2RURA

Solution structure of human pin1 ppiase c113s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 34
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rurA00
3TCZA 4LAXA 4J4OA 2XP4A 4JYSA 5HWBA 3O5RA 5HUAA 3UQAA 1FKFA 2DG3A 1D7JA 2IF4A 3FAPA 1JNSA 4LAVA 3UQIA 1NMVA 2KFWA 2RSEA 4FAPA 1F40A 1FKGA 1FD9A 1D7HA 4G2PA 3UI4A 4QT2A 2DG4A 4IQ2A 1ROUA 2M1IA 4FN2A 4DROA 4ODKA 3NTPA 1Q6IA 2KE0A 3O5KA 3PRDA 4ITZA 2UZ5A 1HXVA 1FKHA 2AWGA 2KR7A 1U79A 3KAFA 5HT1A 1EQ3A 4TW7A 1FKSA 1FJDA 4GGQA 3O5IA 3OOBA 2LPVA 4U86A 4DRKA 5HW8A 1FKBA 3KAIA 2XP7A 3UQBA 1Q1CA 4JFMA 1J6YA 4TW8A 2MNTA 3O5LA 4DRQA 4DRMA 2ITKA 2RUQA 2KGJA 2LJ4A 2OFNA 1JVWA 2ZQVA 4MGVA 2XP3A 4DZ3A 1J4HA 2VN1A 1FKKA 4ODMA 3B7XA 2PV2A 1FAPA 3NI6A 4DH0A 1L1PA 1YW5A 2XP5A 4DRJA 1B6CA 1NMWA 4DRIA 1R9HA 2RUDA 1ZK6A 1Q6UA 3O5EA 5B8IC 3I6CA 5I98A 1BL4A 2RQSA 1KT1A 1A7XA 4J4NA 2LKNA 2ZQSA 4U84A 3JXVA 2MLXA 1EYMA 2ZQTA 3CGMA 3GPKA 4DRNA 5BXJA 3IK8A 4W9QA 2ZQUA 4W9OA 2FKEA 1FKTA 2F2DA 2LGOA 2PPPA 1Q6HA 4C02B 3PA7A 2F21A 2XP9A 3CGNA 3KAGA 2Y78A 4TX0A 3IHZA 3MDYB 4ODLA 2XPBA 2F4EA 1NSGA 1ZCNA 4JFKA 4QT3A 3VAWA 4JFLA 2D9FA 4JFIA 3O5QA 4IPXA 4N19A 4DRHA 2PV3A 3IKDA 3JYJA 4O2TA 4TNSA 3RGCA 1T11A 3NRKA 2L2SA 2MF9A 4GIVA 5DIVA 3RFWA 1YATA 1W26A 5DITA 3EY6A 2JZVA 3UI5A 2ZR4A 4G50A 4U85A 2ZR6A 3O5MA 3O5OA 4MSPA 1PBKA 2RURA 4LAYA 3KACA 1ROTA 1FKRA 5DIUA 5D75A 1J4IA 2XP6A 4ODRA 1N1AA 2MLZA 1QPLA 5HTGA 2PPNA 1QPFA 3UF8A 4DIPA 2ZR5A 1FKLA 5GPGA 1D7IA 4JFJA 3TC5A 3KAHA 4IQCA 1JNTA 4R0XA 2PPOA 3KABA 2XPAA 5HWCA 1P5QA 1FKIA 2M2AA 2PV1A 2N87A 5HKGA 2RUCA 3LUOA 1F8AB 4BF8A 5J6EA 2FAPA 4LAWA 3KCEA 5HW6A 3O5FA 3ODKA 2KI3A 4TW6A 2Q5AA 3O5JA 2DG9A 3KZ7A 1PINA 2PBCA 3IKGA 1J4RA 3O5PA 2M08A 1BKFA 4DT4A 1M5YA 1QZ2A 2KO7A 2K8IA 4ODOA 3UI6A 4DZ2A 2MPHA 3O5GA 3O5DA 1D6OA 3WH0A 3KADA 3TDBA 4ODQA 3H9RB 5HW7A 1FKDA 1C9HA 2VCDA 2XP8A 4NNRA 1KT0A 4W9PA 2MLYA 4ODNA 4QIBA 1TCOC 3PRBA 4ODPA 4TYOA 1Y0OA 4DRPA 3JYMA 1FKJA
chains in the Genus database with same CATH superfamily
4S3KA 3CHDA 1FKFA 2DG3A 1D7JA 3FAPA 1NH6A 1WNOA 3UQIA 3WL1A 2KFWA 1W9UA 1ITXA 1NWUA 4QT2A 1ROUA 3ARSA 3WL0A 3NTPA 2KE0A 3PRDA 1HXVA 1FKHA 5HT1A 4DRKA 1FKBA 2DSVA 2XP7A 4MNMA 1W9PA 4DRQA 4DRMA 3CHCA 2ITKA 2LJ4A 4MNKA 1FFQA 4DZ3A 2FDMA 1LL7A 4S3JA 2PV2A 3WQVA 4DRJA 2DT0A 4LGXA 1ZL1A 3O5EA 2DSZA 1A7XA 4J4NA 2LKNA 2ZQSA 3RM4A 2ZQTA 3CGMA 5GPRA 4DRNA 2ZQUA 2FKEA 2PPPA 3BXWA 2F21A 2Y78A 4MPKA 4TX0A 3MDYB 4ODLA 4JFKA 3CHEA 4IPXA 4MAVA 2PV3A 3FY1A 3B9DA 3PR9A 1ZBCA 5DIVA 4W5UA 1YATA 3EY6A 4WIWA 2ZR4A 1NWRA 2DT1A 5DIUA 1J4IA 5HTGA 1O6IA 2PN0A 3ARPA 1ZBKA 2G8ZA 1D7IA 3KAHA 1W1YA 2P4VA 1FKIA 