2RUDA

Solution structure of the peptidyl prolyl cis-trans isomerase domain of c113d mutant human pin1 with sulfate ion
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title The C113D mutation in human Pin1 causes allosteric structural changes in the phosphate binding pocket of the PPIase domain through the tug of war in the dual-histidine motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rudA00
5HUAA 2ZQUA 3CGNA 3TDBA 2XPBA 2XP3A 3PRDA 1HXVA 3O5IA 2ZQSA 3JYMA 3O5GA 1J4IA 1D7IA 1FKBA 1FKHA 3UI6A 4G50A 4TX0A 3JXVA 2F2DA 3IK8A 5HWCA 4JFKA 4BF8A 4MGVA 2PPOA 4DRQA 3UI5A 1QPFA 5BXJA 4J4NA 1J6YA 1B6CA 3NTPA 4GIVA 3UQIA 5I98A 4DIPA 1PBKA 2FAPA 2MPHA 2M2AA 4DRIA 4LAVA 4IPXA 3UI4A 1A7XA 2F21A 1NMWA 3NI6A 1D6OA 2PV1A 1FKTA 1EYMA 4JFIA 2RQSA 1FKRA 2KE0A 1FKIA 3CGMA 2Q5AA 4DRJA 3KAIA 2M08A 4R0XA 3KADA 3VAWA 3OOBA 2PBCA 3O5FA 2KR7A 3EY6A 4MSPA 1FD9A 1U79A 4ODPA 2KFWA 4FAPA 2XP9A 1TCOC 5HT1A 5HW7A 1QZ2A 1ZCNA 4U85A 1F40A 2M1IA 4ODNA 4DRMA 3O5QA 4IQ2A 1KT1A 2OFNA 4IQCA 1FKKA 4LAYA 1FKDA 2F4EA 2RURA 4O2TA 2VN1A 1QPLA 4QT3A 5GPGA 3O5JA 4DH0A 1YATA 4GGQA 2Y78A 3O5MA 2FKEA 2MF9A 4TW7A 1Q6IA 2MLZA 2ZQTA 3MDYB 2MLXA 2RUCA 3JYJA 4U86A 4ODMA 4QT2A 4ODKA 4JFMA 4G2PA 5D75A 3GPKA 1D7HA 2JZVA 3LUOA 4J4OA 3O5KA 4JYSA 2RUDA 3PA7A 4W9QA 3TCZA 3UF8A 5B8IC 1D7JA 3O5RA 5HWBA 1N1AA 1JNTA 2RUQA 1P5QA 4TNSA 3IHZA 4DRNA 2DG4A 1FAPA 4LAWA 2L2SA 3I6CA 4TW6A 2ITKA 1Q6UA 2PV3A 2VCDA 2IF4A 4DROA 4TW8A 1Q6HA 2KO7A 1NSGA 2DG9A 2DG3A 4QIBA 3KCEA 3UQBA 3H9RB 1ROTA 1NMVA 1EQ3A 2XP8A 3IKGA 1F8AB 3NRKA 4DZ2A 2ZQVA 4DRPA 1L1PA 2MLYA 1C9HA 2XPAA 3KAFA 4DRHA 2LPVA 5HTGA 3O5EA 4U84A 2N87A 2PV2A 4C02B 1JNSA 2MNTA 2RSEA 3WH0A 1Y0OA 5HW8A 1FKLA 2LJ4A 4N19A 1J4RA 4LAXA 3O5PA 2XP6A 3O5DA 2PPPA 3UQAA 2AWGA 4W9OA 4DT4A 3PRBA 4DZ3A 5HW6A 1FJDA 1FKFA 1YW5A 5DIVA 2KGJA 2PPNA 3IKDA 4NNRA 4ODLA 2ZR6A 1J4HA 5J6EA 2XP7A 1BKFA 3RGCA 2LKNA 4ITZA 4FN2A 4JFLA 1FKSA 3KAHA 4ODOA 3FAPA 4W9PA 3RFWA 1R9HA 3KACA 3O5LA 2K8IA 2ZR4A 2LGOA 4ODQA 5DIUA 3O5OA 2D9FA 1M5YA 2XP4A 1JVWA 2KI3A 5DITA 2UZ5A 3TC5A 1FKGA 1PINA 1KT0A 3KAGA 4DRKA 1FKJA 1ROUA 3KZ7A 1BL4A 1T11A 4JFJA 1W26A 2ZR5A 1ZK6A 2XP5A 3ODKA 3KABA 3B7XA 4ODRA 4TYOA 5HKGA 1Q1CA
chains in the Genus database with same CATH superfamily
