2RTTA

Solution structure of the chitin-binding domain of chi18ac from streptomyces coelicolor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
105
structure length
105
Chain Sequence
b'ATSATATFAKTSDWGTGFGGSWTVKNTGTTSLSSWTVEWDFPTGTKVTSAWDATVTNSGDHWTAKNVGWNGTLAPGASVSFGFNGSGPGSPSNCKLNGGSCDGTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ChiC
molecule tags Hydrolase
source organism Streptomyces coelicolor
publication title Solution structure of the Chitin-binding domain of chitinase Chi18aC from Streptomyces coelicolor
rcsb
total genus 12
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2rttA00
1XBDA 3NDYE 1C7TA 2CZNA 1EXGA 2XBDA 2CWRA 3NDZE 5DHDA 1EXHA 1QBAA 1C7SA 1HEJC 1E5BA 1E5CA 1HEHC 1QBBA 5DHEA 2RTTA
chains in the Genus database with same CATH superfamily
5CCKH 3SGKC 3QHZH 4IRSB 2ILLA 1I9JH 2EDNA 3WKMH 4KK5D 3EHBB 2OTPA 2YUZA 4QD2E 2NZIA 3TZVA 2OX5A 2P8PB 4R26L 4B5ZA 3IPEA 1PG7H 2LU4A 2BLFA 2XTJB 2OJ1A 4N20A 1HNGA 5EOCJ 1ZGLA 5E1AB 1QRNE 3BSHA 5A16A 1OGAE 1PNCA 2YK1H 3QPXL 4QR7A 2WLNA 1KPVB 1WSST 4AQEB 2Y25A 5HHNB 4Y4HC 4M62L 5JW5A 1N0LB 1NSNL 4FG0A 4KO5A 4I13B 3CK0H 5CLYA 3ZRSA 1YYCA 2OSXA 2WYTA 4PBWD 2WB7A 1KN4L 3QXDA 4L48A 1DQQB 1G5GA 3MRLB 3O8XD 4XNZC 4MYWB 3T3PB 4LT7A 1B9KA 1FL3A 5AVWB 3CZLA 2AGJH 4M7ZB 4NNYB 4IOIA 1TG8A 2NR6D 5C9KA 4MS6A 5BZXA 1EXGA 5JLZA 1DBBL 2CD0A 2J4WH 1UA6L 3UYPA 5JTWA 3G5VA 1NGQL 4IRJD 3VXQA 1J86A 3HZKA 3FQXA 5DJ8B 4JNXA 2DICA 2GY5A 2O93L 2EYRA 1HN1A 3SDDB 4G80B 3ZDYB 2V37A 3Q6FA 5IVZA 2CXGA 5HY9A 3ULUL 5GS2D 2DLTA 2NY2B 1TEGA 5E0FA 4BK8A 5I18L 3R06A 3QHTC 4XO9A 5CJXC 3WCYA 1G7HB 1UJTA 1X5KA 2FLRT 3MRIB 3DI3B 3KDMB 4OJYA 2CRZA 2MQCA 4EZKA 5FKPB 1CE1H 3GS0A 2P42B 2VDNB 4BXSV 3PWJA 3S2AA 1X5IA 3V4LA 1IJNA 4QHLB 4JQIA 5C6WH 3D4YA 3G04B 1HI6B 3H7BB 2NXYC 3RGHA 1QAWA 3WE6B 3OJMB 3L16A 3ESUF 3K0WA 1IGYB 1FIEA 2JKXA 3ARBD 2OL3A 4Y19B 3PV6B 4MQXC 4O02H 1QFWH 4QPEA 2X4QA 2WBJC 4MVBD 4JX0A 1FVDA 3DWTA 3TN0D 1IBGL 4BCYA 2VMDA 3Q2NA 3NPZB 3EG9A 2FO4A 2UXFA 2WKLA 5E5RB 5GZNC 4L18A 3OAUL 3WDJA 4YSUA 2V33A 4HPOH 4JM2F 1F2QA 2BM3A 2FVNA 2D3JA 3B9VA 3HZVB 4JG0H 4PY7A 4KKLD 5KVEE 1J7VR 1CXKA 1IC4H 4Z7WF 4Y1AD 2XIIA 2A6KB 5AOMA 4BH7B 1KPUB 2C3HA 2EH8H 2YPLA 5IB5B 2JQZA 1B9ZA 1X5FA 2XJKA 1N0LA 4FMFA 3P11H 1GZHA 1OB0A 1YNTA 2AVFA 4AM0Q 3UPRB 3BQUA 2NY4D 4Y88A 2XPGA 4ZJ9A 3W56A 4XOBA 4A37A 5T5NG 1IFHL 2WY3B 5LG1A 4DZBA 4YGAB 4IU3B 1KTJA 3T0XA 3TYFA 4EN3D 3LB6C 4U1GC 4F91B 4PJBA 1DVSA 3D3VD 4NO3A 5FCUL 5HTSA 4Y9GA 5K9JH 4ORGB 4F5CE 4OM0L 4X4YB 4TPRL 2YAQA 5C0AB 4DGYL 2WXNA 3KLQA 2XC8A 4N9GB 5I19L 3VRIA 1NH6A 4PWFA 4UDUB 5I8OL 3DA0A 5IM7A 5T1JA 3A4EA 2J8UB 3HAEA 5LG6A 1I85C 2C9VA 2XNAB 2BNUB 3J7HA 4JDTH 5CD5D 4I2XA 3QZWA 4MKTA 2NDFA 1TQBC 5DMIL 4RMTA 4E9WA 5DEFA 2DEWX 4KTEH 3D39E 1PAZA 1AZUA 1XCQB 4XHJC 4G7VL 4Z3EA 4IJTA 2WZ5A 1C16A 2XTJD 3BSGA 4NJAH 3OMIB 3CZNA 4QHLA 1YYLH 3ISRA 3Q5OA 5H35B 4ZZFA 4MYPA 4A6YA 1KXQE 3E3QC 1XXFC 1RIHL 5JZ7D 5KYYB 3MUUA 4Z8FH 4Y5YA 3SE8L 4GXUM 4YHMH 3LEYL 3DLQR 1XB3A 3P9LB 1DBKL 4YLCA 4PJDF 1AACA 3GJEB 1H0DB 2ZAGA 4I18A 5DJ0A 2Y1ZA 2A4EA 3IJYB 4LQFL 2ADFH 1UQSB 3LV3A 3SKJL 3A6CH 3KVPA 1MHEA 2JTDA 4FNPA 3B9KD 1MCLA 4R7DA 3GUFA 1ZVSA 4N90D 3FN0L 2EVFA 2IBBA 1T2XA 1CD0A 1A9EA 2X4NB 1L0XA 2ZG3A 3B2UD 4XC3L 3S35L 3T0EC 4QEGA 3KYKH 3LKNA 3N1FC 2HT2D 1O9VA 2AJUH 1OP5K 4M6OH 1HINL 2OV0A 3NEOA 4FX5A 2WLZA 4L8BA 2W91A 4U6VL 4UQ9A 4ZX5A 4A7GF 4H26A 3S34H 2HN7B 3QQDB 3R4DA 3QISA 3DGGA 3CCHB 2ZKHL 3G6JA 3CH1A 1XCTA 4PRBB 3UTSE 5AKTA 4XZ4A 3CBRA 3HC3L 3MKGA 5DRZB 1SUJA 4ODTL 3DYMA 1KB9K 5C0BA 5TK4A 4Z3JA 4MJ5B 4X7SH 4FCAA 4ZW7A 2DYSB 3H7LA 4JZJC 2VRAA 5AUMB 3UJJH 2W5PA 3VG0L 2VQ1B 2A9BA 4OF6A 1J8HE 4B5EA 3D85D 2O5ZL 4FNTA 4JFXB 4XODA 2RAMA 5I76B 3EJUA 2K0RA 4MA8H 3KCPB 3ARGD 3FH7A 4K3EH 5B8CA 1NCCH 2CA3A 2E6PA 4KAQH 3TBCA 4N2IA 2JFCA 3D85A 4ZO8A 2YIHA 3FXIC 5KSBF 5J3HD 2VRQA 3MUY1 2AZAA 1YDPB 1AR2A 3VNZA 4ZTEA 2HJFB 1MW0A 5IHZA 4J4PA 4FQLH 2XTLA 3RBGA 4TXVB 4PJHF 2FB4H 3FPXA 1J88A 1MFEL 2JE8A 4IBTA 5BO0D 1KTLA 1F3DH 5KWYC 3TNNA 1KN4H 3ZE2F 3MRCA 2BJML 1BFSA 1CD9B 1QLEL 4L5FL 5EZOH 3MN8A 1A2YB 5DVNA 5LNGA 5LB1A 1GAFL 3BW9A 4U0RB 4WCYH 1PZAA 5INCB 3IBEA 3K71B 1VGKB 3GIVB 5T33H 3M1CA 3SDYH 1VF5C 1ZVSB 3VD5A 5HI3D 1G9EA 3IFOB 5DLML 1RZQA 2LR4A 4ISVB 1PF3A 3PGDA 5C08D 3BQVA 3U1QA 3MUHL 2ARWA 3KXFD 1E2VA 2N01B 3TEXA 4KITB 1PCXA 2FO1A 2AV1B 3VMPA 2PW2B 3FQYA 3QC6X 3GSVA 3MV01 1JWMA 3EDJA 4XXWA 4YDLC 4XZUB 4Y1AE 4BZ2H 2DS4A 4F80A 3KD4A 1FPTH 4HK0A 1MNNA 2D7MA 1OW0C 3DPDA 5JIDA 1F90H 5D2LA 3MLSH 2YD1A 3UAEA 4KOBA 4EN3B 3IXTA 3NMEA 4CMHB 4MCZA 2DI7A 5HYSG 1SXZA 4XVSL 1MVUB 4LDOB 5BVJA 4W6YB 5I26A 2B59A 1P6AB 1A6TB 4LMQE 5D1QB 3ULAB 3QAQA 1X6LA 4PJ8C 1CGSL 5I76A 3R1GH 1FAIH 1RUQL 5CILL 3LH2H 3AACA 4LIQE 3BKML 1AGCA 1GZQA 3KYOA 4Q6KA 2DOCA 1S7XA 4TLUA 3IJEA 4DOHB 1JPGA 5DJDA 1QFWL 4W9HC 2IH9A 2Z8RA 3G6JF 3VGAC 1S7RB 3RJQB 1OAYL 4TUOB 3MRJB 4Z3IA 5TPWL 3VWJB 4LPTA 1W0WA 4MCNA 5HVWA 3QS2A 5DGRA 5HHXL 4ELME 3QDMD 1VGEL 1JS4A 2WLYA 1AE6H 2EINB 1T21A 3GMNB 4EZLA 3DX7A 5K9JL 5LNDA 4NNPL 4XPAL 2EH8L 3UBXB 3GKWL 2BY0A 3VGAB 