB 4PGCB 2CBTA 4YSPA 4Q8BA 2BIMA 3FQXB 3WJJC 3BWUC 1GHFH 3T0VA 3S8FB 1GZPB 3TZVD 1HEZB 5DS8A 3U7WH 3NJGA 3EYUH 3S88L 3WTUA 4GG6A 2JQZA 1C5CH 1X5YA 4YSDA 5K1JA 4G43B 4AQ8C 3IGAB 1QOKA 1LP9A 3EDFA 1WISA 1ETZA 5E8DH 2ZWZA 4DO5A 5DD1H 5LXGL 3TWCH 4QHNB 1OZTG 4PREB 4YHOH 3FO0H 1BJ8A 1X7SA 3SPCA 4GYBA 4ZTPL 2JLLA 4LSTH 2XQYG 2XXFA 2Z35A 4P5RA 4Q4EA 4HUXB 5ADOL 2XUWA 3IM1A 3WDHA 2UXGA 3UPCA 2ZWKA 3TBYA 3QUXB 3BYYA 5HHQA 1BQKA 3ABLB 4Z77B 1DCLA 4KNSA 1SEBA 5DUML 2AABL 1EEYA 2WBJD 3LHPL 4IQHA 3TBWB 3NSYA 3WO3B 3FUMA 1L3NA 1EO8L 2NX5A 2QADC 5JQHC 5DVOA 4ZD3L 3U2JA 2V8LA 2ORBH 5TDPB 3RL2B 2VL5A 4BQ9A 2EVJA 2H32A 3CLWA 3GMQB 4ZPTB 4XCYB 3NCBB 1G6RH 4JG1H 5E94B 5MEOB 5ISZD 1YDPA 2XXGA 3B56A 4IOIA 3N41F 3M1BA 4Q6IC 1RVFL 4LKCB 2VXTH 1VFAA 3GSVB 3C8KA 3Q8CA 1BPLB 3STBA 2VN7A 5E08H 3PWLA 3LKPB 1HHHA 3HNSL 1MQKL 2FEEL 1L9NA 2WIIB 1BZOA 2ZXCA 4F8TA 2EXTA 1SUJA 5HI3D 2ADIA 5FO8A 2AEWA 1X5LA 2YLKA 1G5GA 1W16A 1Z9LA 3QYMA 3ATAA 3QULB 5AAMA 4OLXL 4QUOA 4TQEL 2HRPL 3PIQA 3BP6A 4GRMB 4XOEA 4ZSOA 4YJZL 5HY9B 4ZNCD 4MJHA 3KZ8A 4OCSL 4JE0A 1YVLA 3C08L 1WZAA 1XH3A 1T7VA 4BSWA 2WUCH 3CHPA 3SDDC 2OMUA 4PSRA 1SHXA 3OLGA 4EVNA 2WLLA 5DUBB 2V2XB 1B88A 3MN8A 3S3DB 3BIKB 4F15C 5I6OA 2A77H 3PPEA 1KYOK 4F8OA 2NY3C 3GT6A 2Z93A 4DEPC 5A7EA 4BWUA 2NUTB 1QW8A 5EU5A 3DOIA 3EO0A 4JKWA 3T3MF 2X3CA 4G7YL 4G71B 5DEJA 4AZUA 3QR2A 5ICYA 5I6XC 4IOIB 3CX5K 4WJG3 3MJ7A 1V7MH 3CPUA 5E7FA 1BG1A 2PN5A 4JFSA 4X5QA 4BGLA 4Y9EA 2OCCB 1H3XA 3NJHA 4HDIA 3QUKA 4DVRH 5IB5A 5AVUB 1WBXB 2C9UA 1XDTT 4YC2B 3NQIA 4AENB 4HKBA 2V5TA 1Z5YD 2ZOKB 4LCCB 3CV5A 3D4GA 4XCNB 3U46A 1GH7A 3UC0H 1XEDA 3QZPA 1EJFA 5CLTA 5B1KA 3VM5A 1O7SA 5BRZE 1JCKA 4PGBB 2YMXH 3T5WA 2VDML 3T6QC 1KPRB 