2RURA

Solution structure of human pin1 ppiase c113s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 34
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rurA00
1JNTA 3O5DA 1FKLA 1A7XA 1QPFA 2RUQA 4JFKA 4JFIA 1NMWA 4ODMA 3KAFA 4DRNA 2UZ5A 1B6CA 4ODKA 1QZ2A 3IHZA 1FKGA 1Q1CA 4DH0A 2XP9A 4G50A 1FKJA 2Q5AA 1EYMA 1Q6IA 3IKGA 4O2TA 3PA7A 3O5RA 2XP3A 3PRBA 3JYMA 2PV2A 4MGVA 4ODOA 3TDBA 1NMVA 2DG4A 2MLZA 2ZR4A 3O5GA 3O5JA 4MSPA 3TC5A 1PBKA 5HW8A 4J4NA 1N1AA 1KT0A 4TYOA 4NNRA 3O5FA 1M5YA 2F2DA 3PRDA 4J4OA 2KI3A 1R9HA 4QIBA 3IKDA 3O5IA 5HWBA 3WH0A 2DG3A 1P5QA 2F21A 4U84A 1KT1A 4ODRA 1FKDA 4ODPA 4FN2A 3B7XA 1BL4A 2KR7A 3NRKA 4W9PA 1D7JA 4DZ2A 1FKRA 3MDYB 1W26A 5B8IC 3O5OA 4ITZA 3KACA 1QPLA 3TCZA 2XP5A 2FAPA 2PBCA 4DRJA 4R0XA 2XP8A 4IQCA 4DZ3A 5HKGA 5HUAA 5HTGA 5HWCA 4TNSA 5J6EA 1FKTA 4U85A 3UQIA 1ROUA 1ZK6A 3JYJA 4LAXA 1F40A 2M2AA 3EY6A 3KAIA 4ODQA 5D75A 1J4RA 2PPNA 2MLYA 3LUOA 5GPGA 2MPHA 5HW6A 1NSGA 4DRPA 2PV3A 4LAWA 3UQAA 3UQBA 2VN1A 3O5LA 2L2SA 4JFMA 5BXJA 2N87A 1J4IA 1YW5A 3KABA 1F8AB 3RFWA 3VAWA 1FKHA 1TCOC 2LGOA 2RQSA 1ROTA 3O5KA 1YATA 2Y78A 4IPXA 3O5PA 4QT2A 3H9RB 3I6CA 1J4HA 1Q6UA 2ZR6A 1JVWA 1J6YA 4JYSA 4W9QA 1C9HA 2M1IA 1FKFA 2JZVA 4BF8A 5HW7A 2XPBA 4W9OA 3O5EA 2MF9A 1PINA 4TW8A 4IQ2A 1FAPA 3KZ7A 3RGCA 4JFJA 4DRIA 2K8IA 2XP6A 3KAHA 1FKKA 3JXVA 2LJ4A 2ZR5A 2RSEA 1FKBA 3NI6A 3NTPA 2LKNA 4GIVA 3KADA 3KCEA 1FKSA 1FD9A 2ZQUA 2ZQVA 4QT3A 5I98A 4DROA 2M08A 4C02B 3FAPA 2D9FA 5DIVA 1FJDA 1Q6HA 2RURA 2FKEA 2RUDA 2MLXA 3IK8A 3UF8A 4G2PA 3UI4A 2XPAA 3CGNA 2KO7A 5HT1A 4TW7A 1U79A 3GPKA 2RUCA 4TX0A 2DG9A 5DIUA 2PV1A 4DRHA 4DRQA 4JFLA 2ZQSA 2MNTA 2ITKA 3OOBA 4ODNA 1Y0OA 2OFNA 2ZQTA 1ZCNA 4N19A 4TW6A 3UI6A 3O5QA 2XP4A 4LAYA 1JNSA 2XP7A 2PPOA 2IF4A 4DRMA 4DIPA 1EQ3A 2KFWA 1BKFA 3CGMA 3KAGA 4U86A 1FKIA 1D7IA 3UI5A 1D7HA 4ODLA 1HXVA 4DRKA 1D6OA 1T11A 2F4EA 4GGQA 5DITA 2KE0A 3ODKA 3O5MA 1L1PA 2AWGA 2LPVA 2PPPA 4LAVA 2VCDA 4FAPA 4DT4A 2KGJA