5HUAA 2ZQUA 1HXVA 5GQBA 2B5UB 1E44A 2ZQSA 3WD4A 2B31A 4DWSA 3CZ8A 1ZBVA 3IK8A 4HBOA 5HWCA 1W1VA 4MGVA 1NWSA 2MPHA 2FAPA 4DRIA 4DWSD 1A7XA 3B8SA 3NI6A 1NMWA 1EYMA 2RQSA 4NSBA 2DSVA 2Q5AA 2M08A 4XAKA 3QOKA 2PBCA 1U79A 4FAPA 2XP9A 1TCOC 4PTMA 4MNMA 1QZ2A 2M1IA 3RM4A 4QZVB 3ARUA 5GPGA 4QT3A 4O2TA 2VN1A 4Z2HA 3O5JA 3WD1A 2Y78A 1LG2A 2FKEA 2MF9A 2ZQTA 4U86A 4ODKA 3ALGA 5D75A 3LUOA 4J4OA 5HTGA 3O5KA 3TCZA 5B8IC 2IUZA 3O5RA 1K9TA 4TNSA 3IHZA 1FAPA 4LAWA 2L2SA 1W1PA 1GPFA 5DO2A 3ARYA 3KCEA 1X6LA 1NMVA 1E15A 2A3CA 4DRPA 2XPAA 1WAWA 3O5EA 1LL6A 4U84A 2N87A 3CHCA 2RSEA 2DSZA 5JH8A 3ARTA 4N19A 1J4RA 4LAXA 2XP6A 3O5DA 2WK2A 4DT4A 4Z2JA 5HW6A 1E6ZA 2PPNA 4ODLA 1J4HA 2XP7A 1BKFA 1O6IA 1NWTA 4ODQA 5DIUA 4Z2IA 4WKAA 2AOSA 2DSWA 3G6MA 3TC5A 1KT0A 1ROUA 3AS1A 1HJWA 2XP5A 4MTVA 1LG1A 4R5EA 2ETNA 1LJYA 4MPKA 3CGNA 2ESCA 3OA5A 3PRDA 3O5GA 3JYMA 1ZBWA 5DF0A 3BMBA 3FXYA 4KR0B 2F23A 3CHFA 3UI5A 5BXJA 3AS0A 3B9AA 1B6CA 3NTPA 4GIVA 2WLZA 1OGBA 4LAVA 3ARRA 3PRAA 3ARSA 1KFWA 1LL4A 3CH9A 2YBTA 4S3JA 4WK9A 4R0XA 3KADA 3VAWA 2KR7A 3EY6A 1WB0A 4MSPA 4ODPA 2KFWA 4ZPTR 5HT1A 3RM8A 4U85A 3O5QA 1KT1A 4IQCA 4MAVA 1FKKA 1TFVA 4LAYA 4ML4A 1FKDA 1JNDA 3GU0A 3O5MA 1E6RA 3WD2A 1Q6IA 2MLZA 1E9LA 2MLXA 2RUCA 3JYJA 4P8UA 1LL7A 4G2PA 3GPKA 1JCHB 1D7HA 2JZVA 4W9QA 4LGXA 4IT6A 3AROA 3AS2A 2DPEA 2RUQA 1P5QA 3WL0A 2O9OA 1LQ0A 4MNLA 2PV3A 2VCDA 1HKIA 4DROA 4TW8A 1Q6HA 4QIBA 2WLYA 3IKGA 1F8AB 1XRVA 1HJVA 1VF8A 1GOIA 1C9HA 2LPVA 4Z2KA 2A3BA 1HJXA 4L72B 3WH0A 4S3KA 3EIPA 1FFQA 2PPPA 3UQAA 2EULA 4AY1A 4DZ3A 1FKFA 3RMEA 2KGJA 4NNRA 1IX5A 1HKKA 3RGCA 2LKNA 3RFWA 4JFLA 1W9VA 3KAHA 3ALFA 3FAPA 1R9HA 3W4RA 2LGOA 3O5OA 2D9FA 5DITA 3KAGA 4DRKA 3AS3A 3KZ7A 1BL4A 1T11A 4JFJA 2ZR5A 2G41A 3KABA 4TYOA 1D2KA 5HKGA 1FKRA 3WQVA 1ITXA 3GTYX 2XPBA 1WNOA 3O5IA 1X6NA 1J4IA 1FKHA 1E6PA 5GPRA 2F2DA 3CHDA 4JFKA 4BF8A 1JNEA 2A3EA 4ZPVR 2PPOA 4DRQA 1ZBKA 1W1TA 1J6YA 3WD0A 5I98A 1PBKA 4IT4A 3UI4A 1D6OA 2PV1A 1NWRA 2P4VA 4MNKA 4P8XA 4WKHA 2KE0A 3CGMA 4DRJA 4WJXA 3OOBA 4ZPWR 3O5FA 4HARA 4URIA 1F40A 1UR9A 4ODNA 1FFRA 1GUVA 2F4EA 2RURA 1QPLA 4WKFA 1YATA 4GGQA 2O92A 4TW7A 4ODMA 4QT2A 2A3AA 4JFMA 3UF8A 2RUDA 1D7JA 1JNTA 1XHGA 2QF8A 2DG4A 1OGGA 4Q7NA 4TW6A 4UDMA 4WIWA 2ITKA 2IF4A 3WKZA 2KO7A 2DG9A 2DT0A 3UQBA 1ROTA 2XP8A 1OWQA 3NRKA 3FY1A 2WM0A 2ZQVA 1NH6A 1NWUA 1L1PA 2MLYA 4DRHA 1W1YA 2PV2A 4C02B 1JNSA 5HW8A 3WIJA 1EDQA 1FKLA 3WL1A 4Z2LA 3O5PA 1ZB5A 2AWGA 4W9OA 3PRBA 1GRJA 5DIVA 2PN0A 4KQZA 2ZR6A 3ARQA 4MNJA 4ITZA 4W9PA 1FKSA 3ARZA 3BXWA 2K8IA 4DWSB 1M5YA 2UZ5A 1FKGA 1PINA 2OLHA 1H0GA 3B9EA 1W26A 1ZK6A 1ZU8A 3I6CA 1ZL1A 3TDBA 2XP3A 1D7IA 1FKBA 3UI6A 3B9DA 4G50A 4TX0A 3JXVA 5HBFA 1QPFA 3ARWA 4J4NA 1UR8A 3UQIA 1EHNA 4DIPA 2M2AA 3ARXA 4IPXA 2F21A 1FKTA 4JFIA 1FKIA 3KAIA 3RM9A 3PR9A 4DWSC 1FD9A 2YBUA 5HW7A 1ZCNA 4HBEA 4DRMA 4IQ2A 2OFNA 2PI6A 1E6NA 3ARVA 1EQ3A 4DH0A 4ZS6A 3MDYB 4Q22A 1CTNA 4L3NA 1W9PA 4Z2GA 4JYSA 3PA7A 5HWBA 1N1AA 1EIBA 4DRNA 2FDMA 3WQWA 1Q6UA 2G8ZA 2DT2A 1NSGA 2DG3A 1H0IA 3H9RB 3AQUA 4DZ2A 3KAFA 4NZCA 3G6LA 4P8VA 1RD6A 4P8WA 2MNTA 1Y0OA 1ZBCA 4W5UA 2LJ4A 1SYTA 1FJDA 1YW5A 3IKDA 2DT1A 5J6EA 4FN2A 3WD3A 4ODOA 3KACA 3O5LA 2ZR4A 2DSUA 1SR0A 1HKMA 2XP4A 1JVWA 2KI3A 3CHEA 1FKJA 1HKJA 2DT3A 5DEZA 3ODKA 4ODRA 3B7XA 1W9UA 1Q1CA 3ARPA
