2RUDA

Solution structure of the peptidyl prolyl cis-trans isomerase domain of c113d mutant human pin1 with sulfate ion
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C113D mutation in human Pin1 causes allosteric structural changes in the phosphate binding pocket of the PPIase domain through the tug of war in the dual-histidine motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rudA00
3NI6A 1QPLA 2OFNA 4LAXA 3O5LA 2XP3A 4R0XA 5DIUA 5HT1A 4TW7A 3RGCA 2F4EA 3O5JA 3TDBA 4ODNA 1FKBA 1FKTA 2PV3A 1JNSA 4QT3A 3O5GA 1D7HA 2KR7A 2ZR5A 1D6OA 1U79A 1Y0OA 1NMWA 4DRQA 1JNTA 5HW7A 2UZ5A 3KABA 4J4OA 4IQ2A 2ZQSA 5B8IC 3JYJA 4LAYA 1QZ2A 2RURA 3KAHA 3VAWA 4U85A 2XPBA 1F8AB 4BF8A 2MPHA 4TW8A 3B7XA 2IF4A 3O5MA 3FAPA 4JFIA 3IK8A 4ODLA 2PPPA 5D75A 2XPAA 2F21A 5J6EA 5I98A 1ROTA 2PPOA 4DRKA 5HWBA 4DZ2A 1FKDA 1M5YA 2L2SA 2PV2A 4ITZA 4FN2A 2Q5AA 2PBCA 4ODOA 1KT0A 1FAPA 1L1PA 2F2DA 2FAPA 3IKDA 3NTPA 4DRPA 3UQIA 3KACA 2RSEA 4N19A 4DRIA 4J4NA 4W9QA 1F40A 5DITA 1R9HA 2D9FA 1PINA 4LAVA 4TNSA 4JFLA 1J6YA 2LJ4A 3NRKA 2AWGA 2ZR4A 2MLXA 2PV1A 3MDYB 1T11A 4G50A 1J4HA 3O5QA 4LAWA 4FAPA 3H9RB 1P5QA 4DROA 3CGNA 2DG3A 1FKSA 1Q1CA 1FKJA 3KCEA 4NNRA 1EQ3A 1J4IA 3TC5A 3O5OA 4DT4A 3KADA 3GPKA 3O5EA 3TCZA 2XP6A 4DRHA 3ODKA 2ZQUA 1FKLA 4JFKA 1BL4A 4TYOA 2ZQTA 4GGQA 2M1IA 1QPFA 3O5FA 2N87A 1NMVA 2Y78A 3O5RA 3UI5A 4GIVA 2XP5A 2LKNA 4W9OA 2ITKA 4G2PA 1D7JA 1Q6IA 2LPVA 1NSGA 3UQAA 2LGOA 4O2TA 2XP7A 2K8IA 2MLYA 2DG9A 1HXVA 5HW8A 2XP4A 5HWCA 1FKRA 1N1AA 1PBKA 1W26A 2M2AA 4QIBA 5GPGA 2MNTA 3UF8A 4C02B 5HW6A 3JXVA 3EY6A 4DIPA 2M08A 2RUDA 1EYMA 4QT2A 5BXJA 1FKGA 1YATA 1ZK6A 2XP9A 1JVWA 2KFWA 4ODKA 5HKGA 4W9PA 3RFWA 5HTGA 2KI3A 3O5PA 4DZ3A 2MLZA 3JYMA 2RUCA 2KGJA 4MGVA 4TX0A 3UI6A 3UI4A 3I6CA 2DG4A 1ROUA 2KO7A 2ZQVA 4DRMA 3O5DA 1B6CA 3CGMA 4ODMA 4TW6A 3KAGA 4JFMA 3OOBA 1D7IA 4U86A 3KZ7A 1FD9A 1A7XA 1ZCNA 3IHZA 3O5KA 4JFJA 4ODPA 3WH0A 3UQBA 2PPNA 3PRBA 3O5IA 1TCOC 4DRJA 4MSPA 3LUOA 4JYSA 4DRNA 2MF9A 2KE0A 2XP8A 1FKHA 1BKFA 4IQCA 3PA7A 2VCDA 4ODQA 4ODRA 2RQSA 1FKFA 2FKEA 1J4RA 4DH0A 3KAFA 3PRDA 5HUAA 1FKIA 2VN1A 1KT1A 1Q6HA 2RUQA 3KAIA 1FJDA 1YW5A 2ZR6A 4IPXA 1FKKA 4U84A 1C9HA 3IKGA 2JZVA 5DIVA 1Q6UA
chains in the Genus database with same CATH superfamily
5DIUA 3O5JA 1ITXA 1HKMA 3WIJA 1ZU8A 2ZR5A 5GQBA 4IQ2A 4WJXA 5B8IC 4LAYA 2RURA 1E6NA 3KAHA 4HARA 4DWSD 2XPBA 4UDMA 4WKAA 3IK8A 4ODLA 5D75A 2O9OA 3ARSA 3QOKA 4KR0B 3WL0A 1ROTA 1UR8A 4NSBA 3BXWA 4DZ2A 1FKDA 2L2SA 1NWSA 3B9AA 4FN2A 2A3BA 3EIPA 2F2DA 3NTPA 1F40A 2RSEA 4LGXA 4AY1A 5DO2A 2AWGA 1GRJA 1LG2A 4LAWA 3H9RB 1P5QA 4DWSC 3WQVA 1O6IA 2PN0A 4QZVB 2O92A 1FKLA 4JFKA 2ZQTA 2M1IA 2N87A 