chains in the Genus database with same CATH superfamily
3O5DA 1QPFA 2RUQA 3IHZA 2ESCA 1Q1CA 2XP9A 2B31A 4AY1A 2A3AA 1LL7A 4Z2JA 3ARRA 5HW8A 1ZBCA 3TC5A 1HXVA 3O5JA 1PBKA 1N1AA 1XRVA 1NH6A 1LJYA 4TYOA 3O5FA 3ARUA 1OWQA 3O5IA 4MNLA 2DG3A 1KT1A 5HUAA 1BL4A 3AS1A 5B8IC 3O5OA 3ALFA 1NWRA 2XP5A 3GTYX 2XP8A 4IQCA 2YBUA 2FDMA 1FKTA 3UQIA 3EY6A 4ODQA 3KAIA 2PV3A 4LAWA 1EHNA 3CHEA 5BXJA 3WQWA 1YW5A 3KABA 3RFWA 3VAWA 1FKHA 1IX5A 1ROTA 1YATA 4QT2A 4ZPWR 2DSVA 4BF8A 2XPBA 4MPKA 1HKKA 1HKIA 4TW8A 3KZ7A 1LG1A 1NWTA 3RGCA 4JFJA 4P8XA 4DRIA 2WLZA 2K8IA 2XP6A 4ZPTR 3RM4A 3WD3A 2AOSA 2LJ4A 1X6LA 4NZCA 1D2KA 1FKBA 3NTPA 3KCEA 2ZQVA 2O92A 3FAPA 2D9FA 4HARA 1FJDA 1Q6HA 2RUDA 3IK8A 4G2PA 1OGBA 3CGNA 4L3NA 2KO7A 5DO2A 4WKFA 3CHFA 2DG9A 3WKZA 4DRQA 4DWSB 4HBOA 3ARZA 4URIA 2MNTA 1TFVA 2ITKA 3BXWA 3G6LA 4LAYA 3B9AA 2P4VA 4DRMA 2KFWA 1GUVA 1D6OA 4GGQA 3ODKA 1L1PA 2A3CA 1LQ0A 1E9LA 2KGJA 1ZB5A 1O6IA 4JFKA 3AROA 3ARXA 4DWSC 2UZ5A 1WAWA 1ZU8A 1E15A 1GRJA 3QOKA 1EYMA 1Q6IA 3IKGA 3RM9A 1HJXA 3O5GA 3ARWA 1HJVA 3B8SA 4KQZA 1EIBA 2VCDA 4NNRA 1M5YA 4J4OA 4PTMA 4Q22A 3ARSA 3AS0A 1E6PA 3IKDA 1P5QA 4U84A 4ODRA 4ODPA 4W9PA 2KR7A 5GPRA 1D7JA 1FKRA 4ITZA 3KACA 4ZPVR 5GQBA 5HTGA 5HWCA 5J6EA 4U85A 1ROUA 3CHDA 4LAXA 4R5EA 1F40A 5D75A 3LUOA 4WKHA 1NSGA 3O5LA 2L2SA 4JFMA 4IT4A 1HKJA 3O5KA 1VF8A 2B5UB 3H9RB 3I6CA 3B9EA 4Z2KA 2ZR6A 1J6YA 4JYSA 4MTVA 1FKFA 1SYTA 2PN0A 1E44A 4S3KA 3EIPA 4IQ2A 3FY1A 1GPFA 1E6NA 3WD2A 3PRAA 2RSEA 1GOIA 1LL6A 3ARVA 1FKSA 1FD9A 4DROA 4C02B 4XAKA 4HBEA 3WQVA 2DPEA 