chains in the Genus database with same CATH topology
5HUAA 2ZQUA 1HXVA 5GQBA 2ZQSA 3WD4A 2B31A 4DWSA 3CZ8A 1ZBVA 3IK8A 4HBOA 5HWCA 1W1VA 4MGVA 1NWSA 2MPHA 2FAPA 4DRIA 4DWSD 1A7XA 3B8SA 3NI6A 1NMWA 1EYMA 2RQSA 4NSBA 2DSVA 2Q5AA 2M08A 4XAKA 3QOKA 2PBCA 1U79A 4FAPA 2XP9A 1TCOC 4PTMA 4MNMA 1QZ2A 2M1IA 3RM4A 4QZVB 3ARUA 5GPGA 4QT3A 4O2TA 2VN1A 4Z2HA 3O5JA 3WD1A 2Y78A 1LG2A 2FKEA 2MF9A 2ZQTA 4U86A 4ODKA 3ALGA 5D75A 3LUOA 4J4OA 5HTGA 3O5KA 3TCZA 5B8IC 2IUZA 3O5RA 1K9TA 4TNSA 3IHZA 1FAPA 4LAWA 2L2SA 1W1PA 1GPFA 5DO2A 3ARYA 3KCEA 1X6LA 1NMVA 1E15A 2A3CA 4DRPA 2XPAA 1WAWA 3O5EA 1LL6A 4U84A 2N87A 3CHCA 2RSEA 2DSZA 5JH8A 3ARTA 4N19A 1J4RA 4LAXA 2XP6A 3O5DA 2WK2A 4DT4A 4Z2JA 5HW6A 1E6ZA 2PPNA 4ODLA 1J4HA 2XP7A 1BKFA 1O6IA 1NWTA 4ODQA 5DIUA 4Z2IA 4WKAA 2AOSA 2DSWA 3G6MA 3TC5A 1KT0A 1ROUA 3AS1A 1HJWA 2XP5A 4MTVA 1LG1A 4R5EA 1LJYA 4MPKA 3CGNA 2ESCA 3OA5A 3PRDA 3O5GA 3JYMA 1ZBWA 5DF0A 3FXYA 4KR0B 3CHFA 3UI5A 5BXJA 3AS0A 3B9AA 1B6CA 3NTPA 4GIVA 2WLZA 1OGBA 4LAVA 3ARRA 3PRAA 3ARSA 1KFWA 1LL4A 3CH9A 2YBTA 4S3JA 4WK9A 4R0XA 3KADA 3VAWA 2KR7A 3EY6A 1WB0A 4MSPA 4ODPA 2KFWA 4ZPTR 5HT1A 3RM8A 4U85A 3O5QA 1KT1A 4IQCA 4MAVA 1FKKA 1TFVA 4LAYA 4ML4A 1FKDA 1JNDA 3O5MA 1E6RA 3WD2A 1Q6IA 2MLZA 1E9LA 2MLXA 2RUCA 3JYJA 4P8UA 1LL7A 4G2PA 3GPKA 1D7HA 2JZVA 4W9QA 4LGXA 4IT6A 3AROA 3AS2A 2DPEA 2RUQA 1P5QA 3WL0A 2O9OA 1LQ0A 4MNLA 2PV3A 2VCDA 1HKIA 4DROA 4TW8A 1Q6HA 4QIBA 2WLYA 3IKGA 1F8AB 1XRVA 1HJVA 1VF8A 1GOIA 1C9HA 2LPVA 4Z2KA 2A3BA 1HJXA 4L72B 3WH0A 4S3KA 1FFQA 2PPPA 3UQAA 4AY1A 4DZ3A 1FKFA 3RMEA 2KGJA 4NNRA 1IX5A 1HKKA 3RGCA 2LKNA 3RFWA 4JFLA 1W9VA 3KAHA 3ALFA 3FAPA 1R9HA 3W4RA 2LGOA 3O5OA 2D9FA 5DITA 3KAGA 4DRKA 3AS3A 3KZ7A 1BL4A 1T11A 4JFJA 2ZR5A 2G41A 3KABA 4TYOA 1D2KA 5HKGA 1FKRA 3WQVA 1ITXA 2XPBA 1WNOA 3O5IA 1X6NA 1J4IA 1FKHA 1E6PA 5GPRA 2F2DA 3CHDA 4JFKA 4BF8A 1JNEA 2A3EA 4ZPVR 2PPOA 4DRQA 1ZBKA 1W1TA 1J6YA 3WD0A 5I98A 1PBKA 4IT4A 3UI4A 1D6OA 2PV1A 1NWRA 4MNKA 4P8XA 4WKHA 2KE0A 3CGMA 4DRJA 4WJXA 3OOBA 4ZPWR 3O5FA 4HARA 4URIA 1F40A 1UR9A 4ODNA 1FFRA 1GUVA 2F4EA 2RURA 1QPLA 4WKFA 1YATA 4GGQA 2O92A 4TW7A 4ODMA 4QT2A 2A3AA 4JFMA 3UF8A 2RUDA 1D7JA 1JNTA 1XHGA 2QF8A 2DG4A 1OGGA 4Q7NA 4TW6A 4WIWA 2ITKA 2IF4A 3WKZA 2KO7A 2DG9A 2DT0A 3UQBA 1ROTA 2XP8A 1OWQA 3NRKA 3FY1A 2WM0A 2ZQVA 1NH6A 1NWUA 1L1PA 2MLYA 4DRHA 1W1YA 2PV2A 4C02B 1JNSA 5HW8A 3WIJA 1EDQA 1FKLA 3WL1A 4Z2LA 3O5PA 1ZB5A 2AWGA 4W9OA 3PRBA 5DIVA 4KQZA 2ZR6A 3ARQA 4MNJA 4ITZA 4W9PA 