2N87A 4BF8A 1HJVA 3KCEA 3O5FA 4TW6A 4ZPWR 3KZ7A 4NZCA 3IKGA 1E44A 4DT4A 2A3CA 2K8IA 3O5GA 3O5DA 1VF8A 3WD3A 1E6PA 1D2KA 4ODQA 1GOIA 3H9RB 5HW7A 1FKDA 1C9HA 2VCDA 2XP8A 4QZVB 2EULA 4PTMA 1Y0OA 1FKJA 4LAXA 3FXYA 4J4OA 4JYSA 4MNLA 5HUAA 2DT2A 1UR8A 4Z2IA 1LJYA 1F40A 1D7HA 2G41A 4Z2GA 2DG4A 4ODKA 3O5KA 2UZ5A 3B9AA 2KR7A 1EDQA 1XRVA 1HKMA 5HW8A 3UQBA 5HBFA 3ARYA 1WB0A 1OWQA 1J6YA 3O5LA 5JH8A 1L1PA 1IX5A 1NMWA 2RUDA 2A3EA 1Q6UA 4L72B 5B8IC 5I98A 1KFWA 3OA5A 4WKAA 1H0GA 1LL4A 3IK8A 4W9QA 2F2DA 4C02B 1Q6HA 3PA7A 4URIA 3WIJA 1E6ZA 3IHZA 2XPBA 1XHGA 2F4EA 1NSGA 3O5QA 1T11A 3NRKA 2L2SA 3RFWA 3CZ8A 1W26A 2O92A 5DITA 2PI6A 2DSWA 2ZR6A 2YBUA 1HJWA 4ODRA 1QPFA 1E15A 3UF8A 2A3AA 1WAWA 3WKZA 2ZR5A 1FKLA 5GPGA 1E6NA 1JNTA 5HWCA 2PPOA 2XPAA 1P5QA 3ALFA 5HKGA 2RUCA 3RM9A 4R5EA 1W1PA 1ZBVA 5HW6A 3ARVA 4UDMA 5DEZA 4ZPVR 2M08A 1BKFA 1LG2A 4DWSD 3AS0A 3UI6A 3RM8A 1HKIA 3RMEA 1UR9A 1D6OA 3WH0A 1W9VA 4P8XA 2DT3A 3B9EA 4W9PA 4ODNA 3PRBA 4ODPA 3W4RA 3KADA 3JYMA 2XP4A 5HWBA 3UQAA 2ETNA 4FAPA 2RSEA 1FKGA 1FD9A 4G2PA 3UI4A 4FN2A 4DROA 1Q6IA 4ITZA 2AWGA 3KAFA 1FJDA 3O5IA 4U86A 4JFMA 4TW8A 4P8UA 2F23A 3AS1A 2KGJA 2ZQVA 2XP3A 1J4HA 4IT4A 1FKKA 4ODMA 3B7XA 3NI6A 1FAPA 1SR0A 1B6CA 4DRIA 1GUVA 3I6CA 3CHFA 1BL4A 2RQSA 1KT1A 2MLXA 1EYMA 2AOSA 1GPFA 4NSBA 1FKTA 2LGOA 2XP9A 1EHNA 4IT6A 1ZCNA 4ZPTR 1W1TA 1H0IA 4DRHA 4JFLA 4N19A 4TNSA 3RGCA 1SYTA 2ESCA 4GIVA 2DPEA 4G50A 5GQBA 4MSPA 3O5MA 3O5OA 2RURA 5DF0A 3KACA 1ROTA 1E6RA 4DWSB 4XAKA 4WK9A 4WJXA 4DIPA 1CTNA 3GTYX 4JFJA 3WD0A 3KABA 3ARZA 2PV1A 3LUOA 3G6MA 5J6EA 2Q5AA 3O5JA 2DG9A 3WQWA 1PINA 1J4RA 4DWSA 2WLZA 3O5PA 1ZU8A 3WD1A 3G6LA 4DWSC 3ARRA 1QZ2A 1RD6A 4ODOA 1FFRA 3TDBA 2B31A 4Z2LA 4NNRA 3ALGA 3ARTA 4Z2JA 3QOKA 3B8SA 2MLYA 3EIPA 4QIBA 4TYOA 4DRPA 3AROA 3TCZA 1JNSA 1JCHB 3O5RA 2IF4A 4LAVA 3ARXA 1NMVA 1LQ0A 1K9TA 4AY1A 4IQ2A 1EIBA 2M1IA 2B5UB 4KR0B 1U79A 2QF8A 1EQ3A 4TW7A 1FKSA 4GGQA 1OGBA 1X6NA 2LPVA 1ZB5A 2OLHA 3OOBA 3KAIA 4P8VA 1Q1CA 2MNTA 4WKHA 4WKFA 2RUQA 3AS2A 4Z2HA 2OFNA 4MNJA 1JVWA 4Q7NA 4MGVA 2VN1A 2A3BA 2O9OA 4DH0A 1YW5A 2XP5A 1R9HA 1ZK6A 1LG1A 4U84A 1OGGA 4Z2KA 1HJXA 3AQUA 3GPKA 3JXVA 5BXJA 4W9OA 3PRAA 3ARQA 3CGNA 3KAGA 1X6LA 3GU0A 4MTVA 4QT3A 3VAWA 2IUZA 2D9FA 4JFIA 1GRJA 1ZBWA 3IKDA 2WM0A 3JYJA 4O2TA 4KQZA 4Q22A 1JNDA 2MF9A 1JNEA 2JZVA 3UI5A 4U85A 3WD4A 1E9LA 1PBKA 4LAYA 1FKRA 5D75A 2XP6A 5DO2A 1TFVA 4L3NA 1N1AA 2MLZA 1QPLA 2PPNA 1NWTA 3TC5A 1W1VA 4IQCA 2DSUA 4HARA 4P8WA 4R0XA 3CH9A 2M2AA 1F8AB 2FAPA 3AS3A 4LAWA 4ML4A 3ODKA 2KI3A 2PBCA 3ARWA 4HBOA 1M5YA 2WK2A 2YBTA 2KO7A 3ARUA 3BMBA 4DZ2A 2MPHA 2WLYA 4ZS6A 1LL6A 1KT0A 3WD2A 1NWSA 1HKKA 1TCOC 1HKJA 4HBEA
