2RTTA

Solution structure of the chitin-binding domain of chi18ac from streptomyces coelicolor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
105
structure length
105
Chain Sequence
ATSATATFAKTSDWGTGFGGSWTVKNTGTTSLSSWTVEWDFPTGTKVTSAWDATVTNSGDHWTAKNVGWNGTLAPGASVSFGFNGSGPGSPSNCKLNGGSCDGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChiC
publication title Solution structure of the Chitin-binding domain of chitinase Chi18aC from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Hydrolase
total genus 12
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rttA00
1HEHC 1EXHA 1C7TA 1QBBA 2CWRA 1EXGA 1E5CA 1QBAA 3NDZE 1E5BA 2CZNA 2XBDA 3NDYE 1HEJC 1C7SA 5DHEA 2RTTA 1XBDA 5DHDA
chains in the Genus database with same CATH superfamily
3CZKA 4B5EA 3VWKC 4JR9L 3MUZ1 1NANI 4KKCD 5J13C 1L7IH 2K8QA 2NNAA 2NY3B 4ETYA 1ILUA 4IDLA 2J1ZA 1U8HB 1ZLEA 4LOUD 4QCIB 2CRZA 3VXUE 1KGWA 1E4HA 1O6SA 1UCBH 4R90H 1LP9B 3LKNB 2VSCA 3D30A 32C2A 3EGDA 3KXFB 4XC1H 3N91A 3RE0A 3S3CB 3BZDA 5F9DC 4HU2A 5FXCH 2YD9A 4M48L 3AGVA 4OZFG 3KYNA 4JRYA 2ZKHH 1KV3A 4S1SL 1R5VB 4R4NC 2MCMA 5IQ7H 1CXIA 3PQYD 4JANA 4KAQL 2FZ3A 3D3VB 1GGYA 3P40A 3ZKSD 2OMZA 1N18A 1TG8A 2JJTC 1NCWH 2WWKT 4UB0L 5ELIA 3GHBH 3VFVB 4PJGE 2ODHA 4KQ4L 1OXYA 5I0XA 1UVQA 1CLYH 1IQDA 1ZLUK 4NKIL 1UZ6F 4AX3A 4GRLD 4LVOC 1KTCA 1SM3L 3S3PA 1OHZA 2VDLH 3TBWA 4NJAL 4OIIH 4YR6A 3INOA 3C5ZD 1BZ8A 1R1CA 3U1SL 5I8CB 1AKJA 5EU4A 4D8PA 2VDOH 3PWPA 4J27A 2PO6B 2X4SB 4HC1L 4PYHA 2XN2A 3CC5B 1TVHB 4Z7QF 1CGTA 2W9EH 3O6FC 1QRND 1J8HD 4K71C 1S5HB 1MW1A 2N7BA 3C75A 4OF6A 5IHWA 4V1DD 1BQKA 2V2WB 1G0XA 2XYCA 4ZUUB 4FKEA 1UM5H 2CGRL 2DM3A 2FEEL 4KK9C 4OLEA 4TQ8A 1MJJB 2MOQA 4ZO6A 1IM3A 1M1XA 1A6TB 1R46A 4F37F 4HF5H 2NNAB 4WTWA 3DX8A 3BO8A 5BVPL 2D7MA 4YK4B 4ONGL 5CJXA 1O6SB 4KPHL 4QI3A 3I3DA 4L8SB 4BUQA 1NBVH 2X6BA 3MU3A 2ADYA 32C2B 3EXLA 2XFXB 5HI4D 3TO4B 3EXJA 3VX0A 4JHWH 3SGJC 5DTFA 4R2GB 2J57A 1DJGA 2EIKB 4BZ1H 1R3LA 3HAEH 4JRYB 4X98B 1KENL 1RI8A 1UD3A 3EOTH 3HE7D 4JBSA 5D7LA 2VE6A 4JANB 5IGXL 2FZ3B 1KGJA 2OMZB 3W0WA 1Z9MA 1DL7H 3MNVA 4L8BA 3OKLA 4POYA 2Y1VA 4NYLA 3ARED 5JMRA 5IHUL 1UVQB 4KHTL 1IQDB 4IRJD 1FNHA 5DF0A 4XBPA 5EC1A 5HVWA 1CFSB 1NUNB 2OS7A 4K15A 3MO1B 4N2HA 5LG1A 1AQKL 1P5VA 1ET7A 5F0PB 4A38A 1E4XH 3V0IA 3KM1A 4QF1B 5EU4B 1W8EA 5IEHA 3PWPB 1WUNT 2ID5A 5MHSE 1OHQA 3DV4A 2NY4C 5E5MB 3D25B 2JKRM 3GXUB 1JHTA 4KO7A 1QFUH 3UXFA 3ILQC 3TBYA 3MSPA 1ECZA 1RJLA 5KVEE 1NQBA 2X42A 2O61B 4MMXC 1P5UA 4XMKL 3ISYA 4P57A 3RL2A 3Q2WA 3HAEB 3R19A 2DOCA 4MMZA 1I1CA 4PWKA 4YSUA 4JLRB 1IM3B 1M1XB 4OM0L 2B39A 4K3HA 2OYPA 1HNFA 2GC7C 5AL0A 2ZUWA 2F61A 1AYOA 1RK7A 2X6CA 4MJ6A 3BO8B 1JZ4A 1W0WB 4QO1B 1RK0A 5LXGH 1XGQA 3I9AA 4QR7A 5LBSA 3ARBD 4N9GB 4KUZL 1NIEA 1B6DA 3ABGA 4UILL 5C3TA 1XB3A 2QPFA 1FNGA 4FFZA 4PRHA 1NC2B 2BP8A 1UUNA 2DQCL 3LN4B 4G5ZH 4N28A 3TV3H 1S3KH 4TTGA 3N1GC 5AVTB 2AJSL 2VE6B 1G9MH 4RFOL 2LR4A 2YQBA 4OZFA 2FH6A 4UT7L 3MNVB 3W0WB 3ZL4L 4DKEH 1C9SA 4DH2A 1YQ2A 1T1WA 2WCGA 4NUMA 2DTSA 3G7TA 4AEHH 3WHE1 2J55A 1V7NH 3ESVF 1BQHG 4P5RA 4ZXBC 1P5VB 4NN7C 5EEYA 5LCVL 4XXWA 1H5BB 2ATPA 5LVEA 5JZ7D 1D3CA 4Q9RH 3HBPA 2G2NA 3CPLA 3NFNA 4U3HA 3U0TA 2YC1A 3RZCA 1N6QH 1MHPL 2Y36L 5LNGA 1MH5A 3OF6A 4DN3L 4Q6YA 2RCSL 3OKMB 1NGWB 3ZKND 4Z0BL 1IGCL 4HCGA 1RZGA 1YNKH 3TBYB 2XWXA 2IMNA 4U05A 2EE3A 4OZIE 1RJLB 1DBJL 1WIPA 2XTLA 4IRZL 4KK5C 5HYJE 2O5XH 4NHUA 1HL8A 1JTOA 1P5UB 1WAPA 3IMVA 1WLHA 3GBDA 2J2ZA 3RL2B 4ZS7H 2Q7YA 2CNZA 4YE4L 3S97C 4YUEL 4A2FA 1A02N 3K6FA 5HI5C 2R29H 2YZ8A 3ETBJ 2JELH 4KMTH 4MJ6B 3PGDA 3FQRA 3KPRE 5DZLA 4Y5XB 2VO5A 1RK0B 5J8OA 3O6KH 1UB6A 3C12A 4M6NH 3MNWB 2GBVA 3PL6C 1O7VA 5T1MB 4RSYA 3T3PB 1L6ZA 3BVVA 5JHDA 1HZKA 1MWAA 1CI3M 2H0EA 3FK3A 3B2XA 4O51B 4CW1B 1X5HA 4PS7A 5JHLH 1WFOA 1RFDL 4CADB 3N0AA 2YUVA 4NZDA 2HTLD 4NFDA 5C6TL 1DSWA 1FG9C 4ZFOL 4U1SB 3TT3L 3ZR6A 3DVGA 4CU8A 1GYVA 4LEOA 3B5GA 4JG1H 4NZUL 3I2CL 4UV7L 3D7PA 3QDGA 2NQDA 1E30A 2ATPB 3NFNB 3RZCB 3U0TB 3UL4A 2YC1B 1XGYL 3WEXB 4AYEC 3ZTNH 2DM4A 4PJDA 1UXLA 3MBWB 3FXIC 3GMRA 5KBKA 4JQIA 2ZXGA 3GJFA 4NC2B 3GBML 4JW3A 5DJCA 1IC5L 3FFCA 3Q05A 3OLDA 4H40A 2QGEA 5BVJA 4F8PA 2Y3NA 1UATA 2Z1KA 4W6WB 2O5ZL 1F3JA 1SQMA 3BN9C 4I3RL 1CG9B 3UDWC 2XACC 3GDBA 2R69A 3BT2H 5I6NA 1T0MA 1LILA 2WUCL 4JN2A 1LDPL 2WWNA 1J86A 1MFCH 4KKCC 1IIIA 3TZVB 5IJKA 3PJSA 1IGTB 1WDAA 4L3ED 3FT2A 4CBZA 1V3LA 1DR9A 4KVCH 4LOUC 3PNWA 1UB6B 2L3BA 3N0PB 3VI4F 3CDZA 5EDXA 1CYWA 4WEEA 5JHDB 3WAJA 1H0DA 3BLBA 1T4KB 4I3SH 2APTA 4A1RA 3LH8A 4PBXA 2VM4A 3SO5A 2X4PB 1Z9OA 3HG1D 3MV7A 2BP5M 5D5MF 2X4NA 3IF1A 4O5LH 3SOBL 3V52L 1NOLA 2YPLE 4EVNA 2HCZX 3MMEA 4PJFA 3MRRB 3WIFB 1YECH 3GPSA 1G4RA 1JGDA 3D4ZA 2A9CA 2EYTB 3OHMB 1CU4L 3EDKA 4OCSH 4BKSC 4KTDH 4F9LA 5EBLB 3ZGIA 3OKNA 1B4TA 4LEOB 1FBIH 3QULA 1VGEL 4GRLC 1RIHL 3KPNB 3QDGB 3G08A 4DVBA 3GZOA 3C5ZC 4R4BB 4UZSA 1BQHA 1DUYA 2CQVA 5D8JH 4G8GD 4QHLA 3BKJH 1HEZA 1JPGB 3U2SB 1ZTXE 1OV8A 3OC5A 4RZCA 5CIPH 4N2OA 4YVNA 5GGQH 1XSKA 3VG0H 3B5HA 5IROD 4OAWA 4R97B 5IP4A 3X3GL 5BVJB 2ZKMX 2EINB 3ULAB 3RX9A 1XH0A 3O11A 1F3JB 4NO0A 3DTXB 3GKWL 1AR2A 4NQCD 2RD0A 