2RUCA

Solution structure of the peptidyl prolyl cis-trans isomerase domain of human pin1 with sulfate ion
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title The C113D mutation in human Pin1 causes allosteric structural changes in the phosphate binding pocket of the PPIase domain through the tug of war in the dual-histidine motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 28
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rucA00
3JXVA 3KAGA 4BF8A 1YATA 3O5MA 4C02B 3JYMA 3UQIA 5HW6A 1B6CA 2KE0A 5DIVA 3TDBA 2MNTA 3WH0A 4FAPA 4DZ3A 2XP3A 1JNSA 4DROA 2PPOA 4ODKA 3RGCA 2DG9A 1Q6IA 1QPFA 4O2TA 2ZQVA 4JFMA 5DIUA 2XP8A 1FKKA 2M1IA 4ODPA 3RFWA 3KAFA 1KT1A 2PV2A 4DRKA 4DRHA 2LJ4A 2ZQTA 4ODOA 4QT3A 1W26A 1C9HA 2ZR6A 3KCEA 3O5KA 4TW8A 2VN1A 4FN2A 5DITA 1J6YA 4W9QA 3O5GA 1T11A 2LPVA 4G2PA 4U84A 1TCOC 1PINA 3PRBA 4TYOA 5HWBA 2L2SA 3H9RB 1J4RA 2KR7A 2RSEA 2RUDA 2PBCA 4DRPA 1J4IA 1FKJA 1ZK6A 3NTPA 4JFIA 4DH0A 2F21A 4DT4A 2XPBA 4TX0A 4ODQA 3O5EA 3UF8A 1Y0OA 3KABA 2AWGA 3O5IA 1D7IA 2RUQA 3IK8A 3TCZA 1YW5A 1FKSA 2KO7A 2D9FA 2MLXA 3I6CA 2ITKA 3JYJA 2MPHA 2ZR5A 1Q1CA 3CGNA 3KAHA 4LAVA 5HTGA 1FAPA 3OOBA 4MGVA 2XP5A 2Y78A 4GGQA 1EQ3A 2MLZA 2UZ5A 1ROUA 4NNRA 5HW7A 3UQAA 1NSGA 3PRDA 1A7XA 2FKEA 4W9PA 1FKHA 2ZQSA 1M5YA 2RUCA 1N1AA 1QZ2A 2XP7A 5HW8A 1ZCNA 1P5QA 1QPLA 3PA7A 2OFNA 2KI3A 3EY6A 4JFKA 4LAYA 4QIBA 4G50A 3B7XA 4JFLA 2Q5AA 3KZ7A 5HWCA 3O5LA 4QT2A 2RURA 2KGJA 2KFWA 1BL4A 4DRJA 3O5QA 1HXVA 2MLYA 4ODRA 3UI4A 3FAPA 2ZQUA 2PV3A 4R0XA 4ODNA 1EYMA 2M08A 4W9OA 5B8IC 4TW7A 3NI6A 2XP4A 4ITZA 3IKGA 4ODLA 3LUOA 1FKTA 5D75A 1FJDA 1PBKA 1ROTA 2PPNA 3GPKA 3ODKA 3O5FA 2ZR4A 5I98A 3O5OA 1Q6HA 4ODMA 4TNSA 4U85A 5J6EA 1JNTA 2PPPA 4IQCA 1JVWA 2VCDA 4U86A 4DRQA 2LGOA 2XP9A 3O5RA 4JFJA 4DRMA 1D7HA 3IHZA 1D7JA 1U79A 1F40A 1NMVA 2LKNA 2F4EA 2RQSA 4DRNA 4J4NA 4DZ2A 1FKIA 2N87A 3CGMA 5GPGA 2IF4A 3UQBA 1FD9A 5HUAA 1FKFA 1FKBA 1FKLA 4TW6A 4J4OA 3VAWA 1BKFA 1FKDA 2XP6A 3NRKA 3O5DA 1Q6UA 2DG4A 1L1PA 2DG3A 3KADA 1NMWA 1J4HA 2MF9A 4IPXA 3TC5A 1FKRA 4N19A 4MSPA 3KACA 3O5JA 2M2AA 4LAXA 3O5PA 5HT1A 1KT0A 2FAPA 3UI6A 2K8IA 3UI5A 2PV1A 1F8AB 1D6OA 1FKGA 3KAIA 2XPAA 4GIVA 4JYSA 1R9HA 3IKDA 2JZVA 4DIPA 4DRIA 4IQ2A 2F2DA 5BXJA 5HKGA 3MDYB 4LAWA
chains in the Genus database with same CATH superfamily
