2RUDA

Solution structure of the peptidyl prolyl cis-trans isomerase domain of c113d mutant human pin1 with sulfate ion
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C113D mutation in human Pin1 causes allosteric structural changes in the phosphate binding pocket of the PPIase domain through the tug of war in the dual-histidine motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rudA00
4W9PA 2N87A 3KACA 3KADA 3IKDA 3CGMA 2F2DA 1JVWA 1PINA 4N19A 1J4HA 4TYOA 4NNRA 2M1IA 5BXJA 4G2PA 1BKFA 4DZ2A 3O5MA 3VAWA 3TCZA 3UF8A 1A7XA 1B6CA 1Y0OA 2F4EA 4ODQA 1N1AA 2RUQA 4IQ2A 3UI5A 1ZCNA 1W26A 3CGNA 1M5YA 3O5QA 4DRQA 3PRBA 4JFMA 2PPOA 1FKHA 1KT1A 2PV2A 3O5OA 4LAYA 2F21A 2KE0A 2ZR6A 4TW8A 1J6YA 2PV3A 4LAXA 1FAPA 1TCOC 4DZ3A 2IF4A 2XP4A 3KAGA 3O5EA 4DH0A 3ODKA 4JFLA 4DIPA 4ODOA 4JYSA 4ODMA 3OOBA 3KAIA 5HT1A 2DG4A 5HWBA 3JYJA 1QZ2A 1U79A 4TX0A 3TC5A 4FAPA 5HTGA 3O5IA 4U84A 3KABA 1FKBA 5D75A 4C02B 4JFJA 2RQSA 5DIUA 3RGCA 1JNSA 3O5DA 4FN2A 2RUCA 1FKJA 1FJDA 1QPLA 2XP7A 3PA7A 5DITA 2VCDA 3IK8A 2XP9A 1EYMA 2D9FA 2KO7A 2Q5AA 4TW7A 2M2AA 2ZR5A 1F8AB 1BL4A 2PV1A 4QIBA 1FKTA 2ZR4A 2ZQUA 4J4NA 1FKFA 5HUAA 2XP5A 3UI4A 4LAWA 1J4RA 1KT0A 4IPXA 2MLYA 2K8IA 2LPVA 2UZ5A 3NTPA 3JYMA 4MGVA 4DRPA 3UQBA 1YW5A 4QT2A 2PPNA 1YATA 4J4OA 1D7HA 2MLZA 3IHZA 3KZ7A 1D7IA 3I6CA 4W9OA 4TNSA 1FKRA 4GIVA 1ROUA 3H9RB 1C9HA 1NMVA 2ZQSA 4MSPA 2LJ4A 1FD9A 3O5KA 4U85A 3UI6A 1D6OA 2RSEA 2DG9A 1FKGA 4ODPA 3UQAA 2ZQTA 2AWGA 2XP6A 4LAVA 4JFIA 3NRKA 3IKGA 2KI3A 4GGQA 1FKSA 1FKIA 4JFKA 3UQIA 5I98A 3O5JA 4U86A 2OFNA 3NI6A 4DT4A 4ITZA 1P5QA 3PRDA 1Q1CA 2MNTA 2KR7A 3WH0A 4DRKA 1L1PA 2PPPA 2VN1A 4ODKA 2FAPA 1NMWA 5HW6A 2LGOA 2M08A 4DROA 5HW7A 2DG3A 2L2SA 3RFWA 3O5FA 4DRJA 5HW8A 3EY6A 2MLXA 1NSGA 1EQ3A 4DRNA 1Q6UA 4ODRA 2KGJA 2LKNA 2XPBA 2MF9A 3MDYB 5GPGA 1J4IA 1ZK6A 4ODNA 2XP3A 4DRMA 3KAFA 4BF8A 4G50A 2JZVA 2PBCA 1FKDA 3O5GA 4QT3A 4W9QA 1Q6HA 2XPAA 2XP8A 5HWCA 2MPHA 2ZQVA 1FKLA 4IQCA 4O2TA 4DRHA 3JXVA 3O5LA 3O5RA 5HKGA 3KCEA 4ODLA 1F40A 5J6EA 1QPFA 1HXVA 3KAHA 2ITKA 1T11A 2RUDA 1JNTA 4DRIA 1R9HA 3TDBA 2Y78A 1D7JA 3O5PA 2KFWA 3FAPA 1ROTA 3GPKA 3LUOA 2FKEA 1FKKA 4TW6A 5DIVA 5B8IC 3B7XA 1PBKA 4R0XA 1Q6IA 2RURA
chains in the Genus database with same CATH superfamily
3KACA 1E44A 3IKDA 3AS2A 4N19A 3FY1A 4TYOA 4DWSB 1GUVA 1E6ZA 3VAWA 2F4EA 4ODQA 4S3KA 2RUQA 3CGNA 2PV2A 2YBUA 1LG2A 4TW8A 1TCOC 5HBFA 4DIPA 4ODMA 3OOBA 1KFWA 5HWBA 3CHFA 3JYJA 5HTGA 2IUZA 1JNSA 4DWSC 2OLHA 4FN2A 2RUCA 1FKJA 4ZS6A 1K9TA 2DT3A 2VCDA 2KO7A 4IT4A 1BL4A 2PV1A 2ZR4A 1ZU8A 4P8XA 1HKKA 2XP5A 3UI4A 1ZL1A 1KT0A 4ML4A 4HBOA 2DSUA 4KR0B 2MLZA 4IT6A 3RMEA 1ROUA 2ZQSA 3PRAA 4MSPA 