3O5RA 3CH9A 2XP5A 1EHNA 3ARZA 3UQAA 1NSGA 4O2TA 4Z2JA 5DF0A 2ESCA 2DT1A 1FKRA 1PBKA 1W26A 4P8WA 5GPGA 4DWSB 5BXJA 2EULA 1YATA 1ZK6A 1W1TA 2KI3A 4DZ3A 2MLZA 3JYMA 2RUCA 1NH6A 2KGJA 4MGVA 1NWTA 3RMEA 1NWRA 3O5DA 1B6CA 1FFQA 4MNLA 4JFMA 3OOBA 2OLHA 1FD9A 4ODPA 3UQBA 4S3KA 4DRJA 3LUOA 1LJYA 2MF9A 2XP8A 3PA7A 2VCDA 2WM0A 4XAKA 2RQSA 4DH0A 5HUAA 3RM9A 1KT1A 2RUQA 1D2KA 4U84A 1RD6A 1C9HA 3IKGA 4W9QA 4MPKA 3O5LA 1GPFA 1W9UA 2PV3A 1HJXA 2P4VA 3O5GA 1D7HA 2KR7A 1WAWA 3CHCA 1JNTA 3ALGA 5HW7A 2ZQSA 3FXYA 1QZ2A 1EIBA 4U85A 2DT2A 1W1YA 2FDMA 1IX5A 2IF4A 3FAPA 4JFIA 2PPPA 2XPAA 5J6EA 4DRKA 5HWBA 2PV2A 4ITZA 4ODOA 3FY1A 4Z2GA 1E44A 4DRPA 4DRIA 3G6LA 1R9HA 1J6YA 4LAVA 2LJ4A 4G50A 3ARUA 1GUVA 4DROA 3KADA 4URIA 3GPKA 2DSZA 3O5EA 2XP6A 3ODKA 4ZS6A 1BL4A 4GGQA 3ARPA 1W1PA 3O5FA 3UI5A 2Y78A 4MAVA 4DWSA 2LKNA 2ITKA 2DT3A 1D7JA 2K8IA 1HXVA 3ARRA 2A3AA 4C02B 4QIBA 5HW6A 2MNTA 4WKFA 1KFWA 3JXVA 4DIPA 2A3CA 1EYMA 4QT2A 1FKGA 1JVWA 1UR9A 2A3EA 1H0GA 3RFWA 3CZ8A 5DEZA 3I6CA 2DG4A 3W4RA 3AS2A 3CGMA 4U86A 1ZCNA 3ARVA 3O5KA 4L3NA 3WH0A 2PPNA 4JYSA 2WLYA 1NWUA 2KE0A 5HBFA 1BKFA 1FKFA 3KAFA 3AQUA 1FKIA 2VN1A 1Q6HA 3PRAA 4P8XA 4IPXA 1K9TA 1LQ0A 3ARQA 2KO7A 4L72B 3NI6A 2OFNA 2XP3A 2YBTA 3RGCA 3WL1A 2WLZA 1FKBA 4KQZA 1JNSA 4QT3A 3ALFA 1U79A 1Y0OA 1JNEA 4DRQA 2UZ5A 3KABA 4J4OA 2DSVA 3WD4A 3JYJA 3CHDA 1LL6A 2MPHA 4TW8A 3B7XA 4MNJA 3RM8A 3O5MA 2DSWA 1W9PA 2F21A 1HJVA 2AOSA 4Q22A 1M5YA 2PBCA 1ZBCA 2QF8A 1FAPA 3AS0A 3B9DA 3PR9A 5DITA 1PINA 1HKIA 4TNSA 4ZPWR 2PV1A 4FAPA 1VF8A 3CGNA 1FKSA 1FKJA 3KCEA 1J4IA 4DT4A 4DRHA 3TCZA 1LG1A 2ZQUA 3B8SA 4TYOA 2DSUA 1NMVA 4GIVA 4IT6A 4W9OA 2LPVA 1HKJA 2XP4A 1E6PA 2IUZA 5HWCA 1N1AA 3UF8A 4MNKA 4Z2HA 3BMBA 3EY6A 3OA5A 2M08A 2RUDA 3G6MA 1OGGA 1EDQA 4WKHA 5HKGA 3CHFA 5HTGA 3O5PA 1XHGA 4TX0A 3UI6A 4NZCA 2WK2A 3B9EA 4Z2IA 2ZQVA 3ARTA 4DRMA 3ARWA 4TW6A 1E6RA 1D7IA 1A7XA 1E6ZA 3PRBA 3O5IA 4MSPA 1X6LA 4HBOA 1E15A 2F23A 1FKHA 2G8ZA 1WNOA 3WD1A 4ODQA 4ODRA 2FKEA 1J4RA 4ZPTR 1FJDA 3AS1A 1GOIA 5DIVA 1QPLA 4LAXA 4R0XA 3WQWA 5HT1A 4TW7A 2F4EA 3TDBA 4ODNA 1FKTA 1SR0A 4WIWA 3GTYX 2ETNA 1D6OA 1NMWA 3GU0A 4Q7NA 1TFVA 4MNMA 3VAWA 4S3JA 1F8AB 1H0IA 4BF8A 2DPEA 5I98A 2PPOA 3WKZA 2Q5AA 1JNDA 1KT0A 1L1PA 2B5UB 2FAPA 3IKDA 3UQIA 3KACA 4N19A 4J4NA 1HKKA 2D9FA 3AS3A 4JFLA 3NRKA 1ZB5A 2ZR4A 2MLXA 3MDYB 4WK9A 1T11A 1J4HA 3O5QA 3ARXA 2DG3A 1Q1CA 1EQ3A 4NNRA 4PTMA 3TC5A 1W9VA 3O5OA 4ML4A 1QPFA 2YBUA 3RM4A 3CHEA 1CTNA 1ZBKA 4G2PA 4Z2KA 1Q6IA 3ARYA 2LGOA 2XP7A 2MLYA 2DG9A 4R5EA 1E9LA 5HW8A 2G41A 4MTVA 2M2AA 1OGBA 5JH8A 1ZL1A 2DT0A 1JCHB 2XP9A 4ODKA 2KFWA 3WD3A 4W9PA 4W5UA 1LL4A 3UI4A 5GPRA 4HBEA 1W1VA 1ROUA 4P8UA 3WD0A 4ODMA 3KAGA 3KZ7A 4ZPVR 4Z2LA 3IHZA 4JFJA 1OWQA 2PI6A 1TCOC 4DRNA 3AROA 2B31A 1ZBWA 4IQCA 1WB0A 4P8VA 4IT4A 1ZBVA 3PRDA 1XRVA 1SYTA 1LL7A 1X6NA 1FFRA 3KAIA 1YW5A 3WD2A 2ZR6A 1HJWA 1FKKA 2JZVA 1Q6UA