1FKSA 3ARZA 3BXWA 2K8IA 4DWSB 1M5YA 2UZ5A 1FKGA 1PINA 2OLHA 1H0GA 3B9EA 1W26A 1ZK6A 1ZU8A 3I6CA 1ZL1A 3TDBA 2XP3A 1D7IA 1FKBA 3UI6A 3B9DA 4G50A 4TX0A 3JXVA 5HBFA 1QPFA 3ARWA 4J4NA 1UR8A 3UQIA 1EHNA 4DIPA 2M2AA 3ARXA 4IPXA 2F21A 1FKTA 4JFIA 1FKIA 3KAIA 3RM9A 3PR9A 4DWSC 1FD9A 2YBUA 5HW7A 1ZCNA 4HBEA 4DRMA 4IQ2A 2OFNA 2PI6A 1E6NA 3ARVA 1EQ3A 4DH0A 4ZS6A 3MDYB 4Q22A 1CTNA 4L3NA 1W9PA 4Z2GA 4JYSA 3PA7A 5HWBA 1N1AA 1EIBA 4DRNA 2FDMA 3WQWA 1Q6UA 2G8ZA 2DT2A 1NSGA 2DG3A 1H0IA 3H9RB 3AQUA 4DZ2A 3KAFA 4NZCA 3G6LA 4P8VA 1RD6A 4P8WA 2MNTA 1Y0OA 1ZBCA 4W5UA 2LJ4A 1SYTA 1FJDA 1YW5A 3IKDA 2DT1A 5J6EA 4FN2A 3WD3A 4ODOA 3KACA 3O5LA 2ZR4A 2DSUA 1SR0A 1HKMA 2XP4A 1JVWA 2KI3A 3CHEA 1FKJA 1HKJA 2DT3A 5DEZA 3ODKA 4ODRA 3B7XA 1W9UA 1Q1CA 3ARPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HUA A;  2ZQU A;  3CGN A;  3TDB A;  2XPB A;  2XP3 A;  3PRD A;  1HXV A;  3O5I A;  2ZQS A;  3JYM A;  3O5G A;  1J4I A;  1D7I A;  1FKB A;  1FKH A;  3UI6 A;  4G50 A;  4TX0 A;  3JXV A;  2F2D A;  3IK8 A;  5HWC A;  4JFK A;  4BF8 A;  4MGV A;  2PPO A;  4DRQ A;  3UI5 A;  1QPF A;  5BXJ A;  4J4N A;  1J6Y A;  1B6C A;  3NTP A;  4GIV A;  3UQI A;  5I98 A;  4DIP A;  1PBK A;  2FAP A;  2MPH A;  2M2A A;  4DRI A;  4LAV A;  4IPX A;  3UI4 A;  1A7X A;  2F21 A;  1NMW A;  3NI6 A;  1D6O A;  2PV1 A;  1FKT A;  1EYM A;  4JFI A;  2RQS A;  1FKR A;  2KE0 A;  1FKI A;  3CGM A;  2Q5A A;  4DRJ A;  3KAI A;  2M08 A;  4R0X A;  3KAD A;  3VAW A;  3OOB A;  2PBC A;  3O5F A;  2KR7 A;  3EY6 A;  4MSP A;  1FD9 A;  1U79 A;  4ODP A;  2KFW A;  4FAP A;  2XP9 A;  1TCO C;  5HT1 A;  5HW7 A;  1QZ2 A;  1ZCN A;  4U85 A;  1F40 A;  2M1I A;  4ODN A;  4DRM A;  3O5Q A;  4IQ2 A;  1KT1 A;  2OFN A;  4IQC A;  1FKK A;  4LAY A;  1FKD A;  2F4E A;  2RUR A;  4O2T A;  2VN1 A;  1QPL A;  4QT3 A;  5GPG A;  3O5J A;  4DH0 A;  1YAT A;  4GGQ A;  2Y78 A;  3O5M A;  2FKE A;  2MF9 A;  4TW7 A;  1Q6I A;  2MLZ A;  2ZQT A;  3MDY B;  2MLX A;  2RUC A;  3JYJ A;  4U86 A;  4ODM A;  4QT2 A;  4ODK A;  4JFM A;  4G2P A;  5D75 A;  3GPK A;  1D7H A;  2JZV A;  3LUO A;  4J4O A;  3O5K A;  4JYS A;  2RUD A;  3PA7 A;  4W9Q A;  3TCZ A;  3UF8 A;  5B8I C;  1D7J A;  3O5R A;  5HWB A;  1N1A A;  1JNT A;  2RUQ A;  1P5Q A;  4TNS A;  3IHZ A;  4DRN A;  2DG4 A;  1FAP A;  4LAW A;  2L2S A;  3I6C A;  4TW6 A;  2ITK A;  1Q6U A;  2PV3 A;  2VCD A;  2IF4 A;  4DRO A;  4TW8 A;  1Q6H A;  2KO7 A;  1NSG A;  2DG9 A;  2DG3 A;  4QIB A;  3KCE A;  3UQB A;  3H9R B;  1ROT A;  1NMV A;  1EQ3 A;  2XP8 A;  3IKG A;  1F8A B;  3NRK A;  4DZ2 A;  2ZQV A;  4DRP A;  1L1P A;  2MLY A;  1C9H A;  2XPA A;  3KAF A;  4DRH A;  2LPV A;  5HTG A;  3O5E A;  4U84 A;  2N87 A;  2PV2 