1FD9A 1CTNA 3ARQA 2DG9A 5DEZA 4ODPA 3RM9A 2AWGA 2XP6A 4JFIA 3IKGA 2KI3A 1FKIA 4U86A 4DT4A 1WNOA 1P5QA 1HKIA 1Q1CA 2PPPA 2VN1A 1NMWA 4XAKA 3ARUA 2M08A 2MLXA 1EQ3A 1Q6UA 2FDMA 1J4IA 4ODNA 1X6NA 2XP3A 3ARSA 4BF8A 4G50A 2JZVA 3BMBA 2G8ZA 2XP8A 4O2TA 3O5LA 1LQ0A 3CHDA 1WB0A 3CH9A 5J6EA 3KAHA 4DRIA 1R9HA 3ARWA 3ARZA 2DT0A 1D7JA 4R5EA 3FAPA 4Z2GA 3LUOA 4TW6A 2A3AA 3ARVA 1PBKA 4R0XA 2YBTA 1UR8A 3GU0A 4W9PA 3WKZA 3CGMA 1JVWA 4UDMA 1J4HA 1HJVA 4NNRA 2M1IA 5BXJA 4G2PA 4ZPVR 4DZ2A 3WD1A 3G6MA 2DSVA 1A7XA 1Y0OA 1LL4A 3CHCA 1JCHB 1M5YA 3PRBA 1FKHA 1KT1A 4Q22A 2F21A 2KE0A 1W1VA 1J6YA 3B8SA 3KAGA 4DH0A 3ODKA 4JYSA 4LGXA 2B31A 1QZ2A 4WKFA 4TX0A 3TC5A 3O5IA 3KABA 4HARA 4MTVA 1QPLA 3PA7A 3BXWA 3AS3A 2XP9A 4QIBA 2ZQUA 3ARPA 5HUAA 3RM8A 4IPXA 2K8IA 2WK2A 2DT1A 4DRPA 1E9LA 3UQBA 4Z2HA 4W9OA 4MAVA 1FKRA 3O5KA 1RD6A 3QOKA 4P8UA 1ITXA 2ZQTA 4MNKA 3W4RA 4GGQA 5I98A 1JNEA 1FFQA 2OFNA 3NI6A 4ITZA 1GOIA 1W1YA 2KR7A 4DRKA 4W5UA 4ODKA 4ZPTR 2FAPA 4L3NA 4URIA 4DROA 1LG1A 5HW7A 1GRJA 3O5FA 4DRJA 3EY6A 3B9DA 1ZBWA 2AOSA 1W9PA 2MF9A 3ALFA 5HWCA 3JXVA 5HKGA 1QPFA 1HXVA 2RUDA 4Z2JA 3O5PA 2G41A 1W1PA 2FKEA 1FKKA 3ARXA 3EIPA 2WM0A 2F2DA 1PINA 1IX5A 1TFVA 4Z2LA 1D2KA 3WD4A 1BKFA 1O6IA 1NH6A 2P4VA 1B6CA 4IQ2A 3UI5A 1W26A 2ETNA 3O5QA 4DRQA 1X6LA 3O5OA 4LAYA 1NWTA 2ZR6A 1SR0A 4LAXA 4P8VA 4DZ3A 2XP4A 3O5EA 1E6NA 4JFLA 4ODOA 1WAWA 2DG4A 1U79A 3B9EA 4U84A 4C02B 3AQUA 4JFJA 2RQSA 3WD2A 3GTYX 2QF8A 3IK8A 3WD3A 1ZBKA 2Q5AA 1FKFA 1ZB5A 4LAWA 1J4RA 2MLYA 2LPVA 1ZBCA 1YATA 5DO2A 3CZ8A 4J4OA 4MNJA 1OWQA 4P8WA 3I6CA 4WKHA 4Q7NA 5DF0A 1NMVA 4U85A 2LJ4A 3AS0A 1D6OA 1W9VA 2RSEA 5GPRA 2PI6A 1ZBVA 4L72B 3UQAA 4LAVA 4MPKA 4DWSA 4JFKA 3UQIA 1EIBA 3ARRA 4Z2KA 2MNTA 3WH0A 4DWSD 5HW6A 1OGBA 2LGOA 3RFWA 2L2SA 4MNMA 4DRNA 2KGJA 5GPGA 1JNDA 1UR9A 4Z2IA 1E15A 2PBCA 1FKDA 3O5GA 4W9QA 1GPFA 4DRHA 1HKMA 3KCEA 4WK9A 2ITKA 2WLYA 4WKAA 1JNTA 1LL7A 3ALGA 2KFWA 1ROTA 2WLZA 2DT2A 5DIVA 4WJXA 5DIUA 2DSZA 3WQWA 2N87A 3KADA 4WIWA 1W9UA 1HKJA 4NSBA 3G6LA 3O5MA 3TCZA 3UF8A 2B5UB 1N1AA 1ZCNA 1E6RA 4AY1A 4JFMA 2PPOA 1NWRA 4S3JA 1NWUA 1SYTA 2F23A 1FAPA 2PV3A 3RM4A 2IF4A 1OGGA 2DPEA 5HT1A 3KAIA 4FAPA 1FKBA 5D75A 3RGCA 5JH8A 3AROA 3ARYA 3WQVA 3O5DA 1FJDA 2XP7A 5DITA 4PTMA 1EYMA 2D9FA 2ESCA 4TW7A 2M2AA 2EULA 1F8AB 2PN0A 2ZR5A 3OA5A 1FKTA 1VF8A 4J4NA 2O9OA 3WL0A 2UZ5A 3NTPA 3JYMA 3AS1A 4MGVA 1YW5A 1E6PA 4QT2A 3WD0A 2PPNA 4HBEA 1D7HA 3IHZA 3KZ7A 1D7IA 1LL6A 3WL1A 4TNSA 4GIVA 3H9RB 1C9HA 3WIJA 3UI6A 1FKGA 1NWSA 1HJWA 3NRKA 4NZCA 1FKSA 3O5JA 4ZPWR 5GQBA 3PRDA 1XRVA 1EDQA 2A3EA 1L1PA 2DG3A 5HW8A 1H0GA 1NSGA 2A3BA 2A3CA 4ODRA 2LKNA 1HJXA 2XPBA 3MDYB 1ZK6A 4DRMA 1W1TA 4MNLA 3KAFA 4KQZA 3FXYA 1EHNA 4QT3A 1Q6HA 2XPAA 2MPHA 2ZQVA 1FKLA 4IQCA 4QZVB 2O92A 3O5RA 1F40A 4ODLA 1T11A 3B9AA 1FFRA 1LJYA 2DSWA 1XHGA 3TDBA 2Y78A 3PR9A 3GPKA 3CHEA 1H0IA 5B8IC 3B7XA 3ARTA 1Q6IA 2RURA