3JXVA 2YBUA 5DIVA 2MNTA 4FAPA 3WIJA 1FFRA 2PPOA 2DG9A 5DIUA 3ALFA 2DSZA 1HJWA 1ZBKA 1ZB5A 4MNKA 1HKJA 2PBCA 4DRPA 4JFIA 4W5UA 1SR0A 4TX0A 1X6LA 2KO7A 3QOKA 4U86A 2O9OA 2MPHA 1FAPA 3OOBA 2XP5A 2PN0A 2Y78A 4GGQA 2A3CA 1ITXA 3ARWA 1HKMA 3PRDA 2FKEA 4W9PA 2ZQSA 4L72B 1OGBA 1QPLA 1LL7A 4JFKA 4QIBA 1JCHB 3B7XA 3BMBA 2Q5AA 2KGJA 4DRJA 4DWSB 1HXVA 4ODRA 3FAPA 2PV3A 3NI6A 4ITZA 1ROTA 3ODKA 2WLZA 5I98A 4ODMA 3FY1A 3CHEA 4IQCA 2XP9A 3B9AA 1D7HA 2P4VA 1U79A 4S3JA 1NMVA 4DWSC 1SYTA 2B5UB 4J4NA 1W1VA 1FKFA 1FKLA 1BKFA 1FKDA 3NRKA 4Z2LA 2A3BA 2DG4A 4WJXA 1L1PA 1LG2A 2DG3A 3ARYA 3KADA 1NMWA 3TC5A 4IPXA 4ZS6A 2AOSA 5HT1A 4MNLA 3B9EA 2K8IA 3ARUA 4P8UA 4S3KA 1D6OA 1FKGA 4P8WA 2IUZA 1W9PA 2JZVA 5HKGA 4G2PA 1WNOA 3ARSA 3O5MA 2KE0A 3RM8A 3ARPA 1CTNA 2XP3A 3CHFA 1IX5A 1Q6IA 1EIBA 3RFWA 2DSVA 1KT1A 4KR0B 4QT3A 1W26A 2DT3A 1K9TA 1GPFA 3WD3A 2LPVA 3WL1A 3PRBA 3PRAA 1J4RA 2RSEA 5GPRA 1FKJA 1ZK6A 3NTPA 2FDMA 2F21A 3O5EA 3UF8A 3GU0A 3KABA 4WKFA 1LQ0A 3O5IA 1D7IA 2RUQA 1YW5A 1FKSA 3WD0A 1GRJA 2MLXA 4IT4A 3JYJA 2ZR5A 1Q1CA 4MGVA 1UR9A 3WQVA 1EQ3A 1OWQA 2UZ5A 4NNRA 1WAWA 1M5YA 1JNEA 2RUCA 2XP7A 2G41A 1P5QA 2OFNA 4WIWA 3EY6A 4Z2GA 3WQWA 3ALGA 1E6ZA 1XHGA 4NSBA 3G6LA 1X6NA 3KZ7A 1HJXA 3W4RA 4WKHA 2MLYA 4MTVA 4R0XA 4W9OA 4ODNA 2M08A 1FJDA 1TFVA 1FKTA 3GPKA 3O5FA 3ARXA 1EDQA 4U85A 4MPKA 1JNTA 2PPPA 4Z2IA 1JVWA 3WD4A 2DT2A 3O5RA 4JFJA 4DRMA 2ETNA 1ZBWA 3WD2A 2RQSA 4DZ2A 1VF8A 3CGMA 2N87A 2IF4A 5HUAA 3VAWA 4ZPWR 3GTYX 1Q6UA 4QZVB 2MF9A 3WL0A 1W9VA 3O5JA 2M2AA 4LAXA 3O5PA 2FAPA 1NWUA 3UI5A 3ARTA 3CHDA 4JYSA 4P8XA 5BXJA 4ML4A 1YATA 4C02B 3CHCA 3UQIA 2EULA 3WH0A 4DZ3A 5GQBA 4ODKA 3RGCA 1OGGA 4O2TA 3B9DA 1HKKA 4JFMA 4MAVA 1FKKA 3AQUA 3AS0A 2PV2A 3KAFA 1LJYA 2F23A 3B8SA 4DRKA 4DRHA 2LJ4A 2ZQTA 3CH9A 4ODOA 3KCEA 1C9HA 2ZR6A 1W9UA 2VN1A 4DWSA 4W9QA 3O5GA 1T11A 2OLHA 1LL4A 1W1TA 4TYOA 4Q7NA 2L2SA 3H9RB 2KR7A 1UR8A 2DSUA 4DH0A 4DT4A 2XPBA 1HKIA 4ODQA 3AS1A 1Y0OA 3TCZA 3KAHA 2PI6A 3CGNA 1E6RA 1FFQA 3PR9A 1ROUA 1A7XA 4UDMA 1FKHA 3WD1A 1E9LA 3PA7A 4L3NA 2KI3A 1HJVA 4LAYA 4DWSD 4G50A 5HWCA 1H0GA 1ZL1A 1RD6A 2WLYA 3O5LA 2YBTA 5DO2A 2KFWA 3AS3A 1BL4A 4Z2JA 4PTMA 3UI4A 1NH6A 1GUVA 4Q22A 1EYMA 3CZ8A 2XP4A 1NWSA 4ZPVR 3IKGA 4ODLA 5D75A 1PBKA 2DPEA 2PPNA 4P8VA 2ZR4A 4TNSA 5J6EA 4HBEA 4DRQA 3IHZA 1D7JA 1F40A 3UQBA 1E6PA 2O92A 1FKIA 2DT0A 5GPGA 1FD9A 1ZBCA 4IT6A 4MNMA 4WKAA 1FKBA 4TW6A 4J4OA 3ARZA 1ZBVA 1J4HA 4MSPA 1H0IA 1KT0A 3WKZA 3ARRA 3ARQA 2DSWA 2PV1A 4GIVA 2XPAA 1W1YA 3IKDA 4DIPA 4DRIA 5HTGA 3AROA 2F2DA 3MDYB 1WB0A 4LAWA 3KAGA 4BF8A 4HARA 3JYMA 5HW6A 1B6CA 3TDBA 3G6MA 2ESCA 1JNSA 4DROA 4WK9A 3EIPA 2WM0A 1QPFA 4KQZA 2ZQVA 5HBFA 2XP8A 4ODPA 2M1IA 5DEZA 4XAKA 4URIA 4NZCA 3O5KA 4TW8A 4FN2A 1J6YA 5DITA 1D2KA 2B31A 1NWTA 4U84A 1LG1A 1TCOC 1PINA 3AS2A 5HWBA 2RUDA 1J4IA 1O6IA 2AWGA 4Z2HA 3IK8A 2D9FA 3I6CA 3ARVA 2ITKA 4LAVA 4AY1A 1EHNA 2MLZA 2A3AA 5HW7A 5JH8A 1NSGA 1N1AA 4MNJA 1QZ2A 1E44A 1XRVA 1ZCNA 5HW8A 1LL6A 4R5EA 4ZPTR 4JFLA 1E15A 4QT2A 2RURA 5DF0A 3O5QA 2ZQUA 1FKRA 5B8IC 2QF8A 4TW7A 3LUOA 4LGXA 3O5OA 1E6NA 1Q6HA 1JNDA 3FXYA 2VCDA 2LGOA 1GOIA 2LKNA 2F4EA 4DRNA 4HBOA 3RM9A 2WK2A 1NWRA 2XP6A 3O5DA 1ZU8A 2DT1A 2G8ZA 3BXWA 2A3EA 4N19A 3KACA 3OA5A 3RMEA 4Z2KA 3UI6A 1F8AB 1W1PA 3KAIA 1R9HA 1KFWA 3RM4A 4IQ2A 3UQAA