A;  4C02 B;  1JNS A;  2MNT A;  2RSE A;  3WH0 A;  1Y0O A;  5HW8 A;  1FKL A;  2LJ4 A;  4N19 A;  1J4R A;  4LAX A;  3O5P A;  2XP6 A;  3O5D A;  2PPP A;  3UQA A;  2AWG A;  4W9O A;  4DT4 A;  3PRB A;  4DZ3 A;  5HW6 A;  1FJD A;  1FKF A;  1YW5 A;  5DIV A;  2KGJ A;  2PPN A;  3IKD A;  4NNR A;  4ODL A;  2ZR6 A;  1J4H A;  5J6E A;  2XP7 A;  1BKF A;  3RGC A;  2LKN A;  4ITZ A;  4FN2 A;  4JFL A;  1FKS A;  3KAH A;  4ODO A;  3FAP A;  4W9P A;  3RFW A;  1R9H A;  3KAC A;  3O5L A;  2K8I A;  2ZR4 A;  2LGO A;  4ODQ A;  5DIU A;  3O5O A;  2D9F A;  1M5Y A;  2XP4 A;  1JVW A;  2KI3 A;  5DIT A;  2UZ5 A;  3TC5 A;  1FKG A;  1PIN A;  1KT0 A;  3KAG A;  4DRK A;  1FKJ A;  1ROU A;  3KZ7 A;  1BL4 A;  1T11 A;  4JFJ A;  1W26 A;  2ZR5 A;  1ZK6 A;  2XP5 A;  3ODK A;  3KAB A;  3B7X A;  4ODR A;  4TYO A;  5HKG A;  1Q1C A; 
#chains in the Genus database with same CATH topology
 5HUA A;  2ZQU A;  1HXV A;  5GQB A;  2B5U B;  1E44 A;  2ZQS A;  3WD4 A;  2B31 A;  4DWS A;  3CZ8 A;  1ZBV A;  3IK8 A;  4HBO A;  5HWC A;  1W1V A;  4MGV A;  1NWS A;  2MPH A;  2FAP A;  4DRI A;  4DWS D;  1A7X A;  3B8S A;  3NI6 A;  1NMW A;  1EYM A;  2RQS A;  4NSB A;  2DSV A;  2Q5A A;  2M08 A;  4XAK A;  3QOK A;  2PBC A;  1U79 A;  4FAP A;  2XP9 A;  1TCO C;  4PTM A;  4MNM A;  1QZ2 A;  2M1I A;  3RM4 A;  4QZV B;  3ARU A;  5GPG A;  4QT3 A;  4O2T A;  2VN1 A;  4Z2H A;  3O5J A;  3WD1 A;  2Y78 A;  1LG2 A;  2FKE A;  2MF9 A;  2ZQT A;  4U86 A;  4ODK A;  3ALG A;  5D75 A;  3LUO A;  4J4O A;  5HTG A;  3O5K A;  3TCZ A;  5B8I C;  2IUZ A;  3O5R A;  1K9T A;  4TNS A;  3IHZ A;  1FAP A;  4LAW A;  2L2S A;  1W1P A;  1GPF A;  5DO2 A;  3ARY A;  3KCE A;  1X6L A;  1NMV A;  1E15 A;  2A3C A;  4DRP A;  2XPA A;  1WAW A;  3O5E A;  1LL6 A;  4U84 A;  2N87 A;  3CHC A;  2RSE A;  2DSZ A;  5JH8 A;  3ART A;  4N19 A;  1J4R A;  4LAX A;  2XP6 A;  3O5D A;  2WK2 A;  4DT4 A;  4Z2J A;  5HW6 A;  1E6Z A;  2PPN A;  4ODL A;  1J4H A;  2XP7 A;  1BKF A;  1O6I A;  1NWT A;  4ODQ A;  5DIU A;  4Z2I A;  4WKA A;  2AOS A;  2DSW A;  3G6M A;  3TC5 A;  1KT0 A;  1ROU A;  3AS1 A;  1HJW A;  2XP5 A;  4MTV A;  1LG1 A;  4R5E A;  2ETN A;  1LJY A;  4MPK A;  3CGN A;  2ESC A;  3OA5 A;  3PRD A;  3O5G A;  3JYM A;  1ZBW A;  5DF0 A;  3BMB A;  3FXY A;  4KR0 B;  2F23 A;  3CHF A;  3UI5 A;  5BXJ A;  3AS0 A;  3B9A A;  1B6C A;  3NTP A;  4GIV A;  2WLZ A;  1OGB A;  4LAV A;  3ARR A;  3PRA A;  3ARS A;  1KFW A;  1LL4 A;  3CH9 A;  2YBT A;  4S3J A;  4WK9 A;  4R0X A;  3KAD A;  3VAW A;  2KR7 A;  3EY6 A;  1WB0 A;  4MSP A;  4ODP A;  2KFW A;  4ZPT R;  5HT1 A;  3RM8 A;  4U85 A;  3O5Q A;  1KT1 A;  4IQC A;  4MAV A;  1FKK A;  1TFV A;  4LAY A;  4ML4 A;  1FKD A;  1JND A;  3GU0 