chains in the Genus database with same CATH topology
3KACA 3IKDA 3AS2A 4N19A 3FY1A 4TYOA 4DWSB 1GUVA 1E6ZA 3VAWA 2F4EA 4ODQA 4S3KA 2RUQA 3CGNA 2PV2A 2YBUA 1LG2A 4TW8A 1TCOC 5HBFA 4DIPA 4ODMA 3OOBA 1KFWA 5HWBA 3CHFA 3JYJA 5HTGA 2IUZA 1JNSA 4DWSC 2OLHA 4FN2A 2RUCA 1FKJA 4ZS6A 1K9TA 2DT3A 2VCDA 2KO7A 4IT4A 1BL4A 2PV1A 2ZR4A 1ZU8A 4P8XA 1HKKA 2XP5A 3UI4A 1ZL1A 1KT0A 4ML4A 4HBOA 2DSUA 4KR0B 2MLZA 4IT6A 3RMEA 1ROUA 2ZQSA 3PRAA 4MSPA 1FD9A 1CTNA 3ARQA 2DG9A 5DEZA 4ODPA 3RM9A 2AWGA 2XP6A 4JFIA 3IKGA 2KI3A 1FKIA 4U86A 4DT4A 1WNOA 1P5QA 1HKIA 1Q1CA 2PPPA 2VN1A 1NMWA 4XAKA 3ARUA 2M08A 2MLXA 1EQ3A 1Q6UA 2FDMA 1J4IA 4ODNA 1X6NA 2XP3A 3ARSA 4BF8A 4G50A 2JZVA 2G8ZA 2XP8A 4O2TA 3O5LA 1LQ0A 3CHDA 1WB0A 3CH9A 5J6EA 3KAHA 4DRIA 1R9HA 3ARWA 3ARZA 2DT0A 1D7JA 4R5EA 3FAPA 4Z2GA 3LUOA 4TW6A 2A3AA 3ARVA 1PBKA 4R0XA 2YBTA 1UR8A 4W9PA 3WKZA 3CGMA 1JVWA 1J4HA 1HJVA 4NNRA 2M1IA 5BXJA 4G2PA 4ZPVR 4DZ2A 3WD1A 3G6MA 2DSVA 1A7XA 1Y0OA 1LL4A 3CHCA 1M5YA 3PRBA 1FKHA 1KT1A 4Q22A 2F21A 2KE0A 1W1VA 1J6YA 3B8SA 3KAGA 4DH0A 3ODKA 4JYSA 4LGXA 2B31A 1QZ2A 4WKFA 4TX0A 3TC5A 3O5IA 3KABA 4HARA 4MTVA 1QPLA 3PA7A 3BXWA 3AS3A 2XP9A 4QIBA 2ZQUA 3ARPA 5HUAA 3RM8A 4IPXA 2K8IA 2WK2A 2DT1A 4DRPA 1E9LA 3UQBA 4Z2HA 4W9OA 4MAVA 1FKRA 3O5KA 1RD6A 3QOKA 4P8UA 1ITXA 2ZQTA 4MNKA 3W4RA 4GGQA 5I98A 1JNEA 1FFQA 2OFNA 3NI6A 4ITZA 1GOIA 1W1YA 2KR7A 4DRKA 4W5UA 4ODKA 4ZPTR 2FAPA 4L3NA 4URIA 4DROA 1LG1A 5HW7A 3O5FA 4DRJA 3EY6A 3B9DA 1ZBWA 2AOSA 1W9PA 2MF9A 3ALFA 5HWCA 3JXVA 5HKGA 1QPFA 1HXVA 2RUDA 4Z2JA 3O5PA 2G41A 1W1PA 2FKEA 1FKKA 3ARXA 2WM0A 2F2DA 1PINA 1IX5A 1TFVA 4Z2LA 1D2KA 3WD4A 1BKFA 1O6IA 1NH6A 1B6CA 4IQ2A 3UI5A 1W26A 3O5QA 4DRQA 1X6LA 3O5OA 4LAYA 1NWTA 2ZR6A 1SR0A 4LAXA 4P8VA 4DZ3A 2XP4A 3O5EA 1E6NA 4JFLA 4ODOA 1WAWA 2DG4A 1U79A 3B9EA 4U84A 4C02B 3AQUA 4JFJA 2RQSA 3WD2A 2QF8A 3IK8A 3WD3A 1ZBKA 2Q5AA 1FKFA 1ZB5A 4LAWA 1J4RA 2MLYA 2LPVA 1ZBCA 1YATA 5DO2A 3CZ8A 4J4OA 4MNJA 1OWQA 4P8WA 3I6CA 4WKHA 4Q7NA 5DF0A 1NMVA 4U85A 2LJ4A 3AS0A 1D6OA 1W9VA 2RSEA 5GPRA 2PI6A 1ZBVA 4L72B 3UQAA 4LAVA 4MPKA 4DWSA 4JFKA 3UQIA 1EIBA 3ARRA 4Z2KA 2MNTA 3WH0A 4DWSD 5HW6A 1OGBA 2LGOA 3RFWA 2L2SA 4MNMA 4DRNA 2KGJA 5GPGA 1JNDA 1UR9A 4Z2IA 1E15A 2PBCA 1FKDA 3O5GA 4W9QA 1GPFA 4DRHA 1HKMA 3KCEA 4WK9A 2ITKA 2WLYA 4WKAA 1JNTA 1LL7A 3ALGA 2KFWA 1ROTA 2WLZA 2DT2A 5DIVA 4WJXA 5DIUA 2DSZA 3WQWA 2N87A 3KADA 4WIWA 1W9UA 1HKJA 4NSBA 3G6LA 3O5MA 3TCZA 3UF8A 1N1AA 1ZCNA 1E6RA 4AY1A 4JFMA 2PPOA 1NWRA 4S3JA 