chains in the Genus database with same CATH topology
5DIUA 3O5JA 1ITXA 1HKMA 3WIJA 1ZU8A 2ZR5A 5GQBA 4IQ2A 4WJXA 5B8IC 4LAYA 2RURA 1E6NA 3KAHA 4HARA 4DWSD 2XPBA 4WKAA 3IK8A 4ODLA 5D75A 2O9OA 3ARSA 3QOKA 4KR0B 3WL0A 1ROTA 1UR8A 4NSBA 3BXWA 4DZ2A 1FKDA 2L2SA 1NWSA 3B9AA 4FN2A 2A3BA 2F2DA 3NTPA 1F40A 2RSEA 4LGXA 4AY1A 5DO2A 2AWGA 1LG2A 4LAWA 3H9RB 1P5QA 4DWSC 3WQVA 1O6IA 4QZVB 2O92A 1FKLA 4JFKA 2ZQTA 2M1IA 2N87A 3O5RA 3CH9A 2XP5A 1EHNA 3ARZA 3UQAA 1NSGA 4O2TA 4Z2JA 5DF0A 2ESCA 2DT1A 1FKRA 1PBKA 1W26A 4P8WA 5GPGA 4DWSB 5BXJA 1YATA 1ZK6A 1W1TA 2KI3A 4DZ3A 2MLZA 3JYMA 2RUCA 1NH6A 2KGJA 4MGVA 1NWTA 3RMEA 1NWRA 3O5DA 1B6CA 1FFQA 4MNLA 4JFMA 3OOBA 2OLHA 1FD9A 4ODPA 3UQBA 4S3KA 4DRJA 3LUOA 1LJYA 2MF9A 2XP8A 3PA7A 2VCDA 2WM0A 4XAKA 2RQSA 4DH0A 5HUAA 3RM9A 1KT1A 2RUQA 1D2KA 4U84A 1RD6A 1C9HA 3IKGA 4W9QA 4MPKA 3O5LA 1GPFA 1W9UA 2PV3A 1HJXA 3O5GA 1D7HA 2KR7A 1WAWA 3CHCA 1JNTA 3ALGA 5HW7A 2ZQSA 3FXYA 1QZ2A 1EIBA 4U85A 2DT2A 1W1YA 2FDMA 1IX5A 2IF4A 3FAPA 4JFIA 2PPPA 2XPAA 5J6EA 4DRKA 5HWBA 2PV2A 4ITZA 4ODOA 3FY1A 4Z2GA 4DRPA 4DRIA 3G6LA 1R9HA 1J6YA 4LAVA 2LJ4A 4G50A 3ARUA 1GUVA 4DROA 3KADA 4URIA 3GPKA 2DSZA 3O5EA 2XP6A 3ODKA 4ZS6A 1BL4A 4GGQA 3ARPA 1W1PA 3O5FA 3UI5A 2Y78A 4MAVA 4DWSA 2LKNA 2ITKA 2DT3A 1D7JA 2K8IA 1HXVA 3ARRA 2A3AA 4C02B 4QIBA 5HW6A 2MNTA 4WKFA 1KFWA 3JXVA 4DIPA 2A3CA 1EYMA 4QT2A 1FKGA 1JVWA 1UR9A 2A3EA 1H0GA 3RFWA 3CZ8A 5DEZA 3I6CA 2DG4A 3W4RA 3AS2A 3CGMA 4U86A 1ZCNA 3ARVA 3O5KA 4L3NA 3WH0A 2PPNA 4JYSA 2WLYA 1NWUA 2KE0A 5HBFA 1BKFA 1FKFA 3KAFA 3AQUA 1FKIA 2VN1A 1Q6HA 3PRAA 4P8XA 4IPXA 1K9TA 1LQ0A 3ARQA 2KO7A 4L72B 3NI6A 2OFNA 2XP3A 2YBTA 3RGCA 3WL1A 2WLZA 1FKBA 4KQZA 1JNSA 4QT3A 3ALFA 1U79A 1Y0OA 1JNEA 4DRQA 2UZ5A 3KABA 4J4OA 2DSVA 3WD4A 3JYJA 3CHDA 1LL6A 2MPHA 4TW8A 3B7XA 4MNJA 3RM8A 3O5MA 2DSWA 1W9PA 2F21A 1HJVA 2AOSA 4Q22A 1M5YA 2PBCA 1ZBCA 2QF8A 1FAPA 3AS0A 3B9DA 3PR9A 5DITA 1PINA 1HKIA 4TNSA 4ZPWR 2PV1A 4FAPA 1VF8A 3CGNA 1FKSA 1FKJA 3KCEA 1J4IA 4DT4A 4DRHA 3TCZA 1LG1A 2ZQUA 3B8SA 4TYOA 2DSUA 1NMVA 4GIVA 4IT6A 4W9OA 2LPVA 1HKJA 2XP4A 1E6PA 2IUZA 5HWCA 1N1AA 3UF8A 4MNKA 4Z2HA 3EY6A 3OA5A 2M08A 2RUDA 3G6MA 1OGGA 1EDQA 4WKHA 5HKGA 3CHFA 5HTGA 3O5PA 1XHGA 4TX0A 3UI6A 4NZCA 2WK2A 3B9EA 4Z2IA 2ZQVA 3ARTA 4DRMA 3ARWA 4TW6A 1E6RA 1D7IA 1A7XA 1E6ZA 3PRBA 3O5IA 4MSPA 1X6LA 4HBOA 1E15A 1FKHA 2G8ZA 1WNOA 3WD1A 4ODQA 4ODRA 2FKEA 1J4RA 4ZPTR 1FJDA 3AS1A 1GOIA 5DIVA 1QPLA 4LAXA 4R0XA 3WQWA 5HT1A 4TW7A 2F4EA 3TDBA 4ODNA 