A;  3O5M A;  1E6R A;  3WD2 A;  1Q6I A;  2MLZ A;  1E9L A;  2MLX A;  2RUC A;  3JYJ A;  4P8U A;  1LL7 A;  4G2P A;  3GPK A;  1JCH B;  1D7H A;  2JZV A;  4W9Q A;  4LGX A;  4IT6 A;  3ARO A;  3AS2 A;  2DPE A;  2RUQ A;  1P5Q A;  3WL0 A;  2O9O A;  1LQ0 A;  4MNL A;  2PV3 A;  2VCD A;  1HKI A;  4DRO A;  4TW8 A;  1Q6H A;  4QIB A;  2WLY A;  3IKG A;  1F8A B;  1XRV A;  1HJV A;  1VF8 A;  1GOI A;  1C9H A;  2LPV A;  4Z2K A;  2A3B A;  1HJX A;  4L72 B;  3WH0 A;  4S3K A;  3EIP A;  1FFQ A;  2PPP A;  3UQA A;  2EUL A;  4AY1 A;  4DZ3 A;  1FKF A;  3RME A;  2KGJ A;  4NNR A;  1IX5 A;  1HKK A;  3RGC A;  2LKN A;  3RFW A;  4JFL A;  1W9V A;  3KAH A;  3ALF A;  3FAP A;  1R9H A;  3W4R A;  2LGO A;  3O5O A;  2D9F A;  5DIT A;  3KAG A;  4DRK A;  3AS3 A;  3KZ7 A;  1BL4 A;  1T11 A;  4JFJ A;  2ZR5 A;  2G41 A;  3KAB A;  4TYO A;  1D2K A;  5HKG A;  1FKR A;  3WQV A;  1ITX A;  3GTY X;  2XPB A;  1WNO A;  3O5I A;  1X6N A;  1J4I A;  1FKH A;  1E6P A;  5GPR A;  2F2D A;  3CHD A;  4JFK A;  4BF8 A;  1JNE A;  2A3E A;  4ZPV R;  2PPO A;  4DRQ A;  1ZBK A;  1W1T A;  1J6Y A;  3WD0 A;  5I98 A;  1PBK A;  4IT4 A;  3UI4 A;  1D6O A;  2PV1 A;  1NWR A;  2P4V A;  4MNK A;  4P8X A;  4WKH A;  2KE0 A;  3CGM A;  4DRJ A;  4WJX A;  3OOB A;  4ZPW R;  3O5F A;  4HAR A;  4URI A;  1F40 A;  1UR9 A;  4ODN A;  1FFR A;  1GUV A;  2F4E A;  2RUR A;  1QPL A;  4WKF A;  1YAT A;  4GGQ A;  2O92 A;  4TW7 A;  4ODM A;  4QT2 A;  2A3A A;  4JFM A;  3UF8 A;  2RUD A;  1D7J A;  1JNT A;  1XHG A;  2QF8 A;  2DG4 A;  1OGG A;  4Q7N A;  4TW6 A;  4UDM A;  4WIW A;  2ITK A;  2IF4 A;  3WKZ A;  2KO7 A;  2DG9 A;  2DT0 A;  3UQB A;  1ROT A;  2XP8 A;  1OWQ A;  3NRK A;  3FY1 A;  2WM0 A;  2ZQV A;  1NH6 A;  1NWU A;  1L1P A;  2MLY A;  4DRH A;  1W1Y A;  2PV2 A;  4C02 B;  1JNS A;  5HW8 A;  3WIJ A;  1EDQ A;  1FKL A;  3WL1 A;  4Z2L A;  3O5P A;  1ZB5 A;  2AWG A;  4W9O A;  3PRB A;  1GRJ A;  5DIV A;  2PN0 A;  4KQZ A;  2ZR6 A;  3ARQ A;  4MNJ A;  4ITZ A;  4W9P A;  1FKS A;  3ARZ A;  3BXW A;  2K8I A;  4DWS B;  1M5Y A;  2UZ5 A;  1FKG A;  1PIN A;  2OLH A;  1H0G A;  3B9E A;  1W26 A;  1ZK6 A;  1ZU8 A;  3I6C A;  1ZL1 A;  3TDB A;  2XP3 A;  1D7I A;  1FKB A;  3UI6 A;  3B9D A;  4G50 A;  4TX0 A;  3JXV A;  5HBF A;  1QPF A;  3ARW A;  4J4N A;  1UR8 A;  3UQI A;  1EHN A;  4DIP A;  2M2A A;  3ARX A;  4IPX A;  2F21 A;  1FKT A;  4JFI A;  1FKI A;  3KAI A;  3RM9 A;  3PR9 A;  4DWS C;  1FD9 A;  2YBU A;  5HW7 A;  1ZCN A;  4HBE A;  4DRM A;  4IQ2 A;  2OFN A;  2PI6 A;  1E6N A;  3ARV A;  1EQ3 A;  4DH0 A;  4ZS6 A;  3MDY B;  4Q22 A;  1CTN A;  4L3N A;  1W9P A;  4Z2G A;  4JYS A;  3PA7 A;  5HWB A;  1N1A A;  1EIB A;  4DRN A;  2FDM A;  3WQW A;  1Q6U A;  