1XZ0B 4RAVB 4LPWA 4YHZH 3ARDB 4FTVE 4DK3A 4DW2H 2Q8BL 2CO6B 3N04A 4LOEA 1CYXA 4PJBF 3O3DA 4I3SL 4J3WA 3EBAA 3ABKB 3WD5L 4Q9QL 1U2YA 2VM3A 4JFFA 1BOGA 1HILB 3BHBB 3I9PA 4KK8D 3UL4A 4NQSA 5C0FB 5L4JA 4JM2A 3L1EA 4QHNA 2BDNL 3LIZH 2XY2A 4XZUA 3IFNH 1H9DA 5LN8A 2YXMA 3WMPA 1KYOK 2BOBA 5DURD 1PY9A 3ALXA 5AVYB 3SCMB 4CVZA 2Z35A 4G8GB 4H5SA 3DJRA 4UDTB 3QPKA 4QJ5B 2CUIA 4JO1H 3IXTB 1NLBL 4FQ1L 2WUCH 3TO4B 1F4YL 1TPXC 3GSWB 4A2HA 4KX9A 5E0QA 2X1OA 4KZ0A 1B0GA 1WT5A 3S3BB 1F1GA 32C2B 4KY1L 4OQTH 5TJWK 3VSQA 4AW4A 2NYYC 1T80A 2L4OA 1I3RA 2WXHA 4Z7WE 4E9TA 2AJ3A 2CM5A 3GMRA 5DFVC 4UWQB 1FNAA 2DN7A 3ULUE 6FABL 2BC4A 2X38A 1MCJA 4AK1A 4XN4A 4GEJA 4M48H 4NM8H 1JN6A 2H9GB 1P6FA 3K2UL 3NIGE 2VIRA 1E2ZA 3NQIA 1L9OA 5J6HB 5J7CC 4NNPH 4MD4B 2DKMA 2HH0H 3UJTL 3BAJA 1W0WB 1OSYA 4H20L 1GR7A 2XYCA 1F13A 3VDCA 2EEFA 2P8LA 1CE6B 2FIKA 1RZKL 2Q8BH 2MRYA 3UAJD 1OEZW 3EOYG 3DRQA 1IT9H 1F3DJ 4QRUB 2E59A 2NY1C 1NCGA 5EV7A 1MRFL 4Y4FD 2VLME 3II1A 1KCUL 3JV5A 3F62A 4AH2A 4YHYC 2HJKA 1S3RA 2J12B 1AO7E 2G5BA 2GTZA 2G2PA 2X89A 4HXBH 3IAGC 1NCOA 5A2CA 4TN9A 3ZZLA 1S3KL 1UG9A 4P48A 5E4EB 5IGXH 2X87A 5DUJA 2Y72A 2I9TB 5CCGE 2GJ6B 3JV6B 1HQRB 4MA8L 2F54A 4HFUL 2WVSA 5CJ5A 2SEBB 2XIDA 4RGOH 2D0GA 4S1QH 4CC0A 1YEFH 3JZ7A 4ERSH 5E08L 3VSVA 1B6DA 1SEQL 3QUXB 4ACPA 1ROCA 5CN2A 5D1XB 3IYLW 3EDFA 2EACA 1LK2A 2VXTL 3SQOL 3VCLA 3RFZC 1KG0B 1RHHB 3Q1SH 3SHSA 1WEJH 3EJZC 4Y2DC 3J27A 1XH2A 4J2XA 4KGJA 4HKXB 4PVMA 4QMEA 1BZ8A 3UTSB 4J8RA 1VKXB 3GBMH 1HQ4B 1P1VA 3P3SA 3PQYD 2X6AA 4HAKA 4X6CF 3D2UB 3EF4A 3VG9B 4EI6B 5CEYA 4FABL 1QFOA 4WW2B 3QO0A 3P77B 3T4YB 2X4RB 4L1SA 3NRPA 2E8YA 2J20A 1RZJC 2BC4B 1KEGL 3RVXC 3ZTEA 4Y2DA 4YDZA 4HSQA 2DL9A 4IRZA 3UEQA 3L5WB 3OAWA 3MA7A 5EO0B 4XCCL 3HBQA 2AXFB 2OZ4H 3GEFA 5IMOB 4HCRA 5C3TA 3BRFA 1H3PH 5KYUB 2EEBA 3GZKA 1AMXA 3WIHA 4XCFH 2E4TA 3M45A 3NAAH 3O6ML 4M61B 4EI5B 3ARXA 4IGBB 3Q01A 2RTTA 2IAMB 3AB0B 4M00A 5F89A 4Y2OB 5LO7A 5I8CA 2EEDA 3QW9A 1J8RA 3T4AC 3ARBC 4KROC 1G7JB 1YEIH 2XQYG 3KPRB 3L5JA 4NKMA 1T0OA 1OT2A 5C0IB 3KR3L 5IBTL 2OMXA 2ZP0T 4MQTB 4RA3A 1KFGA 2X28A 4UQIM 3I74A 5J1AA 1N3NB 3IFPB 3INUH 3WN5C 4ODSH 3MRMB 1VLXA 4NQDB 5K93A 5FKAA 3LDBB 3X1FA 4POZD 2MTPA 4BFNA 5HHPB 2IMNA 1YN7A 3QZLA 4OFYA 4AE1A 3JV6A 2VZOA 3T1FA 2I60L 4AGOA 4CMMB 3ARGB 2DQUH 4J7RA 2WXGA 3QR0A 1EZVY 2F6AA 3ASOB 3VXSB 5D1QD 1L9TA 3HE7D 3Q6GL 2X2IA 1HHHB 3L9YA 4DP5X 2A9AA 1MJ7H 4HS8L 2PWGA 4YS4A 1RXLA 2PO6A 2QQKL 1TQVA 5DC0A 5B8CC 1MCBA 1NC2B 3TCTA 2VISA 4Z76B 4ELDA 4YDJA 1N5YH 4Q14A 4M43H 3N42B 5BW7C 1RZ7H 1FAKT 2K9UA 1FO0L 3SYCA 2BNQD 3AWFA 3QJHA 4A2GA 1JYVA 4G59C 1J9CT 2YFOA 4AQ1A 1KY6A 1LXMA 4ELKA 5CBAB 2DYPB 3KHQA 4BQ8A 5ISZA 3V95A 5C0EA 1YY8B 3WFCL 1ZSDB 3FQWB 1DVUA 3K91A 4MAYB 3FT1A 1BZ7A 2FWOA 1HHGA 1SMOA 1YQVH 5LQBL 1GS7A 3ECUA 3NFSH 3CVHB 1RIVL 3KYNB 5D2NE 1J10A 1V3KA 4WKXA 3O2VL 5KBKA 3AADB 4IIQA 1VB9A 5AAWA 1DUYA 3WEXB 3AREA 2MCG1 5HI5C 3GXPA 3M46A 4OIFA 1XF3A 4N0YL 5FUOH 1KBKA 4JRXD 1MFBL 3CUPA 3EYQC 2ROXA 3S6CA 3WNNA 2W80C 1TQBB 4MZRA 5ID1A 4ZTOL 4EI5C 1GOHA 4NCC2 3HG0A 3T3MF 1S5HB 4GW4A 3MTXA 1IL1B 2XDHA 4YHOH 4Q9QH 1KGJA 2IDTA 4YSCA 1W6WA 3P2TA 2ZXBA 4X6DF 1IC5L 1YEKL 4RGMB 3KLHD 3K5SA 3CVHL 1JWSA 4KK6D 4NRYB 1PAMA 2WQ8A 3RJDA 1KLGA 3E2HC 2J57A 4O2CA 4YN3A 2B1HL 3H42L 4YGVB 2FQFA 2G9HA 2QQKH 5EIIG 2QKSA 1KIPA 1CFNB 3HR5A 5DA4A 1MZYA 1BFVH 2ZP9A 5E6IC 4FTVB 2WQRA 3T71A 2R0LH 5DEGB 1FNLA 4G5ZL 4B9YA 3R7QA 4I9WD 4RIRB 2JLLA 1PLCA 5EWIH 1SYSA 4ZQKB 4LSPH 4C8XA 3ALWA 2DI8A 4ZFGL 1FZJA 2PXYB 3ZKNC 1KPVA 1OOWA 3F6IA 1BG1A 5KAQG 3VXNA 1A1NB 3MPCA 1MFAH 3VXRD 4ABWA 2ZUYA 3K80A 5JDSA 1H6TA 2BOCB 3V4VA 4MA7L 5F9WC 1T7ZA 2YD2A 4Y16B 1DANU 2GEQA 1U3ZA 1M7XA 4AGMA 1RAMA 3ZL4L 5IOPB 3MU3A 1XCXA 2Q7AA 3EDKA 1WBZA 5KOMC 1FQ9C 4YZFF 4B9IA 2P5EB 1Y07A 2E74C 1UJ3C 4Y5VA 3DDGA 3DX9B 1I1FA 2PR9A 1MHCB 3D25B 5IVOA 4QYOB 2OR7A 4Z78B 3VXTA 4JHZA 4PJ7F 3FQXB 1Z5HA 1U8OA 1ZV9A 3FBQA 3SPHA 4HLZG 4YHOL 1JPTL 4N8PA 2VR7A 3WKNA 2H2PD 5SWQA 3TIEB 5D2NC 5IW3A 4KTEL 4JO2H 4R7VA 1XR8B 1OOAA 4CU8A 3WFDH 3PWUB 1EXUB 2IC2A 1Z5LA 4I4WA 3M88A 2XPYA 5GIRA 3EJZD 2IWFA 4Y2DD 1A9VA 1E8XA 5C2UB 1IL1A 3CN3A 1Q90A 3EYSH 1HDMB 1ZPLA 3C8KB 2YSSB 3A23A 2FHBA 5E95B 3H54A 4JZOA 1NTDA 3MLUL 1H15A 3NDZE 2AI0H 5C86A 2ZXEB 4YHML 4L3EA 3B2XA 4QXVA 3GXDA 3HOGA 1NEZB 3R18A 3TCXA 1KIRA 4DVBB 2CIIB 3X11B 5CLZA 2EYTA 2PR4H 3UTPE 5BRPA 5INDB 2ZOLA 1GH7A 2ITCB 5FO9A 2H32B 4X9BA 5CP7B 3ZMEA 3K8MA 1KXHA 4MA7H 5T1DH 3RY6C 3CFUA 5B3NA 4TL4A 2CK0H 3KPLA 2GJ6E 3WTVA 2C1OB 3WLWC 2WGXA 3LKPB 2V9RA 1JNNL 2OTWA 3W3BA 5E9DA 5CJOH 4M6NH 5FUCC 4KI5C 1P2CA 1SJHB 1U8JA 2A7BA 5IMKA 3AS0A 4ODXA 3TEUA 1TFPA 2CKBH 3KEDA 4K9EL 2P4AB 5E9DD 4AIZB 3GLDA 1I1YB 1YEEL 2HVJB 4NO3B 5IB1A 3RL1A 2NQ3A 3CLWA 3IJSA 1CGYA 5JQ6H 2WBXA 3CFEB 4FXLA 1JZ4A 4BFBD 3O4LE 2C7FA 2CA4A 4FJZA 2AJVL 5AZEL 3LS5L 4J12A 3T6WA 4ZW8A 3UJJL 4WW1B 3EOBA 3PWVB 2YMXH 3D0VB 2MHAA 4KJWD 2BVQB 4A67A 5FHBH 1X5JA 5T5FL 5DS8B 2GJ6D 3UO1H 2CUAA 3ZE1F 3QA3B 4AJWA 4OZGB 5L4IA 2DQEH 4X6EB 1H6EA 2BY2A 1EPFA 2J8HA 3B2UC 4N26A 2HSIA 4UQCA 4FKKA 4YUEL 4G6MH 3PWUA 3S36X 5F9OH 2AV7B 1T5WA 3OF6A 