3U2SB 3L4ZA 2G3MA 4L8DB 3ARPA 3P3TA 2VXTL 3DGGB 2DQFB 3ARRA 4PLOB 3HMXA 2D2CC 4U1LB 1BXUA 1C8QA 2ARWA 2FR4B 1NIFA 2ADJA 2KI6A 2P46B 4P46D 3JTSA 1TSHA 1KWKA 3MLWL 4JQXA 2YKKA 2DQGH 4JX0A 3NCXA 2QVKA 5MENE 5E8PB 1T80A 1QLRA 5AB1A 1EO8H 4FOMA 4JFEA 1WHPA 43CAA 2Z93B 3EJPA 3HHSA 5F7KC 3GBML 4YDZA 3U4EA 1HHIA 2VC2L 5JDJA 3FFCE 1IARB 3LXUX 4M1CC 5D2NE 1PD6A 2AS5M 1ZT7A 1BAFH 3I2CH 4JKPL 2MQGA 1AP2B 1Q72L 3RGVB 2PETA 5DDHB 1AZRA 3EJSA 3H3KA 4XPHH 5CJXC 3DLQR 1MAML 3ZT7A 5I6PA 3VFPA 2VZ1A 3DO7B 2Z31B 1HWHB 3AAZA 5FYKH 4AGNA 3WKPA 3AM8C 3K8KA 5FYJU 3VXOA 4Y19A 4QO1B 5BUPA 3PGFH 4BFOA 5D4JA 1ICTA 1KIRA 4NWTH 5D9SB 3HG5A 4PS3A 3SJVB 1O7DC 2BZDA 5HPMA 4FG2A 3ZHNA 2YAOA 4ZX5A 3HLKA 1FNLA 1FAKT 2EDEA 5M95B 1IBGL 1IC5H 1LO5A 1SJMA 4DPBX 2NSQA 1OT1A 4N0FA 1HH9A 4UIMB 3MRNA 3P30L 3EYSL 5HVHC 4PBDA 2A74B 1RSFA 1G7MA 1F6LL 4E9TA 5E9DE 4F7TB 3C5ZB 4U3SB 4M56A 3P54A 4J39A 5IK3A 4FXTA 43CAB 1A7OL 3MLUL 3WJLA 4DUWA 2FX8H 3PWNA 4FQCL 4R7XA 5C9JA 2IPKB 3HG4A 4P5KA 4XNYH 3GFUA 1A21A 4XBPA 2IFFL 4DP4X 5AB0A 4OAWB 4M6NL 2DBLL 2GW5A 3WMPA 3HZVA 3WLWC 4YGAB 4DSYA 3UMTA 2W65B 1H5BB 4AM0Q 2YPLA 2XTSA 2JB6A 5B1JA 3BD5A 4DZ8A 3BUBA 1KDIA 4GBXC 5EEXA 2MFNA 3L3DB 3W5MA 3AMKA 3OHMB 1OP5K 4LRNH 4H5SB 3RUGE 3GZOA 2X0VA 2F5BH 1A9VA 1NOLA 1EHNA 4Y19B 2OZNA 2G9HA 3ZL2A 5J11B 1FYTB 3PWVA 4W4OC 2A9NH 3UJIL 4JDZA 2EC8A 3U2IA 1MCCA 3K6NA 4M5SA 3BZDA 4ZUWA 4GFTB 1Z9NA 4UOW1 1MI5B 2B5IC 2YQBA 5K9KB 1S7QA 4Q9BA 1KTDA 3SBQA 1JL8A 2KLTA 2NY4B 4Y8DC 3FCTA 4CN6A 1PFOA 2DQDL 5AL8A 4N1EA 2BDNL 2OM5A 1WAAA 4GQQA 1T7ZA 1N4XH 3D18A 2I69A 3W9EA 3CLFL 3FMGH 3HZKA 3C8DA 1KG0B 3LPGA 4NRXB 5LBSH 3UCQA 4Y4FA 5D7SL 4NFCA 4BA8A 4MFHA 3QQDA 3I9GH 1H5BA 2P80D 2VDMB 2W65A 5H35A 