1NWUA 1SYTA 2PV3A 1FAPA 3RM4A 2IF4A 1OGGA 2DPEA 5HT1A 3KAIA 4FAPA 1FKBA 5D75A 3RGCA 5JH8A 3AROA 3ARYA 3WQVA 3O5DA 1FJDA 2XP7A 5DITA 4PTMA 1EYMA 2D9FA 2ESCA 4TW7A 2M2AA 2ZR5A 1F8AB 3OA5A 1FKTA 1VF8A 4J4NA 2O9OA 3WL0A 2UZ5A 3NTPA 3JYMA 3AS1A 4MGVA 1YW5A 1E6PA 4QT2A 3WD0A 2PPNA 4HBEA 1D7HA 3IHZA 3KZ7A 1D7IA 1LL6A 3WL1A 4TNSA 4GIVA 3H9RB 1C9HA 3WIJA 3UI6A 1FKGA 1NWSA 1HJWA 3NRKA 4NZCA 1FKSA 3O5JA 4ZPWR 5GQBA 3PRDA 1XRVA 1EDQA 2A3EA 1L1PA 2DG3A 5HW8A 1H0GA 1NSGA 2A3BA 2A3CA 4ODRA 2LKNA 1HJXA 2XPBA 3MDYB 1ZK6A 4DRMA 1W1TA 4MNLA 3KAFA 4KQZA 3FXYA 1EHNA 4QT3A 1Q6HA 2XPAA 2MPHA 2ZQVA 1FKLA 4IQCA 4QZVB 2O92A 3O5RA 1F40A 4ODLA 1T11A 3B9AA 1FFRA 1LJYA 2DSWA 1XHGA 3TDBA 2Y78A 3PR9A 3GPKA 3CHEA 1H0IA 5B8IC 3B7XA 3ARTA 1Q6IA 2RURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9P A;  2N87 A;  3KAC A;  3KAD A;  3IKD A;  3CGM A;  2F2D A;  1JVW A;  1PIN A;  4N19 A;  1J4H A;  4TYO A;  4NNR A;  2M1I A;  5BXJ A;  4G2P A;  1BKF A;  4DZ2 A;  3O5M A;  3VAW A;  3TCZ A;  3UF8 A;  1A7X A;  1B6C A;  1Y0O A;  2F4E A;  4ODQ A;  1N1A A;  2RUQ A;  4IQ2 A;  3UI5 A;  1ZCN A;  1W26 A;  3CGN A;  1M5Y A;  3O5Q A;  4DRQ A;  3PRB A;  4JFM A;  2PPO A;  1FKH A;  1KT1 A;  2PV2 A;  3O5O A;  4LAY A;  2F21 A;  2KE0 A;  2ZR6 A;  4TW8 A;  1J6Y A;  2PV3 A;  4LAX A;  1FAP A;  1TCO C;  4DZ3 A;  2IF4 A;  2XP4 A;  3KAG A;  3O5E A;  4DH0 A;  3ODK A;  4JFL A;  4DIP A;  4ODO A;  4JYS A;  4ODM A;  3OOB A;  3KAI A;  5HT1 A;  2DG4 A;  5HWB A;  3JYJ A;  1QZ2 A;  1U79 A;  4TX0 A;  3TC5 A;  4FAP A;  5HTG A;  3O5I A;  4U84 A;  3KAB A;  1FKB A;  5D75 A;  4C02 B;  4JFJ A;  2RQS A;  5DIU A;  3RGC A;  1JNS A;  3O5D A;  4FN2 A;  2RUC A;  1FKJ A;  1FJD A;  1QPL A;  2XP7 A;  3PA7 A;  5DIT A;  2VCD A;  3IK8 A;  2XP9 A;  1EYM A;  2D9F A;  2KO7 A;  2Q5A A;  4TW7 A;  2M2A A;  2ZR5 A;  1F8A B;  1BL4 A;  2PV1 A;  4QIB A;  1FKT A;  2ZR4 A;  2ZQU A;  4J4N A;  1FKF A;  5HUA A;  2XP5 A;  3UI4 A;  4LAW A;  1J4R A;  1KT0 A;  4IPX A;  2MLY A;  2K8I A;  2LPV A;  2UZ5 A;  3NTP A;  3JYM A;  4MGV A;  4DRP A;  3UQB A;  1YW5 A;  4QT2 A;  2PPN A;  1YAT A;  4J4O A;  1D7H A;  2MLZ A;  3IHZ A;  3KZ7 A;  1D7I A;  3I6C A;  4W9O A;  4TNS A;  1FKR A;  4GIV A;  1ROU A;  3H9R B;  1C9H A;  1NMV A;  2ZQS A;  4MSP A;  2LJ4 A;  1FD9 A;  3O5K A;  4U85 A;  3UI6 A;  1D6O A;  2RSE A;  2DG9 A;  1FKG A;  4ODP A;  3UQA A;  2ZQT A;  2AWG A;  2XP6 A;  4LAV A;  4JFI A;  3NRK A;  3IKG A;  2KI3 A;  4GGQ A;  1FKS A;  1FKI A;  4JFK A;  3UQI A;  5I98 A;  3O5J A;  4U86 A;  2OFN A;  3NI6 A;  4DT4 A;  4ITZ A;  1P5Q A;  3PRD A;  1Q1C A;  2MNT A;  2KR7 A;  3WH0 A;  4DRK A;  1L1P A;  2PPP A;  2VN1 A;  