5D6CA 3MYJB 2XSKA 3OD3A 4RDBA 3ZDXB 4ZMLA 5GXBB 2YRZA 5CGMA 3DSFL 4QRFA 5I1LA 3C60B 4FP8H 5MEOB 4UQDA 2XFXA 3NGBB 1MEXL 2I25N 4XE0A 3LPGA 1W16A 4WWKA 3G7TA 4GMSH 1FG9C 3E3QE 1AH1A 5B3JE 3CQPA 4XB7A 2CO1A 2EICA 3GJEA 5D5MB 2XN9E 4PJBB 4LVNB 5FOBB 2AQ1A 3BX7C 3SDAB 3JTBA 1JZJA 4OJEH 3POCA 4KMQA 3VRJA 5M95B 3EJJX 2GBAA 2J88H 2GCYB 1A3ZA 2NXYB 2EC9T 1EMTH 3D3VB 2LTQB 2FIRT 4KHTL 4NWTH 3IFLL 1NKOA 4L3AA 5FDWA 5DQDH 5C0RL 3OPUA 5DI8B 1E5YA 5DWPA 3UPAA 5JW5B 1JHKL 3KXFA 1T03H 5J4MA 1S9XA 3IPBA 5F1NB 1KSRA 1E6OH 1A66A 4ODVL 1DVFA 2L8AA 1AKJA 4BINA 3MCG1 1IKNC 4AIZA 12E8H 3CCHA 3G6JB 4QDGA 3F7QA 3VGHA 5IVNA 3ZX1A 1YYML 4LBEB 3JSSA 2OW7A 4AEFA 3RIFF 3SCMC 1KMGA 4DN4L 1QR1B 2IDQA 3FU7B 4MLIA 4WGKA 4HW6A 1RZGB 3F84A 4WW1A 4BEIA 2FE0A 3C5ZB 5GPRA 4TNFA 3CFIC 5EA0L 5JUEL 2D9CA 2WVVA 4JFDE 4YSRA 5I5IA 2I5YL 2Z9TA 1JZ6A 4UQAA 4KQ0A 2HCZX 2N0KA 3D2TA 4NO0D 1SY6L 3L4VA 3LV3B 4N8UA 4HWNA 4YDVB 1VFBB 4K71B 3RPKA 2E4FA 5ESQA 1WH0A 3S8WA 1DSYA 2RACA 4P4KD 1XGRA 1AC0A 3CZUB 3MLZL 2Y5EA 4B95C 1WISA 4WO4C 2C4FU 4BFRA 1RJLA 3U83A 4PJCA 5J5EA 1GPOL 3B2VL 3TH4T 1EUUA 5DUML 4WI7A 5BV7C 3HI6L 2AEQL 3QVAA 2R1XB 3EOAA 4DEPC 1S78C 1GGCL 1NBZA 5GZNA 3IFLH 2ZWSA 4X4ZA 3ARBB 2J8OA 3GXNA 3RWFB 5IJBC 5B21A 1SDDB 4FN0A 4XWGL 3ATFA 4D9QE 1JHKH 2VDMB 4G71B 1JWUB 4TYUA 4X4XB 2WWOA 3GIZH 2MKLC 1JZGA 2CGRL 4E0RB 3HZVA 4MJ6A 2MPAH 1S9YB 4ATTA 3MMEA 1OSPL 4YO0B 4YDMA 3C5ZD 1J0ZA 4HUUA 3TEWA 1JNLL 2Z92A 2CJ3A 3IK2A 4R5VA 4JQIH 5EC2B 1HL4A 4Q58C 1KTDB 3ZDYE 4Q2ZA 2PCFB 1ETZB 5I17A 3LIZL 3ILQD 3PJNA 5T1MA 2K8QA 1G43A 4ZAKC 4HISA 1EFXA 1T7XA 2WLIA 4AIEA 4LARH 1OCCB 3GHEL 3MGAA 3V52L 5KBLA 4RH4A 5DHVA 3CPLA 2K7PA 3NT0A 4YFLF 4N0UB 1PTZA 2AAAA 2FK9A 4C47A 2AJSL 4B3EA 1KTKE 1JZ8A 2A83A 1DR9A 2Z1KA 3VFRB 4OKVB 4PRHE 3LPPA 1C12B 4OF7A 5GRYA 2WIIA 1F1DA 4OD3L 4K5OA 1HJBC 4DP1X 4JRWA 4L1HA 4XCEA 1RJZA 4XCYB 1E40A 2H0JA 4N2NA 1XCQA 5GJTL 5J12B 3GNMH 4H4NA 2GKIA 2VR5A 5GSVB 4H0GA 4PRDB 3ZRCC 1BJMA 1KB5L 4XBPB 4OJFL 3DVIA 1KEML 4C4KT 4ZFQA 3GK8L 1QO3A 5L88H 3VWJA 1DJIA 3MBEC 4JFFE 4MVBC 4XGZA 1KWGA 4FKHA 5L2KD 4YHYB 4F1ZA 2O6PA 4R26H 4AGQA 1Z9LA 5B7MA 4WWID 5JOFA 1TTUA 3KYKL 1DJZA 1LK3H 2COQA 3QWOA 3L3GB 5GGRA 2RBLA 4U6VH 1B88A 1TQSA 1UQSA 3B7UX 1UWXH 2BNRB 5IKCB 2P49B 4CW1A 1BX2B 4OLXH 3ZKMC 2N7SA 4MMXA 1HHJB 1S9YA 4N2BA 1EO8L 5C07A 7CGTA 2ATPA 2H7WA 3Q8BA 3TA3D 1JAEA 5D7LE 1CDUA 2P5WE 5D7JD 5GGRY 3C08H 3NDYE 2AEOA 3HBZA 4XH2A 3S5LB 1ZHLB 3QJXA 5F70A 4NQED 3B1UA 1W72B 3UC0H 4AQAA 1JGVH 2ZX9A 3SE9H 4W9LC 3DK0A 4JN1H 3HC4L 3LZFL 3QNYA 1AQ8A 4WHYG 4TULL 2DQGH 3KGSA 4XOCA 1KFAL 3TV8A 4F58H 5DMJB 4QXUH 5AL0A 3V4PB 5I30L 3SDCA 1CTNA 2WCGA 3O0RH 5CMAB 5CD5C 3GBML 3NCYS 5CIPB 5I6XC 4XNQB 4PV9A 3EGDA 4YEEA 2PWFA 1PZCA 5HHME 1LO5A 3FTSA 4XN7A 2VDRH 3ARYA 4FTVD 5DFWH 4CADA 5EEYA 3Q7JA 1PD0A 1TF4A 4KJQD 1E4KC 4MQ7B 2Y7OA 3MRQB 4LCYA 2DBLH 5E03A 3ZHDA 3WY3A 3KPQB 3B9KB 5L9DH 2F7PA 4PRIA 1OP5H 2R29A 5IW6B 4FG4A 1RVFL 2OZ4L 2VIRB 3QEUA 2FJHB 5J6GB 3BEVB 3PGCB 4IYKA 4PGDB 4P4KB 4CVUA 1IGIL 2NCMA 4K7FB 5A2KH 3OAUH 1T6VN 2YKLL 2HLAA 1A6UH 5D7JA 1S7VA 3V5DA 3KPNA 5HHVL 2LT9A 4UV4L 2OJEB 1GRWA 1UOKA 4BGLA 3U1PA 3L4CA 1RU9L 3O8XA 2VQ4A 1UJ3A 2MQ0A 4Y5VC 3U82B 3GSRB 5A6MA 3DTDA 2NUTA 4H5SB 5DD6B 4OTXH 2X1XR 1AXSB 3WFCH 1M7IA 1PFCA 5H94B 1LO4L 4HGMA 1WHPA 2F5AH 2GUOA 3QE5A 5AEAA 5SV4A 1N6QL 2J6EL 4ZDHA 5F6HJ 1TQUA 4LCCA 1QQDA 5KVDH 3D8MA 2BHFA 2MH4A 3MLSL 2Y06L 5D1ZC 1J8HB 3S8FB 1H3VA 2ZTBA 3WE1A 2VM9A 3GJFH 1COBA 5DMIH 3EO1B 3GSVB 1NCBH 4AXWA 3II2A 4K3DL 4PJAE 3EH4B 2IDUA 1AZZC 2HPTA 1KIUB 4OFDA 5J13B 1UZ6E 2Q2LA 5C0BE 2LOEA 4JLRB 1VESA 4DVRH 5CWSA 5D7IF 3H9YA 3FO2B 3MGTB 3VFVB 1CF8H 2VT0A 3G6JE 4KUZL 4UIMA 2C3GA 2OL3L 4HJIA 3OKNB 3SDXE 5KZCB 3QEQA 2EO9A 2F8IA 3IDJA 3MOBL 2VZ3A 3ZDWA 3WU1A 5FPIA 4EI6A 4RMRA 1T2JA 4WUKL 4KI5F 4HPYH 5MP6H 2QPFA 3SPJA 4HUCA 1R5IA 2O5NA 3WUZA 1CL7I 5TDPA 1B4JH 3KNBA 4ZPVB 4WV1A 3MLXH 2E5EA 4ECNA 3WUWA 3TEZA 2VB5A 1LVEA 1QTSA 1TZIB 1OXYA 1XD0A 1NFDF 1WA2X 2I9TA 4YLBA 4HP5A 1KDJA 3LRHA 4LHJB 4WEUD 3EYFB 1SOSA 4IKKA 4ZMQA 2ZJSH 5I1KL 4IGBA 4NQEB 2IO5A 5T1LA 4Z7AA 2MMXA 4X2UA 1HS6A 2GITB 3FB6A 2B1OA 3LRSA 4PD4K 4P46D 5AOKA 3MBEB 3GMLB 2FX9H 3U9WA 1NAMA 2LAGB 3K74B 1KJ2A 1AQMA 5EF3A 3NCEB 3RHWK 2I9LB 3ASNB 1AI1L 1KBGL 2JK5B 4ZDHB 1RUML 3QI9C 4F2ME 1AFVL 1Z5YD 5JPMC 2YAMA 4HIEB 5C1MB 3D39A 1E3ZA 1TEFA 3G5ZB 2BNRD 5DO2D 3WDHA 3GBNH 4RAHA 1D5MA 2VLJE 3F6LA 2IQ9L 1AZNA 2C9UA 1GGBH 3HC3H 15C8H 3QZBA 4F9PA 3BWSA 3CHQA 3Q1EA 4ONGH 4U1JB 3BD4A 4M6ML 4JHAL 3LZNA 5GS1C 4ES9A 3D7PA 2CXKA 3T8MA 1X7QB 1R9FA 4XP9H 1NFDB 5CN1A 3G6DL 2J43A 2JJSA 4F24A 4NRXB 2IH1B 2PWDA 3GRBA 3EIFA 3MUGB 2X6UA 1QEXA 4HULB 4FNQA 5AVUB 3FO2A 1XAKA 4BSWA 3VQ1C 2EE0A 4GO9A 1CD8A 1U41A 1H19A 2ICES 2VN7A 4DK6A 3MV8B 2XU9A 2HUHA 4NOFA 1J1OL 3T0WA 4N0UE 2E0PA 2BRRL 3WFHB 1Q9LA 2YAEA 4OZ4A 4TVSa 1VZIA 4NKMB 4PS7A 3SIKA 4JY4B 2WV3A 3C9NB 1A21A 3KBFA 5DJ6A 1QPXA 3VXMA 5JXEC 5D7IB 5IFJB 1OTSC 3WY4A 2HFFB 1E28B 1QWNA 3OKMB 4RFEA 1BREA 3QYNA 3PWPB 1LO0L 4W6WB 4LFHG 1L9NA 2WLKA 2CJSA 1O7SA 3MLYL 4I0PD 1PCSA 3DJ9A 1TIUA 2C9RA 3NJXA 3PDOA 1OO2A 