1O9ZA 3HZMA 1KJMB 1DVFB 1HXYA 4IHBA 1ZT1A 4JPKH 5KVGL 2OXGA 4PJFB 4WUUD 5GQBA 1DQMH 3UTSA 4ZUSA 3R0NA 4L1BA 1TQTA 3MRHA 4ONOA 4PLJD 1UA7A 5B38B 3DX2A 5HHOA 1A3ZA 1HEHC 1SDYA 2EO7A 1PX4A 3QEUB 4OM1L 4E9SA 1B2YA 4Z7UF 3UL4A 5F7NC 4URKA 2UYLA 4QGYA 4X2UA 2WZPA 4YVNA 3HG1B 4OT1L 3NPSB 2AJYL 4U1KB 3W0WA 5I1HH 3BN9D 3LNGA 3LOWA 4HG4J 3GBNH 2YAEA 4PBWD 4UDUA 5IW6A 4HFWA 1T83C 4OTXL 4Y1AB 5JPNA 2RCSH 5GRJH 3HNTH 2CO4A 3MLRL 1ZK5A 4HP5A 4NPJA 4XNZC 2C7UB 3DUSA 4MDJB 4L1TA 4JRXD 1EXGA 1NMCB 3QXWA 3B3IB 3WNIA 4BM7A 4ZW3A 3PL6B 4IRSB 3JT0A 1U6AL 3ARDC 4G9FD 3RWEA 2BSDA 4Z76B 3LIZA 3MLTA 4LQFL 4N2BA 3NN8A 1T22A 5AW4B 3KYOA 2R2HB 3WKNA 2ZOUA 4C4KT 5A2KH 2NCMA 2YD0A 2H3NB 3E9UA 2BVYA 1OGAA 3O9WA 1TFHA 1ZVHA 2X4QA 4EUPG 4ODTL 4FMVA 4NCDA 5BO0D 5K59F 2AQTA 4IEFB 3EYOA 4Z3GA 1CJYA 2VR4A 5I1EH 1N9PA 5HHXH 2AXFB 5C6TL 2BNQA 3KPSD 2EE2A 2W9EL 1ES0A 3M8OH 4YXHH 2AJZB 2Y72A 1A3RL 1BBJB 4P59L 4BWWA 4TLKA 5F3BA 1LTXA 2K9FB 3EF4A 3QFJB 4MQSB 5AKTA 3VDAA 3PABB 1WLHA 1N2RA 1PZ5B 1ASQA 1UVQA 3JWNE 5B21A 1FJ1B 4HPYL 1Q9OB 3BKYL 4YWGH 5B1JC 5ILTL 4BH8B 2MPVA 1UD6A 2A83B 2ESVA 5E5RB 4QRSB 4AQEA 2IAMC 1ZVSB 3DHMA 2ZX6A 3THML 3ZR5A 1AJ7H 3HNTL 1E9OB 1UCTA 3E38A 5GGRY 3SE4A 1KCUL 5CF3A 4K7FB 5JPNB 3ZQXA 5KEZA 3BPCA 3F5WA 1XBDA 2CIKA 3CN4A 1SEQL 2D0HA 3MJ9H 4PTTB 1KJ2H 5CMAA 2XHNA 4F33B 3OTTA 2NX5E 4OZ4A 2CK0L 1NCBL 1YZZA 5F0JB 3O8XD 3VCLB 3ZHFA 5JIHA 4WI7A 2GJZB 4P3CL 2Z7YA 3S8GB 1ZA6A 5AFAA 2ZP8A 2HJKA 4KXCA 5F21B 3Q0HA 2JI3A 2BSED 4H44C 5K39B 1QYGH 3N55A 5K9OA 1J05B 1OTTC 4ZFGL 1KUMA 4GUCA 4E9VA 1DQML 2BC4B 4OCSH 5E99H 1Q38A 2LFEA 4MAYC 3UC2A 4ZXBB 3FRUB 5CSZB 4P2RA 9PCYA 5F1NA 2EDMA 1YEJL 4FQ1H 3T3PB 2CG9X 2VZVA 2YKLL 3E8UL 3GHPA 5GJTH 