4X9YA 3F12A 5EH1A 5T3ZL 5ALBL 1DSFL 4FXKA 3VDAA 2HUHA 1FNSL 3AFLA 3A0OA 3FQ1A 1NLBL 1Y18A 3S7GA 1CFBA 4LE8A 3LN5B 3PJSB 4GP5B 4GP8B 3FT2B 2W07A 3BRDA 4HSAC 3L4YA 4F8LA 4DOHE 4EZKA 1KJVB 3D18A 3PNWB 4AQ1B 2IFFL 3D2UA 1P6AB 4GO6B 4M9OA 1EHLL 2E4FA 3CDZB 1U2CA 2R4SH 5HI4C 1MCWM 1ROCA 3V4VH 3LD8C 3FTUA 1H0DB 3L16A 5GRUH 2RQEA 3NP3A 3ZYIA 3IDMB 1F4XL 1UGNA 1QFWM 3HE7C 3T0WA 2DEWX 2BVTA 3W9DA 3QNZB 5I66A 4MMYA 1CL7I 3MMEB 5AVQB 4EVNB 1J5OH 3UG4A 1JGDB 2PUQT 4AGLA 3QXAB 3AREC 1FFPB 1IE5A 3FB7A 2MPVA 3QQ9D 4G7VL 5F0MB 4IRJC 1B2WL 4Z3EA 1K4DA 2N56A 5ES4B 3G9VA 2K45A 5LKNA 3OJDB 3T0XA 2R0ZH 3FU8A 4J2XA 5FLVA 4HIHA 1YEFL 5IBUG 3COOA 5B1AB 3BVNB 2H6PA 5EN2A 2X0WA 5JYLA 1N59A 1DUYB 4QHLB 4NNXA 4XH2A 5T5FH 4P5TD 1IAII 4ODSH 3JWNG 4XX5A 4M4PA 5DRZA 4FABH 4RGNE 3UAJA 3MOAL 1DLHA 4OAWB 1QVOB 1G43A 2AK4D 5E00A 2ZOKA 3W2DL 3V4VB 3O11B 4NO0B 1XIWD 5E23A 2X89D 4BZ2A 1N4XL 3Q01A 4F7TA 4XP9L 4KXAA 3P9MA 4FXKB 3IAGC 2WC7A 3TYGH 4DK5A 1SBBA 5C0CA 1H8NA 1ZEAL 4W9LC 1I7RA 1JZEA 1W80A 4JGJA 3RNKA 3KLKA 4GW5A 3KNBA 4G7QB 5CHNA 1I9RL 3HB3B 1HHHA 3D2UB 5L6YH 4P5KA 1AC0A 3ARBC 5CFHA 1BF8A 2P80D 4LLMA 3IDUA 5BO1L 4YIQA 5C3IA 4X9BA 2X2UA 1NDMA 3Q2NA 3UTSE 3GTVA 2F1AA 3NIGF 4DUVA 3HG4A 2BSBA 1XL4A 1UXWA 4IJ3B 2H1PL 2QQQA 4HKXB 2XJLA 1G7LA 2RH0A 1R0AH 3F01A 4OI7A 3FUDA 3QJHA 2R1XA 3U6RA 4MMYB 3K71A 2OR9H 4J3XA 5F7LB 3QQNA 1F6LL 3LZNA 5J7CC 3EFOA 2KERA 3TA3B 1RU9H 2IFGA 4HGKC 1EO7A 4OLZL 1U6AH 2R2HB 3EKCA 4C54A 1TTAA 5GGSB 2OZNA 5JZ7C 3ES6A 1ZJBA 2AJVL 2XG5B 2B1AL 4OGYL 4NHCH 4MFHA 1TNMA 3G6AB 3ZKXC 1VFBA 3ZKNC 5AWNH 5IWLC 3UBXG 2HPOA 3CSYB 3VXMB 2FBJL 1PKOA 2WB7A 5E00B 3UYPA 3J07A 2O1AA 1S7QA 1X3DA 4TQEL 1DVUA 4M7LH 5K9QI 4WI7A 3Q5OA 4Z7OB 2GSIA 1NPUA 4F7TB 1T20A 1SN0A 3P9MB 1ZKAA 1OCWL 2O5NA 5C0CB 3N1QC 4ABUA 3KYKL 4C83A 1S9YB 3P4LA 2HVKA 4FEMA 1KFGA 2EC8A 2PCFA 2WTOA 3KNBB 3X11A 1QQDA 3LY6A 5CHNB 4Z7VF 4K5NA 3NVQA 1HHHB 4P5KB 1ORSA 4M3HA 5KSBE 1EJOL 3JSSA 4E9XA 1BJ8A 3HMWL 4C56D 3H2QA 3L95B 3HMXL 1R75A 2QZ5A 2Y72A 2X4OA 2Q7AA 1CQYA 3CDFA 2XV0A 4XAKE 4YHKH 3RDTB 1Y1UA 3O0RH 2EH8L 1FHGA 4YSDA 1LK2B 3WEAA 1ZGLB 2MH4A 2J5WA 2XPZA 3O9WD 4CL7A 3MGTB 5BMFL 4U1IA 1FE8H 5JPMA 3K71B 3O2WH 2HTLC 5D72L 2ADFL 4NO2B 5D71L 5TFSL 3UO1L 3CVDA 1XF4A 4JRFA 3P30H 4GXUN 4QXTA 5IVXE 3IM1A 3QUXD 4R5XA 1IAOA 5I1JH 1J9RA 3O3UN 5FCUL 3E6HA 5IJCC 1LO3L 2DI7A 3UJTH 3ZE2F 3NZ8B 1HILB 1PZ5A 2X6AA 2Q8BH 1BXXA 4A2GA 2WBJD 4D9QE 4W9DC 2BXYA 5LDUA 4MXQC 1FCGA 1VFBB 4Y2NA 2OMWA 1JFHA 5FHAL 4U6XA 5FC9A 4AE1A 5EN3A 5EF2A 3RKDD 1TQWA 3UYPB 4J28A 3GMNA 4X8XA 3WTSA 1MG3C 3R7QA 3DX0A 5BRPA 4F37K 3EBIA 1EDYA 3O41B 2GSIB 5D7SH 3G5XB 3K74B 1J8KA 3KCPB 1T20B 4ACTA 5E0FA 1N2RB 5C08E 1CR9L 4C83B 1G1CA 3FT4B 3GRGA 3ZHLA 4K3DH 3T0DA 2PCFB 1NIAA 1QBLH 3S5LG 2ZAGA 3PJLA 4YPJA 2FQEA 4NCDA 1FUNA 4L3CA 4XVTH 4DVRH 5L8KB 4S11A 1XGUA 5F96L 3V4PL 2VDQL 4DKAA 5SX5H 2PMZA 3EJRA 4WJKB 5DC0A 5F7EL 2ITDA 4F2ME 4IOIA 1I53A 1CTMA 5K39A 5AVXB 5JPMB 2AHIA 3MXWH 4E68A 1OVZA 1CF1A 4HIEB 4EN3B 3UTTB 1E27A 4WTZG 1XF4B 5AYUH 3DX6A 2JCCF 4AIZA 5MP6L 5GS2D 2LVEA 2GKIA 2JKTM 1CTOA 4OVVA 3ECQA 1IAOB 2VXQH 2WQ8A 3VNYA 2X28A 1C5DB 4POUB 3FS9A 2X9ZA 1V3JA 3LKRA 1KJMA 3QG6A 3E6HB 1HESA 4QXWA 2GSGA 3UYOD 5DA0B 1E90A 4DW2L 3ARSA 5CN3A 1K5NB 5HD8D 2EIMB 3NZSA 1PZ5B 2VDRL 1ZLSL 2W65A 2K70A 4PJBE 2SEBA 2OMWB 4G6JH 4U6XB 3D39E 2QV2A 4OGQC 5IROC 1BLIA 4M6MH 1XCTA 1CPUA 1MQ8A 5EO0A 2K78A 5HBBA 3C09C 3NOIA 3U9PH 3UBXA 3O3DB 6TAAA 2WGNB 2CDEA 4TLUA 4CVXB 1MLBA 3FUFA 2P46B 1XX9C 4PRPB 4RFEA 3MJ8A 1AAJA 3FJTA 1OCRB 4UCFA 4FYSA 2MHAA 3CZFA 1RUML 4IOSA 4W9IC 1AQDA 4BBWA 1J12A 2BRRL 2PXYD 5GS1A 1QPKA 1I3RA 5IOKA 4L3CB 5AVVB 5T33L 1XGUB 4LK4A 2DN7A 1M1SA 2CJUL 5KVFE 4OZHF 4ES9A 3WUWA 2ITDB 1UH3A 4IOIB 1HDMA 5AQ0A 2ZSVA 1RZ7H 4GOSA 5JUEH 2XV6B 5LBVA 1UGKA 2NT1A 1E27B 3RVVD 3QEQB 3DX6B 4QRSB 5I1AA 1IBYA 5GRWA 1CK0H 3QQ9C 1W2KT 4XCYA 1YDPA 1DVYA 1LE5A 2F58L 3U2JA 5DXWA 3V0AC 3STBA 4MKTA 3D0VA 3LS4H 3LZFL 1KJMB 2F19L 1IAKA 3N42B 5J6SA 3S8FB 1QYGL 4TRPL 5AKRA 1RMFL 1UJTA 5DSCA 2G5RA 4ZUSA 2CM5A 1OB1A 1IM9A 4YZWA 4P5TC 3SE3A 5AZEH 4OSUL 3MV9E 4OB5L 4D3CH 1A6VL 2A99A 1DUZA 2SEBB 4J3OG 3MLSL 3OWRA 5FGRA 4AVIA 4QYAA 4X4KA 2XN9A 3BAJA 2ZE0A 4Z18A 4P23B 3ZYOA 1CICD 2C3HA 1WP6A 3AUVA 4P3CH 1XCTB 1JSYA 1OE1A 1OEZW 1ZT7A 3ZUCA 5AKVA 1RAMA 4RQQA 3OX8A 5T3XD 4ZZKA 35C8L 1U8MA 4NAQA 4AVHA 5L4JA 3UBXB 3SDYL 5CZRA 1J18A 1PLGH 1ET5A 4QRPD 2Z31A 3SCMD 1I1FA 1NFDF 3EJJX 1NKGA 2G2RB 4RFEB 1JV5A 3ZTDC 3GIZH 5F9AC 2X4UB 3KBEA 3T65B 3CZFB 3SKJH 1AQDB 1MN4A 5F1OB 4FI8A 1BZ9A 1I3RB 4PHZA 4A6YA 4F15C 2VIRB 3L3JA 3TO2A 3PFQA 4OD3H 1NCTA 1NJ9B 3V8CA 3S5LA 3ZJAA 3EBAA 3PV7A 4X8JA 3BSZA 1WAAE 3EOAB 1AI1L 2HJLA 4ZFGL 1OANA 1F18A 4JHUA 4XVJH 4AG4L 2DQHL 5E2JA 1WG3A 3US0A 4M5TA 3FKUS 4IYKA 2ZSVB 4L9DA 4MB4A 4PRPE 3GD1C 2I25N 2F6AA 2PW2A 1GRWA 3WIHL 5I1AB 3TF4A 2F1BA 3DC0A 3LRSB 4XCYB 5HVGB 1YDPB 4NN6C 1LE5B 2Z9TA 1FO0L 1SY6L 4Q14A 2VSKB 3D0VB 2ED6A 2YRPA 4WTZA 2QL1A 3GIVA 3RL1A 1IAKB 5IF0A 1R34A 1RIVL 1CVSC 3AROA 3FQWA 4PRIE 1WAEA 2DEYX 1E6JH 4UDTB 1L0QA 1H3VA 5DSCB 5ETUA 5FO8A 4ZUSB 2FNWA 1IM9B 