chains in the Genus database with same CATH topology
3JXVA 2YBUA 5DIVA 2MNTA 4FAPA 3WIJA 1FFRA 2PPOA 2DG9A 5DIUA 3ALFA 2DSZA 1HJWA 1ZBKA 1ZB5A 4MNKA 1HKJA 2PBCA 4DRPA 4JFIA 4W5UA 1SR0A 4TX0A 1X6LA 2KO7A 3QOKA 4U86A 2O9OA 2MPHA 1FAPA 3OOBA 2XP5A 2Y78A 4GGQA 2A3CA 1ITXA 3ARWA 1HKMA 3PRDA 2FKEA 4W9PA 2ZQSA 4L72B 1OGBA 1QPLA 1LL7A 4JFKA 4QIBA 3B7XA 2Q5AA 2KGJA 4DRJA 4DWSB 1HXVA 4ODRA 3FAPA 2PV3A 3NI6A 4ITZA 1ROTA 3ODKA 2WLZA 5I98A 4ODMA 3FY1A 3CHEA 4IQCA 2XP9A 3B9AA 1D7HA 4S3JA 1U79A 1NMVA 4DWSC 1SYTA 4J4NA 1W1VA 1FKFA 1FKLA 1BKFA 1FKDA 3NRKA 4Z2LA 2A3BA 2DG4A 4WJXA 1L1PA 1LG2A 2DG3A 3ARYA 3KADA 1NMWA 3TC5A 4IPXA 4ZS6A 2AOSA 5HT1A 4MNLA 3B9EA 2K8IA 3ARUA 4P8UA 4S3KA 1D6OA 1FKGA 4P8WA 2IUZA 1W9PA 2JZVA 5HKGA 4G2PA 1WNOA 3ARSA 3O5MA 2KE0A 3RM8A 3ARPA 1CTNA 2XP3A 3CHFA 1IX5A 1Q6IA 1EIBA 3RFWA 2DSVA 1KT1A 4KR0B 4QT3A 1W26A 2DT3A 1K9TA 1GPFA 3WD3A 2LPVA 3WL1A 3PRBA 3PRAA 1J4RA 2RSEA 5GPRA 1FKJA 1ZK6A 3NTPA 2FDMA 2F21A 3O5EA 3UF8A 3KABA 4WKFA 1LQ0A 3O5IA 1D7IA 2RUQA 1YW5A 1FKSA 3WD0A 2MLXA 4IT4A 3JYJA 2ZR5A 1Q1CA 4MGVA 1UR9A 3WQVA 1EQ3A 1OWQA 2UZ5A 4NNRA 1WAWA 1M5YA 1JNEA 2RUCA 2XP7A 2G41A 1P5QA 2OFNA 4WIWA 3EY6A 4Z2GA 3WQWA 3ALGA 1E6ZA 1XHGA 4NSBA 3G6LA 1X6NA 3KZ7A 1HJXA 3W4RA 4WKHA 2MLYA 4MTVA 4R0XA 4W9OA 4ODNA 2M08A 1FJDA 1TFVA 1FKTA 3GPKA 3O5FA 3ARXA 1EDQA 4U85A 4MPKA 1JNTA 2PPPA 4Z2IA 1JVWA 3WD4A 2DT2A 3O5RA 4JFJA 4DRMA 1ZBWA 3WD2A 2RQSA 4DZ2A 1VF8A 3CGMA 2N87A 2IF4A 5HUAA 3VAWA 4ZPWR 1Q6UA 4QZVB 2MF9A 3WL0A 1W9VA 3O5JA 2M2AA 4LAXA 3O5PA 2FAPA 1NWUA 3UI5A 3ARTA 3CHDA 4JYSA 4P8XA 5BXJA 4ML4A 1YATA 4C02B 3CHCA 3UQIA 3WH0A 4DZ3A 5GQBA 4ODKA 3RGCA 1OGGA 4O2TA 3B9DA 1HKKA 4JFMA 4MAVA 1FKKA 3AQUA 3AS0A 2PV2A 3KAFA 1LJYA 3B8SA 4DRKA 4DRHA 2LJ4A 2ZQTA 3CH9A 4ODOA 3KCEA 1C9HA 2ZR6A 1W9UA 2VN1A 4DWSA 4W9QA 3O5GA 1T11A 2OLHA 1LL4A 1W1TA 4TYOA 4Q7NA 2L2SA 3H9RB 2KR7A 1UR8A 2DSUA 4DH0A 4DT4A 2XPBA 1HKIA 4ODQA 3AS1A 1Y0OA 3TCZA 3KAHA 2PI6A 3CGNA 1E6RA 1FFQA 3PR9A 1ROUA 1A7XA 1FKHA 3WD1A 1E9LA 3PA7A 4L3NA 2KI3A 1HJVA 4LAYA 4DWSD 4G50A 5HWCA 1H0GA 1ZL1A 1RD6A 2WLYA 3O5LA 2YBTA 5DO2A 2KFWA 3AS3A 1BL4A 4Z2JA 4PTMA 3UI4A 1NH6A 1GUVA 4Q22A 1EYMA 3CZ8A 2XP4A 1NWSA 4ZPVR 3IKGA 4ODLA 5D75A 1PBKA 2DPEA 2PPNA 4P8VA 2ZR4A 4TNSA 5J6EA 4HBEA 4DRQA 3IHZA 1D7JA 1F40A 3UQBA 1E6PA 2O92A 1FKIA 2DT0A 5GPGA 1FD9A 1ZBCA 4IT6A 4MNMA 4WKAA 1FKBA 4TW6A 4J4OA 3ARZA 1ZBVA 1J4HA 4MSPA 1H0IA 1KT0A 3WKZA 3ARRA 3ARQA 2DSWA 