3GSNL 5I1EH 4K94H 3PNWB 1JGEB 1T5XB 1LMIA 3BEWB 3DETC 5C6TH 3QAZC 3VQ2C 4N2KA 3MNVA 2BVOA 1O9ZA 1A4KB 3QHZL 4ZS7H 4AJYV 2XTJE 5HGBB 1CWVA 1ZLSL 3FJTA 4A55A 1NAMB 3LJ3A 1OGAB 1K4CA 2Y6SD 5EU7C 2R0KL 2ZWZA 2LHAA 1X7SA 1P4LA 1I8KA 1XGTB 2XZAH 1UH3A 4ZAKA 3N41F 4EN2A 2PXYD 1KBPA 2ZXWB 3L3DA 3OX8A 4H13C 4KK8C 4P5RA 4QTHB 4ACTA 1CTOA 1IM9A 4OSUL 5FS5A 1OAXL 4AYFB 3HG4A 1T7WA 5EU3B 3S8GB 2QTEA 2VXTH 5EHFA 2PPDA 2BNRE 1FNSH 5E8NB 1HQRA 2G9HB 3HN3A 1BA9A 3BJ91 1HL8A 4R0LB 1JXGA 3D9AL 2R7EB 3COOA 4PJ9B 4K8RC 1WQVT 1A3LL 2GK0B 3MA9H 4KRLB 5IVXB 25C8L 2VDNL 4NFDA 3PJSA 2V7NA 5BCAA 5AVQB 2JQMA 2F5BL 2FD6H 1USQA 1SUHA 3DMMB 2P24B 4XXDA 5I15L 1W0VB 5EUKA 4ZMAT 4TF4A 2DPKA 4F9PC 1Q0XL 4FC3E 1NUNB 1DQLL 1MZZA 1XSJA 2PYFB 5AOLA 5E70A 4BSWB 4ETQB 2YKLH 3QSKB 4FP8L 4HJJH 5DURB 3SCMD 2DBJA 4KMLB 3RIAK 4UAOB 1KCSL 4H8VA 4ZYKA 3RGBA 2BVPA 1RVFH 4R4NC 1IGJA 4NKOB 2C9QA 1IAII 3E9UA 4XN9A 1OGTA 4JY4A 3LS5H 1E5BA 2Z65C 4X98B 2A38A 5IHUL 4HKZB 4GXFA 5D2NA 1IM3A 3QG6B 5D1ZD 3CFTA 1RZ8B 2NLJA 2C4XA 3QH3A 4PFEA 2EE9A 2DJUA 2QEJA 5I1CL 4L3CB 3TJHC 1LP9B 3ZYIA 2IWGA 3W39A 5IBUG 4D0CB 2A9ML 3BH9B 3QORA 3BI9X 3L4TA 2W59A 2EIZB 2XXMB 2HT4C 4G8FA 5BS0A 5C0JB 4MBRA 3UTOA 2VQTA 5CJ8A 2IAMC 3AB0C 5HYJD 3FU6A 3T6ZA 4EQ3A 5D1XE 2X7LA 3DSFH 3QUMA 4FGMA 4RGNE 5HJBA 1K4CB 5IB4A 4LDEB 3J8F7 5A43C 2JIXA 4O2EB 4U6HB 4UBDC 1IKNA 3HZYB 4LSDA 4GG8B 2GJJA 2FD6L 3IT8D 4C4KO 3U46B 2F8XC 2VMFA 1URZA 3TH2T 5JHDA 1H3GA 2FRGP 1U2CA 1DQLH 3UTTD 5BUAA 1GJUA 1JCKA 2OTUB 3G08A 4U1MA 2CIKB 4WJKB 4F8PA 1I4FA 4R0LC 5H4ZA 2VRKA 1AQDA 4MCMA 2WLMA 2O72A 3U9UA 1XIWA 2AABL 3QDJA 1UZGA 1QW9A 1QBBA 3U6XA 4ZMNA 1RFDH 2AQNA 5F7NC 1U8OB 1RMFL 4OZHB 4HU2A 4AQEA 4UMGA 2XYBA 3K5RA 5I0WA 3JYBA 2HH0L 2R1WA 4GW1B 4OJCA 2GBVA 4HALA 2A77L 5D1ZA 2KUTA 4K15A 2H26A 3RWCB 3WYRA 1GSMA 2B39A 4K73A 3SYQA 4ANVA 4KTDH 5JORA 2JB6A 3EO0B 4LLDA 2ZOWA 1PLBA 3IJ9A 5GGQL 4BHUA 4PQXA 4ZMZA 3QI9D 3WHE0 2Y2WA 1CD1B 3SPVB 2VDLB 3GC3A 2H8PB 3D2UD 5IFHL 4L0YA 1PLGH 1CICC 2QJDA 5F21B 3RWJB 3HZKB 3BXNA 4N0FB 3PIQB 3SE3C 3UABA 2H6OA 4L4TA 5DK0B 3AQZA 3L4UA 1S3KH 3VWKA 1A6VL 4ALAH 4YMPA 4WY7L 1NCHA 3WS6C 3QA3A 4JKPL 1N5AB 1AIFA 4R7NA 4RWYH 3V5HB 4CN4A 2DQTH 2BHYA 4ONHA 3RUGE 4X6EA 3LZOA 1QKZL 5BZDA 3ARUA 3BZ4B 4UNIA 3TA4D 2E9WA 3TONA 5KANI 3RZCC 2PTTA 3MFGB 3N0PB 3DO4A 4GW5A 3N9GH 2XV0A 5F1IB 1T5WB 3FT3A 4PJIE 4MDJA 1S5HA 4S1SH 3HRZC 4XC1L 2R69H 4P5TB 3PWLB 3UERA 3ZR6A 1SVZA 1P6WA 3HI6H 4ZUTB 4C56A 4PWHA 2XQYA 3QDJD 4NQEE 5MEOA 2HRPH 4TRPL 3WE6A 1JYWA 5CJQH 3OQRA 3CFJB 1B0RA 1FN4B 3TVMD 1U8JB 2X44D 4PJHE 4ERSL 3VGBA 4UT7L 1CI3M 3QEHA 5E51A 4DEUA 4FADA 3H8NA 3HNSH 3B7SA 4UYQA 4M93B 5F7EL 3FU0A 3F58H 4Y19D 5T5FA 1D7FA 4O02B 1GC1C 4AZ8A 4NIYE 4BDVB 3LNEA 4KTDL 4EIGB 2BP0A 3N55A 3I6LE 1EJOL 4ABUA 1M6OA 2BVQA 5I2IA 1T89C 3MQIA 3US9A 5JIIA 1H5BC 1ES0A 1ZLUK 3ULVE 5IWLC 3LNIA 2Q7YA 2XA3A 3L1OL 2VJ0A 2XQYK 2VDQB 3NUKA 4GP4B 3T2LA 3DVNA 3TNMB 3VFUA 3WTUA 3DDFA 2Z4QB 3QS3A 1XF5B 4OZGF 2PYEE 3DSNB 4MZIA 3IE9A 4NQCE 1UA6H 3GF8A 3MRIA 5F1KC 3AGVA 1SBBA 2ZKMX 2XKUA 1B3IA 2DM4A 4ZXBD 4XHJD 1NFIA 4AMXA 4LOFA 1CD1A 4EAEA 4HD9A 2B4CC 3H4HA 4XI5C 3EH1A 3RZCA 4YQXH 3EDDA 4XBGB 5F7UA 5IB2B 3X3FH 3BAWA 5HI5D 3ZPDA 4XP4L 3TA3A 1OV8A 3SE4A 3FT4B 4Z7UA 4YIQB 4QLWA 4UDUA 3QUGA 1CGXA 3U2IA 3V5HA 2BNUA 4LF3B 4JFHD 3I84A 5M7QA 1HSBA 5AKSA 2AQRA 4KAQL 3WTWA 4XVTL 4YDVA 2CR6A 4OLVL 3CE1A 2AERT 3RDTA 3REVB 4Z7NF 3BH8A 4P23C 3KYMB 3L7EA 4GW5B 5AW3B 5GIRB 2WKOA 1E67A 1KXVC 1B4RA 1ANUA 4HEME 1OWWA 3L2MA 4APQD 3KPSA 2YEZA 1YY9D 3U0PB 2BFVH 4KK6C 2OAAA 1A7PL 3BO8A 4U3SB 3L3KB 1ORSB 3P73A 5FF6B 4EOWL 4FLHA 3BQUB 5DSCA 2QVFB 4EUPG 3SPGA 3PHQB 3VD9A 4WUUD 5FYJD 3NTCL 4KC3B 1MELA 4IRSD 5F6HI 1X7TA 1BDYA 3TZVB 1CXEA 1D5RA 3HTLX 1YMMD 1WUNT 1BSIA 5IQ9A 4X4YA 3F7LA 2AHIA 2ARJB 4AZ8B 4R7DB 9CGTA 1OT4A 4PJGA 5E6UB 4HJ1A 1ZEAL 3IDIB 1RUAH 4OF8A 5IEHA 1J11A 3U4KA 2OMTB 4XPBH 1Z3RA 1RZ7L 3C6LD 1JNJA 5K39A 1TVBB 3NIGF 5FYLD 3T77B 3BVWA 5D1QE 2MNJB 5FA4B 3MRKB 4HUXA 3DVNB 3FUNA 3L3JB 3TPUB 1U6AL 5FWRA 3N2JA 1R3JB 1WIOA 2GI7A 5DZJA 3RVTC 1A4BA 1DQQA 1FCGA 3MRLA 2WLIB 2BVTA 3V5KA 2P3YA 4JAMA 5HYFA 4DOHE 1G7MA 4JGNA 2J2ZA 3DRTA 1UUNA 5C97A 2CLVB 1LE5B 2QPSA 1CR9H 4BFFA 1WBXA 4PJEE 4ONFH 4NI6A 2QVMA 2KZWA 5BRZA 1CYGA 2MHAB 4DTGH 1IQWH 2BP5M 4XNYL 2UXTA 4JPWH 4PREB 3FCTA 2X6VA 1WAPA 4XHQA 3RL2B 1FUNA 4CVWA 3LEVL 1H8NA 4GG6E 3P1VA 4TVPL 1P69B 3MZGB 5FYKH 2F53B 4LOVA 4AJVA 4ZRGA 5EPMB 1PIFA 2DQMA 4GKNB 2O61B 1YEKH 5FECA 1LP9E 1UCTA 1E9QA 3GEWB 3LKNB 1ZXQA 4DP4X 5T8IA 2EVIA 1WJ3A 3N1QC 4HIPA 3VFNB 3ZTJG 5IVXF 2EZ0C 4L1BA 3CXFA 4HUVA 5C08B 3IETB 2JKNA 4RESB 1KCLA 4ZUUB 1C5DB 5DJZA 1OTTD 5HHOE 1XBRA 4X7TA 2X4QB 4HDIB 4WHTB 3K6SA 4IOFD 5K9KA 1XCTB 1T6BX 4WI8A 1VADA 2HKAA 5LGYA 3KLDA 2HFEA 2DMBA 1FGNL 2XWZA 5IQ9B 1R3IL 4GLRI 4GINA 2QVKA 3LQAL 2A77H 2ZT9C 4P57B 2FEEL 1MLCA 2ZX6A 2R2EA 5JPMB 3HCVA 3O2DA 5ACZA 1DVFC 1Z2KA 1HC1A 3FOMB 5LBSH 1TQWA 1WYJA 4AVIA 3T6XA 4HJEA 1AY1L 1UWEH 4JFQA 4LCCC 1FLTX 1JPTH 1RJCA 3UPCA 3PXJA 3E6FB 1FO0A 2EIKB 1U8KA 3W9EA 2D4DA 1G6RH 4IGBD 1JZ3A 2R1YA 3C8DA 3LH9A 1Y7VA 4A2FA 3RNKA 