4ODK A;  2FAP A;  1NMW A;  5HW6 A;  2LGO A;  2M08 A;  4DRO A;  5HW7 A;  2DG3 A;  2L2S A;  3RFW A;  3O5F A;  4DRJ A;  5HW8 A;  3EY6 A;  2MLX A;  1NSG A;  1EQ3 A;  4DRN A;  1Q6U A;  4ODR A;  2KGJ A;  2LKN A;  2XPB A;  2MF9 A;  3MDY B;  5GPG A;  1J4I A;  1ZK6 A;  4ODN A;  2XP3 A;  4DRM A;  3KAF A;  4BF8 A;  4G50 A;  2JZV A;  2PBC A;  1FKD A;  3O5G A;  4QT3 A;  4W9Q A;  1Q6H A;  2XPA A;  2XP8 A;  5HWC A;  2MPH A;  2ZQV A;  1FKL A;  4IQC A;  4O2T A;  4DRH A;  3JXV A;  3O5L A;  3O5R A;  5HKG A;  3KCE A;  4ODL A;  1F40 A;  5J6E A;  1QPF A;  1HXV A;  3KAH A;  2ITK A;  1T11 A;  2RUD A;  1JNT A;  4DRI A;  1R9H A;  3TDB A;  2Y78 A;  1D7J A;  3O5P A;  2KFW A;  3FAP A;  1ROT A;  3GPK A;  3LUO A;  2FKE A;  1FKK A;  4TW6 A;  5DIV A;  5B8I C;  3B7X A;  1PBK A;  4R0X A;  1Q6I A;  2RUR A; 
#chains in the Genus database with same CATH topology
 3KAC A;  1E44 A;  3IKD A;  3AS2 A;  4N19 A;  3FY1 A;  4TYO A;  4DWS B;  1GUV A;  1E6Z A;  3VAW A;  2F4E A;  4ODQ A;  4S3K A;  2RUQ A;  3CGN A;  2PV2 A;  2YBU A;  1LG2 A;  4TW8 A;  1TCO C;  5HBF A;  4DIP A;  4ODM A;  3OOB A;  1KFW A;  5HWB A;  3CHF A;  3JYJ A;  5HTG A;  2IUZ A;  1JNS A;  4DWS C;  2OLH A;  4FN2 A;  2RUC A;  1FKJ A;  4ZS6 A;  1K9T A;  2DT3 A;  2VCD A;  2KO7 A;  4IT4 A;  1BL4 A;  2PV1 A;  2ZR4 A;  1ZU8 A;  4P8X A;  1HKK A;  2XP5 A;  3UI4 A;  1ZL1 A;  1KT0 A;  4ML4 A;  4HBO A;  2DSU A;  4KR0 B;  2MLZ A;  4IT6 A;  3RME A;  1ROU A;  2ZQS A;  3PRA A;  4MSP A;  1FD9 A;  1CTN A;  3ARQ A;  2DG9 A;  5DEZ A;  4ODP A;  3RM9 A;  2AWG A;  2XP6 A;  4JFI A;  3IKG A;  2KI3 A;  1FKI A;  4U86 A;  4DT4 A;  1WNO A;  1P5Q A;  1HKI A;  1Q1C A;  2PPP A;  2VN1 A;  1NMW A;  4XAK A;  3ARU A;  2M08 A;  2MLX A;  1EQ3 A;  1Q6U A;  2FDM A;  1J4I A;  4ODN A;  1X6N A;  2XP3 A;  3ARS A;  4BF8 A;  4G50 A;  2JZV A;  3BMB A;  2G8Z A;  2XP8 A;  4O2T A;  3O5L A;  1LQ0 A;  3CHD A;  1WB0 A;  3CH9 A;  5J6E A;  3KAH A;  4DRI A;  1R9H A;  3ARW A;  3ARZ A;  2DT0 A;  1D7J A;  4R5E A;  3FAP A;  4Z2G A;  3LUO A;  4TW6 A;  2A3A A;  3ARV A;  1PBK A;  4R0X A;  2YBT A;  1UR8 A;  3GU0 A;  4W9P A;  3WKZ A;  3CGM A;  1JVW A;  4UDM A;  1J4H A;  1HJV A;  4NNR A;  2M1I A;  5BXJ A;  4G2P A;  4ZPV R;  4DZ2 A;  3WD1 A;  3G6M A;  2DSV A;  1A7X A;  1Y0O A;  1LL4 A;  3CHC A;  1JCH B;  1M5Y A;  3PRB A;  1FKH A;  1KT1 A;  4Q22 A;  2F21 A;  2KE0 A;  1W1V A;  1J6Y A;  3B8S A;  3KAG A;  4DH0 A;  3ODK A;  4JYS A;  4LGX A;  2B31 A;  1QZ2 A;  4WKF A;  4TX0 A;  3TC5 A;  3O5I A;  3KAB A;  4HAR A;  4MTV A;  1QPL A;  3PA7 A;  3BXW A;  3AS3 A;  2XP9 A;  4QIB A;  2ZQU A;  3ARP A;  5HUA A;  3RM8 A;  4IPX A;  2K8I A;  2WK2 A;  2DT1 