2PV1A 4GIVA 2XPAA 1W1YA 3IKDA 4DIPA 4DRIA 5HTGA 3AROA 2F2DA 3MDYB 1WB0A 4LAWA 3KAGA 4BF8A 4HARA 3JYMA 5HW6A 1B6CA 3TDBA 3G6MA 2ESCA 1JNSA 4DROA 4WK9A 2WM0A 1QPFA 4KQZA 2ZQVA 5HBFA 2XP8A 4ODPA 2M1IA 5DEZA 4XAKA 4URIA 4NZCA 3O5KA 4TW8A 4FN2A 1J6YA 5DITA 1D2KA 2B31A 1NWTA 4U84A 1LG1A 1TCOC 1PINA 3AS2A 5HWBA 2RUDA 1J4IA 1O6IA 2AWGA 4Z2HA 3IK8A 2D9FA 3I6CA 3ARVA 2ITKA 4LAVA 4AY1A 1EHNA 2MLZA 2A3AA 5HW7A 5JH8A 1NSGA 1N1AA 4MNJA 1QZ2A 1XRVA 1ZCNA 5HW8A 1LL6A 4R5EA 4ZPTR 4JFLA 1E15A 4QT2A 2RURA 5DF0A 3O5QA 2ZQUA 1FKRA 5B8IC 2QF8A 4TW7A 3LUOA 4LGXA 3O5OA 1E6NA 1Q6HA 1JNDA 3FXYA 2VCDA 2LGOA 1GOIA 2LKNA 2F4EA 4DRNA 4HBOA 3RM9A 2WK2A 1NWRA 2XP6A 3O5DA 1ZU8A 2DT1A 2G8ZA 3BXWA 2A3EA 4N19A 3KACA 3OA5A 3RMEA 4Z2KA 3UI6A 1F8AB 1W1PA 3KAIA 1R9HA 1KFWA 3RM4A 4IQ2A 3UQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXV A;  3KAG A;  4BF8 A;  1YAT A;  3O5M A;  4C02 B;  3JYM A;  3UQI A;  5HW6 A;  1B6C A;  2KE0 A;  5DIV A;  3TDB A;  2MNT A;  3WH0 A;  4FAP A;  4DZ3 A;  2XP3 A;  1JNS A;  4DRO A;  2PPO A;  4ODK A;  3RGC A;  2DG9 A;  1Q6I A;  1QPF A;  4O2T A;  2ZQV A;  4JFM A;  5DIU A;  2XP8 A;  1FKK A;  2M1I A;  4ODP A;  3RFW A;  3KAF A;  1KT1 A;  2PV2 A;  4DRK A;  4DRH A;  2LJ4 A;  2ZQT A;  4ODO A;  4QT3 A;  1W26 A;  1C9H A;  2ZR6 A;  3KCE A;  3O5K A;  4TW8 A;  2VN1 A;  4FN2 A;  5DIT A;  1J6Y A;  4W9Q A;  3O5G A;  1T11 A;  2LPV A;  4G2P A;  4U84 A;  1TCO C;  1PIN A;  3PRB A;  4TYO A;  5HWB A;  2L2S A;  3H9R B;  1J4R A;  2KR7 A;  2RSE A;  2RUD A;  2PBC A;  4DRP A;  1J4I A;  1FKJ A;  1ZK6 A;  3NTP A;  4JFI A;  4DH0 A;  2F21 A;  4DT4 A;  2XPB A;  4TX0 A;  4ODQ A;  3O5E A;  3UF8 A;  1Y0O A;  3KAB A;  2AWG A;  3O5I A;  1D7I A;  2RUQ A;  3IK8 A;  3TCZ A;  1YW5 A;  1FKS A;  2KO7 A;  2D9F A;  2MLX A;  3I6C A;  2ITK A;  3JYJ A;  2MPH A;  2ZR5 A;  1Q1C A;  3CGN A;  3KAH A;  4LAV A;  5HTG A;  1FAP A;  3OOB A;  4MGV A;  2XP5 A;  2Y78 A;  4GGQ A;  1EQ3 A;  2MLZ A;  2UZ5 A;  1ROU A;  4NNR A;  5HW7 A;  3UQA A;  1NSG A;  3PRD A;  1A7X A;  2FKE A;  4W9P A;  1FKH A;  2ZQS A;  1M5Y A;  2RUC A;  1N1A A;  1QZ2 A;  2XP7 A;  5HW8 A;  1ZCN A;  1P5Q A;  1QPL A;  3PA7 A;  2OFN A;  2KI3 A;  3EY6 A;  4JFK A;  4LAY A;  4QIB A;  4G50 A;  3B7X A;  4JFL A;  2Q5A A;  3KZ7 A;  5HWC A;  3O5L A;  4QT2 A;  2RUR A;  2KGJ A;  2KFW A;  1BL4 A;  4DRJ A;  3O5Q A;  1HXV A;  2MLY A;  4ODR A;  3UI4 A;  3FAP A;  2ZQU A;  2PV3 A;  4R0X A;  4ODN A;  1EYM A;  2M08 A;  4W9O A;  5B8I C;  4TW7 A;  3NI6 A;  2XP4 A;  4ITZ A;  3IKG A;  4ODL A;  3LUO A;  1FKT A;  5D75 A;  1FJD A;  1PBK A;  1ROT A;  2PPN A;  3GPK A;  3ODK A;  3O5F A;  2ZR4 A;  5I98 A;  3O5O A;  1Q6H A;  