4WFHE 3FO1A 1PLGL 4XO3A 1BQRA 4NZ8A 1QW8A 2P5PA 2GIMA 4LBEA 1YDPA 4AYGA 4TVPH 4ZNEE 3V10A 3EFDH 3HMXL 3MRHA 2APBA 6FABH 5CU5A 4YXLL 4KZEH 1O9WA 2PMZA 2WOYA 4P49A 5CMAA 1ET5A 5CBEA 5DS1A 4U7KA 1AI1H 1KBGH 1VIWA 2F58L 5FC9A 3VD4A 3QIUC 4WI6A 5E2UH 4LAQL 3OWRA 2OCJA 4EN3C 1QSZA 2UX7A 4PS3A 3QZWB 5D5ME 1UXMA 1UYWH 3MR9B 4QY8A 3UAJA 1J05A 1ZPUA 5D6DC 1SHXA 3VM7A 1I8AA 1OARL 2E75C 1LEIA 5EORH 3FU5A 4YC2C 1HH9B 2WXKA 5GS0D 3I6SA 2VOTA 4EBQH 3PGCA 3F5WA 5F0LB 4G1MA 4N8CL 2VDOB 3IEAA 4YSEA 4H7VA 2GT9B 4H1LB 3R8QA 3VXRA 2Y9RT 2BVUA 1IUZA 2DJ4A 3PUCA 5GGTL 1OB1B 4HETA 3VQLA 4NKQB 3LRLA 4QRPB 1E0OB 1M56B 1BIIA 1N4XH 4M1CD 4HUWB 4NERA 2ATKA 3GMMA 4L05A 4TQEH 5CEZD 2LAAA 3MRBB 3KVQA 1KJMA 4JKMA 4X6DB 1IAIL 2VR4A 4P57A 3OVUB 4P2YA 3EYOA 3DX6A 1AR1B 4P8QA 4U1SB 4KXBA 2ZP8A 1QQDB 1NC4B 4XAKD 5EG6C 3GSNA 2F18A 4MX7A 3QULA 5D1QA 1KLFA 1G0YR 4JFQB 4UV7L 1LO0H 3TYGL 4PJGE 2ICEB 2K3TA 1FO0B 3Q0HA 4CADB 4ANWA 1OSEA 5E24E 3PQYA 3VXME 1LEKB 1UGNA 5FIEA 3TBWB 3CH1B 1HESA 3PHAA 3QPXH 4LNRA 2X4OB 4D9RD 1OTSD 4DAGH 4QCIA 1BMZA 4QO1B 3D69B 1TMQA 2FBJL 4FLSA 4KTYA 4XX1E 5A2AA 1U92B 4Q89A 2X40A 3UJIL 1EDYA 3WN5A 5C7XL 2F7OA 3EDEA 1CGTA 1B0GB 3OMZA 2D2CC 2RFXB 1QACA 1A9BB 2Q1EA 1HXMB 2P8MB 1XR9B 3HE6B 1MG3C 2A5UA 1T83A 2UUDK 5DD6A 3NJVA 5KOVC 3V6OC 4HZLB 4NXKA 3V4VH 2N59A 1MRCH 2IADB 4B9GA 4HJTA 3QRLA 4AVHA 1NCAL 4NQCA 2FX8L 1MCHA 3QNXB 5G4OA 5IBTH 4I89A 3IPFA 3K6DA 4OCXH 1FORL 3BT2L 3QFGA 2XZQL 4QHNB 5IMMA 3RU8H 1IJ9A 2DQ6A 1FNEB 1GCYA 1FG2A 5DD3H 1OB1A 1TMCB 2CWRA 1YN6A 1SVBA 4B60A 4QXGH 3EGXA 3IJHA 2EDKA 4ZXBB 1MFVA 4JKKA 3KR3H 4P3DB 1U30A 2RMNA 1YYMH 1IIKA 4FFWD 4B6ZA 2WTOA 4NPKA 3FQNB 2HKFH 5GS2H 4LESA 2WXPA 4D7PA 2R9HD 3VFMA 3O9WB 4I0PB 4UIMB 2IPKB 1ZLUH 5IR1A 1PSKL 2O5XH 3L5XL 3WNIA 4ISVA 3JVGC 4IKLA 4NQQA 1O75A 3CZEA 3BLBA 5IMLB 1JVKA 1ZS8B 1MXDA 3F7VA 4GIAA 4QHUB 4B0MB 5FFLA 4LSSH 3JQOB 5KBPA 5A2BA 2RQEA 1SY6H 3LS4L 5EFIB 4WFGD 3UJIH 4WU5B 3DO7B 2UWEB 4NN5C 3C5SB 2VSKB 3IXAA 4GKSB 4JGJA 4XMLL 2GAZB 3TBWA 5A3IC 4RGMC 1QUNA 4RVBA 4YSQA 4PB9L 4NRXA 3GS4A 2DIBA 3FFOA 4TNWF 4IJ3B 5E5LA 1D6EA 4HCFA 2JIXD 4DP9X 5KSVB 4NGHH 4N6QA 3VA2C 1BQHA 1VA9A 4YPGA 5HYSB 1IGTA 1A6TA 3CVIL 4PVBA 3KPOB 5ADOH 3DRQB 1KBVA 3BDYH 2AJZA 2E9JA 3QEGL 4OGXH 2YO3A 3H6JA 1HXMA 2P8MA 3AT8A 2PXYC 2BSBA 1O5PA 4G3YL 2DWEB 3ATEA 1F11A 4PH8A 1FVEA 4AUYA 3MRQA 4LCYB 4UQBA 4CC1A 4D94A 4KDTC 2HVBA 4MDIB 2H6PA 3ATBA 3CV5A 4FXKB 5JW4R 3FCGA 1QR4A 1DZ0A 4MJIB 1QBLL 3GM0A 5IREA 3LKRA 5GGVH 2D7QA 1F0LA 4P5KA 1UVQA 3GSOA 4PJ8D 4TLTA 5DRXA 2RCSL 2HLAB 3BWAA 1PMYA 1DN2A 3PNWA 3T65B 4F33B 1AD0A 3WGVB 1E27A 4ATWA 1SJMA 3IDXL 3S98A 2IFGA 4IKJA 4PTUB 4G9FD 5E9DE 3ZKMD 3CJJA 5F88A 2NUTB 4U2ZA 1T04B 1WC7A 1INEL 1WA1X 5I1JH 3BQUC 1QVOA 1N59A 3RX8A 4RGOL 1TU2A 1JHLH 2YGPA 3CXDH 1R17A 4J8RB 1KC5H 3O3DB 1DBMH 3OKEB 4EVNB 4EIZC 1YN7B 4UM8A 4J8QA 1TFHA 1P1ZA 4X9YA 4FFZA 5HHMB 2DMKA 1JD7A 1IAOB 4NT6A 4X7DC 1Z9MA 2WO3B 4Y4KC 4J27A 2WO2B 1YNTF 4NM4H 1NOFA 2V7NB 4FL4B 1KY7A 1OALA 4N1CA 3RTQD 4ADIA 4QTIH 2OSWA 1T1ZA 2IAND 3HE6D 4X6CB 3T6QC 1LWHA 3HI5L 1NL0H 4G43A 1F97A 3O6FB 1NCNA 3FMGL 4HCRH 4FQXD 2FQGA 1NC2A 4PHXA 1WAAF 3CDGA 1ZLWK 5E4IA 2ZG1A 1N8OE 2PETA 3CN1A 3HUJE 4Q8BA 1QSEE 1OAZL 2HXAA 4OCNC 3ZL4H 2NY5H 5EOTB 4AC2A 3CGTA 5TQ2H 3HN5A 3W2DH 1T0NA 4WU7B 1LE9A 4H2AA 4E5XG 1MFDL 4AENB 4UAOC 3F58L 4Q4IA 3X13A 1D2PA 1JTPA 4F15B 3KCWA 4UOQA 1VFOA 3VI4A 2C9AA 2OMYB 4X42A 1WGOA 1Q94A 3T2NH 1DQKA 3T09A 4H0IA 1DBAH 2ZPKL 4GLRH 5BJTA 1WZAA 4HA1A 4GKLA 4AJ0A 5D55A 2LE9A 3M7FB 2J5WA 3SGDI 4FFYH 1UUSA 2CALA 3A4FA 4PY8J 4QRRD 1MUJB 5DD5L 2XQBH 4DESA 5J11C 5EF2A 1ZHBA 1MQKH 4QGTA 2GITA 4S1SL 1WFIA 4OUOA 2OP4L 2IQ9H 1WC7B 4GKOA 2IJ0C 3OLIA 5B1AB 2XPZA 4R9HA 1DE4A 1KJ3L 1N59B 2YBRB 2E3VA 2F7QA 1ZTXL 3QIWB 3EGSA 1MAJA 4NZRL 5T5NF 5BOJA 4NP4H 4JM4L 1PYWB 2P52A 3C09C 3KL0A 5EOQH 4PJ5A 4ABVA 5EZIH 2QKIA 4TSBL 4NT6B 1I7TA 3R1GL 5FW8A 3VGFA 3M17B 3WKML 4B9PA 3Q2LA 3I75A 5T33L 2DB8A 3NZHL 2CZNA 2XKSA 5EBMA 5CEXB 3RVUC 1IZKA 4G72B 4RA0C 4WK0B 1UB5A 1IM3B 3LKQB 3L3IB 4H88H 4BH8B 2BIQA 4LL4A 4IK6A 5DJAB 1AQKH 3O6LL 2RGSA 3FNKA 5DEJA 2F61A 2XRAL 3BT2H 1BXAA 4IS6B 4D0CA 4F8TA 4FG6D 4Z7NB 5MI0C 3OZ9H 2CKBB 1MWAA 3HPLA 2CCVA 2L7UA 1JGIA 3FL7A 3GRGA 3U7YL 3CFDB 5C09A 1NCAH 3GMOB 3BSZA 3SZ6A 2AJVH 4NHUB 4HJGA 4IRJA 4JRYE 3O3EB 4LP8A 3VH8G 2ZICA 4ODWB 3ECBB 4GRLA 3DTXA 4AUJA 2WCSA 2WXOA 4DP0X 3OBAA 3VB9A 3H3BC 4XX1G 4F5CA 2WTRA 2TAAA 4AWJC 4F3FB 4QRSB 1KIPB 5SX5H 3TX4A 3US0A 1DDTA 2WC7A 4L2YA 5BQ7B 3EXLA 1MHPL 2MJWA 2PN5A 3I3DA 3UOAB 1K8DA 1NCBL 3PHOA 4IMLB 5CZXC 5T3ZL 3RVXD 3EO9H 1JERA 2F19H 3G5WA 3EBHA 4C83B 1MVYA 2CM6A 2O5YH 4C56B 1ZAGA 3NJHA 5JMOC 1MEXH 2OULB 1FZMA 4HOXA 3VDBA 1M53A 2D3NA 3UPRA 2ZF8A 2C7UA 5T3XL 2NUPB 3EO0A 4IU3A 2CO4A 4KI5D 4X8JB 3MOBH 3AY4C 2EYTB 2IFFH 3ZKXC 3MCLL 2KLTA 1II4E 2LU7A 3O2DL 1MW1A 1JZIA 4GAFB 1HEZA 2EAEA 2W9EH 2DLFH 3N50A 4XMKL 1LDPH 4G6JL 3VM5A 3VFGH 4GRWH 4XCCH 5AENA 4G2AA 1JTOA 1PJWA 3CSTA 1Q9KA 2J1XA 2YJQA 2RJMA 4M5ZL 5KYXA 4YSTA 2WMPB 4K8RL 4DZ8B 2IMMA 2WQAA 4WEBL 2XV2A 4P0DA 4Y19E 1KCRH 4JFSA 3KJ6L 2NY6B 3D6GA 1D3CA 3MLXL 4GSUA 3MBXH 2PTTB 1P84K 4NO0A 1LNUA 3B7RL 1G7LA 4MA1B 1YEGL 4NPYA 4KVPA 3TFKD 1K5NB 2ZWNA 3MXVL 4FOMA 5IHHA 2X5PA 4IRJB 4QTFA 2X6BA 4HKZA 4APQB 4FZEH 4Y1AB 3TA3B 4JPWL 3IGUA 4PLJC 1OHQA 4IIQB 3OR7B 1I8MB 4PRIE 3VTTA 4XNXH 3FB5B 3SDDA 1GIGH 2ZNXA 5MENA 2APTA 4AYBA 1XF2B 3IJYA 4NM4L 3RE0A 4BQBA 1HHIB 3CU1A 3TURA 1H3UA 1QLEB 3HS0B 4F93B 5ID1B 1L9QA 1MWAL 2YQ3A 4WGVB 3IVKB 3LEYH 4ZW6A 1U9KA 4PJDB 5E1AA 2C1OA 3PPSA 3KM2A 4QI3A 4U6HA 1ORSA 5FF6A 1HKLH 1ED3A 5HD8C 4WJ5B 1BVLB 3MOAH 4G1EB 3FT0A 5KS9A 3FONA 4JRXB 3SE8H 3O9WD 1IT9L 3E1ZA 3EYQD 1SXNA 1MSPA 4X8JA 1HE7A 4OCSH 3IKKA 4PAZA 2VR8A 2Q86A 4HXAL 1CO1A 3HS8A 3LQAH 2DJSA 3WNPA 1M9SA 3FSOA 3RY5A 4DFIA 3MLTA 3TBVA 1ID5I 1XIWB 4LEXL 5J1SC 4P2RA 1DQDL 1KLUB 1NANI 2H0FA 2WLJA 4L29B 3TASA 3SYOA 3TZVC 1GYCA 5HHQB 4HFUH 1RPQA 3NCJH 3T0VA 4BYHA 4OZGA 3SGKA 4LRNL 4HUXB 5KN5B 4MKMA 4Z3FA 4NN5B 4M93C 2DLIA 1CT8A 4PJ9C 1DBBH 2HP4A 2OXHB 1DQIA 5JW3H 4NO0B 2RD0A 5FKPA 4E9QA 4PJ7B 1ODAA 4KVCH 4OD3H 1XX9C 4PRHA 3KPSB 4BZ1L 4ZS6D 4U33A 1FSKC 4RGNB 3FHQA 4HS3A 1HI6A 3H7BA 5I5RA 1Z9SA 2EKSA 4HCGA 5DCCA 1BP3B 1OE3A 4N3UA 3AY2A 4Y1AA 4B9CA 4AYSA 1KTLB 3BXNB 4MXVF 4N0FA 4OGYL 5D93C 1X5LA 3P30L 4MXVE 3KWTA 2A6IA 3QJTB 2JCCE 3FCTB 4QOKD 1QX1A 2LFEA 2DH2A 3KPPA 1L7IL 3O6KH 1CG9A 2EYSA 3EG9B 1NWPA 2FB4L 4NAMA 2WKGA 2H1PL 1UC6A 4M56A 2CQVA 1G7PA 2J1ZA 5D70L 5CJXA 5FECB 4PSRA 1ZHNA 4OJFH 1KEMH 5FDWB 2GTWA 5GS3A 4BH7A 3WS3B 4X8XA 4FXTA 1QYGL 4YX2H 2VZTA 4KQ4L 1TCRB 5DHXB 4GQZA 3CH8A 5HYQB 3H2QA 3PGFH 3QRGH 1BVNP 4M3HA 2PP7A 1CL7L 1SOKA 2AV1A 3WAJA 3VW3L 4KNSA 5DVKA 1F3JB 1ZGLM 2HLFD 4E36A 1JPFA 1NGWB 3DURB 2APVA 2H3KA 2UZIH 3L95B 3NP3A 4HX1A 3O45B 2VYRE 4JR9H 1PKOA 4FKEA 4M1DH 2BP0B 3KPLB 3DGCR 3AITA 3S88L 4Y5XA 3V0IA 3LKPA 1I8LC 4A6YH 4HQQL 3P4OA 4QOKB 1CFTB 2PP9A 3IN2A 4W9KC 4HEPG 4XP5L 1P4IH 4JZJB 1N64L 3MX0A 4NC2B 5GZOA 3HFFA 2F53A 2WBKA 2XN2A 4Z5RA 3CZJA 3Q6GH 1AG0A 1BJ8A 3RU8L 1EFXB 3FTWA 5D96C 3BAEH 5EO1A 3AWEA 5HGDB 4H8WH 5I0ZA 1R3KB 2CCWA 2GSGB 2I5YH 4YH6A 1GYAA 3NSCA 2Y3NA 1JRHH 2FBJH 5DRWB 4I5BB 4CC4A 4OLVH 2BP8B 1G0XA 4HIQA 3OXSA 1EJ8A 4GQ9H 4NJ9H 4F20A 1ZJBA 1NBZB 1ZDQA 5KSUB 2WNWA 2D0HA 2NX5A 3GDCA 4ZUVA 1IM9D 1TJGL 5AWNL 5K9OB 3MLZH 1J48A 3RX7A 4JRYB 3LVTA 5DLLA 4GO8A 3BP5B 5EU5B 1WG3A 1J05B 1R6VA 1N19A 3Q9PA 4DJMA 1A1MB 1LDPL 2C1PB 4G6JH 1BG9A 1MRCL 2HJLB 1A02N 2CK0L 2IANB 4J1UA 4U4BA 1OM9A 4XCNA 5JPMA 3BZ5A 5CN3A 4AL8H 5HI4D 5JIHA 1F4XL 2HJFA 4FYTA 3A21A 4X5XB 1KCWA 3CK0L 5I75B 2XZQH 2Y4SA 3SDDD 3ZKSD 4IBQA 3DJSA 4JQVA 2NW2B 1ZT1B 3HRPA 1QLFA 2MPAL 1IV8A 2PYEB 3LD8C 3QWRD 5E6ID 4I77H 3SDAA 2VXVH 5DT1H 4N0CD 1NJ9B 3D18A 4AYDC 1KJMB 3PP4L 5C0BB 5LDUA 4QRTA 4MMXB 4F7TA 4BRJA 4KKAC 5I75C 1FVCA 1YPZB 3ZTNH 4HWZB 4WV1C 1CDCA 1TVBA 3HG1D 4FNUA 4HYTB 4HGWA 1VFUA 3TH3T 4FNSA 2XX1A 3K6FA 2WZ6A 3HAEG 1E4WL 4UZUA 5D7KD 1IBDA 1T0MB 3BZDA 4YUEH 3WEBA 4KX8A 4FZEL 1KOAA 2R2BB 1XEUA 4PRDA 4AM0B 3CSYB 3KLKA 4GUCA 2FJGB 4KMTL 4UB0H 4EPSA 5J6HA 4OGAC 5LWYH 1QLRB 2PPAA 1WBXB 3T2PA 1KB5B 3UZVA 1RZGA 3AS3A 2NY3D 1RD6A 4P2QB 1XMEB 4IBVA 2AVGA 3TBSA 4CSSA 3ROLA 3JWNG 4DKAA 1DLFL 2XZZA 3E6HA 3ORJA 3LEXB 1SJEB 4P23D 4PRNB 1CU4L 1EHNA 1TZGL 4IEFA 2EDOA 4Z7UE 3RTQA 2ZWYA 1G9MC 1PZUB 4PEEA 5TD4A 2IANA 2VXUH 3QUZC 3TBYB 4MB1A 4Q0XH 4ZMXA 3UG3A 4CNIA 5FW7A 2D7TH 5IROA 3RLSA 1ZK9A 2G4GA 1XF1A 3V0VB 1JHTA 3NZUA 2VLJB 1ZHLA 3IAQA 3QQ3A 4DN3L 2O6DA 5A3ID 3BLKA 3HG5A 1YJDL 1N10A 1W72A 5DK2A 3UGUA 4DKTA 3BPLB 2DQIL 5FYLH 5IJDC 2X4OA 1VADB 1MCDA 3N85L 3KHOA 4H8WC 3UAJC 1XB6A 4UU9B 3D18B 4IMKA 1E4HA 4JBSA 3BUIA 5CR8A 2XBZA 4LRNH 1CFSB 3K2MC 4P4RB 3ARDA 4JG9A 1FC2D 3HJEA 2B16A 3UTSA 4LLQA 2W0KA 1L5GB 3GPEA 1BPLB 4HGWB 2BSED 4N2EA 1GGTA 1I1AC 1BYOA 4KKBD 5C70A 1BZOA 2XWTA 5JIQA 4R6UA 4ZX4A 2PCFA 3EJCA 2PPEA 5GSRB 3FO1B 1XEDA 4U1LB 4HG4J 4QJ4B 5E1QA 5FLVA 2EO1A 4BWTA 5HJ3A 5B7EA 4HC1L 2VKWA 4OCLC 4B9FA 1YYLL 4FZ8L 4FXGB 3B9EA 1USZA 4LSTH 2AITA 5KSVA 3DHPA 2IGFH 5EBLA 2ICEC 2WW8A 1YRKA 2UY7B 1OSZA 3K1KC 5FX3A 5HP5A 1KXTA 1UACH 1U3HA 1U3NA 3WTXA 4JHVA 4H8PA 4PLKD 3ELQA 3LB6D 3BYTA 4QRQB 1Y18A 3ZSSA 1NDGB 1T1WB 4XPFH 4PBVC 5HHXH 4WEMB 1EEZA 1OLZA 3GBEA 4XBPA 5FKAB 1IEAB 4FXKA 4BA8A 4F37K 2ZWLT 1RZFL 5LCVH 1HH9A 4TSAH 4EKXA 3LKSB 2XLLA 1QO3B 3TM6A 1A6ZA 4J6IA 1RU9H 1YEJH 5E8OA 4AT6B 2AMUA 4EDWH 3MV11 4EDXB 5J9PB 2VLJA 3QQ3B 2KKQA 1BPVA 4KO7A 1EGJH 3FFCA 3MRDB 2XVGA 4ODVH 1GHFL 4I9XA 1E27B 5IVXE 1AJ7H 1MJUL 1CN4A 3GRWH 1ZANH 2GAZA 5EMYA 4GBXA 5KVDL 5TE4L 3MBEA 3S48A 4CVZB 4M6AA 1VCAA 4P9ML 1YEIL 5J1TC 4MWFB 3S35X 3H3PL 4GOSA 1HKFA 5E6IB 5CD3A 1I3GH 1SXAA 1RZIB 5I71B 3KGUA 5KVMC 4NQXA 1FNSL 1NAKH 1TQCC 5D4HA 2JV6A 3B7YA 4KXAA 2ZXDA 3UTZA 1N7ML 1IQWL 3KVDD 4XNYH 4LSTL 3T3ME 4YAQB 4CC4C 4TUJB 4FNLL 4JDEA 4W9IC 5CHNA 5CINH 5D4IA 1YY8A 1NLDH 4LRIC 3S5LG 1WO2A 4K23H 1R46A 3N40P 4WV1B 5D1XD 1O0VA 1TTCA 5I74B 4B7LA 3S3JA 2P80A 2ALWA 3HBPA 1JE6A 4TLSA 1MAKA 1H8LA 3O3BA 1KJVB 1IBGH 1JZDC 4P5KB 5K59F 1DVTA 2EDJA 5LAXB 1FFNB 2GG1A 4OLUH 3GYRA 2BCKA 1CVSC 4LLYA 3EGDB 4RZKA 4X5PA 5CLXA 5AYTA 1REIA 3IU4H 4YSSA 2EVJA 3E8UH 4O51B 2ZX8A 4ZUSB 1GSKA 2WUBL 1TTFA 3FSZA 