1FKTA 1SR0A 4WIWA 1D6OA 1NMWA 4Q7NA 1TFVA 4MNMA 3VAWA 4S3JA 1F8AB 1H0IA 4BF8A 2DPEA 5I98A 2PPOA 3WKZA 2Q5AA 1JNDA 1KT0A 1L1PA 2FAPA 3IKDA 3UQIA 3KACA 4N19A 4J4NA 1HKKA 2D9FA 3AS3A 4JFLA 3NRKA 1ZB5A 2ZR4A 2MLXA 3MDYB 4WK9A 1T11A 1J4HA 3O5QA 3ARXA 2DG3A 1Q1CA 1EQ3A 4NNRA 4PTMA 3TC5A 1W9VA 3O5OA 4ML4A 1QPFA 2YBUA 3RM4A 3CHEA 1CTNA 1ZBKA 4G2PA 4Z2KA 1Q6IA 3ARYA 2LGOA 2XP7A 2MLYA 2DG9A 4R5EA 1E9LA 5HW8A 2G41A 4MTVA 2M2AA 1OGBA 5JH8A 1ZL1A 2DT0A 2XP9A 4ODKA 2KFWA 3WD3A 4W9PA 4W5UA 1LL4A 3UI4A 5GPRA 4HBEA 1W1VA 1ROUA 4P8UA 3WD0A 4ODMA 3KAGA 3KZ7A 4ZPVR 4Z2LA 3IHZA 4JFJA 1OWQA 2PI6A 1TCOC 4DRNA 3AROA 2B31A 1ZBWA 4IQCA 1WB0A 4P8VA 4IT4A 1ZBVA 3PRDA 1XRVA 1SYTA 1LL7A 1X6NA 1FFRA 3KAIA 1YW5A 3WD2A 2ZR6A 1HJWA 1FKKA 2JZVA 1Q6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NI6 A;  1QPL A;  2OFN A;  4LAX A;  3O5L A;  2XP3 A;  4R0X A;  5DIU A;  5HT1 A;  4TW7 A;  3RGC A;  2F4E A;  3O5J A;  3TDB A;  4ODN A;  1FKB A;  1FKT A;  2PV3 A;  1JNS A;  4QT3 A;  3O5G A;  1D7H A;  2KR7 A;  2ZR5 A;  1D6O A;  1U79 A;  1Y0O A;  1NMW A;  4DRQ A;  1JNT A;  5HW7 A;  2UZ5 A;  3KAB A;  4J4O A;  4IQ2 A;  2ZQS A;  5B8I C;  3JYJ A;  4LAY A;  1QZ2 A;  2RUR A;  3KAH A;  3VAW A;  4U85 A;  2XPB A;  1F8A B;  4BF8 A;  2MPH A;  4TW8 A;  3B7X A;  2IF4 A;  3O5M A;  3FAP A;  4JFI A;  3IK8 A;  4ODL A;  2PPP A;  5D75 A;  2XPA A;  2F21 A;  5J6E A;  5I98 A;  1ROT A;  2PPO A;  4DRK A;  5HWB A;  4DZ2 A;  1FKD A;  1M5Y A;  2L2S A;  2PV2 A;  4ITZ A;  4FN2 A;  2Q5A A;  2PBC A;  4ODO A;  1KT0 A;  1FAP A;  1L1P A;  2F2D A;  2FAP A;  3IKD A;  3NTP A;  4DRP A;  3UQI A;  3KAC A;  2RSE A;  4N19 A;  4DRI A;  4J4N A;  4W9Q A;  1F40 A;  5DIT A;  1R9H A;  2D9F A;  1PIN A;  4LAV A;  4TNS A;  4JFL A;  1J6Y A;  2LJ4 A;  3NRK A;  2AWG A;  2ZR4 A;  2MLX A;  2PV1 A;  3MDY B;  1T11 A;  4G50 A;  1J4H A;  3O5Q A;  4LAW A;  4FAP A;  3H9R B;  1P5Q A;  4DRO A;  3CGN A;  2DG3 A;  1FKS A;  1Q1C A;  1FKJ A;  3KCE A;  4NNR A;  1EQ3 A;  1J4I A;  3TC5 A;  3O5O A;  4DT4 A;  3KAD A;  3GPK A;  3O5E A;  3TCZ A;  2XP6 A;  4DRH A;  3ODK A;  2ZQU A;  1FKL A;  4JFK A;  1BL4 A;  4TYO A;  2ZQT A;  4GGQ A;  2M1I A;  1QPF A;  3O5F A;  2N87 A;  1NMV A;  2Y78 A;  3O5R A;  3UI5 A;  4GIV A;  2XP5 A;  2LKN A;  4W9O A;  2ITK A;  4G2P A;  1D7J A;  1Q6I A;  2LPV A;  1NSG A;  3UQA A;  2LGO A;  4O2T A;  2XP7 A;  2K8I A;  2MLY A;  2DG9 A;  1HXV A;  5HW8 A;  2XP4 A;  5HWC A;  1FKR A;  1N1A A;  1PBK A;  1W26 A;  2M2A A;  4QIB A;  5GPG A;  2MNT A;  3UF8 A;  4C02 B;  5HW6 A;  3JXV A;  3EY6 A;  4DIP A;  2M08 A;  2RUD A;  1EYM A;  4QT2 A;  5BXJ A;  1FKG A;  1YAT A;  1ZK6 A;  2XP9 A;  1JVW A;  