4TW7A 1HJWA 5HBFA 2G8ZA 2PV1A 2DSZA 4DRHA 4JFLA 4S3JA 2ZQTA 4TW6A 1ZBVA 1SR0A 2XP4A 1JNSA 2IF4A 4DIPA 1EQ3A 1LG2A 1FKIA 4W5UA 2F4EA 1EDQA 4MAVA 3ARQA 1OGGA 2LPVA 2JZVA 1FKLA 3KAFA 1QZ2A 2DT0A 2Q5AA 1JNDA 4O2TA 2EULA 2PI6A 2A3BA 3PA7A 1ZBKA 3PRBA 3JYMA 1JNEA 4MSPA 2MLZA 3CHCA 4J4NA 1E6ZA 4NSBA 3B9DA 1HKMA 2F2DA 2KI3A 4QIBA 3WH0A 3AS2A 4UDMA 1FKDA 3B7XA 4DZ2A 1W1YA 4Z2IA 4Z2GA 1QPLA 3TCZA 2FAPA 5HKGA 4R0XA 3AS3A 3CH9A 1ZK6A 2M2AA 5GPGA 1J4RA 1W9VA 2MLYA 2PPNA 2MPHA 5HW6A 3ARTA 2VN1A 1UR9A 2N87A 1J4IA 1H0IA 1F8AB 1E6RA 1TCOC 2RQSA 2WK2A 2Y78A 1Q6UA 5DEZA 4WJXA 2DT1A 4L72B 1C9HA 3WD1A 2M1IA 3FXYA 5HW7A 1JCHB 2DT3A 1PINA 3AQUA 2WLYA 1FKKA 3JXVA 3NI6A 2LKNA 3KADA 2ZQUA 3RM8A 4QT3A 2M08A 1W1TA 5DIVA 2RURA 3UF8A 4DWSA 3UI4A 2XPAA 5HT1A 3WD0A 3GPKA 1NWUA 4Q7NA 4QZVB 4Z2LA 4MNJA 2ZQSA 4IT6A 3G6MA 2OFNA 4N19A 4Z2HA 1LL4A 1BKFA 1WNOA 1D7HA 4ODLA 1UR8A 4DRKA 2A3EA 2KE0A 3O5MA 4KR0B 2AWGA 2PPPA 3WL0A 4FAPA 2ETNA 1JNTA 2O9OA 1A7XA 4JFIA 1NMWA 3GU0A 4ODMA 1NWSA 4WK9A 4DRNA 1B6CA 4ODKA 4MNKA 1FKGA 4P8UA 4P8WA 4DH0A 1ITXA 4G50A 1FKJA 3O5RA 2XP3A 4ODOA 4MGVA 2PV2A 3TDBA 3PR9A 1NMVA 2DG4A 2ZR4A 1RD6A 1WB0A 3ARYA 1KT0A 2G41A 3PRDA 4P8VA 1R9HA 5HWBA 5DF0A 1K9TA 2F21A 2DT2A 1KFWA 2OLHA 4FN2A 3NRKA 3MDYB 1W26A 1FFQA 4DRJA 4ML4A 2PBCA 4DZ3A 3ARPA 1XHGA 2DSUA 4ZS6A 4TNSA 4LGXA 3JYJA 3UQBA 3UQAA 4DRPA 4MNMA 2WM0A 1X6NA 2LGOA 3ALGA 3BMBA 4IPXA 3O5PA 2QF8A 1CTNA 1J4HA 1W1VA 1JVWA 4W9QA 2YBTA 3RMEA 4W9OA 2F23A 3O5EA 2MF9A 1FAPA 1H0GA 3WL1A 3KAHA 2ZR5A 4GIVA 1W9UA 1ZL1A 2DSWA 5I98A 2IUZA 2FKEA 4WIWA 2MLXA 1U79A 2RUCA 1ZBWA 4TX0A 5DIUA 1FFRA 1W9PA 3W4RA 3OOBA 4ODNA 1Y0OA 1ZCNA 3UI6A 3O5QA 5JH8A 4WKAA 2XP7A 2PPOA 3CGMA 3KAGA 4U86A 3UI5A 3WIJA 1D7IA 4DWSD 1T11A 5DITA 1W1PA 3WD4A 4LAVA 3OA5A 3CZ8A 4DT4A