chains in the Genus database with same CATH topology
4S3KA 3CHDA 1FKFA 2DG3A 1D7JA 3FAPA 1NH6A 1WNOA 3UQIA 3WL1A 2KFWA 1W9UA 1ITXA 1NWUA 4QT2A 1ROUA 3ARSA 3WL0A 3NTPA 2KE0A 3PRDA 1HXVA 1FKHA 5HT1A 4DRKA 1FKBA 2DSVA 2XP7A 4MNMA 1W9PA 4DRQA 4DRMA 3CHCA 2ITKA 2LJ4A 4MNKA 1FFQA 4DZ3A 2FDMA 1LL7A 4S3JA 2PV2A 3WQVA 4DRJA 2DT0A 4LGXA 1ZL1A 3O5EA 2DSZA 1A7XA 4J4NA 2LKNA 2ZQSA 3RM4A 2ZQTA 3CGMA 5GPRA 4DRNA 2ZQUA 2FKEA 2PPPA 3BXWA 2F21A 2Y78A 4MPKA 4TX0A 3MDYB 4ODLA 4JFKA 3CHEA 4IPXA 4MAVA 2PV3A 3FY1A 3B9DA 3PR9A 1ZBCA 5DIVA 4W5UA 1YATA 3EY6A 4WIWA 2ZR4A 1NWRA 2DT1A 5DIUA 1J4IA 5HTGA 1O6IA 3ARPA 1ZBKA 2G8ZA 1D7IA 3KAHA 1W1YA 1FKIA 2N87A 4BF8A 1HJVA 3KCEA 3O5FA 4TW6A 4ZPWR 3KZ7A 4NZCA 3IKGA 4DT4A 2A3CA 2K8IA 3O5GA 3O5DA 1VF8A 3WD3A 1E6PA 1D2KA 4ODQA 1GOIA 3H9RB 5HW7A 1FKDA 1C9HA 2VCDA 2XP8A 4QZVB 4PTMA 1Y0OA 1FKJA 4LAXA 3FXYA 4J4OA 4JYSA 4MNLA 5HUAA 2DT2A 1UR8A 4Z2IA 1LJYA 1F40A 1D7HA 2G41A 4Z2GA 2DG4A 4ODKA 3O5KA 2UZ5A 3B9AA 2KR7A 1EDQA 1XRVA 1HKMA 5HW8A 3UQBA 5HBFA 3ARYA 1WB0A 1OWQA 1J6YA 3O5LA 5JH8A 1L1PA 1IX5A 1NMWA 2RUDA 2A3EA 1Q6UA 4L72B 5B8IC 5I98A 1KFWA 3OA5A 4WKAA 1H0GA 1LL4A 3IK8A 4W9QA 2F2DA 4C02B 1Q6HA 3PA7A 4URIA 3WIJA 1E6ZA 3IHZA 2XPBA 1XHGA 2F4EA 1NSGA 3O5QA 1T11A 3NRKA 2L2SA 3RFWA 3CZ8A 1W26A 2O92A 5DITA 2PI6A 2DSWA 2ZR6A 2YBUA 1HJWA 4ODRA 1QPFA 1E15A 3UF8A 2A3AA 1WAWA 3WKZA 2ZR5A 1FKLA 5GPGA 1E6NA 1JNTA 5HWCA 2PPOA 2XPAA 1P5QA 3ALFA 5HKGA 2RUCA 3RM9A 4R5EA 1W1PA 1ZBVA 5HW6A 3ARVA 5DEZA 4ZPVR 2M08A 1BKFA 1LG2A 4DWSD 3AS0A 3UI6A 3RM8A 1HKIA 3RMEA 1UR9A 1D6OA 3WH0A 1W9VA 4P8XA 2DT3A 3B9EA 4W9PA 4ODNA 3PRBA 4ODPA 3W4RA 3KADA 3JYMA 2XP4A 5HWBA 3UQAA 4FAPA 2RSEA 1FKGA 1FD9A 4G2PA 3UI4A 4FN2A 4DROA 1Q6IA 4ITZA 2AWGA 3KAFA 1FJDA 3O5IA 4U86A 4JFMA 4TW8A 4P8UA 3AS1A 2KGJA 2ZQVA 2XP3A 1J4HA 4IT4A 1FKKA 4ODMA 3B7XA 3NI6A 1FAPA 1SR0A 1B6CA 4DRIA 1GUVA 3I6CA 3CHFA 1BL4A 2RQSA 1KT1A 2MLXA 1EYMA 2AOSA 1GPFA 4NSBA 1FKTA 2LGOA 2XP9A 1EHNA 4IT6A 1ZCNA 4ZPTR 1W1TA 1H0IA 4DRHA 4JFLA 4N19A 4TNSA 3RGCA 1SYTA 2ESCA 4GIVA 2DPEA 4G50A 5GQBA 4MSPA 3O5MA 3O5OA 2RURA 5DF0A 3KACA 1ROTA 1E6RA 4DWSB 4XAKA 4WK9A 4WJXA 4DIPA 1CTNA 4JFJA 3WD0A 3KABA 3ARZA 2PV1A 3LUOA 3G6MA 5J6EA 2Q5AA 3O5JA 2DG9A 3WQWA 1PINA 1J4RA 4DWSA 2WLZA 3O5PA 1ZU8A 3WD1A 3G6LA 4DWSC 3ARRA 1QZ2A 1RD6A 4ODOA 1FFRA 3TDBA 2B31A 4Z2LA 4NNRA 3ALGA 3ARTA 4Z2JA 3QOKA 3B8SA 2MLYA 4QIBA 4TYOA 4DRPA 3AROA 3TCZA 1JNSA 3O5RA 2IF4A 4LAVA 3ARXA 1NMVA 1LQ0A 1K9TA 4AY1A 4IQ2A 1EIBA 2M1IA 4KR0B 1U79A 2QF8A 1EQ3A 4TW7A 1FKSA 4GGQA 1OGBA 1X6NA 2LPVA 1ZB5A 2OLHA 3OOBA 3KAIA 4P8VA 1Q1CA 2MNTA 4WKHA 4WKFA 2RUQA 3AS2A 4Z2HA 2OFNA 