A;  4DRP A;  1E9L A;  3UQB A;  4Z2H A;  4W9O A;  4MAV A;  1FKR A;  3O5K A;  1RD6 A;  3QOK A;  4P8U A;  1ITX A;  2ZQT A;  4MNK A;  3W4R A;  4GGQ A;  5I98 A;  1JNE A;  1FFQ A;  2OFN A;  3NI6 A;  4ITZ A;  1GOI A;  1W1Y A;  2KR7 A;  4DRK A;  4W5U A;  4ODK A;  4ZPT R;  2FAP A;  4L3N A;  4URI A;  4DRO A;  1LG1 A;  5HW7 A;  1GRJ A;  3O5F A;  4DRJ A;  3EY6 A;  3B9D A;  1ZBW A;  2AOS A;  1W9P A;  2MF9 A;  3ALF A;  5HWC A;  3JXV A;  5HKG A;  1QPF A;  1HXV A;  2RUD A;  4Z2J A;  3O5P A;  2G41 A;  1W1P A;  2FKE A;  1FKK A;  3ARX A;  3EIP A;  2WM0 A;  2F2D A;  1PIN A;  1IX5 A;  1TFV A;  4Z2L A;  1D2K A;  3WD4 A;  1BKF A;  1O6I A;  1NH6 A;  2P4V A;  1B6C A;  4IQ2 A;  3UI5 A;  1W26 A;  2ETN A;  3O5Q A;  4DRQ A;  1X6L A;  3O5O A;  4LAY A;  1NWT A;  2ZR6 A;  1SR0 A;  4LAX A;  4P8V A;  4DZ3 A;  2XP4 A;  3O5E A;  1E6N A;  4JFL A;  4ODO A;  1WAW A;  2DG4 A;  1U79 A;  3B9E A;  4U84 A;  4C02 B;  3AQU A;  4JFJ A;  2RQS A;  3WD2 A;  3GTY X;  2QF8 A;  3IK8 A;  3WD3 A;  1ZBK A;  2Q5A A;  1FKF A;  1ZB5 A;  4LAW A;  1J4R A;  2MLY A;  2LPV A;  1ZBC A;  1YAT A;  5DO2 A;  3CZ8 A;  4J4O A;  4MNJ A;  1OWQ A;  4P8W A;  3I6C A;  4WKH A;  4Q7N A;  5DF0 A;  1NMV A;  4U85 A;  2LJ4 A;  3AS0 A;  1D6O A;  1W9V A;  2RSE A;  5GPR A;  2PI6 A;  1ZBV A;  4L72 B;  3UQA A;  4LAV A;  4MPK A;  4DWS A;  4JFK A;  3UQI A;  1EIB A;  3ARR A;  4Z2K A;  2MNT A;  3WH0 A;  4DWS D;  5HW6 A;  1OGB A;  2LGO A;  3RFW A;  2L2S A;  4MNM A;  4DRN A;  2KGJ A;  5GPG A;  1JND A;  1UR9 A;  4Z2I A;  1E15 A;  2PBC A;  1FKD A;  3O5G A;  4W9Q A;  1GPF A;  4DRH A;  1HKM A;  3KCE A;  4WK9 A;  2ITK A;  2WLY A;  4WKA A;  1JNT A;  1LL7 A;  3ALG A;  2KFW A;  1ROT A;  2WLZ A;  2DT2 A;  5DIV A;  4WJX A;  5DIU A;  2DSZ A;  3WQW A;  2N87 A;  3KAD A;  4WIW A;  1W9U A;  1HKJ A;  4NSB A;  3G6L A;  3O5M A;  3TCZ A;  3UF8 A;  2B5U B;  1N1A A;  1ZCN A;  1E6R A;  4AY1 A;  4JFM A;  2PPO A;  1NWR A;  4S3J A;  1NWU A;  1SYT A;  2F23 A;  1FAP A;  2PV3 A;  3RM4 A;  2IF4 A;  1OGG A;  2DPE A;  5HT1 A;  3KAI A;  4FAP A;  1FKB A;  5D75 A;  3RGC A;  5JH8 A;  3ARO A;  3ARY A;  3WQV A;  3O5D A;  1FJD A;  2XP7 A;  5DIT A;  4PTM A;  1EYM A;  2D9F A;  2ESC A;  4TW7 A;  2M2A A;  2EUL A;  1F8A B;  2PN0 A;  2ZR5 A;  3OA5 A;  1FKT A;  1VF8 A;  4J4N A;  2O9O A;  3WL0 A;  2UZ5 A;  3NTP A;  3JYM A;  3AS1 A;  4MGV A;  1YW5 A;  1E6P A;  4QT2 A;  3WD0 A;  2PPN A;  4HBE A;  1D7H A;  3IHZ A;  3KZ7 A;  1D7I A;  1LL6 A;  3WL1 A;  4TNS A;  4GIV A;  3H9R B;  1C9H A;  3WIJ A;  3UI6 A;  1FKG A;  1NWS A;  1HJW A;  3NRK A;  4NZC A;  1FKS A;  3O5J A;  4ZPW R;  5GQB A;  3PRD A;  1XRV A;  1EDQ A;  2A3E A;  1L1P A;  2DG3 