5HJBA 2H2SD 1NICA 2FLBT 3T1WA 4NO2A 4Q2ZA 3ZE2F 5ABAA 1D9KD 3VU2A 4XO3A 3TWYA 5HPOA 2FATH 3WNNA 1F1GA 1BQ5A 2FBOJ 2WZ6A 3QUMH 1QASA 1F86A 3ROLA 1CD1B 3KJ6H 2YEQA 3QIBB 4OJYA 4KUZL 4AY0A 3CQFA 1WUZA 3OKYA 4FTVD 3Q2WA 2D0GA 1O9VA 3HTLX 4J4PC 3AS0A 5K5YA 2OZ4A 5E6YA 4CDHA 1CE6A 1WUNT 5KSVA 4X5WB 3BAXA 5G2NA 2JJSA 2EC9T 3RU8H 5AW7B 4RMSA 25C8L 3CZLA 4X4KA 4WUKH 3BVNB 3GINA 1NPUA 5HI5C 32C2B 1U95A 1AG6A 3B7YA 4NCC2 1PLBA 2IQAA 1N6VA 4JPWL 5CSZA 4J1UB 3LKOA 2AI0L 4YHOL 2WGNB 3RBGA 1SMDA 1SN0A 1KXQE 2HSIA 2K0RA 4JM2A 1JD9A 4QJ5B 5K93A 3VXRA 3KS0H 3O3EB 4AI7A 4L3AA 1EVTC 5AW5B 3NOIA 1L7TH 4NENA 2VR3A 3B9KC 1R5IB 1YY9D 4H8WH 2XACC 5AOZA 3RX5A 4Z3FA 4DUXA 3IMRA 3LPPA 2E9WA 4HULB 3MRIB 1XB8A 1J0KA 3S48A 1FLTX 1P84J 1HU8A 3MBEA 5T1KD 4N1CA 5ABZA 3DJRA 4HIIA 5HYSG 1UWGL 5DU7A 1MFEL 4WW2F 2E9JA 2AJZA 3DECA 5AQ0A 5LHDA 2EKJA 2LQRA 3HCVA 4AKPA 5AVSB 1N7ML 4JN2A 4NWTL 3FFCA 5D2NA 5AW2B 3AMLA 2HRLA 1FNSH 1QBLL 1HCVA 1QSFD 4PJDF 2YXMA 3BAEH 3F7VA 3CFJB 4MNHA 3P77B 1LEIB 2IDUA 4KKNA 2PCFA 2WQAA 3BPLB 1Z9SA 1KNOA 4ODHL 3QDMA 3EZ8A 2HJFB 2AI0H 3SGEI 3L3KA 4L8CB 1XF2B 5E8EA 1QLFA 1RZIA 1WFJA 3NIGB 1QFHA 1ZD6A 4XCCL 4ZMXA 4NDMA 2PYEB 3GGWA 2LU3A 2LHAA 3EOTL 2FE0A 2IV9A 3V9FA 4YFEA 3LN5A 1U8LB 1E8WA 3X13B 2NSMA 5F88A 5I15H 1NCUA 4RMTA 4AVJA 3OKEA 3IFNL 4H26A 3DWTA 4D0BB 3SDCC 3Q8FA 2FWUA 4HUNB 1UZ8B 2APSA 1CZ8L 4QT5A 4BCYA 5DTFA 3HNSH 1XF5B 1MHPL 4NFBA 5IJBC 2GBTA 4N6RB 4FN0A 3D85A 4NQED 2P1YA 3EXLA 3BWZA 3QG7H 4ELKA 5FHBL 4Q0XL 2DEWX 1HXMB 2DQ6A 2R2CA 2YD9A 3D39D 3EO9L 4RNRA 4XMPH 2YXFA 2JCWA 3QWRD 4YL4A 4DEPB 5EEZA 2DQFA 1CF8H 3A6CL 4GRLD 1L9OA 3AADB 5AOJA 1OF2A 4UQCA 6PCYA 5CD3B 4XVUD 5HGBA 5ERWB 3ZDYF 1F18A 4GQZA 1QHOA 3JWNC 2UY7B 