4MNJA 1JVWA 4Q7NA 4MGVA 2VN1A 2A3BA 2O9OA 4DH0A 1YW5A 2XP5A 1R9HA 1ZK6A 1LG1A 4U84A 1OGGA 4Z2KA 1HJXA 3AQUA 3GPKA 3JXVA 5BXJA 4W9OA 3PRAA 3ARQA 3CGNA 3KAGA 1X6LA 4MTVA 4QT3A 3VAWA 2IUZA 2D9FA 4JFIA 1ZBWA 3IKDA 2WM0A 3JYJA 4O2TA 4KQZA 4Q22A 1JNDA 2MF9A 1JNEA 2JZVA 3UI5A 4U85A 3WD4A 1E9LA 1PBKA 4LAYA 1FKRA 5D75A 2XP6A 5DO2A 1TFVA 4L3NA 1N1AA 2MLZA 1QPLA 2PPNA 1NWTA 3TC5A 1W1VA 4IQCA 2DSUA 4HARA 4P8WA 4R0XA 3CH9A 2M2AA 1F8AB 2FAPA 3AS3A 4LAWA 4ML4A 3ODKA 2KI3A 2PBCA 3ARWA 4HBOA 1M5YA 2WK2A 2YBTA 2KO7A 3ARUA 4DZ2A 2MPHA 2WLYA 4ZS6A 1LL6A 1KT0A 3WD2A 1NWSA 1HKKA 1TCOC 1HKJA 4HBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCZ A;  4LAX A;  4J4O A;  2XP4 A;  4JYS A;  5HWB A;  3O5R A;  5HUA A;  3UQA A;  1FKF A;  2DG3 A;  1D7J A;  2IF4 A;  3FAP A;  1JNS A;  4LAV A;  3UQI A;  1NMV A;  2KFW A;  2RSE A;  4FAP A;  1F40 A;  1FKG A;  1FD9 A;  1D7H A;  4G2P A;  3UI4 A;  4QT2 A;  2DG4 A;  4IQ2 A;  1ROU A;  2M1I A;  4FN2 A;  4DRO A;  4ODK A;  3NTP A;  1Q6I A;  2KE0 A;  3O5K A;  3PRD A;  4ITZ A;  2UZ5 A;  1HXV A;  1FKH A;  2AWG A;  2KR7 A;  1U79 A;  3KAF A;  5HT1 A;  1EQ3 A;  4TW7 A;  1FKS A;  1FJD A;  4GGQ A;  3O5I A;  3OOB A;  2LPV A;  4U86 A;  4DRK A;  5HW8 A;  1FKB A;  3KAI A;  2XP7 A;  3UQB A;  1Q1C A;  4JFM A;  1J6Y A;  4TW8 A;  2MNT A;  3O5L A;  4DRQ A;  4DRM A;  2ITK A;  2RUQ A;  2KGJ A;  2LJ4 A;  2OFN A;  1JVW A;  2ZQV A;  4MGV A;  2XP3 A;  4DZ3 A;  1J4H A;  2VN1 A;  1FKK A;  4ODM A;  3B7X A;  2PV2 A;  1FAP A;  3NI6 A;  4DH0 A;  1L1P A;  1YW5 A;  2XP5 A;  4DRJ A;  1B6C A;  1NMW A;  4DRI A;  1R9H A;  2RUD A;  1ZK6 A;  1Q6U A;  3O5E A;  5B8I C;  3I6C A;  5I98 A;  1BL4 A;  2RQS A;  1KT1 A;  1A7X A;  4J4N A;  2LKN A;  2ZQS A;  4U84 A;  3JXV A;  2MLX A;  1EYM A;  2ZQT A;  3CGM A;  3GPK A;  4DRN A;  5BXJ A;  3IK8 A;  4W9Q A;  2ZQU A;  4W9O A;  2FKE A;  1FKT A;  2F2D A;  2LGO A;  2PPP A;  1Q6H A;  4C02 B;  3PA7 A;  2F21 A;  2XP9 A;  3CGN A;  3KAG A;  2Y78 A;  4TX0 A;  3IHZ A;  3MDY B;  4ODL A;  2XPB A;  2F4E A;  1NSG A;  1ZCN A;  4JFK A;  4QT3 A;  3VAW A;  4JFL A;  2D9F A;  4JFI A;  3O5Q A;  4IPX A;  4N19 A;  4DRH A;  2PV3 A;  3IKD A;  3JYJ A;  4O2T A;  4TNS A;  3RGC A;  1T11 A;  3NRK A;  2L2S A;  2MF9 A;  4GIV A;  5DIV A;  3RFW A;  1YAT A;  1W26 A;  5DIT A;  3EY6 A;  2JZV A;  3UI5 A;  2ZR4 A;  4G50 A;  4U85 A;  2ZR6 A;  3O5M A;  3O5O A;  4MSP A;  1PBK A;  2RUR A;  4LAY A;  3KAC A;  1ROT A;  1FKR A;  5DIU A;  5D75 A;  1J4I A;  2XP6 A;  4ODR A;  1N1A A;  2MLZ A;  1QPL A;  5HTG A;  2PPN A;  1QPF A;  3UF8 A;  4DIP A;  2ZR5 A;  1FKL A;  5GPG A;  1D7I A;  4JFJ A;  3TC5 A;  