A;  5HW8 A;  1H0G A;  1NSG A;  2A3B A;  2A3C A;  4ODR A;  2LKN A;  1HJX A;  2XPB A;  3MDY B;  1ZK6 A;  4DRM A;  1W1T A;  4MNL A;  3KAF A;  4KQZ A;  3FXY A;  1EHN A;  4QT3 A;  1Q6H A;  2XPA A;  2MPH A;  2ZQV A;  1FKL A;  4IQC A;  4QZV B;  2O92 A;  3O5R A;  1F40 A;  4ODL A;  1T11 A;  3B9A A;  1FFR A;  1LJY A;  2DSW A;  1XHG A;  3TDB A;  2Y78 A;  3PR9 A;  3GPK A;  3CHE A;  1H0I A;  5B8I C;  3B7X A;  3ART A;  1Q6I A;  2RUR A; 
#chains in the Genus database with same CATH homology
 3KAC A;  3IKD A;  3AS2 A;  4N19 A;  3FY1 A;  4TYO A;  4DWS B;  1GUV A;  1E6Z A;  3VAW A;  2F4E A;  4ODQ A;  4S3K A;  2RUQ A;  3CGN A;  2PV2 A;  2YBU A;  1LG2 A;  4TW8 A;  1TCO C;  5HBF A;  4DIP A;  4ODM A;  3OOB A;  1KFW A;  5HWB A;  3CHF A;  3JYJ A;  5HTG A;  2IUZ A;  1JNS A;  4DWS C;  2OLH A;  4FN2 A;  2RUC A;  1FKJ A;  4ZS6 A;  1K9T A;  2DT3 A;  2VCD A;  2KO7 A;  4IT4 A;  1BL4 A;  2PV1 A;  2ZR4 A;  1ZU8 A;  4P8X A;  1HKK A;  2XP5 A;  3UI4 A;  1ZL1 A;  1KT0 A;  4ML4 A;  4HBO A;  2DSU A;  4KR0 B;  2MLZ A;  4IT6 A;  3RME A;  1ROU A;  2ZQS A;  3PRA A;  4MSP A;  1FD9 A;  1CTN A;  3ARQ A;  2DG9 A;  5DEZ A;  4ODP A;  3RM9 A;  2AWG A;  2XP6 A;  4JFI A;  3IKG A;  2KI3 A;  1FKI A;  4U86 A;  4DT4 A;  1WNO A;  1P5Q A;  1HKI A;  1Q1C A;  2PPP A;  2VN1 A;  1NMW A;  4XAK A;  3ARU A;  2M08 A;  2MLX A;  1EQ3 A;  1Q6U A;  2FDM A;  1J4I A;  4ODN A;  1X6N A;  2XP3 A;  3ARS A;  4BF8 A;  4G50 A;  2JZV A;  2G8Z A;  2XP8 A;  4O2T A;  3O5L A;  1LQ0 A;  3CHD A;  1WB0 A;  3CH9 A;  5J6E A;  3KAH A;  4DRI A;  1R9H A;  3ARW A;  3ARZ A;  2DT0 A;  1D7J A;  4R5E A;  3FAP A;  4Z2G A;  3LUO A;  4TW6 A;  2A3A A;  3ARV A;  1PBK A;  4R0X A;  2YBT A;  1UR8 A;  4W9P A;  3WKZ A;  3CGM A;  1JVW A;  1J4H A;  1HJV A;  4NNR A;  2M1I A;  5BXJ A;  4G2P A;  4ZPV R;  4DZ2 A;  3WD1 A;  3G6M A;  2DSV A;  1A7X A;  1Y0O A;  1LL4 A;  3CHC A;  1M5Y A;  3PRB A;  1FKH A;  1KT1 A;  4Q22 A;  2F21 A;  2KE0 A;  1W1V A;  1J6Y A;  3B8S A;  3KAG A;  4DH0 A;  3ODK A;  4JYS A;  4LGX A;  2B31 A;  1QZ2 A;  4WKF A;  4TX0 A;  3TC5 A;  3O5I A;  3KAB A;  4HAR A;  4MTV A;  1QPL A;  3PA7 A;  3BXW A;  3AS3 A;  2XP9 A;  4QIB A;  2ZQU A;  3ARP A;  5HUA A;  3RM8 A;  4IPX A;  2K8I A;  2WK2 A;  2DT1 A;  4DRP A;  1E9L A;  3UQB A;  4Z2H A;  4W9O A;  4MAV A;  1FKR A;  3O5K A;  1RD6 A;  3QOK A;  4P8U A;  1ITX A;  2ZQT A;  4MNK A;  3W4R A;  4GGQ A;  5I98 A;  1JNE A;  1FFQ A;  2OFN A;  3NI6 A;  4ITZ A;  1GOI A;  1W1Y A;  2KR7 A;  4DRK A;  4W5U A;  4ODK A;  4ZPT R;  2FAP A;  4L3N A;  4URI A;  4DRO A;  1LG1 A;  5HW7 A;  3O5F A;  4DRJ A;  3EY6 A;  3B9D A;  1ZBW A;  2AOS A;  1W9P A;  2MF9 A;  3ALF A;  