4QRUA 1IC4L 1E8WA 1ND0B 1GAFH 2WWMD 4M02A 2W92A 4GW4B 4YK4B 1QI3A 2ZXQA 2OMVB 1ZVHA 4OZFA 1MFCH 1KJ2B 5ADPL 1L3NA 3DIDA 4G42B 4P99A 3P11L 1AGBB 1IKFH 3DYPA 1K8IB 2FWUA 1AJ7L 1QPKA 4QNPF 2B3RA 2DLFL 4O58H 1M7UA 1PZDA 1K2DA 1ZRUA 2V9QA 1E4JA 1ADQL 4JFED 5IV2A 5BJTB 2NY7H 5EUOE 3VU1A 2X41A 2WXQA 2JKSA 4F7MB 4X50A 1URLA 3BZEA 1HWGB 4N0YH 2L7QA 5DWUL 1FZKA 1M2VA 1DDHB 2XA8H 1YN6B 4MA3B 4DKEL 3LXUX 1FYTB 1SYSB 2MNWA 2OJEA 3EGXB 1KDIA 3IJHB 4XR8C 3TIDB 3VYNA 1EBAA 1IBHA 3RB5A 3WKQA 5EEUA 2ORBH 2O5YL 3UZEA 1BFVL 5L2KA 1OGAA 5JHDE 1NLDL 3ESNA 2SODB 4LKXA 1BM3L 5ICYA 1I8KB 35C8H 1IBFA 2BZ7A 3MJ6A 3Q13A 4I0PA 4HOZA 3ZDXE 2BOCA 3V4VB 1OGAD 3SO3B 2FX7L 2VW7A 4NYLA 1FE8H 4GIOA 4YAQA 2ERJC 1SN0A 2D2OA 5GHWH 2B9AA 1YG9A 4NENB 4ZFFB 3MBWB 4PJGF 4CGUB 1SDAB 1P7HL 1XSIA 2N1KA 5ICXA 5C0CD 2BWIA 3DX9A 2I24N 4L3FA 1K4DB 1U8PA 4GAJH 5ALCL 2DKSA 2EDXA 5IFJA 3ULSB 4F2EA 2CK2A 2D7TL 5T1KD 3K6OA 5EORL 4MXWL 2YD3A 4N87A 4IBWA 1HINH 3O3BB 2JJTC 1V7ML 3KW7A 1PU0A 3CIAA 3V79C 1IGIH 4LGRB 2CDEA 3FK3A 2GSIA 2DDQL 3F05A 1IGTB 3PAVA 1JGEA 1RUPL 1TCMA 5SV3A 2G3ZA 4AG4H 4V1DD 2Y5TB 4UZGA 4S0TD 4X8CA 4NZUL 5TE6L 4BWWA 3UGEA 4X9IA 3RGVC 3MV9E 1F11B 2AJSH 2YSSA 3BKCH 4ZPVA 2GFBA 3B8YA 1J0IA 3GSQB 3ECBA 4GRLB 3ML8A 1S9VA 2M1KA 1ZLVH 3W1ZA 2ZKHH 4ZS7L 5IOKA 2DQTL 4XMXA 1PQZB 4Z7VE 2W07A 1AZBA 4PN6A 1AG6A 2D31B 5A40E 3M17A 5CJQL 5A6LA 3DHJA 4RMQA 2OI9C 3PJSB 3U0WH 3NVQA 1K8DB 1KGYE 3PHOB 4JFDB 2E76C 1GTFA 1KGIA 2R69L 5ISZD 4JFZL 4WF7A 2DYPD 1M42A 4B9JA 1JFQL 2EC8A 4C83A 3HNTH 5HHNA 3QJZA 5D72L 5DJAA 4BKLA 2X3CA 2N7AA 3LZPA 5FB8B 2HT3D 2VISB 4GAGL 2Y7NA 4HIJA 5LAPA 1DEEA 4L1DA 4JZNB 4EVNA 4O2CB 3GI8H 1ZT7A 3K0YA 5I1IL 5ID0B 1P1ZB 5K69A 2OQJA 2Z6FA 3RL1B 2R2HA 1SJVA 3MKKA 4R7LA 3GMOA 2A6DA 3HHMA 4U1JA 1AGDB 4DQOL 4AI7A 5L9DL 4ODWA 4UQEA 4X6CA 3FRPB 4Y89A 5F9AC 3CSGA 1R4XA 5GRWA 3UJTH 1UZ6F 3O6FA 2WMPA 4S10A 4KZDL 2GC4C 4XVJH 2B5IB 3PYCA 4DZ8A 3S37X 4DWHA 3VYPA 3WTYA 2EE6A 1EGJL 5CJBA 5EU6E 2Q9OA 4WCYL 1F56A 2ZYSA 5JDSB 4JMXA 3ULUF 3LZRA 2AKRB 2IOOA 2Y07H 5K59E 1LWJA 3HVNA 4GI8A 4U7MA 5IT2H 3GI9L 4G7RB 3SGEI 4OZ4B 3KMDA 2X2HA 4HWBA 1KCBA 1ZS2A 4POUB 3O11A 1PDKA 3CFBA 4X83A 2DQDH 1TJMA 3NPSC 3NZ8A 5T1LD 2WANA 3CFQA 4OCXL 3SJVA 1X9LA 5D7IA 3ZDZF 1FZMB 4HJSA 4M1DL 4MB4A 5FYKE 2F0CA 3VNYA 1R0AH 1INDH 3DV6B 5IGXL 2P1YA 4J6RH 1KLGB 2YRBA 4K2UH 3W11C 4DGUA 2R4SL 4KKLC 1TTGA 3Q1SL 5EEVA 3TVMC 2NT0A 5KVFH 2COVD 2CGZA 1OCWH 3QXAA 4LCIH 3WHXB 5BZDB 2NW3B 1I4FB 1N64H 2KH2B 2VDKB 2V2TB 2NYYD 5L0QC 5FDYA 3HE7A 4PJDA 1ETJA 2YUVA 3U9PH 1UWYA 2YQBA 5SWSA 3F65A 1VCBC 3C8KA 3F7KA 4PS8A 2W0LA 3QQ4B 2J88L 5DTFA 3EYUH 4GSQA 4PU2A 2KS0A 5DDHB 2FEDD 2FL5B 4IW4C 5BUPA 1S9XB 3L3DB 4C57C 4EUPA 4RMSA 1BQ5A 3ME0B 4I8DA 3T5WA 3H9SB 2YPKB 3HUJB 5FXCH 3DO3A 2XQ0A 2WD0A 2OQJB 5F3HA 4LOUC 4NPYB 2X88A 3OKOA 5INDA 1QD0A 1KT2A 5IESL 8PAZA 3TF4A 5CEXA 3BP6B 1N9PA 4I3RL 4R97C 1TYEB 2C5DC 1GGIL 4RBPH 3D12B 1G9NH 4H1LH 4UIKL 1G7QB 3HIZA 3PE9A 2E7MA 3U7YH 3IDMA 4JFEE 3CVIH 4D8PB 3DPBA 1TLKA 2IBZX 1T66C 3CWGA 3LN5B 2Y22A 4LASH 5DEFB 4PJEA 1P5VA 3ZK0A 5D7LB 4QRPD 5F72S 3UG4A 1AAJA 4FL4C 1G9MH 5ETUA 5B39A 1JXKA 3PWLA 1RJLB 2LFGA 1TETH 2GHZA 4FD0A 4OIIH 1WDAA 2HRLA 1Q72H 5K5YA 3WG7B 2RCSH 2QPEB 2PKDA 1RZPA 1YMHB 2ZX5A 4MZ3A 1GKEA 1BEYL 4LVEA 3RWIA 5ICZA 2VZSA 3A3YB 5DQJB 2VDPB 4G80A 1J5OH 3B1TA 5FW6A 2EUZA 1CG9B 2EYSB 5FO2A 2GPZA 3EYSL 4J3VA 2ZYIA 25C8H 4MHHG 1RERA 3QB7C 5IBUB 2EXWC 2NTSP 3DX3A 1GY2A 5DZNA 4BUHA 4Q6IA 2AI0L 4QXWA 1GZPA 4D0DA 2L0DA 1A9EB 2GJPA 3TLRA 5ECJE 1AANA 4WTWA 5L4MA 4U31A 4X0NA 4A39A 1PZ2A 1OAKH 4U3SA 3B2VH 4LRIA 3T04D 2I85A 4UT9H 4MNQB 2FL5A 4K9EC 1D6VH 1BVKA 2NZ9D 2OL3B 4Y19A 5F9JA 4E68A 4TVPD 4M5SA 5D7LD 4IOSA 3CXHK 1TYRA 4I77L 1FVDB 5JHDB 2QR0A 3IGAB 4P23A 2ZOTA 4PJ7A 3IJSB 5CGYC 4XXCA 3CFEA 2BIHA 3WSQL 3CPLB 1V7NH 2JF1A 3SKMA 2D03L 4JM0A 3BUPA 2BSRB 3Q8AA 4I48A 4MQXD 2Q3XA 3MBXL 3N43B 1MCPL 3CDZA 3EOTL 3IMRA 4HGKC 5BS0E 1RK7A 4Y5XB 4FG6C 3UBXI 2EVHA 4YEFA 4L37B 5AW9B 3PL6A 3L6FB 1SFHA 3ETTA 2WJ7A 4MJ2A 4U1HA 5IFAL 1G84A 5IVZB 5JHLL 3ABMB 3PDGA 4WWKD 4DGWC 2QDWA 4XCEB 1AKJB 1EXHA 2KDYA 3RBSA 3L7EB 3O41B 2VH5H 1EK3A 4HIHB 4LPVA 3NK4A 2AV7A 4K9JA 4FRWA 5DZLA 4GKZA 1KCKA 5C8JB 1X5XA 1IAKA 3C75A 2X2YA 3HNTL 3WS3A 5D1QC 4W68A 2O30A 4P9HL 5IF0B 5JXED 4C56E 5E6SB 3KPMA 4XGZB 3RWJA 2J6EA 1P84J 1WTLA 2DW5A 2BOLA 4KV5F 1MCOL 5HGAA 1NPUA 1IIIA 5DSCB 3S4SB 1FWXA 5KW9H 1E8YA 5BOPA 3F7YB 4HFWB 4HMDA 1ONQB 2FO4B 3LPFA 3AXIA 3DK2A 3F6JA 3O45A 3B4NA 3VTMA 3LZLA 1LO3H 1KTRL 1KGCE 2ARJA 3SDXB 1BVOA 4GKNA 2HJLA 1NGYB 2FH6A 2Y0SA 1VZHA 3ZT5A 3WGUB 3DVGB 4KDVA 1RFDL 2VDLH 1BD2E 4AEHH 1CK0H 7PCYA 2X2UA 5JXAL 1BAFH 2A74C 1ZGLP 3MRKA 1Q4NX 3VI3A 4IM8A 3ZL1A 2ENYA 3IETA 1DVFB 4ZUUA 5IZ7A 5ILTL 3CZSA 3V7MA 2XT1B 5B1CA 3D50A 5C0RH 2HTLC 4DF9A 3EJTA 5ERWB 3T8VA 5JOEA 5D2LB 1ZIBA 1MHEB 3INUL 2ZCLH 4I48B 5E99H 4F7TB 3RWEA 3PABA 3FTGB 4WGWB 5C0CB 1MLCB 5GRVL 3CDZB 1R24B 5D8JH 1XGPB 2UV3A 5E94A 5I71C 5GQBA 3PJLA 5F0JB 4G8GE 3E6FA 3Q9QA 4AVJA 3L08A 3QIUD 2A9MH 4RLDA 5T1MB 1E3FA 4LQ1A 4PJIF 3G9VA 3DKHA 1INDL 3OLDA 4YHIB 5I9QB 3WXWL 3ESMA 5TE4H 