3KS0H 4IBQA 3LIZL 3V6OE 5EEXA 1HIML 1DUZB 3DARA 3ARDD 3LNEA 2JH2A 3BCFA 3Q8BA 4LFHD 4XNMA 1DBAL 2XN9B 3ZE1F 4F7PA 5CD3A 1OAYL 5FUZH 4XPTH 4FQXD 5A2AA 4RGMB 1ZT7B 3WFEL 4AQOA 2BHUA 3OX8B 4RQQB 1AOHA 3DUSA 3F7LA 4Q2ZB 4E2OA 5CEXA 2XOTA 1E4XI 3MJ7A 3KBPA 1JIBA 1MIEH 5ESAA 5I1EL 4PSRA 5F6IC 3QDMD 1JYXA 1QI4A 2Z31B 1I1FB 2X53A 1RZIA 2KLTA 2QPUA 2ZG2A 4JCLA 4Y1SA 1ZS8B 2BOLA 2DQDH 1QA9A 1KBKA 5AUMB 4LNRB 3QARA 1BZ9B 3PCYA 4A6YB 3V5DB 3L3JB 1CGSL 2D4FA 2DQTH 3TO2B 3L4UA 5EBMB 1L0PA 2NPLX 3S5LB 2EDJA 2RJMA 4JDTH 3Q3GB 3K7UA 2ZUTA 3H6AA 1LO4L 4MJIA 3SPHA 2DRUA 1COBA 3PXHA 3NJMA 3MRDA 4G7RB 4N8PA 1T66D 5B3JE 3TF7C 3O9WC 2Z3FA 5E1HB 2M2DA 2CH8A 1N5AB 2R1YA 2PW2B 4AVKA 3QRFM 1SDYA 3FQ2A 1E0OB 3FN3A 4I18C 5J56B 4KY1H 2VLJE 3DGGA 5JW4Q 4LLYA 3FU5A 5B7EA 3QUXC 4JRXE 1DQML 2CBOA 1IGJA 4FLOA 4NIKB 3MLRL 5GZND 2R7EA 1PEZA 1QWNA 4TVPD 3EH1A 2BVEA 5FO8B 4NGHH 3WKYA 3QT2A 5EC2B 1EDHA 1Z9SA 2WBJC 2GUYA 4HWUA 5DU7A 4F7PB 5CD3B 5A16B 4OUUB 1FLTX 4XZ4A 1Q9LA 3NESA 3RKDC 2I9TB 4MA7L 3GB7A 2XXMB 4JFEE 3EW3B 3DUSB 2XTSA 4NB7A 2PYEB 2YD6A 2A0LD 5EO1A 3MJ7B 3ME0A 5FV2A 1IFHH 3IJ8A 3VGAB 2M1KA 43C9A 2B5IC 3Q0HA 4U49A 5AFAA 1ZLUH 1X7QB 4JFHE 1RZIB 1MCCA 4YN3A 1DVSA 1TO5A 3K6OA 1JK8A 4GO8A 4YHPA 3GHEL 4ZMVA 1JFQL 1MJ8H 1QA9B 3M7FB 1I8MA 2CO1A 1EERB 2YD4A 3SY0A 2YWYA 2VM9A 4N0FA 3BDYL 5D9SB 4PTUA 1EQWA 2VN4A 5EIQA 4M8QA 1TZIA 4MJIB 1EJ8A 2PWEA 5HHOD 4KHXH 3MRDB 5J3HC 4WTQA 3HZVA 4R7NA 3FUJA 1TNNA 2XBTA 4RIRA 5G5DA 1N6VA 4I5BA 1YJDC 2NRDA 1PZBA 3FO0H 3QIBD 4XNZB 3AWFA 5DJAB 4LLYB 5HDQH 3MV11 4XWGH 1X44A 2Q7NA 3SEPA 1C8PA 3PXJA 5ANMB 3HHSA 1G6RH 2ALAA 2YN3A 3KJ6H 1L9NA 5I30H 1CTNA 2OMVA 2ZXEB 3TTSA 4NRYA 1RZJC 2E8ZA 1E4WH 5HD8C 4C8XA 1W72L 1NDGA 3L5WA 5BV7B 3VGBA 3INUL 3UJJL 1DN2A 1F56A 4YFLI 7FABH 1E5AA 1L4IA 5C0DA 4IBWA 3VI3F 3EHBD 3N06B 3WY1A 2E7CA 4BDVB 3WU1A 3DYOA 1YNTF 2Q20A 3I02A 2Y25A 1AD9B 1A9BB 3GC3A 3ME0B 3WNOA 5HSFA 4AT6B 2AQSA 1CDIA 5F70A 1QP1A 5TF0A 1D5MA 4HXBH 4N0UA 4HJSA 3E3QC 3MC0A 1ED3B 3LXAA 4GRWB 5GS0H 1JK8B 2Y6SD 2GW5A 3AMKA 1WC7A 1UKTA 2XG4A 5HPMA 1KN2L 3WS6C 4GIOA 2PXYC 2L7EA 5IHLB 3SKUD 4P4RA 4D7BA 4ECNA 2X6MA 4K9JA 4N0FB 5AW7B 1V10A 2JMRA 4X9IA 4S0HA 1QLEH 4OBRA 1XCWA 3QDJE 4KRNA 3B2PA 4HC1A 3MLYL 1URLA 4IHOB 3HZVB 3DPBA 4ZBJA 1MRCH 4EKXA 4GUPB 3HR6A 1ZDSA 2ICES 4UOQA 2WLHA 1R3HB 4BFIB 4RIRB 1L5GB 3RVVC 5CZVL 4E9VA 2F5AH 3B3IA 1T2QL 3AM8C 2YMXH 1H9DA 1ADQH 1QSEB 3WN5A 3HHSB 3BGFB 2BINA 3M8OH 4IGBA 2EDXA 4EZJA 1FL6A 3S4SB 2NXZB 1BP3B 4YXHH 5AW0B 5FW8A 3L5WB 2VL5A 4ZFQA 4PJAE 4FCHA 4LLUA 2Q10A 1GZHA 5DJYA 1CICC 5D2NA 1NGYA 5IMOA 3GBNL 3QNFA 1RZJL 1L9TA 4L2YA 2Z7ZA 3WY3A 4ONFL 3BRFA 1JV2B 2Z8RA 1KYFA 3L4VA 3RNQA 2D7TH 1D5MB 5FF6B 2BH0A 3HG3A 2H47C 4N0UB 4U1KA 5AD0B 4G1MA 3V10A 2IALA 4IBVA 4G70B 3SCMC 1BM3L 2E59A 5I6KA 1GS8A 4JM2F 4JJOA 1P69B 5LNEA 4AGPA 4DESA 1AOZA 3NTCL 4AKPA 1WC7B 1EANA 2XG4B 4BK5C 1OKEA 1TTBA 1HL9A 4GSQA 4P4RB 1BEYH 3LHAA 1C12B 1MW3A 2YAMA 3QVAA 3T0ED 2JJTA 3IMSA 2ZUUA 4JM2D 4JKKA 2W38A 5JPNC 2MJWA 2VR3A 3W1ZA 1M9SA 5F1NB 4AITA 3DPBB 4MA3B 4N2LA 5A2CA 1QNZL 2GJ6A 4X6DE 3ZDXB 3ZDZB 3ZQXA 3BPNC 5IKCA 5I19L 4JY5H 5JA8B 1CO1A 5DEJA 1YY8B 3Q1SH 3KLDA 1BIIA 4OI9A 5DWUL 2YK1L 2Q3ZA 5E8OB 1E9QB 5E9DE 2XQBH 3BIKA 4NLHA 5FOBA 3ZUNC 4M03A 4XXDA 4JFFD 3WN5B 4IGBB 2F2HA 1MDAA 3B8SA 5AZ2L 3CIQA 3BIBX 3KPPA 4DUXA 3ETTA 4W9GC 4BQ6A 2DKMA 4IKIA 3UAEA 1O9VA 3GXTA 4DP5X 4LRNL 3ECUA 3EZJB 3ARDC 4ZQKA 6CGTA 5ACLA 1P1ZA 4MCYB 2ADJB 2JF1A 3VWKB 3P4MA 1D6VL 5T1LA 3QQDB 1A3RL 1NGYB 4FQXC 2C1OA 3L4WA 3VXRA 2CLRA 2Y2YA 2P7TA 5FW7A 2KT6A 3SPGA 4OI8A 1SFDA 4MB5A 3QJSB 4H5SA 1YPZA 5DQJA 2P44B 25C8L 5JXAL 3LYRA 3ATFA 4ZMPA 2GITA 1Z5LA 2NY5C 3SGJA 1FF5A 3F7VA 1OAUL 3S34L 2WXPA 2COQA 3K4DA 4LLDA 5T3XL 1EAPB 2VDPH 4OY9A 2VN7A 1C5CL 5EB9A 4JO2L 1RVFL 2VXVL 3CG8A 4TS6A 5HDRA 4RA0C 3EGSA 1NIDA 3PRZA 5E94A 1GCYA 5LCVA 3FU3A 4MLIA 2P28B 2A83A 4QMEA 2H2PD 4FQHA 4PRNB 2AF2A 2XVKA 4NKDA 2P42B 1T66C 4CA4A 2P9RA 3OD3A 2R2BA 4LVOB 3C8KB 5IKCB 1FP5A 4HIJA 3FNKA 1UJ3C 3QCVL 1GW0A 1O7DC 2FQDA 1XZ0A 1V3MA 1BIIB 2VJ8A 1J87A 1AGFB 1SXBA 3PGFL 4IRZA 4CVUA 2BNRA 1PPIA 3VGDA 3TCLB 1GGCL 2XWRA 3BIKB 3IFOB 2GAZB 4Q8BA 5FOBB 1NFAA 1GY1A 2VT0A 5LBGA 3IJSA 3T3ME 3T77B 5J12C 3TH4T 4TLKA 3O6FB 5GZNC 4K71B 3KPPB 1NAML 1MCBA 3BOVA 1RHHA 4Y19A 4MMXA 5IY5B 5EU6B 1GYCA 1ZHLA 1FV1A 4LLQA 4ZQKB 3GS7A 2VDPB 5KJRH 3V7MA 3CQPA 1S9XA 3RPBA 3GI8H 1HE7A 1WBYB 3C8HA 1UWXK 2E9GA 4M1GL 4OLYL 3O3EA 3X1FA 4W6YB 2C1OB 5LAPA 2CLRB 1NC4B 4LSQL 4Z76A 5KVGH 4OTXL 5DMIH 1NWPA 2A0LC 2H0FA 1TJHL 3FN9A 5DRNB 4X7TB 4H5SB 1G7HB 4YHOH 2UWEF 1KACB 8FABA 3BLPX 1Z5LB 3QG7L 1BFSA 3B83A 2X05A 4ZFOA 1B0GA 2EDQA 4ENED 5J1SC 1RLBA 1LO5A 3IMUA 2HTKD 3EAKA 2JKXA 4L18A 2DQGL 5E94B 2QGCA 2P5WA 4NOBA 2NY5L 2A83B 4ZNCD 1ZVNA 4WEMB 4UINL 4ODWA 2CRYA 3V0FA 4CMMB 1QUNA 4X4XB 4YWGH 5D1ZI 2R2BB 4ZXBA 5I5RA 4DKFL 3MRLA 2NY6D 3TFKD 5B1JA 2BNRB 3QIBC 1N7ML 2IH3A 1J7VR 4FNLH 2OCJA 3O81A 2NY4B 3DXAE 1AXIB 4P59L 4ODXA 3KL5A 2R56H 1BF2A 1DE4B 1P84J 4NP9A 3ULUL 2R8SL 5I6XC 4OJAA 3KYOA 5EWIH 1DFBL 2GEEA 5KTEH 4RGOL 4MMXB 4Y19B 5GJSH 1KDJA 4HD9A 3CCHA 