4ODM A;  4TNS A;  4U85 A;  5J6E A;  1JNT A;  2PPP A;  4IQC A;  1JVW A;  2VCD A;  4U86 A;  4DRQ A;  2LGO A;  2XP9 A;  3O5R A;  4JFJ A;  4DRM A;  1D7H A;  3IHZ A;  1D7J A;  1U79 A;  1F40 A;  1NMV A;  2LKN A;  2F4E A;  2RQS A;  4DRN A;  4J4N A;  4DZ2 A;  1FKI A;  2N87 A;  3CGM A;  5GPG A;  2IF4 A;  3UQB A;  1FD9 A;  5HUA A;  1FKF A;  1FKB A;  1FKL A;  4TW6 A;  4J4O A;  3VAW A;  1BKF A;  1FKD A;  2XP6 A;  3NRK A;  3O5D A;  1Q6U A;  2DG4 A;  1L1P A;  2DG3 A;  3KAD A;  1NMW A;  1J4H A;  2MF9 A;  4IPX A;  3TC5 A;  1FKR A;  4N19 A;  4MSP A;  3KAC A;  3O5J A;  2M2A A;  4LAX A;  3O5P A;  5HT1 A;  1KT0 A;  2FAP A;  3UI6 A;  2K8I A;  3UI5 A;  2PV1 A;  1F8A B;  1D6O A;  1FKG A;  3KAI A;  2XPA A;  4GIV A;  4JYS A;  1R9H A;  3IKD A;  2JZV A;  4DIP A;  4DRI A;  4IQ2 A;  2F2D A;  5BXJ A;  5HKG A;  3MDY B;  4LAW A; 
#chains in the Genus database with same CATH topology
 3JXV A;  2YBU A;  5DIV A;  2MNT A;  4FAP A;  3WIJ A;  1FFR A;  2PPO A;  2DG9 A;  5DIU A;  3ALF A;  2DSZ A;  1HJW A;  1ZBK A;  1ZB5 A;  4MNK A;  1HKJ A;  2PBC A;  4DRP A;  4JFI A;  4W5U A;  1SR0 A;  4TX0 A;  1X6L A;  2KO7 A;  3QOK A;  4U86 A;  2O9O A;  2MPH A;  1FAP A;  3OOB A;  2XP5 A;  2PN0 A;  2Y78 A;  4GGQ A;  2A3C A;  1ITX A;  3ARW A;  1HKM A;  3PRD A;  2FKE A;  4W9P A;  2ZQS A;  4L72 B;  1OGB A;  1QPL A;  1LL7 A;  4JFK A;  4QIB A;  1JCH B;  3B7X A;  3BMB A;  2Q5A A;  2KGJ A;  4DRJ A;  4DWS B;  1HXV A;  4ODR A;  3FAP A;  2PV3 A;  3NI6 A;  4ITZ A;  1ROT A;  3ODK A;  2WLZ A;  5I98 A;  4ODM A;  3FY1 A;  3CHE A;  4IQC A;  2XP9 A;  3B9A A;  1D7H A;  2P4V A;  1U79 A;  4S3J A;  1NMV A;  4DWS C;  1SYT A;  2B5U B;  4J4N A;  1W1V A;  1FKF A;  1FKL A;  1BKF A;  1FKD A;  3NRK A;  4Z2L A;  2A3B A;  2DG4 A;  4WJX A;  1L1P A;  1LG2 A;  2DG3 A;  3ARY A;  3KAD A;  1NMW A;  3TC5 A;  4IPX A;  4ZS6 A;  2AOS A;  5HT1 A;  4MNL A;  3B9E A;  2K8I A;  3ARU A;  4P8U A;  4S3K A;  1D6O A;  1FKG A;  4P8W A;  2IUZ A;  1W9P A;  2JZV A;  5HKG A;  4G2P A;  1WNO A;  3ARS A;  3O5M A;  2KE0 A;  3RM8 A;  3ARP A;  1CTN A;  2XP3 A;  3CHF A;  1IX5 A;  1Q6I A;  1EIB A;  3RFW A;  2DSV A;  1KT1 A;  4KR0 B;  4QT3 A;  1W26 A;  2DT3 A;  1K9T A;  1GPF A;  3WD3 A;  2LPV A;  3WL1 A;  3PRB A;  3PRA A;  1J4R A;  2RSE A;  5GPR A;  1FKJ A;  1ZK6 A;  3NTP A;  2FDM A;  2F21 A;  3O5E A;  3UF8 A;  3GU0 A;  3KAB A;  4WKF A;  1LQ0 A;  3O5I A;  1D7I A;  2RUQ A;  1YW5 A;  1FKS A;  3WD0 A;  1GRJ A;  2MLX A;  4IT4 A;  3JYJ A;  2ZR5 A;  1Q1C A;  4MGV A;  1UR9 A;  3WQV A;  1EQ3 A;  1OWQ A;  2UZ5 A;  4NNR A;  1WAW A;  1M5Y A;  1JNE A;  2RUC A;  2XP7 A;  2G41 A;  1P5Q A;  2OFN A;  4WIW A;  3EY6 A;  4Z2G A;  3WQW