2G8Z A;  2DT2 A;  1NSG A;  2DG3 A;  1H0I A;  3H9R B;  3AQU A;  4DZ2 A;  3KAF A;  4NZC A;  3G6L A;  4P8V A;  1RD6 A;  4P8W A;  2MNT A;  1Y0O A;  1ZBC A;  4W5U A;  2LJ4 A;  1SYT A;  1FJD A;  1YW5 A;  3IKD A;  2DT1 A;  5J6E A;  4FN2 A;  3WD3 A;  4ODO A;  3KAC A;  3O5L A;  2ZR4 A;  2DSU A;  1SR0 A;  1HKM A;  2XP4 A;  1JVW A;  2KI3 A;  3CHE A;  1FKJ A;  1HKJ A;  2DT3 A;  5DEZ A;  3ODK A;  4ODR A;  3B7X A;  1W9U A;  1Q1C A;  3ARP A; 
#chains in the Genus database with same CATH homology
 5HUA A;  2ZQU A;  1HXV A;  5GQB A;  2ZQS A;  3WD4 A;  2B31 A;  4DWS A;  3CZ8 A;  1ZBV A;  3IK8 A;  4HBO A;  5HWC A;  1W1V A;  4MGV A;  1NWS A;  2MPH A;  2FAP A;  4DRI A;  4DWS D;  1A7X A;  3B8S A;  3NI6 A;  1NMW A;  1EYM A;  2RQS A;  4NSB A;  2DSV A;  2Q5A A;  2M08 A;  4XAK A;  3QOK A;  2PBC A;  1U79 A;  4FAP A;  2XP9 A;  1TCO C;  4PTM A;  4MNM A;  1QZ2 A;  2M1I A;  3RM4 A;  4QZV B;  3ARU A;  5GPG A;  4QT3 A;  4O2T A;  2VN1 A;  4Z2H A;  3O5J A;  3WD1 A;  2Y78 A;  1LG2 A;  2FKE A;  2MF9 A;  2ZQT A;  4U86 A;  4ODK A;  3ALG A;  5D75 A;  3LUO A;  4J4O A;  5HTG A;  3O5K A;  3TCZ A;  5B8I C;  2IUZ A;  3O5R A;  1K9T A;  4TNS A;  3IHZ A;  1FAP A;  4LAW A;  2L2S A;  1W1P A;  1GPF A;  5DO2 A;  3ARY A;  3KCE A;  1X6L A;  1NMV A;  1E15 A;  2A3C A;  4DRP A;  2XPA A;  1WAW A;  3O5E A;  1LL6 A;  4U84 A;  2N87 A;  3CHC A;  2RSE A;  2DSZ A;  5JH8 A;  3ART A;  4N19 A;  1J4R A;  4LAX A;  2XP6 A;  3O5D A;  2WK2 A;  4DT4 A;  4Z2J A;  5HW6 A;  1E6Z A;  2PPN A;  4ODL A;  1J4H A;  2XP7 A;  1BKF A;  1O6I A;  1NWT A;  4ODQ A;  5DIU A;  4Z2I A;  4WKA A;  2AOS A;  2DSW A;  3G6M A;  3TC5 A;  1KT0 A;  1ROU A;  3AS1 A;  1HJW A;  2XP5 A;  4MTV A;  1LG1 A;  4R5E A;  1LJY A;  4MPK A;  3CGN A;  2ESC A;  3OA5 A;  3PRD A;  3O5G A;  3JYM A;  1ZBW A;  5DF0 A;  3FXY A;  4KR0 B;  3CHF A;  3UI5 A;  5BXJ A;  3AS0 A;  3B9A A;  1B6C A;  3NTP A;  4GIV A;  2WLZ A;  1OGB A;  4LAV A;  3ARR A;  3PRA A;  3ARS A;  1KFW A;  1LL4 A;  3CH9 A;  2YBT A;  4S3J A;  4WK9 A;  4R0X A;  3KAD A;  3VAW A;  2KR7 A;  3EY6 A;  1WB0 A;  4MSP A;  4ODP A;  2KFW A;  4ZPT R;  5HT1 A;  3RM8 A;  4U85 A;  3O5Q A;  1KT1 A;  4IQC A;  4MAV A;  1FKK A;  1TFV A;  4LAY A;  4ML4 A;  1FKD A;  1JND A;  3O5M A;  1E6R A;  3WD2 A;  1Q6I A;  2MLZ A;  1E9L A;  2MLX A;  2RUC A;  3JYJ A;  4P8U A;  1LL7 A;  4G2P A;  3GPK A;  1D7H A;  2JZV A;  4W9Q A;  4LGX A;  4IT6 A;  3ARO A;  3AS2 A;  2DPE A;  2RUQ A;  1P5Q A;  3WL0 A;  2O9O A;  1LQ0 A;  4MNL A;  2PV3 A;  2VCD A;  1HKI A;  4DRO A;  4TW8 A;  1Q6H A;  4QIB A;  2WLY A;  3IKG A;  1F8A B;  1XRV A;  1HJV A;  1VF8 A;  1GOI A;  1C9H A;  2LPV A;  4Z2K A;  2A3B A;  