1RK0B 2GJ6E 2HRHA 5FF6A 1JGDA 4V2BA 3ALPA 3HNVL 1BCIA 2OR9L 1NAMB 3ARBB 2E27H 2BMKA 2EXWC 2R0LL 1CI5A 1HL4A 1ZS8A 1PIFA 3EOTH 5B3JF 3MLRH 4IBUA 3ZYIA 4MX7B 4W6WB 4LCYB 4TL5A 5DYOB 4CSZA 5EG6C 4L48A 2KZBA 4ES8A 4GRMA 2DEYX 5E4EC 3ZE2E 1ZTXH 4MCZB 1A14L 1MLCB 1DE4B 1OE2A 3GPEA 1UOKA 3AQZA 4HQQL 4PPTA 5JR1H 4NO0D 2XWCA 5EFIB 5IEKB 4X6DE 3GSXA 3ETBJ 4P9MH 5LAXB 2F53E 1M6UA 2HWZL 2MRYA 2D3JA 2JK5A 2XVKA 2GTZA 3ZX1A 1Y6NR 4PJCF 4ZBJA 2B59B 2RH0A 2VLRD 4OI8A 5DD0H 3L3GA 3B2PA 1N8OE 1S7WB 3A24A 2PCYA 5DLML 1DQVA 1N6UA 4Z78A 3ZTCC 4AYID 3IGLA 1ZMYA 2WKLA 3Q6GL 2EE6A 2VZOA 3FT1A 2QR0B 3TYGH 4PJDA 2CH8A 2VAAA 4Y5VC 1N6QL 3CVHA 4GSXA 3RX9A 4MWFB 3QJUB 3FN0H 1HKLH 2PO6A 3HJEA 3UGXA 4XN5A 3GEWB 3SBWC 3HR5B 1INQA 1SHMA 1E3FA 4O02L 1NBYB 1TO4A 6FABH 1PJWA 1OB1B 3IJEB 4LKXB 3F7PC 4L8DA 4WU5A 4MCZA 1UWYA 2HUEA 1LE5A 3CN3A 2AQ3A 2XLLA 1DQDL 3JTSB 2LE9A 2VXUH 4ODSL 2VSKB 3T6VA 5DRWA 2AEIT 4BXVA 1AHWC 3PWUA 2AABH 5ETUB 3TH3T 3VWJA 1M3JA 1S7UB 2O72A 1UWGH 1AFVH 3AITA 2HFFB 2OSLA 1Q8MA 1M1XA 1U3YA 2GYSA 2IXQB 1A6WH 3C5ZC 5GRJL 4G3YL 4N5ED 3FXIC 3SY6A 3X12B 1YAIA 3FRPG 4JO1H 2JTDA 2VE6A 1JGVH 5CZRA 2HVKB 2O26U 1OCRB 4NHUA 4DF9A 4XBGB 4NT6B 3KYMB 4LCWD 3U6RA 1IFRA 2E76C 4WV1C 3C2AL 4G8IB 3ZKMC 2IFFH 4X42A 3HS0B 2HFGH 1A4AA 3NCJL 4MJ2A 4ORGA 5MHSE 4H1LA 5KBDA 5JOFA 3H6AA 1WCBA 3IEAA 2R4SL 4AV5A 3A4DA 1E9PA 2EAEA 2CU9A 3MA7A 1QWHA 5EO0B 3LZNA 4MB1A 4NRXA 1JGLL 2XU9A 3M1BB 4AGQA 1O6VA 1VGEL 1EZVY 5TQ0L 5KBMA 1UTDA 3GMPA 2R2BB 5D7JC 4V2CB 3P69A 4Z0XA 5GIRA 3QIWA 4Z7OB 4Q9RH 1BWMA 5D93B 5TE7L 5E4IA 2ALWA 4ANUA 3SPHA 4L2LA 2B5IB 5ECGA 4ZMQA 2MQ3A 3OGOE 1J5CA 2YSTA 3OKLB 3UZQB 3LS5L 4UIKL 4H40A 4MA1B 5AWNL 2D03H 1BD2E 2E9BA 1DBKH 2VZUA 3MJ9L 