A;  3ALG A;  1E6Z A;  1XHG A;  4NSB A;  3G6L A;  1X6N A;  3KZ7 A;  1HJX A;  3W4R A;  4WKH A;  2MLY A;  4MTV A;  4R0X A;  4W9O A;  4ODN A;  2M08 A;  1FJD A;  1TFV A;  1FKT A;  3GPK A;  3O5F A;  3ARX A;  1EDQ A;  4U85 A;  4MPK A;  1JNT A;  2PPP A;  4Z2I A;  1JVW A;  3WD4 A;  2DT2 A;  3O5R A;  4JFJ A;  4DRM A;  2ETN A;  1ZBW A;  3WD2 A;  2RQS A;  4DZ2 A;  1VF8 A;  3CGM A;  2N87 A;  2IF4 A;  5HUA A;  3VAW A;  4ZPW R;  3GTY X;  1Q6U A;  4QZV B;  2MF9 A;  3WL0 A;  1W9V A;  3O5J A;  2M2A A;  4LAX A;  3O5P A;  2FAP A;  1NWU A;  3UI5 A;  3ART A;  3CHD A;  4JYS A;  4P8X A;  5BXJ A;  4ML4 A;  1YAT A;  4C02 B;  3CHC A;  3UQI A;  2EUL A;  3WH0 A;  4DZ3 A;  5GQB A;  4ODK A;  3RGC A;  1OGG A;  4O2T A;  3B9D A;  1HKK A;  4JFM A;  4MAV A;  1FKK A;  3AQU A;  3AS0 A;  2PV2 A;  3KAF A;  1LJY A;  2F23 A;  3B8S A;  4DRK A;  4DRH A;  2LJ4 A;  2ZQT A;  3CH9 A;  4ODO A;  3KCE A;  1C9H A;  2ZR6 A;  1W9U A;  2VN1 A;  4DWS A;  4W9Q A;  3O5G A;  1T11 A;  2OLH A;  1LL4 A;  1W1T A;  4TYO A;  4Q7N A;  2L2S A;  3H9R B;  2KR7 A;  1UR8 A;  2DSU A;  4DH0 A;  4DT4 A;  2XPB A;  1HKI A;  4ODQ A;  3AS1 A;  1Y0O A;  3TCZ A;  3KAH A;  2PI6 A;  3CGN A;  1E6R A;  1FFQ A;  3PR9 A;  1ROU A;  1A7X A;  4UDM A;  1FKH A;  3WD1 A;  1E9L A;  3PA7 A;  4L3N A;  2KI3 A;  1HJV A;  4LAY A;  4DWS D;  4G50 A;  5HWC A;  1H0G A;  1ZL1 A;  1RD6 A;  2WLY A;  3O5L A;  2YBT A;  5DO2 A;  2KFW A;  3AS3 A;  1BL4 A;  4Z2J A;  4PTM A;  3UI4 A;  1NH6 A;  1GUV A;  4Q22 A;  1EYM A;  3CZ8 A;  2XP4 A;  1NWS A;  4ZPV R;  3IKG A;  4ODL A;  5D75 A;  1PBK A;  2DPE A;  2PPN A;  4P8V A;  2ZR4 A;  4TNS A;  5J6E A;  4HBE A;  4DRQ A;  3IHZ A;  1D7J A;  1F40 A;  3UQB A;  1E6P A;  2O92 A;  1FKI A;  2DT0 A;  5GPG A;  1FD9 A;  1ZBC A;  4IT6 A;  4MNM A;  4WKA A;  1FKB A;  4TW6 A;  4J4O A;  3ARZ A;  1ZBV A;  1J4H A;  4MSP A;  1H0I A;  1KT0 A;  3WKZ A;  3ARR A;  3ARQ A;  2DSW A;  2PV1 A;  4GIV A;  2XPA A;  1W1Y A;  3IKD A;  4DIP A;  4DRI A;  5HTG A;  3ARO A;  2F2D A;  3MDY B;  1WB0 A;  4LAW A;  3KAG A;  4BF8 A;  4HAR A;  3JYM A;  5HW6 A;  1B6C A;  3TDB A;  3G6M A;  2ESC A;  1JNS A;  4DRO A;  4WK9 A;  3EIP A;  2WM0 A;  1QPF A;  4KQZ A;  2ZQV A;  5HBF A;  2XP8 A;  4ODP A;  2M1I A;  5DEZ A;  4XAK A;  4URI A;  4NZC A;  3O5K A;  4TW8 A;  4FN2 A;  1J6Y A;  5DIT A;  1D2K A;  2B31 A;  1NWT A;  4U84 A;  1LG1 A;  1TCO C;  1PIN A;  3AS2 A;  5HWB A;  2RUD A;  1J4I A;  1O6I A;  2AWG A;  4Z2H A;  3IK8 A;  2D9F A;  3I6C A;  3ARV A;  2ITK A;  4LAV A;  4AY1 A;  1EHN A;  2MLZ A;  2A3A A;  5HW7 A;  5JH8 A;  1NSG A;  1N1A A;  4MNJ A;  1QZ2 A;  1E44 A;  1XRV A;  1ZCN A;  5HW8 A;  1LL6 A;  4R5E A;  4ZPT R;  