5HWC A;  3JXV A;  5HKG A;  1QPF A;  1HXV A;  2RUD A;  4Z2J A;  3O5P A;  2G41 A;  1W1P A;  2FKE A;  1FKK A;  3ARX A;  2WM0 A;  2F2D A;  1PIN A;  1IX5 A;  1TFV A;  4Z2L A;  1D2K A;  3WD4 A;  1BKF A;  1O6I A;  1NH6 A;  1B6C A;  4IQ2 A;  3UI5 A;  1W26 A;  3O5Q A;  4DRQ A;  1X6L A;  3O5O A;  4LAY A;  1NWT A;  2ZR6 A;  1SR0 A;  4LAX A;  4P8V A;  4DZ3 A;  2XP4 A;  3O5E A;  1E6N A;  4JFL A;  4ODO A;  1WAW A;  2DG4 A;  1U79 A;  3B9E A;  4U84 A;  4C02 B;  3AQU A;  4JFJ A;  2RQS A;  3WD2 A;  2QF8 A;  3IK8 A;  3WD3 A;  1ZBK A;  2Q5A A;  1FKF A;  1ZB5 A;  4LAW A;  1J4R A;  2MLY A;  2LPV A;  1ZBC A;  1YAT A;  5DO2 A;  3CZ8 A;  4J4O A;  4MNJ A;  1OWQ A;  4P8W A;  3I6C A;  4WKH A;  4Q7N A;  5DF0 A;  1NMV A;  4U85 A;  2LJ4 A;  3AS0 A;  1D6O A;  1W9V A;  2RSE A;  5GPR A;  2PI6 A;  1ZBV A;  4L72 B;  3UQA A;  4LAV A;  4MPK A;  4DWS A;  4JFK A;  3UQI A;  1EIB A;  3ARR A;  4Z2K A;  2MNT A;  3WH0 A;  4DWS D;  5HW6 A;  1OGB A;  2LGO A;  3RFW A;  2L2S A;  4MNM A;  4DRN A;  2KGJ A;  5GPG A;  1JND A;  1UR9 A;  4Z2I A;  1E15 A;  2PBC A;  1FKD A;  3O5G A;  4W9Q A;  1GPF A;  4DRH A;  1HKM A;  3KCE A;  4WK9 A;  2ITK A;  2WLY A;  4WKA A;  1JNT A;  1LL7 A;  3ALG A;  2KFW A;  1ROT A;  2WLZ A;  2DT2 A;  5DIV A;  4WJX A;  5DIU A;  2DSZ A;  3WQW A;  2N87 A;  3KAD A;  4WIW A;  1W9U A;  1HKJ A;  4NSB A;  3G6L A;  3O5M A;  3TCZ A;  3UF8 A;  1N1A A;  1ZCN A;  1E6R A;  4AY1 A;  4JFM A;  2PPO A;  1NWR A;  4S3J A;  1NWU A;  1SYT A;  2PV3 A;  1FAP A;  3RM4 A;  2IF4 A;  1OGG A;  2DPE A;  5HT1 A;  3KAI A;  4FAP A;  1FKB A;  5D75 A;  3RGC A;  5JH8 A;  3ARO A;  3ARY A;  3WQV A;  3O5D A;  1FJD A;  2XP7 A;  5DIT A;  4PTM A;  1EYM A;  2D9F A;  2ESC A;  4TW7 A;  2M2A A;  2ZR5 A;  1F8A B;  3OA5 A;  1FKT A;  1VF8 A;  4J4N A;  2O9O A;  3WL0 A;  2UZ5 A;  3NTP A;  3JYM A;  3AS1 A;  4MGV A;  1YW5 A;  1E6P A;  4QT2 A;  3WD0 A;  2PPN A;  4HBE A;  1D7H A;  3IHZ A;  3KZ7 A;  1D7I A;  1LL6 A;  3WL1 A;  4TNS A;  4GIV A;  3H9R B;  1C9H A;  3WIJ A;  3UI6 A;  1FKG A;  1NWS A;  1HJW A;  3NRK A;  4NZC A;  1FKS A;  3O5J A;  4ZPW R;  5GQB A;  3PRD A;  1XRV A;  1EDQ A;  2A3E A;  1L1P A;  2DG3 A;  5HW8 A;  1H0G A;  1NSG A;  2A3B A;  2A3C A;  4ODR A;  2LKN A;  1HJX A;  2XPB A;  3MDY B;  1ZK6 A;  4DRM A;  1W1T A;  4MNL A;  3KAF A;  4KQZ A;  3FXY A;  1EHN A;  4QT3 A;  1Q6H A;  2XPA A;  2MPH A;  2ZQV A;  1FKL A;  4IQC A;  4QZV B;  2O92 A;  3O5R A;  1F40 A;  4ODL A;  1T11 A;  3B9A A;  1FFR A;  1LJY A;  2DSW A;  1XHG A;  3TDB A;  2Y78 A;  3PR9 A;  3GPK A;  3CHE A;  1H0I A;  5B8I C;  3B7X A;  3ART A;  1Q6I A;  2RUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...