5IF0A 1UM5L 2I60H 3MLUH 4NO5A 5HYIA 2IG2H 3O4OB 2GVYA 3KPMB 1JVLA 1MIEL 2X4SA 4YE4H 3FSAA 4Y5YB 3BUDA 3B5HA 5GS0C 1E42A 4ESKA 2CDGA 4F27A 1HZHL 1U8MB 3D4ZA 3M7OA 3ROLB 2MWCA 5AB0A 3O2WL 4KGLA 1M7DA 4RZCB 1MJ8L 1ORQB 4V2BA 1CGSH 2DF3A 5DHVH 1OQXA 4KVNH 3UMNA 5LXGL 5KVGH 2NR6A 5DK3A 2DM2A 2V9UA 2DBLL 1C5CH 1LEIB 2YD5A 1HNYA 3HCVB 1IBYA 2G2RA 5DC9B 3RI5K 3V9CA 3NN8B 1BQLL 4DGIH 5EU4A 1T22A 5C3LD 4UILH 3F5WB 4L8BB 1J8HA 3IRCA 2L7EA 1UM6H 2Q76B 4WI3A 2BHUA 3W9EB 3FKUS 1IB5A 1XGZA 1JZ7A 3QNZB 4ZQTA 5IJKC 3PQYE 3VRLE 4PRBA 5EF0A 2IXQA 2Q3AA 1E4KA 1QATA 1TZOA 1R3LA 4APXB 1O7DC 3CSYA 1LMKA 2WYIA 4P9MH 1DQJB 4B97A 1HT6A 4ETYA 3EJYC 5AB9A 5INCA 4CW1B 4NNXB 3MTRA 4PJFE 3MLRH 3B9DA 5ADPH 3G3LA 5DFVD 2YR3A 3AABA 4YOKA 1BEYH 1MCRA 3BIKB 5IEHB 1OF2A 4OB5L 3V4UL 3NJMA 4U1SA 4DW2L 3MRRB 1BFOB 1T3FA 5E94B 3VFRA 4J3XA 5B1KA 3T8XB 3TBSB 3CFCL 1L3WA 3QZNA 4XNXL 5EU7E 4JKPH 2Y06H 4G5ZH 5I0VA 3K72A 4WNQB 1L9MA 3EADA 3SKNB 3MRFA 1R3JA 1EV2E 4TOYL 5HBBA 2CJUH 2V7HA 3GXMA 3NACH 2FHCA 2X1QA 4R84A 1M3JA 2MSPA 3TP4A 2OZNA 1E7VA 3NEEA 2NY1D 1DQVA 2VLRA 4WW2C 3WLWD 1DBJH 4BFGA 2KZKA 5FV2A 2ZX7A 3TNNB 1P7KA 1L0YA 4XNQA 1ICTA 5DQ9B 3BDYL 4ZUVB 3QWQB 1DLHA 1E9PB 1WWBX 4GXVH 3WXVL 5K9QG 4XPTL 4F37F 2H5UA 2B4CH 5E2VL 4R8WL 1K3ZA 1XH0A 3LNFA 3T0BA 4A66A 3QDMA 4I85A 3O6FC 3K2KA 4LSUL 1QSEA 1IO4C 4PGCB 4XPBL 3S5ZA 4AQ8A 3UTQB 4URKA 1D5BB 4LLQB 3D39B 4LZKA 2QSQA 2AANA 1E9OB 2ZUSA 4Z7UF 3VFNA 3NABL 4AT6A 3KWWB 7FABL 4FHKA 3O8XC 4D3CL 4JQXA 1FIGL 4TVUA 3HW7A 4UQ3B 4CSTA 1QLFB 2PW2A 2ATAA 4GS7B 1I8LA 1SPDA 1VEOA 3CHSA 3AS1A 3NESA 5IHWA 4P3DA 3QFJA 2QQNL 5DZAA 4UV7H 3DBXA 5D9SB 4YZWA 2E7LA 1BM3H 1AXSA 4EN3A 4JDZB 1N2RB 2YD6A 4XNDA 2FECL 4ENED 2XV3A 5F8RC 1P4BH 2YKKA 2WWMC 1Q8MA 1OSZB 4BFKA 2IPUG 2VH5L 3TC9A 3RTLA 3ARWA 1NFAA 1UWFA 3AU0A 5IMLA 3LXAA 1HCZA 1CTMA 3RNQB 2HFGL 2Q5BA 4JRYD 2X4RA 1NIBA 1WD8A 1UCBH 2Z8WC 4LL9A 4NQVB 4NXSA 4QRQA 5GRXG 3RGVD 1QA9A 1U21A 5DFAA 4B0MM 4RMBA 1DP0A 3MROA 5IW6A 4L0ZA 1C7SA 5DUMH 4LLUA 1TZGH 3CN2A 3L8QA 3INOA 4GEIA 3ZDZB 2B15A 1KB5A 1OCZB 2WBJD 3BP7B 2VXUL 4M3KB 4YPGB 4X6FA 4QKXB 3GJFB 4NCC1 4AYID 5FM8A 3D51A 2VDLL 3OHMB 1S7SB 1CVRA 2VERN 5FHAH 3SGDH 5F6IC 3VD7A 3L3OA 4Y1SA 1XD1A 2CGRH 1PZSA 2UVFA 4J28A 1V3LA 2CLRA 3WDIA 1N68A 2F1AA 3EJPA 2CHZA 3WI9A 3GJFK 3M1BA 4P2RD 2ED9A 2Y1YA 3ZT7A 4KWUA 1GY1A 2ICWJ 4RRPA 3V0VA 3RA7L 4QJ3B 1GW6A 3NFNA 3US1A 3VFTA 1I7RA 1AGEB 3AXLB 1ZTXH 1QFWM 4ZPTB 2W9LA 4OSUH 1P9MC 4RCAA 2O1AA 4XX5A 1E7UA 3OKLA 4OCMC 2NSMA 3PWNB 4IRSC 5BV7H 4QHKI 1IC7H 1EHLL 4NRZB 5ACLA 3RUGB 4BBWA 2GIYA 2I27N 2IALB 2WN3A 2EIEA 2AK4B 2QSCH 4OBSA 2OYLA 3ARZA 4K3HA 3FRUB 4L9LB 1UKSA 1RKRA 3VJ6B 4TNGA 3GSWA 1K6QL 1CFQB 5K9QI 5EOQL 1J1XH 4DTGL 5F9OL 5CKGA 2Y1AA 3NBNA 1E4XI 4IU2B 1R75A 4P2OA 1ND0A 1CFVH 2VL4A 3NRQA 1MFEH 4M1CC 4A2EA 5F3FA 2VLLA 2BSCA 1DFBH 3QZOA 3KAAA 5E1GA 4NQVA 5HJDA 4PJHB 1GGYA 5DO8A 1QA9B 1T66D 3B83A 5TH2A 3MLVH 3FU8A 2R0ZL 4N22A 2E8ZA 4PRID 3K2IA 2JKWA 1KYAA 3PAUA 4KO6A 1KG0A 1RHHA 4G7YH 2LV4A 5BRQA 3HN8A 3LKOB 2JKIS 2VE6B 2H3XC 3ABZA 4MB3A 2EDRA 4RNRA 2ADYA 3NSDA 3WEOA 4O2FA 5ESVB 1CE6A 2YXWA 2FIKB 1IX2A 4G8AC 4G8FB 3RQ3A 1BAGA 2Z8VC 4RX4A 2Q20A 1G1CA 2VO8A 1E30A 2FATL 5DQDL 3DHMA 3RA7H 5IEKB 3V9EA 3GMLA 4DK5A 5I1GH 3M86A 2DQJH 1J9TA 3PWPD 5ICYB 1NC2D 5CXPA 2EDEA 1UD8A 1GGIH 1I7ZA 1XXDC 4ZODA 4F8LA 4K2UL 3WL9B 4QNPE 3FO0H 5E00B 4UINL 3L54A 4FG2A 4RSYA 4ANXA 4MJHA 1S7TA 4IKIA 1F6LL 4PV1C 4I1NB 1PPIA 4EI5A 4E9RA 1MFBH 4N8VA 1FRGH 3TTSA 3F85A 4J39A 2EDMA 3NIFE 2V3EA 1ZHBB 1RUMH 2BS8A 4FQCL 4U1IB 5CIPH 1QBMH 4NKIH 3CX2A 4NRZA 1NOAA 3F2LA 3VCLB 3VD3A 4IIQC 3RVUD 2AK1L 5AYUH 4HIXL 1A1NA 5ITBH 3KL5A 1D9KB 5AAPA 1GOGA 2ZQKA 3EGSB 3IMBA 1VKXA 4LEOA 1F6FB 2XWBB 3BKJH 1YNLH 1KNOB 3Q2WA 5EEWA 5ESAA 4JS7A 3FYEB 4XMVA 3DMMD 3F8UB 5KTEL 2E9GA 4I3RH 4FYSA 2PWEA 3VXSA 5EBMB 3LMJH 3VDAA 5AZ2H 1KGUA 3SKUD 2X6MA 4M8VA 2NNCA 3V0AC 1BMWA 1PZ3A 3L3OC 3OHXC 2RR3A 1BLNA 3DX2A 4N5EC 2ZIDA 4Q6YA 1C1EL 1R5VB 3TVMA 4N5UA 4MNGB 3WOVA 5B4MC 3MV7D 1OPGL 2YFNA 3CQQA 1IVTA 2X09A 5F89B 2MCAA 3FN0H 2P44B 3PDDA 3BRGC 3ML9A 3RWGA 4HVBA 1PG7X 2DYPA 3IF1A 4XN8A 1I7UB 4WFGE 1A6WH 2VMCA 3NZ8B 1ACYL 4HJGB 3RIKA 2MCMA 4ZI8A 3ZHFA 3CVHA 4F8NA 3BVTA 1RZ8A 2H3NB 2ITFA 3QH3B 5DJYB 2DEXX 3QUYA 5DD0L 2OR8A 4LB8A 3KGRA 1AZCA 1KIRB 2WZAA 5F6IB 5EU6A 5IB3B 4HLZH 1DQTA 5KS9F 4L8SA 2VJ8A 4GQPH 2HRPL 4TRPH 1FLRL 2R7EA 4PJ9A 3UP1A 3KJ4C 3CC5B 1FZKB 4MA3A 2NY2C 3MI6A 1DL7L 4ZD3L 5FUZL 3X1BA 4U7SA 1DCEA 2JCCA 3DOSA 1FYTD 3IMTA 4KJQC 1W0VA 2NNRA 5EUKB 2CHWA 4L4VA 3Q2CA 5IB4B 2F53E 1U2HA 2HTLD 4HPOL 2OK0H 3BFWA 2QLVB 4U6XB 1UXWB 1JWSB 2OS7A 3KJ4B 1WZ1L 2NUPA 3D3VE 5FM5M 4ES8A 5A2LH 5EO9A 5ESAB 4IHOB 1B2WL 1AXIB 1P7BA 4KJWC 4ELKB 1OL0A 1QASA 5DJXA 5CBAA 4PJ7E 4PJ6A 1IAIH 2XBTA 5ICXB 3FQWA 4NHUA 3RVWC 2CE6A 3O81A 4N86A 1K4DA 1IFHH 3P0VH 5SX5K 3QG6A 3EOBB 1N67A 1XF4A 2BH0A 4LU5L 3ARRA 4QHPA 3SZKC 2WLLB 4ZO9A 4LLWA 4TNVK 1GC1L 3W39B 2V9TA 2DI9A 4Z7VA 4PLJD 1XSOA 5IBLD 3R06B 4YBQC 3OKYA 3DJTA 4HF5H 2VABB 3UTTA 1N0XL 2HFTA 2UWEF 5E7FA 3IKCA 4FULA 4PRAB 2VMJA 4AENA 2FZ3A 5I9QC 5I1LB 3SYPA 1RIUL