4JFL A;  1E15 A;  4QT2 A;  2RUR A;  5DF0 A;  3O5Q A;  2ZQU A;  1FKR A;  5B8I C;  2QF8 A;  4TW7 A;  3LUO A;  4LGX A;  3O5O A;  1E6N A;  1Q6H A;  1JND A;  3FXY A;  2VCD A;  2LGO A;  1GOI A;  2LKN A;  2F4E A;  4DRN A;  4HBO A;  3RM9 A;  2WK2 A;  1NWR A;  2XP6 A;  3O5D A;  1ZU8 A;  2DT1 A;  2G8Z A;  3BXW A;  2A3E A;  4N19 A;  3KAC A;  3OA5 A;  3RME A;  4Z2K A;  3UI6 A;  1F8A B;  1W1P A;  3KAI A;  1R9H A;  1KFW A;  3RM4 A;  4IQ2 A;  3UQA A; 
#chains in the Genus database with same CATH homology
 3JXV A;  2YBU A;  5DIV A;  2MNT A;  4FAP A;  3WIJ A;  1FFR A;  2PPO A;  2DG9 A;  5DIU A;  3ALF A;  2DSZ A;  1HJW A;  1ZBK A;  1ZB5 A;  4MNK A;  1HKJ A;  2PBC A;  4DRP A;  4JFI A;  4W5U A;  1SR0 A;  4TX0 A;  1X6L A;  2KO7 A;  3QOK A;  4U86 A;  2O9O A;  2MPH A;  1FAP A;  3OOB A;  2XP5 A;  2Y78 A;  4GGQ A;  2A3C A;  1ITX A;  3ARW A;  1HKM A;  3PRD A;  2FKE A;  4W9P A;  2ZQS A;  4L72 B;  1OGB A;  1QPL A;  1LL7 A;  4JFK A;  4QIB A;  3B7X A;  2Q5A A;  2KGJ A;  4DRJ A;  4DWS B;  1HXV A;  4ODR A;  3FAP A;  2PV3 A;  3NI6 A;  4ITZ A;  1ROT A;  3ODK A;  2WLZ A;  5I98 A;  4ODM A;  3FY1 A;  3CHE A;  4IQC A;  2XP9 A;  3B9A A;  1D7H A;  4S3J A;  1U79 A;  1NMV A;  4DWS C;  1SYT A;  4J4N A;  1W1V A;  1FKF A;  1FKL A;  1BKF A;  1FKD A;  3NRK A;  4Z2L A;  2A3B A;  2DG4 A;  4WJX A;  1L1P A;  1LG2 A;  2DG3 A;  3ARY A;  3KAD A;  1NMW A;  3TC5 A;  4IPX A;  4ZS6 A;  2AOS A;  5HT1 A;  4MNL A;  3B9E A;  2K8I A;  3ARU A;  4P8U A;  4S3K A;  1D6O A;  1FKG A;  4P8W A;  2IUZ A;  1W9P A;  2JZV A;  5HKG A;  4G2P A;  1WNO A;  3ARS A;  3O5M A;  2KE0 A;  3RM8 A;  3ARP A;  1CTN A;  2XP3 A;  3CHF A;  1IX5 A;  1Q6I A;  1EIB A;  3RFW A;  2DSV A;  1KT1 A;  4KR0 B;  4QT3 A;  1W26 A;  2DT3 A;  1K9T A;  1GPF A;  3WD3 A;  2LPV A;  3WL1 A;  3PRB A;  3PRA A;  1J4R A;  2RSE A;  5GPR A;  1FKJ A;  1ZK6 A;  3NTP A;  2FDM A;  2F21 A;  3O5E A;  3UF8 A;  3KAB A;  4WKF A;  1LQ0 A;  3O5I A;  1D7I A;  2RUQ A;  1YW5 A;  1FKS A;  3WD0 A;  2MLX A;  4IT4 A;  3JYJ A;  2ZR5 A;  1Q1C A;  4MGV A;  1UR9 A;  3WQV A;  1EQ3 A;  1OWQ A;  2UZ5 A;  4NNR A;  1WAW A;  1M5Y A;  1JNE A;  2RUC A;  2XP7 A;  2G41 A;  1P5Q A;  2OFN A;  4WIW A;  3EY6 A;  4Z2G A;  3WQW A;  3ALG A;  1E6Z A;  1XHG A;  4NSB A;  3G6L A;  1X6N A;  3KZ7 A;  1HJX A;  3W4R A;  4WKH A;  2MLY A;  4MTV A;  4R0X A;  4W9O A;  4ODN A;  2M08 A;  1FJD A;  1TFV A;  1FKT A;  3GPK A;  3O5F A;  3ARX A;  1EDQ A;  4U85 A;  4MPK A;  1JNT A;  2PPP A;  4Z2I A;  1JVW A;  3WD4 A;  2DT2 A;  3O5R A;  4JFJ A;  4DRM A;  1ZBW A;  3WD2 A;  2RQS A;  4DZ2 A;  1VF8 A;  3CGM A;  2N87 A;  2IF4 A;  5HUA A;  3VAW A;  4ZPW R;  1Q6U A;  4QZV B;  