3KAH A;  4IQC A;  1JNT A;  4R0X A;  2PPO A;  3KAB A;  2XPA A;  5HWC A;  1P5Q A;  1FKI A;  2M2A A;  2PV1 A;  2N87 A;  5HKG A;  2RUC A;  3LUO A;  1F8A B;  4BF8 A;  5J6E A;  2FAP A;  4LAW A;  3KCE A;  5HW6 A;  3O5F A;  3ODK A;  2KI3 A;  4TW6 A;  2Q5A A;  3O5J A;  2DG9 A;  3KZ7 A;  1PIN A;  2PBC A;  3IKG A;  1J4R A;  3O5P A;  2M08 A;  1BKF A;  4DT4 A;  1M5Y A;  1QZ2 A;  2KO7 A;  2K8I A;  4ODO A;  3UI6 A;  4DZ2 A;  2MPH A;  3O5G A;  3O5D A;  1D6O A;  3WH0 A;  3KAD A;  3TDB A;  4ODQ A;  3H9R B;  5HW7 A;  1FKD A;  1C9H A;  2VCD A;  2XP8 A;  4NNR A;  1KT0 A;  4W9P A;  2MLY A;  4ODN A;  4QIB A;  1TCO C;  3PRB A;  4ODP A;  4TYO A;  1Y0O A;  4DRP A;  3JYM A;  1FKJ A; 
#chains in the Genus database with same CATH topology
 4S3K A;  3CHD A;  1FKF A;  2DG3 A;  1D7J A;  3FAP A;  1NH6 A;  1WNO A;  3UQI A;  3WL1 A;  2KFW A;  1W9U A;  1ITX A;  1NWU A;  4QT2 A;  1ROU A;  3ARS A;  3WL0 A;  3NTP A;  2KE0 A;  3PRD A;  1HXV A;  1FKH A;  5HT1 A;  4DRK A;  1FKB A;  2DSV A;  2XP7 A;  4MNM A;  1W9P A;  4DRQ A;  4DRM A;  3CHC A;  2ITK A;  2LJ4 A;  4MNK A;  1FFQ A;  4DZ3 A;  2FDM A;  1LL7 A;  4S3J A;  2PV2 A;  3WQV A;  4DRJ A;  2DT0 A;  4LGX A;  1ZL1 A;  3O5E A;  2DSZ A;  1A7X A;  4J4N A;  2LKN A;  2ZQS A;  3RM4 A;  2ZQT A;  3CGM A;  5GPR A;  4DRN A;  2ZQU A;  2FKE A;  2PPP A;  3BXW A;  2F21 A;  2Y78 A;  4MPK A;  4TX0 A;  3MDY B;  4ODL A;  4JFK A;  3CHE A;  4IPX A;  4MAV A;  2PV3 A;  3FY1 A;  3B9D A;  3PR9 A;  1ZBC A;  5DIV A;  4W5U A;  1YAT A;  3EY6 A;  4WIW A;  2ZR4 A;  1NWR A;  2DT1 A;  5DIU A;  1J4I A;  5HTG A;  1O6I A;  2PN0 A;  3ARP A;  1ZBK A;  2G8Z A;  1D7I A;  3KAH A;  1W1Y A;  2P4V A;  1FKI A;  2N87 A;  4BF8 A;  1HJV A;  3KCE A;  3O5F A;  4TW6 A;  4ZPW R;  3KZ7 A;  4NZC A;  3IKG A;  1E44 A;  4DT4 A;  2A3C A;  2K8I A;  3O5G A;  3O5D A;  1VF8 A;  3WD3 A;  1E6P A;  1D2K A;  4ODQ A;  1GOI A;  3H9R B;  5HW7 A;  1FKD A;  1C9H A;  2VCD A;  2XP8 A;  4QZV B;  2EUL A;  4PTM A;  1Y0O A;  1FKJ A;  4LAX A;  3FXY A;  4J4O A;  4JYS A;  4MNL A;  5HUA A;  2DT2 A;  1UR8 A;  4Z2I A;  1LJY A;  1F40 A;  1D7H A;  2G41 A;  4Z2G A;  2DG4 A;  4ODK A;  3O5K A;  2UZ5 A;  3B9A A;  2KR7 A;  1EDQ A;  1XRV A;  1HKM A;  5HW8 A;  3UQB A;  5HBF A;  3ARY A;  1WB0 A;  1OWQ A;  1J6Y A;  3O5L A;  5JH8 A;  1L1P A;  1IX5 A;  1NMW A;  2RUD A;  2A3E A;  1Q6U A;  4L72 B;  5B8I C;  5I98 A;  1KFW A;  3OA5 A;  4WKA A;  1H0G A;  1LL4 A;  3IK8 A;  4W9Q A;  2F2D A;  4C02 B;  1Q6H A;  3PA7 A;  4URI A;  3WIJ A;  1E6Z A;  3IHZ A;  2XPB A;  1XHG A;  2F4E A;  1NSG A;  3O5Q A;  1T11 A;  3NRK A;  2L2S A;  3RFW A;  3CZ8 A;  1W26 A;  2O92 