2Q2EB 5B4MC 4POZC 4GUPA 1NEPA 3ZR6A 5HHPA 5TGBB 1NCCL 5D70L 2DQEH 3QEQD 3QUYA 4X8XA 3VH8B 4DZ8B 4E9XA 5I6XB 5FW6A 4C54A 1KENL 4WUUE 3U6RB 2WLLB 5I30L 3CSTA 1Z5LB 1TJMA 3PHQA 4Y4HD 5DXWA 2XN9A 4JHAL 1MH5B 5KVGE 4X7TB 4WI3A 5E0FA 3VD7A 1KN2H 3B3IA 1WIPA 1TJIL 1BQHG 2P5ED 1G94A 4LCCC 1P6WA 5TQ0H 3FB8A 3QEHA 4PRHA 4TOYL 1VESA 4UTBA 4J28A 4WI6A 3VI4A 3NFPA 4ERSH 1VZGA 1Z0MA 2BP3A 2XOTA 1AQKH 3ZTNH 3ARSA 5JHAA 4HDIB 3VFRB 5EDXA 1KY7A 3R0MA 1RI8A 3RG1C 2OJZL 4C4BA 2P8MA 3B7RL 3ATFA 3FTVA 4LL1A 3U9WA 5K9KA 4WO0A 2WXHA 3BQUA 3KPQB 1R1CA 2DDQL 3T65B 1CG9B 3UXFA 4MNGA 4HU8A 1QUNA 3O2VH 3QC6X 1JDDA 4N2DA 3WV0A 4A55A 4QRRA 1T5WB 3QZWG 4FL4B 1EPFA 2PP7A 5C7ZA 1VRSA 3D9AL 2E8ZA 4LSPH 3DGGA 3NJXA 4IJTA 2Z1KA 4JANA 4MA7H 3NSFA 1N5AA 1ZHNB 1QSEA 3TJHC 1XGQB 4FJZA 3TEZA 4JDEB 3DOSB 1EJ6A 1DVXA 3G5VA 1MREL 4XWGH 1N3NA 4UZSA 2Y1ZA 3NZSA 1AGFA 1CGWA 1AXTL 4LHUB 5H35B 3SPVB 4DKAA 3GMOB 5EEWA 3BH8A 4TULH 1NGXB 5E2JA 1NL0H 3QPXL 2DMCA 3L7EB 3PHQB 3VFUB 5MENA 4N0RA 4O5LL 2K45A 4YDKH 2ZPKL 2BLFA 3QJQB 3EJYC 3SPJA 2UZYB 4ODXB 1ZGLA 3FTGA 1WV7T 5LWYH 4ZFQA 5ITFA 2FQFA 4GJTB 2WXNA 2WLIB 3QUZA 2VRQA 2IXQA 3D8MA 4MTMA 5J1AA 3KPSE 4ODBD 2A9BA 5IVXF 2CHNA 2AP2A 4HEMA 4PJ5D 2KMWA 5FIEA 5KAQG 4OLXH 2X12A 5JHLH 2IPUK 2R4RL 4JB9H 3TT1L 2BNRA 4PV8B 1MCSA 3NCEB 1MFUA 4ENEC 4MXQD 3NGBB 2DI9A 2VL5B 3BHBA 1DSYA 1JE6A 2GTQA 1T0MB 5JPNC 3MLXL 4OD3H 1A6UH 4KTGA 2I9TA 1OZUA 5KYUA 2XJLA 1AACA 3FSVA 4JLRB 5GRZA 5IFJB 5C6PB 2GITA 5D1QC 3KEDA 1LK2B 4PV1C 4L29B 1JYXA 3WHXB 4AQ1C 4FQXD 3ILQC 4KAQH 5FFGA 5EEVA 3AWFA 1GPOH 3WN5B 1RZ8A 3O6FA 4HZLA 1Y7VA 4KOBA 5LCVL 3QORC 3AGVA 2CLRA 1MJUH 1W6WA 2XWTA 3PWNB 5AVYB 3LSOB 3KE0A 1DVQA 5SWZA 4KK8D 4AGPA 3FT9A 3EFOA 