2MF9 A;  3WL0 A;  1W9V A;  3O5J A;  2M2A A;  4LAX A;  3O5P A;  2FAP A;  1NWU A;  3UI5 A;  3ART A;  3CHD A;  4JYS A;  4P8X A;  5BXJ A;  4ML4 A;  1YAT A;  4C02 B;  3CHC A;  3UQI A;  3WH0 A;  4DZ3 A;  5GQB A;  4ODK A;  3RGC A;  1OGG A;  4O2T A;  3B9D A;  1HKK A;  4JFM A;  4MAV A;  1FKK A;  3AQU A;  3AS0 A;  2PV2 A;  3KAF A;  1LJY A;  3B8S A;  4DRK A;  4DRH A;  2LJ4 A;  2ZQT A;  3CH9 A;  4ODO A;  3KCE A;  1C9H A;  2ZR6 A;  1W9U A;  2VN1 A;  4DWS A;  4W9Q A;  3O5G A;  1T11 A;  2OLH A;  1LL4 A;  1W1T A;  4TYO A;  4Q7N A;  2L2S A;  3H9R B;  2KR7 A;  1UR8 A;  2DSU A;  4DH0 A;  4DT4 A;  2XPB A;  1HKI A;  4ODQ A;  3AS1 A;  1Y0O A;  3TCZ A;  3KAH A;  2PI6 A;  3CGN A;  1E6R A;  1FFQ A;  3PR9 A;  1ROU A;  1A7X A;  1FKH A;  3WD1 A;  1E9L A;  3PA7 A;  4L3N A;  2KI3 A;  1HJV A;  4LAY A;  4DWS D;  4G50 A;  5HWC A;  1H0G A;  1ZL1 A;  1RD6 A;  2WLY A;  3O5L A;  2YBT A;  5DO2 A;  2KFW A;  3AS3 A;  1BL4 A;  4Z2J A;  4PTM A;  3UI4 A;  1NH6 A;  1GUV A;  4Q22 A;  1EYM A;  3CZ8 A;  2XP4 A;  1NWS A;  4ZPV R;  3IKG A;  4ODL A;  5D75 A;  1PBK A;  2DPE A;  2PPN A;  4P8V A;  2ZR4 A;  4TNS A;  5J6E A;  4HBE A;  4DRQ A;  3IHZ A;  1D7J A;  1F40 A;  3UQB A;  1E6P A;  2O92 A;  1FKI A;  2DT0 A;  5GPG A;  1FD9 A;  1ZBC A;  4IT6 A;  4MNM A;  4WKA A;  1FKB A;  4TW6 A;  4J4O A;  3ARZ A;  1ZBV A;  1J4H A;  4MSP A;  1H0I A;  1KT0 A;  3WKZ A;  3ARR A;  3ARQ A;  2DSW A;  2PV1 A;  4GIV A;  2XPA A;  1W1Y A;  3IKD A;  4DIP A;  4DRI A;  5HTG A;  3ARO A;  2F2D A;  3MDY B;  1WB0 A;  4LAW A;  3KAG A;  4BF8 A;  4HAR A;  3JYM A;  5HW6 A;  1B6C A;  3TDB A;  3G6M A;  2ESC A;  1JNS A;  4DRO A;  4WK9 A;  2WM0 A;  1QPF A;  4KQZ A;  2ZQV A;  5HBF A;  2XP8 A;  4ODP A;  2M1I A;  5DEZ A;  4XAK A;  4URI A;  4NZC A;  3O5K A;  4TW8 A;  4FN2 A;  1J6Y A;  5DIT A;  1D2K A;  2B31 A;  1NWT A;  4U84 A;  1LG1 A;  1TCO C;  1PIN A;  3AS2 A;  5HWB A;  2RUD A;  1J4I A;  1O6I A;  2AWG A;  4Z2H A;  3IK8 A;  2D9F A;  3I6C A;  3ARV A;  2ITK A;  4LAV A;  4AY1 A;  1EHN A;  2MLZ A;  2A3A A;  5HW7 A;  5JH8 A;  1NSG A;  1N1A A;  4MNJ A;  1QZ2 A;  1XRV A;  1ZCN A;  5HW8 A;  1LL6 A;  4R5E A;  4ZPT R;  4JFL A;  1E15 A;  4QT2 A;  2RUR A;  5DF0 A;  3O5Q A;  2ZQU A;  1FKR A;  5B8I C;  2QF8 A;  4TW7 A;  3LUO A;  4LGX A;  3O5O A;  1E6N A;  1Q6H A;  1JND A;  3FXY A;  2VCD A;  2LGO A;  1GOI A;  2LKN A;  2F4E A;  4DRN A;  4HBO A;  3RM9 A;  2WK2 A;  1NWR A;  2XP6 A;  3O5D A;  1ZU8 A;  2DT1 A;  2G8Z A;  3BXW A;  2A3E A;  4N19 A;  3KAC A;  3OA5 A;  3RME A;  4Z2K A;  3UI6 A;  1F8A B;  1W1P A;  3KAI A;  1R9H A;  1KFW A;  3RM4 A;  4IQ2 A;  3UQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...