A;  5DIT A;  2PI6 A;  2DSW A;  2ZR6 A;  2YBU A;  1HJW A;  4ODR A;  1QPF A;  1E15 A;  3UF8 A;  2A3A A;  1WAW A;  3WKZ A;  2ZR5 A;  1FKL A;  5GPG A;  1E6N A;  1JNT A;  5HWC A;  2PPO A;  2XPA A;  1P5Q A;  3ALF A;  5HKG A;  2RUC A;  3RM9 A;  4R5E A;  1W1P A;  1ZBV A;  5HW6 A;  3ARV A;  4UDM A;  5DEZ A;  4ZPV R;  2M08 A;  1BKF A;  1LG2 A;  4DWS D;  3AS0 A;  3UI6 A;  3RM8 A;  1HKI A;  3RME A;  1UR9 A;  1D6O A;  3WH0 A;  1W9V A;  4P8X A;  2DT3 A;  3B9E A;  4W9P A;  4ODN A;  3PRB A;  4ODP A;  3W4R A;  3KAD A;  3JYM A;  2XP4 A;  5HWB A;  3UQA A;  2ETN A;  4FAP A;  2RSE A;  1FKG A;  1FD9 A;  4G2P A;  3UI4 A;  4FN2 A;  4DRO A;  1Q6I A;  4ITZ A;  2AWG A;  3KAF A;  1FJD A;  3O5I A;  4U86 A;  4JFM A;  4TW8 A;  4P8U A;  2F23 A;  3AS1 A;  2KGJ A;  2ZQV A;  2XP3 A;  1J4H A;  4IT4 A;  1FKK A;  4ODM A;  3B7X A;  3NI6 A;  1FAP A;  1SR0 A;  1B6C A;  4DRI A;  1GUV A;  3I6C A;  3CHF A;  1BL4 A;  2RQS A;  1KT1 A;  2MLX A;  1EYM A;  2AOS A;  1GPF A;  4NSB A;  1FKT A;  2LGO A;  2XP9 A;  1EHN A;  4IT6 A;  1ZCN A;  4ZPT R;  1W1T A;  1H0I A;  4DRH A;  4JFL A;  4N19 A;  4TNS A;  3RGC A;  1SYT A;  2ESC A;  4GIV A;  2DPE A;  4G50 A;  5GQB A;  4MSP A;  3O5M A;  3O5O A;  2RUR A;  5DF0 A;  3KAC A;  1ROT A;  1E6R A;  4DWS B;  4XAK A;  4WK9 A;  4WJX A;  4DIP A;  1CTN A;  3GTY X;  4JFJ A;  3WD0 A;  3KAB A;  3ARZ A;  2PV1 A;  3LUO A;  3G6M A;  5J6E A;  2Q5A A;  3O5J A;  2DG9 A;  3WQW A;  1PIN A;  1J4R A;  4DWS A;  2WLZ A;  3O5P A;  1ZU8 A;  3WD1 A;  3G6L A;  4DWS C;  3ARR A;  1QZ2 A;  1RD6 A;  4ODO A;  1FFR A;  3TDB A;  2B31 A;  4Z2L A;  4NNR A;  3ALG A;  3ART A;  4Z2J A;  3QOK A;  3B8S A;  2MLY A;  3EIP A;  4QIB A;  4TYO A;  4DRP A;  3ARO A;  3TCZ A;  1JNS A;  1JCH B;  3O5R A;  2IF4 A;  4LAV A;  3ARX A;  1NMV A;  1LQ0 A;  1K9T A;  4AY1 A;  4IQ2 A;  1EIB A;  2M1I A;  2B5U B;  4KR0 B;  1U79 A;  2QF8 A;  1EQ3 A;  4TW7 A;  1FKS A;  4GGQ A;  1OGB A;  1X6N A;  2LPV A;  1ZB5 A;  2OLH A;  3OOB A;  3KAI A;  4P8V A;  1Q1C A;  2MNT A;  4WKH A;  4WKF A;  2RUQ A;  3AS2 A;  4Z2H A;  2OFN A;  4MNJ A;  1JVW A;  4Q7N A;  4MGV A;  2VN1 A;  2A3B A;  2O9O A;  4DH0 A;  1YW5 A;  2XP5 A;  1R9H A;  1ZK6 A;  1LG1 A;  4U84 A;  1OGG A;  4Z2K A;  1HJX A;  3AQU A;  3GPK A;  3JXV A;  5BXJ A;  4W9O A;  3PRA A;  3ARQ A;  3CGN A;  3KAG A;  1X6L A;  3GU0 A;  4MTV A;  4QT3 A;  3VAW A;  2IUZ A;  2D9F A;  4JFI A;  1GRJ A;  1ZBW A;  3IKD A;  2WM0 A;  3JYJ A;  4O2T A;  4KQZ A;  4Q22 A;  1JND A;  2MF9 A;  1JNE A;  2JZV A;  3UI5 A;  4U85 A;  3WD4 A;  1E9L A;  1PBK A;  4LAY A;  1FKR A;  5D75 A;  2XP6 A;  5DO2 A;  1TFV A;  4L3N A;  1N1A A;  2MLZ A;  1QPL A;  2PPN A;  1NWT A;  3TC5 A;  1W1V A;  4IQC A;  2DSU A;  4HAR A;  4P8W A;  4R0X A;  3CH9 A;  2M2A A;  1F8A B;  2FAP A;  3AS3 A;  4LAW A;  4ML4 A;  3ODK A;  2KI3 A;  2PBC A;  3ARW A;  4HBO A;  1M5Y A;  2WK2 A;  2YBT A;  2KO7 A;  3ARU A;  3BMB A;  4DZ2 A;  2MPH A;  2WLY A;  4ZS6 A;  1LL6 A;  1KT0 A;  3WD2 A;  1NWS A;  1HKK A;  1TCO C;  1HKJ A;  4HBE A; 