1FV1B 1JGUL 1MFDH 4L0PB 1AO7E 1NCUA 4RISH 3EYSH 3V95A 4PJ7E 4DO6A 4OGXH 3AXIA 2XVLA 4ORGA 2NX5D 4D0CB 3NPSB 4JM4L 3VWJA 4TVPL 4I0CC 2J1YA 2Q8AH 4Z76B 1S3RA 3T2LA 4QXUH 3ETBF 3LTVA 4YC2C 3P4NA 1VERA 1UYWL 2R4RL 3MLWL 5E99H 3PL6A 4KZEH 1BG1A 4BUGA 2QVTA 5TE7H 3QHZH 1KFAL 2Y6SC 1B0GB 3SJVE 4PJIF 4DAGL 4DCQA 4LPCA 4YDIH 5KVMC 1LO5B 2F8VA 1PKQA 3E8UL 1G94A 5C92A 1ZK5A 2WXRA 2YXVA 3BMWA 4ZO8A 1JE6A 2P5WB 3NIDF 5I15L 2AS5M 2VKWA 1Z0NA 3ET9F 2CALA 2WKOA 3A4FA 3C5SA 3ZYJA 3QJOA 1QUNB 3WKQA 5C3LD 3CFMA 1P4BL 3A67L 4HUUA 1UACH 3MCYA 5I0YA 4ZXBB 3BQUD 2O5YH 3BWSA 3MRLB 5AVRB 1ET8A 4CMHC 1MZZA 5KSAB 2JIXD 5IG7A 2I60H 3KHOA 5HGHA 2I07A 1A66A 1K72A 4M7KL 4ODXB 4UF7C 1XO8A 4XB8A 3SYQA 4QTHB 2CLVA 4N86A 3B8YA 5E1QA 3R0MA 1J1XH 1Q1JH 4EE2A 2P5EB 3P77B 3RY5A 5FB8B 2F54E 4XBGA 5INDA 4HHGA 3UDWA 1MOEA 1U8PB 4JZOB 1RP8A 1RSFA 1X5AA 1MI5A 4LDLB 3UROR 4Y2LA 3BUYA 2QSVA 3DIDA 2LW3A 2ZYRA 1OAZH 1Q72H 2MKWA 3HFMH 4A7UA 4GNKB 3TNNB 3RUGB 5KVGE 4K7FA 2D9CA 1SFHA 2EO7A 3VGFA 5HP5A 4K23H 1ZGLM 3PL6B 1D9KD 2AI0L 4UV4H 2APFA 3KWTA 1MAJA 3QSKB 1B90A 4XMLL 5JOEA 2J3SA 3IJYA 3N41B 1PKQB 2AJUL 4CAGA 5KN5A 1IBGL 2ERJC 3DX9A 5IM7A 3PQYA 3LQZB 5I0DA 3HTLX 1CMOA 4N3TA 4NQSA 3QR2A 3T0EC 4XT1C 2ZOUA 4R5VA 4JM2C 5BOJA 4N8VG 1YN7A 4BQ8A 3F6JA 3TPUA 5ADPH 5C0AE 3KMDA 4U1NB 4HUUB 1DBKL 1DDHA 4M02A 3OXSA 4ODTL 4WCYH 3WEOA 4FQLH 4LL1A 3C5ZA 1IC4L 1MCWW 3VM5A 2VO8A 5HGHB 1BV8A 2I07B 2H45A 1K3IA 1UHVA 2ZONA 5F7WC 5A2FA 3RWFA 3RFZB 4G8IA 2AJXL 3CLEL 4KO5A 4AUJA 1A7NH 1J8HA 1GVIA 1JPFA 3SKMA 3WN6A 3U30B 3SDXF 4V1DA 5CEZH 4GAYA 1M9WA 1BW8A 4NSKA 4ZTPH 1TLKA 2KLSA 4IS6B 5INDB 3TWCL 4P2YA 5KUKA 3RWHA 4S1RL 1Q94A 5IB2A 2KQMA 3OKDA 4MQSB 4RMSA 1HYRC 1RURL 4X8CA 3BUTA 5GHWL 5T1KD 3MXVH 5IUSA 3SN6N 2FLMA 4HJ1A 5JO5A 2N7AA 2F18A 3FMGH 4K7FB 3SDCD 4I48A 3DURA 4X80L 4PJ5D 3GEWB 1OQXA 2FYVA 4AY0A 5C0JA 4HMCA 2OSWA 3RTQD 4PW9A 3KVDD 2H8PA 3IJYB 1U41A 1OSPH 5IM7B 15C8H 3PQYB 2ZCLH 3QPXL 3NIFE 5FYKD 3ZLQC 3WFCH 4PLJD 3G04B 3Q48A 4FFZH 3HS9A 2UZIL 3AREA 3DWTA 4UBDD 1YN7B 3CDYA 4OLUH 1URZA 3TPUB 2V17L 1VPOH 2H2PC 3IDNB 4PJXA 6FABL 1C1EL 4I0PD 1IEBA 4GRLB 2Q3XA 3RAJL 3OXSB 5JW3H 2QSQA 2V3FA 3N1PC 3QCTL 5A2BA 3W9EB 2CO4A 2C9SA 2GYSA 2YAFA 3C5ZB 3NJLA 4WW1A 2BNUA 2CAKA 3C9NA 1OB0A 4JFDD 3S88L 4KZCA 2F53B 1N8ZA 2Z0BA 3RWFB 2DD8L 2FB4H 4ZMWA 1QRNB 1JPFB 1UD8A 5K1NA 1PFOA 3DKHA 1JCKA 4F8NA 5IMKB 4V1DB 4GAYB 3IT8D 4MQTB 1PDKA 3MGOB 2WXGA 3IJHA 4FQ2H 4JKWA 5L2KA 3GKZA 1OSZB 1YMHB 3NG5A 5D93C 3RWHB 4Y7OC 3TEUA 1EX0A 4Z7QB 1Q94B 2CIKB 4IM8A 3IPFA 3L9YA 5IB2B 4YNYA 2W59A 3IU4L 3HMXA 3BD4A 4G7YL 3O3AA 4XPBL 2NR6D 4WAFA 1A64A 5JO5B 3U7AA 3QZLA 5ALCH 1DTUA 3DURB 1BEXA 4A66A 5IESH 4NS0A 5JHBA 4PBWD 3AY4A 4BHUA 1GGBL 2YQ2A 4LU5L 2OJZL 4NZRL 5BW7C 4KO6A 4AIEA 2H1XA 4ENEC 2H8PB 3HE7B 3HI6L 4IMKC 1KB5L 1FSKC 3BUIA 1WK0A 2HTKC 1NFKA 3PPSA 2X1WL 2ZXQA 3LRLA 3BKMH 3ZDYF 3W39B 1OPOA 4NWTL 2DLFH 1RIUL 3NCXA 4XX1E 4PJCA 1WFIA 4FI7A 1N0XL 4XVOA 4IRJB 4U6VL 4DZ8A 4WJ5A 2YSSA 2APVA 3AABA 1IEBB 3DRQA 3G9AB 4XGZA 5CGTA 5I1CH 1CZ8L 1RERA 5D7LE 4OW6A 2NY6C 4MZ2A 4N8VA 3TFKC 4NPYA 3WHXA 1YYML 4L37B 1RJZB 4PWFA 3LQAH 4WW1B 1AH1A 1GS6X 5KYUB 2BNUB 3C9NB 5IHHA 3QI9D 1U3JA 2RTTA 1N8ZB 3W57A 5IFAL 2VISB 4ZMYA 3VFSA 1HEHC 2MSPA 4FDWA 5DHXB 1WWAX 1SMOA 1A7RL 2X1XR 4QRTB 1LXMA 4L29A 5H37G 1OP4A 3D87B 2C34A 2X6UA 1PDKB 3B56A 3FH8A 3KPSA 4OUOA 5E8NB 5CCHE 3IJHB 3CSFA 2WSPA 1EEYA 2PPEA 4Z3HA 4MDJA 2AXFA 1RP9A 2C9VA 2E6QA 5EU7C 2I9LA 3BWAA 3KS0J 3MUY1 3GJFH 1OGAD 3QFDA 4WDIA 3O3AB 4F8QA 3V4PA 4FQCL 2E9JA 2MKLC 2MRYA 3GBEA 2F53E 1KCVH 2QSTA 3B9KD 1NIBA 3ARBB 5KG9B 1X7SA 2QADB 3MKKA 2EVIA 3DOSA 2UZYB 3FOMB 3HS8A 4MA8L 2AC0A 4J6RH 4U7MA 3I6LD 4RVBA 3K6SA 1DVTA 2QKIC 2X88A 5EZJA 1KB9K 2ITEA 4HOMA 1CF8H 2MOGA 5E51A 1U42A 2B15A 2VRAA 4XNUL 4JG5A 5GZOD 1WPCA 3RYMA 4MNHA 2A1WH 4PW4A 4PJCB 4QNPE 4DKDC 3QHFL 3N43F 2BSSA 4G6ML 4DZ8B 1JHLL 3DUHA 3FSAA 5E2WL 4ZMTA 3TVMD 2H9GA 3NUKA 3BQUC 3F7KA 3PAVA 3T2NL 3LXUX 1GH7A 4UANA 1Z7JA 4FNPA 5MEND 4GKNA 4YFDB 4NQED 4LHUD 1XEDA 3MLZH 1TQSA 3LNHA 2LLNA 1FFRA 4PJEF 4JFQA 3ZKXB 1IZKA 4U1HA 1CJYA 2IAMD 5GGVL 3CFTA 1JNHA 5GISH 5IMLB 2V2TB 5KAQG 2I7SA 2ZCKL 3B7RL 2C26A 4L29B 3VFNA 1TMCB 2XXCB 3Q6GL 3ECWA 3WD5L 1EEYB 3P0GB 1C5BH 1UB5A 2X40A 2X2JA 2AXFB 3ARGD 1T1ZB 5CZKA 2M26A 2I9LB 3BWAB 3I75B 3ILPA 3I3BA 3SGEH 4LCWD 5DHMC 2XDHA 4P0DA 4CUCA 3ARPA 4OM1L 3ELQA 2C4FU 1M2VA 4NUPA 4P3DB 4S1DD 4WDIB 2YA2A 1R3IL 3V4PB 1T0NA 3CZNA 4PS4L 4X6CF 1MNNA 2VDQB 1OGPA 4L3EA 5EOCJ 4ZYKB 1HN1A 4DWHA 3LKPA 2MCAA 1FYTE 1XSJA 1WA1X 3CSPA 5KVDH 3KR3L 1MRFH 3DOSB 1D9KC 4KFZC 5AVSB 2G0LA 2WV3A 4CSTA 3S37L 3NT0A 2FSEA 1FVDA 1DJHA 3H2WA 3L4ZA 5C6PB 1BVLA 3D06A 1BBJA 2IH1A 4GLRI 1QFHA 2ZZUT 3IRZA 1T0PB 5DUJA 1N5YL 1H6TA 2KS0A 4FNUA 3ATDA 3VXOA 4X8GA 3L8QA 4YEFA 4WUUB 4XMZA 4FP8H 5AW5B 4L8CA 4TMPA 3IKCA 3UAAA 1EXGA 2BSSB 3BHBA 4ODVH 3VXUD 3WKML 5DEGA 3TJEL 1D7BA 2H9GB 2AV1A 1H9VA 1QHQA 3FUHA 3MVSA 5D5MA 5E9NA 2DWXA 5C0ND 5TQ0H 1KTJA 3CQFA 1RCYA 1X5MA 2F5BH 2KI6A 2VH5H 1LO0H 3GSUA 4OGZA 4PJGF 3LRKA 4D9LH 5C2BL 3BEVA 4PJ8D 1HC1A 2GTWA 1R3KB 3Q8FA 4O2CB 