2KFW A;  4ODK A;  5HKG A;  4W9P A;  3RFW A;  5HTG A;  2KI3 A;  3O5P A;  4DZ3 A;  2MLZ A;  3JYM A;  2RUC A;  2KGJ A;  4MGV A;  4TX0 A;  3UI6 A;  3UI4 A;  3I6C A;  2DG4 A;  1ROU A;  2KO7 A;  2ZQV A;  4DRM A;  3O5D A;  1B6C A;  3CGM A;  4ODM A;  4TW6 A;  3KAG A;  4JFM A;  3OOB A;  1D7I A;  4U86 A;  3KZ7 A;  1FD9 A;  1A7X A;  1ZCN A;  3IHZ A;  3O5K A;  4JFJ A;  4ODP A;  3WH0 A;  3UQB A;  2PPN A;  3PRB A;  3O5I A;  1TCO C;  4DRJ A;  4MSP A;  3LUO A;  4JYS A;  4DRN A;  2MF9 A;  2KE0 A;  2XP8 A;  1FKH A;  1BKF A;  4IQC A;  3PA7 A;  2VCD A;  4ODQ A;  4ODR A;  2RQS A;  1FKF A;  2FKE A;  1J4R A;  4DH0 A;  3KAF A;  3PRD A;  5HUA A;  1FKI A;  2VN1 A;  1KT1 A;  1Q6H A;  2RUQ A;  3KAI A;  1FJD A;  1YW5 A;  2ZR6 A;  4IPX A;  1FKK A;  4U84 A;  1C9H A;  3IKG A;  2JZV A;  5DIV A;  1Q6U A; 
#chains in the Genus database with same CATH topology
 5DIU A;  3O5J A;  1ITX A;  1HKM A;  3WIJ A;  1ZU8 A;  2ZR5 A;  5GQB A;  4IQ2 A;  4WJX A;  5B8I C;  4LAY A;  2RUR A;  1E6N A;  3KAH A;  4HAR A;  4DWS D;  2XPB A;  4UDM A;  4WKA A;  3IK8 A;  4ODL A;  5D75 A;  2O9O A;  3ARS A;  3QOK A;  4KR0 B;  3WL0 A;  1ROT A;  1UR8 A;  4NSB A;  3BXW A;  4DZ2 A;  1FKD A;  2L2S A;  1NWS A;  3B9A A;  4FN2 A;  2A3B A;  3EIP A;  2F2D A;  3NTP A;  1F40 A;  2RSE A;  4LGX A;  4AY1 A;  5DO2 A;  2AWG A;  1GRJ A;  1LG2 A;  4LAW A;  3H9R B;  1P5Q A;  4DWS C;  3WQV A;  1O6I A;  2PN0 A;  4QZV B;  2O92 A;  1FKL A;  4JFK A;  2ZQT A;  2M1I A;  2N87 A;  3O5R A;  3CH9 A;  2XP5 A;  1EHN A;  3ARZ A;  3UQA A;  1NSG A;  4O2T A;  4Z2J A;  5DF0 A;  2ESC A;  2DT1 A;  1FKR A;  1PBK A;  1W26 A;  4P8W A;  5GPG A;  4DWS B;  5BXJ A;  2EUL A;  1YAT A;  1ZK6 A;  1W1T A;  2KI3 A;  4DZ3 A;  2MLZ A;  3JYM A;  2RUC A;  1NH6 A;  2KGJ A;  4MGV A;  1NWT A;  3RME A;  1NWR A;  3O5D A;  1B6C A;  1FFQ A;  4MNL A;  4JFM A;  3OOB A;  2OLH A;  1FD9 A;  4ODP A;  3UQB A;  4S3K A;  4DRJ A;  3LUO A;  1LJY A;  2MF9 A;  2XP8 A;  3PA7 A;  2VCD A;  2WM0 A;  4XAK A;  2RQS A;  4DH0 A;  5HUA A;  3RM9 A;  1KT1 A;  2RUQ A;  1D2K A;  4U84 A;  1RD6 A;  1C9H A;  3IKG A;  4W9Q A;  4MPK A;  3O5L A;  1GPF A;  1W9U A;  2PV3 A;  1HJX A;  2P4V A;  3O5G A;  1D7H A;  2KR7 A;  1WAW A;  3CHC A;  1JNT A;  3ALG A;  5HW7 A;  2ZQS A;  3FXY A;  1QZ2 A;  1EIB A;  4U85 A;  2DT2 A;  1W1Y A;  2FDM A;  1IX5 A;  2IF4 A;  3FAP A;  4JFI A;  2PPP A;  2XPA A;  5J6E A;  4DRK A;  5HWB A;  2PV2 A;  4ITZ A;  4ODO A;  3FY1 A;  4Z2G A;  1E44 A;  4DRP A;  4DRI A;  3G6L A;  1R9H A;  1J6Y A;  4LAV A;  2LJ4 A;  4G50 A;  3ARU A;  1GUV A;  4DRO A;  3KAD A;  4URI A;  3GPK A;  2DSZ A;  3O5E A;  2XP6 A;  3ODK A;  4ZS6 A;  1BL4 A;  4GGQ A;  3ARP A;  1W1P A;  3O5F A;  3UI5 A;  2Y78 A;  4MAV A;  4DWS A;  2LKN A;  2ITK A;  2DT3 A;  1D7J A;  2K8I A;  1HXV A;  3ARR A;  2A3A A;  4C02 B;  4QIB A;  5HW6 A;  2MNT A;  4WKF A;  1KFW A;  3JXV A;  4DIP A;  2A3C A;  1EYM A;  4QT2 A;  1FKG A;  1JVW A;  1UR9 A;  2A3E A;  1H0G A;  3RFW A;  3CZ8 A;  5DEZ A;  3I6C A;  2DG4 A;  3W4R A;  3AS2 A;  3CGM A;  4U86 A;  1ZCN A;  3ARV A;  3O5K A;  4L3N A;  3WH0 A;  2PPN A;  4JYS A;  2WLY A;  1NWU A;  2KE0 A;  5HBF A;  1BKF A;  1FKF A;  3KAF A;  3AQU A;  1FKI A;  2VN1 A;  1Q6H A;  3PRA A;  4P8X A;  4IPX A;  1K9T A;  1LQ0 A;  3ARQ A;  2KO7 A;  4L72 B;  3NI6 A;  2OFN A;  2XP3 A;  2YBT A;  3RGC A;  3WL1 A;  2WLZ A;  1FKB A;  4KQZ A;  1JNS A;  4QT3 A;  3ALF A;  1U79 A;  1Y0O A;  1JNE A;  4DRQ A;  2UZ5 A;  3KAB A;  4J4O A;  2DSV A;  3WD4 A;  3JYJ A;  3CHD A;  1LL6 A;  2MPH A;  4TW8 A;  3B7X A;  4MNJ A;  3RM8 A;  3O5M A;  2DSW A;  1W9P A;  2F21 A;  1HJV A;  2AOS A;  4Q22 A;  1M5Y A;  2PBC A;  1ZBC A;  2QF8 A;  1FAP A;  3AS0 A;  3B9D A;  3PR9 A;  5DIT A;  1PIN A;  1HKI A;  4TNS A;  4ZPW R;  2PV1 A;  4FAP A;  1VF8 A;  3CGN A;  1FKS A;  1FKJ A;  3KCE A;  1J4I A;  4DT4 A;  4DRH A;  3TCZ A;  1LG1 A;  2ZQU A;  3B8S A;  4TYO A;  2DSU A;  1NMV A;  4GIV A;  4IT6 A;  4W9O A;  2LPV A;  1HKJ A;  2XP4 A;  1E6P A;  2IUZ A;  5HWC A;  1N1A A;  3UF8 A;  4MNK A;  4Z2H A;  3BMB A;  3EY6 A;  3OA5 A;  2M08 A;  2RUD A;  3G6M A;  1OGG A;  1EDQ A;  4WKH A;  5HKG A;  3CHF A;  5HTG A;  3O5P A;  1XHG A;  4TX0 A;  3UI6 A;  4NZC A;  2WK2 A;  3B9E A;  4Z2I A;  2ZQV A;  3ART A;  4DRM A;  3ARW A;  4TW6 A;  1E6R A;  1D7I A;  1A7X A;  1E6Z A;  3PRB A;  3O5I A;  4MSP A;  1X6L A;  4HBO A;  1E15 A;  2F23 A;  1FKH A;  2G8Z A;  1WNO A;  3WD1 A;  4ODQ A;  4ODR A;  2FKE A;  1J4R A;  4ZPT R;  1FJD A;  3AS1 A;  1GOI A;  5DIV A;  1QPL A;  4LAX A;  4R0X A;  3WQW A;  5HT1 A;  4TW7 A;  2F4E A;  3TDB A;  4ODN A;  1FKT A;  1SR0 A;  4WIW A;  3GTY X;  2ETN A;  1D6O A;  1NMW A;  3GU0 A;  4Q7N A;  1TFV A;  4MNM A;  3VAW A;  4S3J A;  1F8A B;  1H0I A;  4BF8 A;  2DPE A;  5I98 A;  2PPO A;  3WKZ A;  2Q5A A;  1JND A;  1KT0 A;  1L1P A;  2B5U B;  2FAP A;  3IKD A;  3UQI A;  3KAC A;  4N19 A;  4J4N A;  1HKK A;  2D9F A;  3AS3 A;  4JFL A;  3NRK A;  1ZB5 A;  2ZR4 A;  2MLX A;  3MDY B;  4WK9 A;  1T11 A;  1J4H A;  3O5Q A;  3ARX A;  2DG3 A;  1Q1C A;  1EQ3 A;  4NNR A;  4PTM A;  3TC5 A;  1W9V A;  3O5O A;  4ML4 A;  1QPF A;  2YBU A;  3RM4 A;  3CHE A;  1CTN A;  1ZBK A;  4G2P A;  4Z2K A;  1Q6I A;  3ARY A;  2LGO A;  2XP7 A;  2MLY A;  2DG9 A;  4R5E A;  1E9L A;  5HW8 A;  2G41 A;  4MTV A;  2M2A A;  1OGB A;  5JH8 A;  1ZL1 A;  2DT0 A;  1JCH