4ZXBC 4ZSOE 3BFWA 4PJAF 4PGCA 5DJXA 3ZTDC 1F2QA 3FQUA 5J11C 5HP5A 5HGHB 5L2JA 3UTPD 2E7BA 3KPNB 3MSPA 4K94C 4CADB 4KITB 4R6UA 1HH6B 1P4IH 3CC5B 3FQNB 3HVNA 3GZPA 3V6ZA 3LB6C 2WZ5A 1PZCA 2CHZA 1V10A 3BPOC 4U1HB 3LNFA 5KVEH 5INDA 4Q7DA 3FZUC 4I13B 3D87B 3KL5A 4QRFA 1DLHB 4N2OA 1KJVB 2E7CA 5K9JL 2Y5TB 1DVSA 3IWUA 2YC1A 3JYBA 3HKFA 3BZEA 2BRRH 4G5ZL 1QP1A 4OZ4B 4JO2H 1E5BA 1H3VA 1GGIL 4AH2A 2LLGA 1HQRA 1F4HA 4ISVB 4PJAB 3UFIA 4GG8A 1G6RL 5D7KE 1SLVA 4XNXL 3O6FB 3DV6B 4GRWE 1J0HA 1RK7A 1KLFB 1IEAB 5C0EB 2G4EA 4CNIA 2EIBA 3JV6A 2VAJA 2NCEA 4J3TA 1YEHH 3ZVVA 2X0UA 1MF2L 5LGHL 3BAJA 1PG7H 4PRPD 5IR1A 3VXUE 1P69B 1MQKH 1J8HE 4UWQB 2NR6C 5B8CA 1AKPA 1QHQA 3DX0A 3HZMB 4OLZH 3ECBB 1M9SA 4KJWD 4ODVH 5BUAA 2ZE0A 2QLYA 5IMLB 5AVQB 1AS7A 4WGWB 3BLKA 4IBLT 1T1YA 1AGDA 2X70B 3G08B 5ANMB 1EFQA 4NNPH 5ENWA 5AVVB 3S37X 3WDIA 3L3KB 5B38A 3NG5A 1CD1A 1VERA 3MTRA 4L3ED 1IQWH 3KVQA 5LCVA 1LD9B 2FIKA 5F9DC 2PPDA 4WWNA 4UU9B 4Y16D 5JORA 4QRAA 1NGQH 4N0CD 5AKSA 2Z9TA 1GC1C 1I1FB 3EXJA 3TPUB 1UA3A 3LQMA 3RVXD 2J88L 5AZEL 2VZ3A 1DVFD 3K91A 3MXWL 2P24A 3IJHA 3OR7A 5IBTH 1PIGA 1HCYA 4DESA 4GIOA 1OP9A 3AQXA 4NRZA 1ZIAA 1RJLB 1I8IB 1JPSH 1T5XB 1Q90A 2AZUA 4TVUA 3X1NA 3DGDA 4E9WA 5J0BA 3D2UD 4BQBA 5BS0D 3PJSB 4NI3A 2AQSA 1KZQA 3BPLC 1YYLH 4ZZFA 1E4XI 1IAKB 5PCYA 3MV8A 5GGRB 3K3QA 1PZDA 1OSZA 2NY4D 1RP9A 1I3VA 2W60A 2XICA 1EUUA 4U6XB 3UC0L 4FZEH 1U8KA 4QRQA 5E4OA 1JI1A 3W38A 2NYZA 1MCDA 2B14A 4UT6H 5AYTA 1TR7A 4M7JH 1NKRA 3ECWA 3FSOA 3EYOB 1Q72H 2AJSL 3OX8A 1IBHA 4OUUA 3FN9A 4GI9A 2ZCKL 4XT1C 1HXKA 1KY6A 4UQ3B 5C0NC 2W0FB 3D0LA 1YJDL 4PGBA 2OK0H 5EC1B 3WLBB 2MNUA 4KI5C 5CR8A 1X5HA 2QZ5A 3LAFA 3BD4A 1Q9OA 1FFPA 2YPLB 1KXTA 2XV6B 3CSFA 3G6DH 3P3YA