4MJJA 4U1HB 4HG4J 2XKNA 2HG5B 3L5IA 1D7FA 2DB8A 5IROA 1CE1L 4GUQA 3VFUA 1SOQA 5DYOA 3BVUA 1HOCA 2DKSA 1UXMA 2CUAA 4NQCA 4PJDE 4XOEA 5H37A 2WBKA 1M3JA 1F97A 2BWIA 4QHPA 3LDBC 3ZL2A 4M61A 3DOIA 2YEZA 3VQ1C 4N24A 1RL1A 1FL3A 2LABA 3BZ4A 1T0NB 3O45A 3FFCE 2X4QA 4L3EB 5LGYA 1PS3A 3LKPB 4JAMA 1H15A 3AB0C 5DS2A 4W9ZA 3SDCC 3WFZA 1K8IB 2NY1D 1AFVL 2EVJA 1TJMA 3VXTA 3SE8H 3TYFA 3WIHA 1BWMA 2WINA 3FB5B 3OZ9L 4NWUH 1FVDB 2D8KA 5SWSD 5SX4I 3RTQC 1TSRA 1BVLB 2QLYA 4BINA 5FPIA 2Y24A 4K94C 3LN9A 3V0EA 3QZMA 2BW4A 2JKLA 3HG1B 1FO0A 1SY6A 4YDZA 2VCOA 4AMXA 1BVOA 1T3FA 3VXOB 1MJ7L 3QUYD 4XNYL 2Q9OA 4NOFA 4PLJC 4XOBA 4JCWA 3QE5A 4L8CB 2B0SH 3NRQA 3IKCB 4IDJH 4UBDC 4HX1A 1KYOJ 1YYLH 3BHBB 1LEGA 3Q5TA 1CDCA 3UC0H 1E28A 1BZ7A 3LIZA 2XTJC 3CX2A 4I0PC 3QA3A 1BVKA 1FWXA 5D5MB 2D0GA 3MV7E 5JIPA 5DGQA 1E9OA 1QFWL 3L9EA 1CLVA 2KLRA 3GSUB 5TD4A 1MFMA 1HZHL 4PJFE 4DP7X 4X5WA 5I73C 1WFMA 1AY1L 4G8GB 4FQIH 1NFIA 3BWZA 3V2AR 5IR1A 1MEXH 1U3NA 5I6LA 3MLVL 5F1IA 4D7PA 2XKNB 4IOFD 1S8DA 4W9EC 4WUUE 1NLDL 3D85A 4J6IA 5BZDA 2AK4A 3VFUB 1UT1A 2O72A 2TSBA 1H3WM 3C09B 1XIWA 4NQCB 2X89A 1GHFH 4E42B 2F8XC 2FT7A 4M61B 5CJQH 2YEZB 4I8DA 2XZQL 5HHQA 1FL3B 1F11B 3R1GH 2H26A 2XJKA 3P54A 2DWTA 3WNPA 1KTDA 3MBXL 2NR6C 2X4QB 1EBPA 2VLKB 3O45B 3S35H 8PAZA 1EZUA 5MHSD 5MEPB 4H20H 1H15B 5DRXB 4D8OA 2XBZA 3H42L 1K9TA 1IUZA 4UT6L 4AIOA 2P80A 2VITB 3VXTB 5HI3D 5KVDE 4M43L 4X4YB 4LSRH 3IFLH 1FNEA 1KN4H 4RMBA 5FA3A 2EDTA 5KYXA 3ABMB 4UNTA 5DDHA 4BK4A 4JDEA 3FUMA 1XSOA 1Y0LA 3BUQA 4CC1A 2X5PA 3RVTD 3C6EA 2LFEA 3V6ZA 3K4AA 4I2XA 1EXUB 4FFYL 5I1IL 2OTUB 4AEFA 2QDVA 4HX1B 5FUOH 1KLUB 4CKVX 2ZSWA 4F7CA 1BZ7B 5C2UB 1P6FA 4NLAA 3TC9A 1JGEA 1IVLA 3QA3B 4LOEA 1BVKB 1UEYA 2CZNA 4PREB 1E9OB 3GMPA 2YOAA 5FYKL 2GPZA 3TNMB 3ZSTA 1ZV2A 2DIEA 2B20A 3R4RA 4ZSOA 3BVXA 3X14B 1NCBL 4MAUH 4LSSH 3QI9C 5IR1B 2D2CC 3NSYA 4MYPA 4P5TB 5KS9A 3VI4E 5F1IB 3ATAA 3BP6A 4RDQG 4AEIL 4Q4EA 4J8RB 3CMOL 1DVXA 3AJ7A 4O2FA 2HJFA 4DHLA 1UADC 1IGFH 2AK4B 2DLEA 3SBRA 4ZZFA 2BJMH 1HHKB 1MF2L 5DD0H 2JLLA 5JW4M 4LVNC 4N8CH 2V8MA 3AG3B 2IQAA 3NACH 4R2GD 5T5NG 1Z3RA 4JGNA 5HHQB 4OZIF 2H26B 1GOFA 2GTQA 2NYYD 2QPEB 4OCRL 1KTDB 5IBTL 4G83A 3NFSL 3S5ZA 1FGVL 1ZV5A 3WGUB 1T83C 3B9KC 3CN0A 2Y22A 5CSZB 1K3ZA 3DSFL 4C56A 3THML 2JJUA 5IB5B 1FNEB 5FA3B 5HYJD 3GBLA 4XP1L 3E6FB 3UAFA 3LKSA 3DJSA 4JDEB 3S3DB 3DGCR 2R27A 3ZOAA 2WXQA 3QQ3A 1IKNC 5T1DL 1TOXA 1A9EA 4OGAD 2BS8A 3T09A 3O9WA 5IB4A 4WI8A 4AOFA 5GZOC 4M6OH 1SUHA 4L4TE 2CGYA 3X12A 1ES0A 4G43A 3KPRD 3NIGB 2HSIA 1GZQA 4I18A 4F7CB 4A63A 1W72A 2H6OA 4NN6B 2NNCA 3U4BL 1BIHA 3TVMC 1CGVA 1HXYA 4NEHB 3QUXA 4XCNA 5DR5H 4TNEA 3X3FH 3GMPB 1QKZH 3ULVE 1B3JA 3LNGA 3VI3E 1U36A 2CMRH 3FPYA 4ZSOB 3GSVA 2K9FB 3GZQA 1NCGA 3V9EA 4XMVA 3VQLA 4EN2A 1N64H 2FECL 3TJHD 2WBJA 4S1QL 4RMTA 3BP6B 2IAMC 2XIDA 3HRZA 2QHLA 4O2FB 4CVZB 3K80A 2HJFB 3Q2LA 1D7CA 1NMAH 1WZ1L 2BCKB 4PP1D 3UJIH 4DEWA 4EDWH 3NA4A 3GS0A 2R15A 1KJ2H 3P3RA 1DN0A 1P6WA 1H8SA 3ARGC 5H4ZA 3VD3A 2K4AA 2IQAB 3B2UD 3QUHA 4MDIB 5DK0A 1X9LA 3ZQ9A 1J1PH 5F6IB 4OJFL 1NC2D 1O7SA 4S1DC 2ICWB 5ECGA 1C8QA 3E1ZA 3DX1A 3A6CL 1EVUA 4DGWC 2EVGA 1MCPL 4HU8A 1H3PH 3W11D 3QUZD 1RJCA 1V55B 1IARB 5ACZA 2UYLB 2AKRA 4C56B 5KANI 4ELDA 2MPAL 4K07A 4Y9EA 4JHVA 1KIUB 1GSKA 4Z7VB 4DQOH 4TUJA 4WWKD 1W6WA 4I7ZC 3O9WB 4GG8A 1S7RA 3Q9QA 3WMSA 5JYMA 2IC2A 3VB9A 1CIUA 3AAZB 4YL9A 1JZ8A 3X12B 1ES0B 4G43B 1GZQB 3O6LL 1W72B 1DEDA 5ILTH 1ZRUA 4X42A 5LQBH 2CJSA 1TEGA 1HXYB 2V9QA 1XF2B 1KJ2B 3QUXB 3EG9A 2A9AA 5DUML 4MBOA 3D12B 3U4EB 4QHKI 3EO9H 5C0NC 4C4BA 1RY7B 4LSVH 5JDSA 3EJZD 4XXCC 4AV4A 1T80A 2D7OA 2X9WA 3GSVB 4L0ZA 2OK0L 1YEIL 3L3GA 4PJ8C 2JCCA 5JXED 5L9DL 4IRSD 2H0JA 2J8HA 2ESVA 1RZQA 1WEJH 2KZBA 2YPLD 4MJ4A 4HIPA 3EJSA 1CD1B 4XZUA 1YJDH 4ELKB 2WXOA 5BOZG 2W5PA 1THCA 4LCIL 1VRSA 4MD0A 4WKZA 3RKPA 4F93B 3BCDA 2H2SD 1XGPA 5BQ7A 4P06A 1CD8A 3ZE2B 1N19A 1F90H 2WNKA 4DP1X 1DN0B 4PGBB 5AOKA 2WTPA 3GXMA 2DLTA 3K8LA 4UOJA 3QJFA 2X9XA 2B5IB 3LEVH 5CZXD 5DK0B 3ZYZA 4R0LC 2I32A 1DANT 4UIMB 5C0RH 4L3AA 5EBGA 3PXLA 1CDYA 1JF1A 4HKBA 4UTBH 4HJTA 3IPBA 2G9KA 3MQIA 4YXKL 1UT2A 3WS6A 2BFVH 2NY1C 3LQMA 4GXVL 2PXYA 2GVYA 4KZDH 4I89A 5A3ID 4P2QE 4ZNEA 2WBXA 3ARUA 4G9FE 4GPVA 5D70H 4JPWL 2NXYD 3II1A 3U7YL 1T04A 4FYQA 1BM7A 3H0TA 7TAAA 12E8H 1LQSR 3SBWC 4HUKB 3QUYC 3UACA 2BP3A 4QHKJ 4RMVA 1FDLH 4MZRA 1C7SA 2ZWKA 3B9DA 5HDWA 4D9RE 3AM8A 3FB8A 1UWXH 3FAWA 3APMA 4E9YA 2P8LB 5DZJA 3CHPA 2VR5A 4JKMA 3CVHL 2OX5A 3MODH 4EOWL 4YFLF 1EA9C 3RB5A 3O4LE 4XPHL 2JCCB 5IVOA 1UKSA 4Z7VE 3P11L 4KITB 1XBRA 4HHWA 3JTBA 3QEGL 2V5YA 1ULVA 4JFPA 4IOFC 3TZVD 1BZOA 4TQPA 4WTXA 1TZ8A 4LDEB 4Y5VA 1ETZA 3T6WA 3L1GA 1CYGA 1TFHA 1CICA 4WKZB 2FX7H 2BSCA 3VRLE 5A6IA 2WLJA 2Y5TA 4HS6A 3RWDA 1IVTA 1JN6A 2N7SA 1OSYA 5IQMA 4O02L 3FHAA 1JRHH 5BRZB 3I6SA 2GJZA 3SCMA 3V55A 3CDCA 2EABA 1WF5A 4HKBB 3U7WL 2GABA 3AXLA 4NJ9H 1INEL 1JZ3A 3T0AA 2DBLH 1NCCL 4BK5A 3SY6A 4AYBA 4AKQA 1S5IH 2CA4A 4RGND 3QUMH 5HI3C 1KLGA 2F7OA 1V3KA 4HPOH 1TCRB 2Z64C 4G9DB 4GBXA 3PHQA 4Q6IC 1KJ3H 5CP3H 1BYOA 2UVFA 3BAEL 3B6SA 3A6BL 3IK2A 5JPNA 3REVA 2CRIA 5G4NA 1T04B 4RAHA 4RX4D 