B;  2XP9 A;  4ODK A;  2KFW A;  3WD3 A;  4W9P A;  4W5U A;  1LL4 A;  3UI4 A;  5GPR A;  4HBE A;  1W1V A;  1ROU A;  4P8U A;  3WD0 A;  4ODM A;  3KAG A;  3KZ7 A;  4ZPV R;  4Z2L A;  3IHZ A;  4JFJ A;  1OWQ A;  2PI6 A;  1TCO C;  4DRN A;  3ARO A;  2B31 A;  1ZBW A;  4IQC A;  1WB0 A;  4P8V A;  4IT4 A;  1ZBV A;  3PRD A;  1XRV A;  1SYT A;  1LL7 A;  1X6N A;  1FFR A;  3KAI A;  1YW5 A;  3WD2 A;  2ZR6 A;  1HJW A;  1FKK A;  2JZV A;  1Q6U A; 
#chains in the Genus database with same CATH homology
 5DIU A;  3O5J A;  1ITX A;  1HKM A;  3WIJ A;  1ZU8 A;  2ZR5 A;  5GQB A;  4IQ2 A;  4WJX A;  5B8I C;  4LAY A;  2RUR A;  1E6N A;  3KAH A;  4HAR A;  4DWS D;  2XPB A;  4WKA A;  3IK8 A;  4ODL A;  5D75 A;  2O9O A;  3ARS A;  3QOK A;  4KR0 B;  3WL0 A;  1ROT A;  1UR8 A;  4NSB A;  3BXW A;  4DZ2 A;  1FKD A;  2L2S A;  1NWS A;  3B9A A;  4FN2 A;  2A3B A;  2F2D A;  3NTP A;  1F40 A;  2RSE A;  4LGX A;  4AY1 A;  5DO2 A;  2AWG A;  1LG2 A;  4LAW A;  3H9R B;  1P5Q A;  4DWS C;  3WQV A;  1O6I A;  4QZV B;  2O92 A;  1FKL A;  4JFK A;  2ZQT A;  2M1I A;  2N87 A;  3O5R A;  3CH9 A;  2XP5 A;  1EHN A;  3ARZ A;  3UQA A;  1NSG A;  4O2T A;  4Z2J A;  5DF0 A;  2ESC A;  2DT1 A;  1FKR A;  1PBK A;  1W26 A;  4P8W A;  5GPG A;  4DWS B;  5BXJ A;  1YAT A;  1ZK6 A;  1W1T A;  2KI3 A;  4DZ3 A;  2MLZ A;  3JYM A;  2RUC A;  1NH6 A;  2KGJ A;  4MGV A;  1NWT A;  3RME A;  1NWR A;  3O5D A;  1B6C A;  1FFQ A;  4MNL A;  4JFM A;  3OOB A;  2OLH A;  1FD9 A;  4ODP A;  3UQB A;  4S3K A;  4DRJ A;  3LUO A;  1LJY A;  2MF9 A;  2XP8 A;  3PA7 A;  2VCD A;  2WM0 A;  4XAK A;  2RQS A;  4DH0 A;  5HUA A;  3RM9 A;  1KT1 A;  2RUQ A;  1D2K A;  4U84 A;  1RD6 A;  1C9H A;  3IKG A;  4W9Q A;  4MPK A;  3O5L A;  1GPF A;  1W9U A;  2PV3 A;  1HJX A;  3O5G A;  1D7H A;  2KR7 A;  1WAW A;  3CHC A;  1JNT A;  3ALG A;  5HW7 A;  2ZQS A;  3FXY A;  1QZ2 A;  1EIB A;  4U85 A;  2DT2 A;  1W1Y A;  2FDM A;  1IX5 A;  2IF4 A;  3FAP A;  4JFI A;  2PPP A;  2XPA A;  5J6E A;  4DRK A;  5HWB A;  2PV2 A;  4ITZ A;  4ODO A;  3FY1 A;  4Z2G A;  4DRP A;  4DRI A;  3G6L A;  1R9H A;  1J6Y A;  4LAV A;  2LJ4 A;  4G50 A;  3ARU A;  1GUV A;  4DRO A;  3KAD A;  4URI A;  3GPK A;  2DSZ A;  3O5E A;  2XP6 A;  3ODK A;  4ZS6 A;  1BL4 A;  4GGQ A;  3ARP A;  1W1P A;  3O5F A;  3UI5 A;  2Y78 A;  4MAV A;  4DWS A;  2LKN A;  2ITK A;  2DT3 A;  1D7J A;  2K8I A;  1HXV A;  3ARR A;  2A3A A;  4C02 B;  4QIB A;  5HW6 A;  2MNT A;  4WKF A;  1KFW A;  3JXV A;  4DIP A;  2A3C A;  1EYM A;  4QT2 A;  1FKG A;  1JVW A;  1UR9 A;  2A3E A;  1H0G A;  3RFW A;  3CZ8 A;  5DEZ A;  3I6C A;  2DG4 A;  3W4R A;  3AS2 A;  3CGM A;  4U86 A;  1ZCN A;  3ARV A;  3O5K A;  4L3N A;  3WH0 A;  2PPN A;  