#chains in the Genus database with same CATH homology
 4S3K A;  3CHD A;  1FKF A;  2DG3 A;  1D7J A;  3FAP A;  1NH6 A;  1WNO A;  3UQI A;  3WL1 A;  2KFW A;  1W9U A;  1ITX A;  1NWU A;  4QT2 A;  1ROU A;  3ARS A;  3WL0 A;  3NTP A;  2KE0 A;  3PRD A;  1HXV A;  1FKH A;  5HT1 A;  4DRK A;  1FKB A;  2DSV A;  2XP7 A;  4MNM A;  1W9P A;  4DRQ A;  4DRM A;  3CHC A;  2ITK A;  2LJ4 A;  4MNK A;  1FFQ A;  4DZ3 A;  2FDM A;  1LL7 A;  4S3J A;  2PV2 A;  3WQV A;  4DRJ A;  2DT0 A;  4LGX A;  1ZL1 A;  3O5E A;  2DSZ A;  1A7X A;  4J4N A;  2LKN A;  2ZQS A;  3RM4 A;  2ZQT A;  3CGM A;  5GPR A;  4DRN A;  2ZQU A;  2FKE A;  2PPP A;  3BXW A;  2F21 A;  2Y78 A;  4MPK A;  4TX0 A;  3MDY B;  4ODL A;  4JFK A;  3CHE A;  4IPX A;  4MAV A;  2PV3 A;  3FY1 A;  3B9D A;  3PR9 A;  1ZBC A;  5DIV A;  4W5U A;  1YAT A;  3EY6 A;  4WIW A;  2ZR4 A;  1NWR A;  2DT1 A;  5DIU A;  1J4I A;  5HTG A;  1O6I A;  3ARP A;  1ZBK A;  2G8Z A;  1D7I A;  3KAH A;  1W1Y A;  1FKI A;  2N87 A;  4BF8 A;  1HJV A;  3KCE A;  3O5F A;  4TW6 A;  4ZPW R;  3KZ7 A;  4NZC A;  3IKG A;  4DT4 A;  2A3C A;  2K8I A;  3O5G A;  3O5D A;  1VF8 A;  3WD3 A;  1E6P A;  1D2K A;  4ODQ A;  1GOI A;  3H9R B;  5HW7 A;  1FKD A;  1C9H A;  2VCD A;  2XP8 A;  4QZV B;  4PTM A;  1Y0O A;  1FKJ A;  4LAX A;  3FXY A;  4J4O A;  4JYS A;  4MNL A;  5HUA A;  2DT2 A;  1UR8 A;  4Z2I A;  1LJY A;  1F40 A;  1D7H A;  2G41 A;  4Z2G A;  2DG4 A;  4ODK A;  3O5K A;  2UZ5 A;  3B9A A;  2KR7 A;  1EDQ A;  1XRV A;  1HKM A;  5HW8 A;  3UQB A;  5HBF A;  3ARY A;  1WB0 A;  1OWQ A;  1J6Y A;  3O5L A;  5JH8 A;  1L1P A;  1IX5 A;  1NMW A;  2RUD A;  2A3E A;  1Q6U A;  4L72 B;  5B8I C;  5I98 A;  1KFW A;  3OA5 A;  4WKA A;  1H0G A;  1LL4 A;  3IK8 A;  4W9Q A;  2F2D A;  4C02 B;  1Q6H A;  3PA7 A;  4URI A;  3WIJ A;  1E6Z A;  3IHZ A;  2XPB A;  1XHG A;  2F4E A;  1NSG A;  3O5Q A;  1T11 A;  3NRK A;  2L2S A;  3RFW A;  3CZ8 A;  1W26 A;  2O92 A;  5DIT A;  2PI6 A;  2DSW A;  2ZR6 A;  2YBU A;  1HJW A;  4ODR A;  1QPF A;  1E15 A;  3UF8 A;  2A3A A;  1WAW A;  3WKZ A;  2ZR5 A;  1FKL A;  5GPG A;  1E6N A;  1JNT A;  5HWC A;  2PPO A;  2XPA A;  1P5Q A;  3ALF A;  5HKG A;  2RUC A;  3RM9 A;  4R5E A;  1W1P A;  1ZBV A;  5HW6 A;  3ARV A;  5DEZ A;  4ZPV R;  2M08 A;  1BKF A;  1LG2 A;  