2IWGA 3H0TB 1WO2A 2AEWA 3RVTC 3WXWL 3BKYL 1GW6A 2XRAH 1YRKA 3SQRA 3VTAA 5CR8A 3RY6A 3TIDB 3FO2A 4NP4H 4XN4A 4YDKH 3FB8B 3KVQA 4N26A 4YHLH 1UWYA 3KH3A 4TVSa 4O9HL 2QHRH 4OZHB 1FAKT 4Z9KB 4HT1H 1P7KB 1E9PA 3UTSD 5SWQB 1MJUH 4RRPM 2YKLL 3F85A 3GGWA 1XR8B 4JPVL 1GZHC 1CLOH 1DVFD 1KCSL 2KH2B 5CUSL 4G6FB 2CHNA 1DQQA 1TVBA 5FLUA 1XT5A 3BUDA 2Y7QA 3KD4A 4JFPB 3ARDA 1QATA 3EDJA 1A7OH 1ETZB 1LEIA 2EE9A 3WFBL 1AGDA 2XXFA 3AQYA 2ENYA 1GPOH 1CICB 2QQNH 4FQXA 3MLTB 4WU5B 1SGKA 1NCNA 4L8SC 2FR4B 1RD6A 1HAUA 2D31A 1E2VA 4M8UA 3T8XA 2E86A 2Y5TB 4HS6B 4RBPK 1DQDH 3RWDB 1JN6B 1MWOA 4EDXB 4R2GC 2KDYA 5B7FA 1VFUA 4QRPB 3R8QA 3QDMA 2GJZB 1LDSA 1MCOH 1PZ2A 4ZPVB 3NEOA 2JI1A 3SCMB 2NYYC 5BUGA 1BA9A 3B7SA 4OCWH 5F93C 1PD0A 2NW2A 3AXLB 3OVUB 1SHMA 2V2XB 1GOHA 4YO0A 2Q2LA 1NGQL 1ZV9A 4B9FA 1G1OA 3NK3A 5GGRA 3EYUL 4PB9H 3EUUA 1KLGB 4KO9A 1DQKA 2IV9A 4G80A 1BX2A 1NFDB 4UAHA 4A2EA 1TJIL 3GRWL 3HBZA 3QDHA 5JPNB 3E38A 3KEHA 4HFUL 3REVB 3OMZA 1U8NA 2E74C 2H32A 2WPGA 3QP3A 4MQ7A 4AH2A 4BM7A 5KSBF 4OGAC 1ZVSA 1DZBA 1JK9A 2FGWL 4F9PA 2ZICA 1NOFA 2UUDK 2KZKA 3JZ7A 2WQAA 1F58L 2A4CA 4XCEB 2WXMA 3WENA 3SGKC 3EDFA 3LVEA 1NAMB 5FCSH 3JWDL 3FO2B 1CT8A 4WO4D 4B97A 1YEJL 4MCZA 1SRDA 2X0UA 5CILL 1AJ7H 1JGLH 4LPXA 4XNXL 5FKAA 3LCYA 2PYFA 1OARL 4K5MA 5E8DH 1E9PB 3JUYA 4MX7A 4HK0A 5GZNA 3GINA 1L7IL 1VEOA 4HJGB 3VUAA 3GGWB 1XD1A 1AGCA 3P02A 4FOMA 1TVBB 3UZEC 3NAAL 3TJHC 2Y7QB 4Q7DA 4QT5A 1UCBL 4R90L 3ARDB 3KLAB 3NYKA 3FONA 3NDYE 1I9EA 1TPXC 4PP1C 1LEIB 2XV3A 1GCFA 4XC1L 2AV7B 2W91A 4HV8B 5FK9A 3VRJA 3OSKA 3CUPA 1VFOA 3NJGA 2AEPH 4XMWA 2D31B 3B2VH 3TONA 3T8XB 2DQEH 1UASA 3B2UC 3W81A 5IQ7L 4QY8A 2TRHA 3ZE1B 1CFQB 1QG3A 4LLVA 1NCWL 1ZPLA 3GHBL 5IFJB 1AE6H 4X7FC 4M48H 2NW2B 1TU2A 1PG7W 3G5VA 4YBLC 3GSRA 3GMMA 1HU8A 3W11C 5EHFA 1CLYL 2X0VA 3OR6A 3QUZC 1JHKH 4D9QD 3WE6A 1IZJA 5DZOA 2PCPB 4OLWH 1A2YA 2VDLL 4I13B 4OIIL 5DVOA 3HUJA 4G80B 3BVWA 1NPNA 4N8UA 3IJ9A 1KULA 3T8VA 1D2PA 3KJ4C 1IGMH 2VDOL 3F5WA 5FGCE 2PW1A 4MQ7B 4RWYH 1DJWA 4WWKC 5HHOA 4ZMQA 5BOPA 1ZHNA 1JK9B 3HC4H 3NSDA 5ID1A 3U6XA 3RY4A 3QO1B 5C08D 1SM3H 1Z0MA 2FWOA 4QXGH 2W9EL 5BS0A 1UJ3B 4ANVA 3S3JA 4PRDB 1CT8B 2RBLA 4XBMA 4HUVA 3QIBA 4PCSA 5MEQA 1NEPA 4MCZB 2IEPA 5FKAB 1UM5L 2PYFB 4Z7NB 5J12B 3C6LB 1E3FA 4MX7B 4P2OD 3ARFD 2FX8H 3EJZC 3MRNA 4PB0H 2OMXA 4HF5L 5C8JA 1AGCB 5JXEC 1W0VB 2BVPB 1XGZA 1YMME 4IRSC 1CBVH 2X6VA 1NBVL 3HJEA 4MAYA 2VLLA 3RVUD 1G9MC 1SOKA 1DJYA 4KVPA 4JHWL 5FK9B 3GUFA 1B0IA 4NX0A 4KTGA 3VRJB 3CUPB 4ADJA 2H2SC 5E4EC 1FPTL 5B8CB 4BZ1L 3MDJA 4WK2B 4LEEA 3EOTL 1IKOP 1QR1A 3QIUA 2EICA 3FOLA 3DV6A 5CZXC 5FDYA 1YQVH 3S35X 3FT9A 1QSZA 4GW4A 1DL7L 1MCSA 2EH7H 3MRMB 1TU2B 2PP8A 3GSRB 1YNTA 3MRCA 3OR6B 4W4OC 3WE6B 1WTLA 3LMJH 2YEVB 3IDXH 4O2EB 2VSMB 3D39D 1T6BX 1A2YB 2BO0A 3VYPA 5A3IC 3HUJB 2ARJQ 1WBZA 4HJJH 2HMID 3S96A 2ADIA 3MRBA 1E4XL 4OV6F 5IQ9A 4JO1H 4X5XA 2NXYC 5HHOB 3RZWA 5ID1B 1ZHNB 3IAQA 3B9AA 3OLEA 4ZFZB 2FWOB 3NFPA 3CNKA 1QFUL 2G75A 5EA0H 3WDIA 4M5ZH 5AOZA 3QIBB 1TVDA 4UTCA 2BY1A 3ARTA 3P9LA 4GKOA 3KPOA 2CK0H 1VB9A 4WEUD 1BHGA 4ICXA 3MOBH 2OMXB 5C8JB 4ZW3A 5I18H 2CIIA 1WWBX 4P46D 5L8JB 1TSHA 4NPJA 1SXNA 3OPUA 5LXGL 1SHSA 2W0LA 1ICTA 1XR9B 4XMKH 5I8EA 4LCVA 3CHSA 3TZVC 1BPLB 2VLLB 1VADA 3LNIA 2JJSA 3EADA 4MA1C 3NQKA 1A3ZA 4X0NA 3TV3L 1S3KL 1R4XA 3UGUA 5DS8A 3FOLB 4B95C 5JIIA 1G9ML 1INDH 1A3LH 1YEDA 4GW4B 4YHZH 3RG1C 2R0WH 3EOBA 1AZRA 4DKEL 5JW4N 3X1BA 1EFXB 4XMPH 1AR1D 1TTRA 5EOQH 2XSKA 3N9GH 3GPEA 2Q86A 1YNTB 4AEHL 3MV9D 1T89A 3BGAA 1V7NL 1QOKA 3ZXAC 4C59B 2YBGA 4JNXA 3GM8A 3FB6A 4RGNC 3UTTD 1R5IB 2J8UA 1NCAH 2DIJA 3FTSA 5CXPA 2WIIA 4Q9RL 3T0EA 2ADIB 3MRBB 1TITA 3U2IA 4JM2A 4QRBA 3ZIYA 1N6QL 3AQDA 2RGSA 1AANA 3U0PA 2Z1PA 4GG6F 4CC4C 4PLKD 1YNKL 2G75B 5KSVA 4U1MA 3AU0A 4YAQB 4CMHB 3O2DH 3M1BB 2O5XL 3P9LB 4X83A 3HNVH 3KPOB 1O9ZA 2PTTB 2Y36H 5D4HA 4QOKE 2CKNA 2RCSH 2WUBH 4ZS7L 1XSIA 3SKOA 4BD4A 3TT1H 4JFFA 3LB6D 5F89B 3ILDA 1U4EA 4Z0BH 2R29L 1DYZA 3RIFF 2JELL 2CDGA 4KMTL 2CIIB 4WW2C 1LWJA 1DVFC 4LGPB 2YO3A 2BW5A 3VFMA 1LWRA 3ZW3A 2XVGA 4AQAB 4WIQA 4M6NL 2B4CH 1AMYA 1QW8A 2NNRA 4PRPD 4I85A 4KY2A 1O9WA 5D4IA 1KTRL 1Q0YH 3PHOA 3WIAA 2XA8L 3PDGA 4AQ1C 3CSBA 2W88A 1UFUA 1PTZA 4OF5A 43CAA 5E4AA 5JOPE 5LJYH 2EVFA 1FNLA 1KB5A 2KL6A 2IBBA 3U1PA 5D1XA 2BSDA 4UU9A 4MBRA 2HFTA 4U1JA 2DICA 3TLRA 4Q0XH 3L3OC 1YEDB 1XCXA 4PRID 3EOBB 4R4FH 3ARRA 2YZ1A 5D2NE 3NRPA 3BE1H 3JVGC 2QMKA 5E5RB 5GRVK 4UZGA 3RWIB 3UTPE 4H8UA 5SV3A 4JG1L 3TIEA 3FB6B 3BEWA 4XPGH 4WU7B 2ERJB 3VNZA 2X9YA 3BFQG 2UXTA 2BHZA 4H26A 2WIIB 3WNLA 3T0EB 3ZGHA 1GYWA 4JM2B 5DHYA 1NANH 3VFTA 3DI3B 3ZTNL 4AXWA 3U0PB 1NGXA 1JDCA 3I2CH 4FADA 2BNQA 1I1AD 2WCPA 5KSVB 2Y7LA 1BFVH 4U1MB 1UWGH 4WO4C 4DETA 3N85H 1XFPA 1TQCC 1CFNA 2FJGA 2IPUG 5IBLD 1N0LB 1HINH 3SKOB 3B9EA 4JFFB 3D05A 4ZW6A 3BT2L 3SPJA 2GJ6E 4ZFFA 1UQSA 2XQ0A 5ESVA 1K6QH 1MFCL 2MQGA 2CDGB 5KBMA 4XAWH 1RULH 1MVUB 3ZKMD 3OAUH 1PCXA 1UA7A 3CTTA 3VX1A 3WFHB 4KVCL 4WSJA 1A5FH 1NM4A 1T6WA 5E6ZA 3K46A 4ES8A 3AT8A 2ARJB 3PS6A 3HC0A 4JRLA 4NKMA 3DETD 2GC4C 3PHOB 4Y5YC 2NOYA 4LPWA 4I3SL 43CAB 1SMDA 3NCWA 1KB5B 2VDNH 4JRXD 