4JYS A;  2WLY A;  1NWU A;  2KE0 A;  5HBF A;  1BKF A;  1FKF A;  3KAF A;  3AQU A;  1FKI A;  2VN1 A;  1Q6H A;  3PRA A;  4P8X A;  4IPX A;  1K9T A;  1LQ0 A;  3ARQ A;  2KO7 A;  4L72 B;  3NI6 A;  2OFN A;  2XP3 A;  2YBT A;  3RGC A;  3WL1 A;  2WLZ A;  1FKB A;  4KQZ A;  1JNS A;  4QT3 A;  3ALF A;  1U79 A;  1Y0O A;  1JNE A;  4DRQ A;  2UZ5 A;  3KAB A;  4J4O A;  2DSV A;  3WD4 A;  3JYJ A;  3CHD A;  1LL6 A;  2MPH A;  4TW8 A;  3B7X A;  4MNJ A;  3RM8 A;  3O5M A;  2DSW A;  1W9P A;  2F21 A;  1HJV A;  2AOS A;  4Q22 A;  1M5Y A;  2PBC A;  1ZBC A;  2QF8 A;  1FAP A;  3AS0 A;  3B9D A;  3PR9 A;  5DIT A;  1PIN A;  1HKI A;  4TNS A;  4ZPW R;  2PV1 A;  4FAP A;  1VF8 A;  3CGN A;  1FKS A;  1FKJ A;  3KCE A;  1J4I A;  4DT4 A;  4DRH A;  3TCZ A;  1LG1 A;  2ZQU A;  3B8S A;  4TYO A;  2DSU A;  1NMV A;  4GIV A;  4IT6 A;  4W9O A;  2LPV A;  1HKJ A;  2XP4 A;  1E6P A;  2IUZ A;  5HWC A;  1N1A A;  3UF8 A;  4MNK A;  4Z2H A;  3EY6 A;  3OA5 A;  2M08 A;  2RUD A;  3G6M A;  1OGG A;  1EDQ A;  4WKH A;  5HKG A;  3CHF A;  5HTG A;  3O5P A;  1XHG A;  4TX0 A;  3UI6 A;  4NZC A;  2WK2 A;  3B9E A;  4Z2I A;  2ZQV A;  3ART A;  4DRM A;  3ARW A;  4TW6 A;  1E6R A;  1D7I A;  1A7X A;  1E6Z A;  3PRB A;  3O5I A;  4MSP A;  1X6L A;  4HBO A;  1E15 A;  1FKH A;  2G8Z A;  1WNO A;  3WD1 A;  4ODQ A;  4ODR A;  2FKE A;  1J4R A;  4ZPT R;  1FJD A;  3AS1 A;  1GOI A;  5DIV A;  1QPL A;  4LAX A;  4R0X A;  3WQW A;  5HT1 A;  4TW7 A;  2F4E A;  3TDB A;  4ODN A;  1FKT A;  1SR0 A;  4WIW A;  1D6O A;  1NMW A;  4Q7N A;  1TFV A;  4MNM A;  3VAW A;  4S3J A;  1F8A B;  1H0I A;  4BF8 A;  2DPE A;  5I98 A;  2PPO A;  3WKZ A;  2Q5A A;  1JND A;  1KT0 A;  1L1P A;  2FAP A;  3IKD A;  3UQI A;  3KAC A;  4N19 A;  4J4N A;  1HKK A;  2D9F A;  3AS3 A;  4JFL A;  3NRK A;  1ZB5 A;  2ZR4 A;  2MLX A;  3MDY B;  4WK9 A;  1T11 A;  1J4H A;  3O5Q A;  3ARX A;  2DG3 A;  1Q1C A;  1EQ3 A;  4NNR A;  4PTM A;  3TC5 A;  1W9V A;  3O5O A;  4ML4 A;  1QPF A;  2YBU A;  3RM4 A;  3CHE A;  1CTN A;  1ZBK A;  4G2P A;  4Z2K A;  1Q6I A;  3ARY A;  2LGO A;  2XP7 A;  2MLY A;  2DG9 A;  4R5E A;  1E9L A;  5HW8 A;  2G41 A;  4MTV A;  2M2A A;  1OGB A;  5JH8 A;  1ZL1 A;  2DT0 A;  2XP9 A;  4ODK A;  2KFW A;  3WD3 A;  4W9P A;  4W5U A;  1LL4 A;  3UI4 A;  5GPR A;  4HBE A;  1W1V A;  1ROU A;  4P8U A;  3WD0 A;  4ODM A;  3KAG A;  3KZ7 A;  4ZPV R;  4Z2L A;  3IHZ A;  4JFJ A;  1OWQ A;  2PI6 A;  1TCO C;  4DRN A;  3ARO A;  2B31 A;  1ZBW A;  4IQC A;  1WB0 A;  4P8V A;  4IT4 A;  1ZBV A;  3PRD A;  1XRV A;  1SYT A;  1LL7 A;  1X6N A;  1FFR A;  3KAI A;  1YW5 A;  3WD2 A;  2ZR6 A;  1HJW A;  1FKK A;  2JZV A;  1Q6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...