4DWS D;  3AS0 A;  3UI6 A;  3RM8 A;  1HKI A;  3RME A;  1UR9 A;  1D6O A;  3WH0 A;  1W9V A;  4P8X A;  2DT3 A;  3B9E A;  4W9P A;  4ODN A;  3PRB A;  4ODP A;  3W4R A;  3KAD A;  3JYM A;  2XP4 A;  5HWB A;  3UQA A;  4FAP A;  2RSE A;  1FKG A;  1FD9 A;  4G2P A;  3UI4 A;  4FN2 A;  4DRO A;  1Q6I A;  4ITZ A;  2AWG A;  3KAF A;  1FJD A;  3O5I A;  4U86 A;  4JFM A;  4TW8 A;  4P8U A;  3AS1 A;  2KGJ A;  2ZQV A;  2XP3 A;  1J4H A;  4IT4 A;  1FKK A;  4ODM A;  3B7X A;  3NI6 A;  1FAP A;  1SR0 A;  1B6C A;  4DRI A;  1GUV A;  3I6C A;  3CHF A;  1BL4 A;  2RQS A;  1KT1 A;  2MLX A;  1EYM A;  2AOS A;  1GPF A;  4NSB A;  1FKT A;  2LGO A;  2XP9 A;  1EHN A;  4IT6 A;  1ZCN A;  4ZPT R;  1W1T A;  1H0I A;  4DRH A;  4JFL A;  4N19 A;  4TNS A;  3RGC A;  1SYT A;  2ESC A;  4GIV A;  2DPE A;  4G50 A;  5GQB A;  4MSP A;  3O5M A;  3O5O A;  2RUR A;  5DF0 A;  3KAC A;  1ROT A;  1E6R A;  4DWS B;  4XAK A;  4WK9 A;  4WJX A;  4DIP A;  1CTN A;  4JFJ A;  3WD0 A;  3KAB A;  3ARZ A;  2PV1 A;  3LUO A;  3G6M A;  5J6E A;  2Q5A A;  3O5J A;  2DG9 A;  3WQW A;  1PIN A;  1J4R A;  4DWS A;  2WLZ A;  3O5P A;  1ZU8 A;  3WD1 A;  3G6L A;  4DWS C;  3ARR A;  1QZ2 A;  1RD6 A;  4ODO A;  1FFR A;  3TDB A;  2B31 A;  4Z2L A;  4NNR A;  3ALG A;  3ART A;  4Z2J A;  3QOK A;  3B8S A;  2MLY A;  4QIB A;  4TYO A;  4DRP A;  3ARO A;  3TCZ A;  1JNS A;  3O5R A;  2IF4 A;  4LAV A;  3ARX A;  1NMV A;  1LQ0 A;  1K9T A;  4AY1 A;  4IQ2 A;  1EIB A;  2M1I A;  4KR0 B;  1U79 A;  2QF8 A;  1EQ3 A;  4TW7 A;  1FKS A;  4GGQ A;  1OGB A;  1X6N A;  2LPV A;  1ZB5 A;  2OLH A;  3OOB A;  3KAI A;  4P8V A;  1Q1C A;  2MNT A;  4WKH A;  4WKF A;  2RUQ A;  3AS2 A;  4Z2H A;  2OFN A;  4MNJ A;  1JVW A;  4Q7N A;  4MGV A;  2VN1 A;  2A3B A;  2O9O A;  4DH0 A;  1YW5 A;  2XP5 A;  1R9H A;  1ZK6 A;  1LG1 A;  4U84 A;  1OGG A;  4Z2K A;  1HJX A;  3AQU A;  3GPK A;  3JXV A;  5BXJ A;  4W9O A;  3PRA A;  3ARQ A;  3CGN A;  3KAG A;  1X6L A;  4MTV A;  4QT3 A;  3VAW A;  2IUZ A;  2D9F A;  4JFI A;  1ZBW A;  3IKD A;  2WM0 A;  3JYJ A;  4O2T A;  4KQZ A;  4Q22 A;  1JND A;  2MF9 A;  1JNE A;  2JZV A;  3UI5 A;  4U85 A;  3WD4 A;  1E9L A;  1PBK A;  4LAY A;  1FKR A;  5D75 A;  2XP6 A;  5DO2 A;  1TFV A;  4L3N A;  1N1A A;  2MLZ A;  1QPL A;  2PPN A;  1NWT A;  3TC5 A;  1W1V A;  4IQC A;  2DSU A;  4HAR A;  4P8W A;  4R0X A;  3CH9 A;  2M2A A;  1F8A B;  2FAP A;  3AS3 A;  4LAW A;  4ML4 A;  3ODK A;  2KI3 A;  2PBC A;  3ARW A;  4HBO A;  1M5Y A;  2WK2 A;  2YBT A;  2KO7 A;  3ARU A;  4DZ2 A;  2MPH A;  2WLY A;  4ZS6 A;  1LL6 A;  1KT0 A;  3WD2 A;  1NWS A;  1HKK A;  1TCO C;  1HKJ A;  4HBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...