4UU9B 1MCNA 2JJWA 3K2UH 3MLUL 4O5LL 3DHMA 4X6BA 1OAQH 1V7MH 2BHFA 4MNGA 1YECL 2Q2EB 4FA6A 5CGYD 4BWWA 2WP3T 1CQKA 2P3YA 1SZNA 4OCSL 4KTDL 4A7GF 2EACA 5BW7A 1P4UA 2OPCA 3VXRE 1OTSD 1GKEA 1L7TH 4IMKA 5E1IA 2VERA 4TPRH 3BEWB 1H3GA 1M6OA 2QPDB 5EIIG 2IDFA 3MUGA 1QHOA 7PAZA 1KBPA 4H26B 3OLGA 3P73B 1PNCA 5C6WH 1UM6L 3VFTB 4IHBA 5D8JL 3PUCA 4NZTH 3BKJL 4AGNA 4Q9CA 1RIHH 4C55A 5GGQL 3X13A 5I1LA 1F02I 3GMLA 2XETA 4JFHD 2V37A 3ZT5A 3UC2A 1R9FA 1TQUA 1CFNB 2FJGB 2X1OA 2HH0H 2BC4A 2ZXDA 2R1WA 1WH0A 2JB5H 4GY4A 4OCYH 1UQSB 4P2OC 5HGDB 5MI0C 3ARFC 3P0YH 5IT2H 5DEFA 1IO4C 5JHLL 2HWZH 4XCFH 2EEDA 1ZA3B 4NDMA 3QFJB 1T5KA 1R5WA 4NQVA 1EVTC 5D93B 3RVUC 2R4SL 4UQBA 4OIFA 1ORQA 3H9HA 1GKOA 1RZPA 3HC0B 4HUCA 4NKMB 3V4VL 2PKDA 2NX5A 2OMNA 3NN8A 2WCSA 5GRUL 2GBAA 2Z4TA 1GC1H 2C4FT 2UZPA 1GZPB 1TMQA 5TDNA 1J5OL 5FGBC 1OTTD 1KSRA 3BDBA 2WGXA 2CUMA 4BQCA 4JDZA 3U48A 2QKIA 1FSKB 3KWXA 2YD7A 1MCHA 3TS8A 3MUGB 1WCBB 2NNXA 4Y4FD 2HMIC 1V5JA 1TXKA 2AMGA 2EXSA 2Q87A 2BDNH 3FT1A 3NPZB 4G7VH 5T5FL 2E4TA 3V0VB 5EUOE 5INCA 1PY4A 4ODSL 3PDOA 4NM4H 1OF2A 1WT5C 3BQUA 2AJ3B 4FMFA 3GMLB 4FABL 2NY6B 3QJQB 3UBXI 3PWUA 5FOJA 5E08H 4QRUB 3D4YA 4J12A 3K72A 1F8TL 5J6GA 1DQJB 3GUTA 2CSPA 2RACA 2X10A 4RESB 3D52A 3TU6A 2N1TE 1OY3B 1RZFH 1EEZB 1KBVA 2WQWA 4Q58C 4Z3IA 4H0HB 2H0PA 3QDJD 4P46C 1HZLA 2V4LA 4P2RB 3OKYA 3ZE0E 2A9NL 4LBAA 4PBDA 2D3VA 1B4RA 1L9PA 2QJDA 2OW6A 1R5WB 4MD5A 4NQVB 3WL9A 5CCJA 1FG2A 1ORQB 2Z7UA 4HGWB 1VESA 2NX5B 2ZG3A 3NN8B 4IU3A 3HLKA 3D1MC 3KGTA 4NUJA 4N2AA 3P3UA 2PR4H 2EKSA 3IE4A 5ENWA 3MRHA 1R0AL 4AJVA 2CKBH 4ZX4A 2OR9L 4YDVB 5K59E 4HUXB 5AG8A 1AR1C 1S9VB 4Y2OA 2JSFA 1TKWA 2VR9A 4R7VA 3DO7A 2QKIB 4M4RA 3NJNA 1RU9L 4G71B 3MCLH 1XXFC 5DD5H 1U6AL 2MFNA 2QVMA 3WFDH 1OO2A 4IK6A 1T7WA 2AVFA 1KIQA 2XIBA 1T22A 4JJ5A 2Y4SA 3GXDA 1GAFH 1G7QA 3EJPA 3HI5H 4UTAH 3SE4C 2AERT 1B3IA 3QUGA 2NUTA 1A6ZA 4PJIB 5EIIA 4NHCL 3LRMA 1OF2B 1U93A 3BQUB 5G55A 1I8LC 5AWNL 2MTPA 4PLKC 4HUNB 2EYRB 2F8IA 2OSXA 1J05A 2ICCA 1IX2A 2JIXB 1LWHA 5KYNA 4X7EC 1TEYA 4M7LL 3WTTA 3ZHFA 1INQA 2OSYA 3VMOA 4X6DF 3PU7A 2UWEE 2WVVA 1NEZG 3LB6C 2CPCA 4TNWF 4OKDA 1Q9WA 3EYVA 2X4TA 4LKXB 1KDIA 1QFPA 2J6EL 3DX7B 3TURA 4RAVB 3BW9B 5FDWB 3VD7A 1OCOB 2P45B 2WZ0A 4MD5B 4JFXA 4C47A 4UQAA 4UT6A 2PTVA 2P43B 3WL9B 1G9EA 4XMTA 4HS3B 3EFDH 1NGPH 3H56A 5D7IF 4MCNA 3MTXA 2E46A 4NUJB 4N0CD 4MWFB 4WNQA 1A21A 3P3SA 4YHKL 5E9DD 5I5IA 4TQIA 3O0RL 2EKSB 5ENWB 3SDCA 3GQFA 2HFFA 3MRHB 3VCLA 2C7UA 5TTRA 1EJOH 5F0JB 4PJ5A 1E5YA 1FE8L 3C87A 5DVKA 3O2WL 2A6JA 4M1CD 2DV6A 1D9KB 1MI5E 4FFYA 1TQTA 4D0DB 1A4JA 4YVUA 1TKWB 3P30L 4P2RE 3DO7B 5EEVA 3V6OC 4M4RB 5DWPA 4KH2A 3WIIH 4AUYA 2JK5A 4NENA 1DJZA 5I1JL 3HLAA 5D2LA 3D09A 2VXTL 4JREC 5D71H 1LNUA 3VDCA 5JOFA 3ZZLA 3UJTL 1JRHI 1QSED 2NUTB 3B4NA 2Q8BL 5EORH 5C09A 4I0PA 1U93B 3UP6A 5HVFB 1I1AC 2LOEA 3D08A 4AJ0A 1XMWA 4K94H 3O0LA 5GS0D 1FZMA 2YXFA 1INQB 1TENA 2K4WA 4JFDA 4JPIA 5D7SL 5DJ2B 5IBLC 2WVVB 1P84K 2RHEA 2ATKB 1J0YA 4PV8A 1Q9WB 4BZYA 4PCYA 3AQZA 4K3DL 4ZMNA 2NCEA 1QBLL 5TDOB 2J88H 3ZKMC 2DWDB 4YHNB 5K9QG 5EBWB 1BXAA 3T3MF 5I1GH 1CIDA 4JFXB 1ML0A 1TZOA 4NQUA 4W9KC 2ZQKA 1XTLA 3NIDE 3SPVA 3STLA 3LDBB 4H1LG 4XVTL 4DVRL 3OG6B 3DETC 3ZO0A 4QRRE 5T1KB 3SDXB 4WNQB 1X5FA 2NR6A 1J9TA 4LPYA 4AJYV 3SDCB 3SSGA 3VCLB 4EBQH 4G8EA 5ISZE 4PJ5B 1YEEH 2J72A 2LT9A 4AWJC 2WLYA 2Q5BA 3MXWL 3RB7A 3BGMA 4QRQA 3SGDH 3ZTEA 5CGYC 2ZCHH 5AYUL 1BYPA 5D7EA 1IEAA 3RTQB 1DO5A 2JK5B 1OTSC 4NENB 4IQHA 4CVWA 5HDBE 3EGXA 2ZT9C 1Z9PA 2IOMA 2VXQL 1RPUA 2PWGA 2Q76B 2X7LB 5E6IA 2WXKA 2QSCH 1UXSB 4F7KA 1LNUB 2ROYA 4QGTA 5JOFB 4BYHA 4ISVA 4FTVE 1XF3B 5MP6H 4EZLA 4A7QA 2XTJB 2CK2A 4I0PB 4MJ5A 2V33A 1MNUH 1MQKH 4G6JL 1PFCA 1A6WH 2H3KA 3QXDA 1KPUA 5I73B 4P4KD 1FZMB 3LV3A 1TZHA 3TP4A 4JFDB 3FTXA 4JPIB 1PY0A 4PJXE 3CFUA 2GY7B 3MBED 4AZ8B 1VCAA 3IB4A 3VVVA 1U58B 1OWRM 2Y7MA 4IW4C 1ZS2A 3IJEA 2MOVA 1CL7H 1N70A 2NTFA 4TSAH 1HE8A 3L45A 3MV8B 3ROOB 3UBHA 1NEZA 3RVXC 4RLDA 4YDMA 2J4WH 4FL4C 1BAWA 5I0ZA 1UA6H 5HY9B 4WUKH 3SPVB 2W0FA 3STLB 5CLZA 4DERA 3BKCH 3FFDA 4TM9A 5JORA 1OGAA 2D7QA 1GR7A 4ZPTA 1J0IA 1U91A 4ZTOH 4PAZA 2A74C 5EZOH 5TGBB 3W56A 4LSPH 3DXAD 3IETA 5C07B 2E7LC 2IDUA 1MFAH 4K4KA 3B9KA 5FA4A 5L2KE 3JV4A 3MCG1 4PJ7F 1JNLH 1IAIH 1I1YB 5JUEL 1RZ7L 5FECA 2VQUA 3J2PA 1N68A 1OTTC 5IB1A 5F7NC 2MQ0A 1IEAB 1CK0L 2OW7A 4NQDE 5B1BB 4GIAA 4JVWA 3EGXB 1AO7D 3R4DA 1IKNA 1SNRA 1UC6A 3LS4L 3AZUA 4Y4FC 3HKZA 5FYKU 2HRLA 1AQHA 5IOPB 5B1KA 2E7HA 3VTMA 4ONHB 4UNIA 4ISVB 3WCYA 1AQ8A 4HULB 5HTSA 2YUWA 3HZYB 1CFVH 4E0RB 5AZEL 4MJ5B 5SX5K 4G1EB 3TVMA 2FJHA 3BDXA 3C8DA 2OKMA 1QBMH 1TO4A 4OU3A 1JPTH 3QXDB 3ZDYB 4X7SH 5EOTB 4P3CL 3O2VH 4HOZA 1LMKA 3SJVD 3RIFK 3LV3B 2OCCB 1TZHB 1YN6A 3VXPA 3QI9B 3VJ6A 1I75A 4U6HA 3VFGH 2M83A 2IAMA 1PLGL 4GAFB 4OZGF 3G6DH 3HN8A 3NJIA 1P4LA 1NC4D 5DFTA 4DFHA 2NTFB 2HT3D 5E2UH 5AG9A 3GIZL 5ID0A 2E27H 1ZWIA 3VGAC 4WF7A 2RFXA 4EI5D 1MZYA 5DFAA 3SKJL 1DP0A 1VGKB 2PPFA 3ARGA 4ILDA 3L4CA 2A6IA 2W0FB 4LCWA 5B21A 3CH1A 3CZGA 1AD0B 5IVZA 4Z78A 2FRGP 3H2PA 3UGEA 4OD3L 4LGRB 3WO4B 1NKRA 4HEME 2K7QA 5DUBA 3KPSE 4H1LA 4XVJL 3B9KB 4J3BA 