1HJX A;  4L72 B;  3WH0 A;  4S3K A;  1FFQ A;  2PPP A;  3UQA A;  4AY1 A;  4DZ3 A;  1FKF A;  3RME A;  2KGJ A;  4NNR A;  1IX5 A;  1HKK A;  3RGC A;  2LKN A;  3RFW A;  4JFL A;  1W9V A;  3KAH A;  3ALF A;  3FAP A;  1R9H A;  3W4R A;  2LGO A;  3O5O A;  2D9F A;  5DIT A;  3KAG A;  4DRK A;  3AS3 A;  3KZ7 A;  1BL4 A;  1T11 A;  4JFJ A;  2ZR5 A;  2G41 A;  3KAB A;  4TYO A;  1D2K A;  5HKG A;  1FKR A;  3WQV A;  1ITX A;  2XPB A;  1WNO A;  3O5I A;  1X6N A;  1J4I A;  1FKH A;  1E6P A;  5GPR A;  2F2D A;  3CHD A;  4JFK A;  4BF8 A;  1JNE A;  2A3E A;  4ZPV R;  2PPO A;  4DRQ A;  1ZBK A;  1W1T A;  1J6Y A;  3WD0 A;  5I98 A;  1PBK A;  4IT4 A;  3UI4 A;  1D6O A;  2PV1 A;  1NWR A;  4MNK A;  4P8X A;  4WKH A;  2KE0 A;  3CGM A;  4DRJ A;  4WJX A;  3OOB A;  4ZPW R;  3O5F A;  4HAR A;  4URI A;  1F40 A;  1UR9 A;  4ODN A;  1FFR A;  1GUV A;  2F4E A;  2RUR A;  1QPL A;  4WKF A;  1YAT A;  4GGQ A;  2O92 A;  4TW7 A;  4ODM A;  4QT2 A;  2A3A A;  4JFM A;  3UF8 A;  2RUD A;  1D7J A;  1JNT A;  1XHG A;  2QF8 A;  2DG4 A;  1OGG A;  4Q7N A;  4TW6 A;  4WIW A;  2ITK A;  2IF4 A;  3WKZ A;  2KO7 A;  2DG9 A;  2DT0 A;  3UQB A;  1ROT A;  2XP8 A;  1OWQ A;  3NRK A;  3FY1 A;  2WM0 A;  2ZQV A;  1NH6 A;  1NWU A;  1L1P A;  2MLY A;  4DRH A;  1W1Y A;  2PV2 A;  4C02 B;  1JNS A;  5HW8 A;  3WIJ A;  1EDQ A;  1FKL A;  3WL1 A;  4Z2L A;  3O5P A;  1ZB5 A;  2AWG A;  4W9O A;  3PRB A;  5DIV A;  4KQZ A;  2ZR6 A;  3ARQ A;  4MNJ A;  4ITZ A;  4W9P A;  1FKS A;  3ARZ A;  3BXW A;  2K8I A;  4DWS B;  1M5Y A;  2UZ5 A;  1FKG A;  1PIN A;  2OLH A;  1H0G A;  3B9E A;  1W26 A;  1ZK6 A;  1ZU8 A;  3I6C A;  1ZL1 A;  3TDB A;  2XP3 A;  1D7I A;  1FKB A;  3UI6 A;  3B9D A;  4G50 A;  4TX0 A;  3JXV A;  5HBF A;  1QPF A;  3ARW A;  4J4N A;  1UR8 A;  3UQI A;  1EHN A;  4DIP A;  2M2A A;  3ARX A;  4IPX A;  2F21 A;  1FKT A;  4JFI A;  1FKI A;  3KAI A;  3RM9 A;  3PR9 A;  4DWS C;  1FD9 A;  2YBU A;  5HW7 A;  1ZCN A;  4HBE A;  4DRM A;  4IQ2 A;  2OFN A;  2PI6 A;  1E6N A;  3ARV A;  1EQ3 A;  4DH0 A;  4ZS6 A;  3MDY B;  4Q22 A;  1CTN A;  4L3N A;  1W9P A;  4Z2G A;  4JYS A;  3PA7 A;  5HWB A;  1N1A A;  1EIB A;  4DRN A;  2FDM A;  3WQW A;  1Q6U A;  2G8Z A;  2DT2 A;  1NSG A;  2DG3 A;  1H0I A;  3H9R B;  3AQU A;  4DZ2 A;  3KAF A;  4NZC A;  3G6L A;  4P8V A;  1RD6 A;  4P8W A;  2MNT A;  1Y0O A;  1ZBC A;  4W5U A;  2LJ4 A;  1SYT A;  1FJD A;  1YW5 A;  3IKD A;  2DT1 A;  5J6E A;  4FN2 A;  3WD3 A;  4ODO A;  3KAC A;  3O5L A;  2ZR4 A;  2DSU A;  1SR0 A;  1HKM A;  2XP4 A;  1JVW A;  2KI3 A;  3CHE A;  1FKJ A;  1HKJ A;  2DT3 A;  5DEZ A;  3ODK A;  4ODR A;  3B7X A;  1W9U A;  1Q1C A;  3ARP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...