5FA4B 1F4HA 3K5SA 3QCUH 5F9JB 3V0DA 2NYZA 3DVFA 1ITBB 2FEEI 5D1QE 1VA9A 5IB1B 2F54D 1FVCA 1OAKH 4TKWA 4F8OA 5AENA 1QLRB 4PJ9A 2XVBA 1E8YA 3CVHA 1MFBH 3WMQA 4DEPC 1KBBA 3WIHH 4M00A 3H7BA 4APQD 3RWCA 2UXFA 4WI5A 2ZJSH 3GSNH 3MRQA 3CFBA 5HVHC 2YGVA 3FCSA 5E1AB 5HJDA 2FJHB 3NCYP 3TVMB 1FO0H 3CVIH 1XH2A 4H7VA 1SJEB 4J3UA 1ZK9A 1ZANH 4A39A 5MENB 4RBPH 4XPTL 1RIVH 4NQEB 4XXCA 4AYDC 2EZ0C 3F8UB 4LHUB 3N43B 4PJ8A 1YN6B 1I9JH 2DYSB 2IDCA 5BXFA 3AG2B 3LZOA 3VJ6B 2V5MA 4PG9A 4U6HB 3MYJA 2OSLA 2IAMB 1MIEL 4KNSA 3ASOB 5ITFB 1X5LA 4O02A 1OGTA 1P4LB 5SWZE 1I3VA 3QWQB 4DGIH 5ID0B 4B41A 3D0AA 5C0AD 3W38A 4WI0A 3DMMA 2DQDL 3ARGB 4PJEB 1JZ6A 2FYYA 1BMZA 4ZUVA 4LCWB 3CH1B 1CLZH 4R0LA 2DQTL 5IVZB 1KIPB 3FQXB 3T08A 2ZP8A 1EDQA 1T5XA 4AQ8C 4N0CC 3VFRA 4JDTL 4M62H 1DBBH 3FZUD 4F7MB 4H1LB 2Y07H 2K3TA 2N1KA 1CD0A 2AQQA 1EXHA 4M1CC 1KNOA 3OMIB 2CWRA 5DYFA 4UQ3A 3CHXA 3EH4B 3DBSA 5SWSA 4MJHA 4KY1L 1DJXA 2VAAA 5EU5A 1B9KA 1ZCRA 2EECA 2D0FA 3SBWA 4HLEA 1JI1A 2PPAA 3PP3K 5KSAD 1Z9NA 4LP8A 3QUYA 3CVHB 4A2MA 2B8OT 4NC1E 2IQ9L 2COVD 5EPMB 3LS5H 3MRQB 4NGHL 5FYLH 3VXUB 3DROB 1PF3A 3CVBA 3TEZA 2XZZA 4R7DA 3UTZA 4P2CG 4PI2A 3HAEG 1ANUA 5JQ6H 1AMXA 1U3ZA 3K6IA 3PHSA 5FO9A 5KEZA 2VC2H 4UQCA 2P5ED 4OFPA 4X50A 5MEOA 4RH4A 3CFJA 3W5NA 4EUPH 5GS0C 5CBAB 4PJ8B 2YEQA 4UM8B 3RGBA 3TBSB 1RUQH 4IJTA 4MNQE 4PG9B 1IFHL 1A4CA 3UP1A 3VB8A 2NY7H 2HUEA 4O02B 1OGTB 3A4AA 4PG2C 4BCXA 4PJGB 5AAWC 3CSTA 1SVZA 1ERNA 3II2A 5BV7L 4HCIA 1H8LA 1JWUB 2WLMA 4QCIA 3MJ9L 5KJ4A 4G42B 1LP9A 3LKNA 1MJ8L 5J4MA 5CWSA 3RX5A 3POHA 4ZUVB 4R0LB 1S4IA 2V3DA 4GT0A 4XOAA 1T5XB 3G5WA 5DD3H 4BH8A 1BPVA 3VFRB 2ODIA 3GRWA 1OF0A 3CBJB 4BA0A 5I23A 3N1MC 1J9QA 4KHXL 2ZXCA 2NY1B 2OZ4H 3DVNB 1A1NA 1HWWA 3SYAA 4QWWD 3FO0L 4Q6IA 2VAAB 3QORB 1QFOA 2YQ3A 3RJDA 4PJEE 5HDQL 5JIHA 3STZB 4EUPB 1KY7A 3IFPB 4XWGL 3EH2A 2DM7A 4K3EH 2VZ3A 3V0WH 3QXTA 3U4AA 3KJ6L 5I8CA 2WAQA 5I30L 2IANE 2X4SA 4DNLA 5TE6H 1E4WL 4TSBH 2GHWB 3O3BB 1TVHA 4R7DB 4MJ2A 3UTZB 7FABL 2G30A 1HFUA 4LSDA 4F80A 1HCYA 2F1EA 3TOPA 3OAZH 2V2WA 1I4FB 4X6CE 3F7PC 3ZMRA 2ZD0A 4OLVH 3CFJB 1SOSA 5MEOB 4P4KC 1J9CT 1E8WA 1N26A 3MBEC 1A6TA 1LE9B 2Z34A 3BIAX 2IDSA 4HXBL 4NQTA 4JGUA 1OLZA 1GXEA 2ZPKL 3AUWB 4PWHA 5I75C 1C16A 4PPTA 5GS0L 1S7XA 2HN7A 4Q9QH 4L8SA 5CWSB 2D03H 2CDFB 2XFXA 1E5BA 5D7LD 3TO4A 2W8CA 2WXJA 4LEXH 1VACA 2NZIA 2FL5B 3SDAD 4JY6B 4GAGH 4X98A 4BH8B 3QWRD 1SXZA 3QQ4B 4BSWA 1KB9J 1CDGA 1QLEL 2VDKB 5IJDC 1IB5A 1MRCL 2A6KA 1G9HA 1A1NB 5IREA 4YZFE 1G87A 3L2NA 4B9JA 4XPFH 4Q6IB 2F5AL 5CEZD 1CFSA 1ASPA 3VFNB 4ZD3H 2YMXL 5HJBA 3MO1A 4CC0A 1ADQL 5E7BA 4Y9BA 4OCMC 1LEKA 2ZXAA 5IHZA 1CBJA 3M8OL 4OCXH 4OLXH 4QF1A 1NAKH 2ZF9A 4TSCH 1A1OB 2AGJH 3GSWA 2F53D 4N9OB 4YXHL 4YSCA 2FD6L 4NRZB 3MRFB 1DO6A 5FYLE 1CGYA 5E5MA 3D4GA 3D25A 5C0IA 2VN5A 4ICWA 1WFNA 3PABA 3T3PF 4LXFA 4BA8A 4QNPF 4MZIA 3TEWA 4HWBH 2O61A 2EP6A 3FQUB 1LMIA 3KWVA 4TNWK 1E5ZA 3RJOA 3HAEA 2HKFH 4BZ1A 3UZEA 4HG4K 3FUNA 4JHZA 2YFOA 4JLRA 2D7TL 3CXDH 4CNIB 3HC3H 3D0LB 4CU7A 1N9PA 4WO0A 4QAWA 1W0WA 4PGZA 2YAOA 4I77L 4NERA 4QO1A 2HT3C 1F45A 1C16B 3K6DA 1S7XB 2HN7B 4AMWA 4N9GA 4EI5C 5EG6C 1MRDH 1K5WA 2W94A 2Z91B 4Y9CA 5KS9E 2X87A 4XO3A 2AJYH 4F8TA 1BEYL 1OWWA 2BWDA 2VDLB 4JM0A 1VACB 5F7YC 3NH7H 1NC2A 3CHOA 9CGTA 1FA4A 2F7RA 1FFQA 3LN4A 5DZVA 4BSWB 1OGSA 3FU0A 2VDOB 4G6KH 2JNZA 2FJFA 1KXTA 2UZXA 3NDZE 3QUZA 4KOCA 4MXVE 2A6KB 1UURA 1PGRB 3GNML 4JY5L 3G5YB 3IFNH 3A4EA 3HNTH 2QGDA 4X7CC 3RPKA 4OZIB 3AG1B 3Q1SL 5HYJB 2G60H 4IBTA 4GJTB 3F58H 2ZNWA 3OF6D 4PJHE 2WMPA 2XQBL 5FM5M 4BKLA 4WWKA 5K1JA 1LEKB 1H5BA 5IHZB 4GH7B 2HX7A 2J71A 4YSRA 1KYOK 1QPXA 2X38A 4APQC 3GSWB 3KPRB 3EIFA 3OKMA 2WQSA 1FYTD 5C0IB 1NGWA 4GQ9H 1BAGA 4DKTA 1Q9KA 2NYKA 1KCUH 4OJYA 3PABB 5LWYH 3ML8A 1IC7H 3H8NA 5FS5A 2UXGA 1AHWB 4KI1A 4OCLC 5DZPA 2DAVA 3FTZA 3FUEA 4IRSA 4LRNH 3S3BB 4LAQH 1I3GH 2BIMA 2YPLA 5DMYA 1TPXB 2DL2A 3NPSC 5IMMB 2ORBH 1KBGH 4I88A 5I74C 2FCBA 4G82A 2X3AA 4Y5XA 1M56B 1KV7A 5AL8A 2VDPL 5AB0A 4K5LA 3MNWA 2QADD 2FWLB 5T1MA 4JQXC 4KNQA 2CO7A 4LB8A 3N2JA 4LHJB 4O51A 4CW1A 4Y1AE 4A37A 2K7PA 2HX9A 5I1HH 2EDFA 2JI3A 4BFEA 4YBLB 3FZUC 4CADA 2FJFB 1KXTB 1C5CH 2UZXB 3QUZB 4PJDF 4W4OA 3OB0K 2PPDA 5J1TC 1XAKA 2RA1A 5B39G 4HWEH 2XQYK 1FZOA 4NPKA 3VFPA 4U1SA 2EDEA 2HLEB 3CHRA 1Q1PA 2QVKA 3KJ4B 2HRPH 2WMPB 4BKLB 4HUWB 4WWKB 5GRJH 3FPXA 2BPBA 5KSAC 3A5VA 3BH4A 3ASNB 2R29A 2W80C 5GGUA 3FFCD 1ZTXH 4G5AA 3WEXA 2F0CA 1NZRA 3MBWA 3KGRA 4WI6A 1LLAA 3HG2A 1G4MA 1Q9KB 2AXGA 1EGJH 5F7MC 1E4JA 4DN4H 3K2MC 2D7NA 5KJRL 2VUKA 3GI8L 1FQ9C 3VD0A 2DKUA 1DBMH 3QBTB 5F7HA 4PVNA 4JO4H 4W9HC 4B9KC 1CE6B 1CG9A 3CBRA 4N2CA 5KVGL 1OCCB 1QBAA 5DMIL 4HS8H 3QC6X 4IRSB 2ZG1A 2UY7B 3LKQB 5FHBH 1PLBA 2IG2H 2YPLB 4YHOL 2B3RA 3TZVA 4PJFF 1UZGA 2DI9A 1IGTA 4UUJA 1W6LA 2DTMH 4PGEA 3OSVA 5E4EB 5T8IA 4ZQTA 5L7XH 2CO6B 2V5TA 2XX0A 1D2OA 1NCJA 3BP7B 2VKXA 5GSRB 2CO7B 1EBAA 3F84A 2B1OA 2ESVE 1NCDH 2FO4A 4L1TA 5GGTL 1T4KA 3HN5A 2EKJA 3IVKA 1TQBC 4XN9A 2X4PA 4FQQA 3W82A 2XFGB 2X3BA 3ML9A 5I6MA 4YWGL 3UIYA 4Q89A 3WIFA 3MRRA 5IIEB 2ICEC 2DH3A 1QSFE 1FRGH 2EYTA 4WUUD 2BP0B 1FZOB 3VFPB 5I1KH 2X1PA 4QWWC