chains in the Genus database with same CATH topology
3O5DA 1QPFA 2RUQA 3IHZA 2ESCA 1Q1CA 2XP9A 2B31A 4AY1A 2A3AA 1LL7A 4Z2JA 3ARRA 5HW8A 1ZBCA 3TC5A 1HXVA 3O5JA 1PBKA 1N1AA 1XRVA 1NH6A 1LJYA 4TYOA 3O5FA 3ARUA 1OWQA 3O5IA 4MNLA 2DG3A 1KT1A 5HUAA 1BL4A 3AS1A 5B8IC 3O5OA 3ALFA 1NWRA 2XP5A 2XP8A 4IQCA 2YBUA 2FDMA 1FKTA 3UQIA 3EY6A 4ODQA 3KAIA 2PV3A 4LAWA 1EHNA 3CHEA 5BXJA 3WQWA 1YW5A 3KABA 3RFWA 3VAWA 1FKHA 1IX5A 1ROTA 1YATA 4QT2A 4ZPWR 2DSVA 4BF8A 2XPBA 4MPKA 1HKKA 1HKIA 4TW8A 3KZ7A 1LG1A 1NWTA 3RGCA 4JFJA 4P8XA 4DRIA 2WLZA 2K8IA 2XP6A 4ZPTR 3RM4A 3WD3A 2AOSA 2LJ4A 1X6LA 4NZCA 1D2KA 1FKBA 3NTPA 3KCEA 2ZQVA 2O92A 3FAPA 2D9FA 4HARA 1FJDA 1Q6HA 2RUDA 3IK8A 4G2PA 1OGBA 3CGNA 4L3NA 2KO7A 5DO2A 4WKFA 3CHFA 2DG9A 3WKZA 4DRQA 4DWSB 4HBOA 3ARZA 4URIA 2MNTA 1TFVA 2ITKA 3BXWA 3G6LA 4LAYA 3B9AA 4DRMA 2KFWA 1GUVA 1D6OA 4GGQA 3ODKA 1L1PA 2A3CA 1LQ0A 1E9LA 2KGJA 1ZB5A 1O6IA 4JFKA 3AROA 3ARXA 4DWSC 2UZ5A 1WAWA 1ZU8A 1E15A 3QOKA 1EYMA 1Q6IA 3IKGA 3RM9A 1HJXA 3O5GA 3ARWA 1HJVA 3B8SA 4KQZA 1EIBA 2VCDA 4NNRA 1M5YA 4J4OA 4PTMA 4Q22A 3ARSA 3AS0A 1E6PA 3IKDA 1P5QA 4U84A 4ODRA 4ODPA 4W9PA 2KR7A 5GPRA 1D7JA 1FKRA 4ITZA 3KACA 4ZPVR 5GQBA 5HTGA 5HWCA 5J6EA 4U85A 1ROUA 3CHDA 4LAXA 4R5EA 1F40A 5D75A 3LUOA 4WKHA 1NSGA 3O5LA 2L2SA 4JFMA 4IT4A 1HKJA 3O5KA 1VF8A 3H9RB 3I6CA 3B9EA 4Z2KA 2ZR6A 1J6YA 4JYSA 4MTVA 1FKFA 1SYTA 4S3KA 4IQ2A 3FY1A 1GPFA 1E6NA 3WD2A 3PRAA 2RSEA 1GOIA 1LL6A 3ARVA 1FKSA 1FD9A 4DROA 4C02B 4XAKA 4HBEA 3WQVA 2DPEA 4TW7A 1HJWA 5HBFA 2G8ZA 2PV1A 2DSZA 4DRHA 4JFLA 4S3JA 2ZQTA 4TW6A 1ZBVA 1SR0A 2XP4A 1JNSA 2IF4A 4DIPA 1EQ3A 1LG2A 1FKIA 4W5UA 2F4EA 1EDQA 4MAVA 3ARQA 1OGGA 2LPVA 2JZVA 1FKLA 3KAFA 1QZ2A 2DT0A 2Q5AA 1JNDA 4O2TA 2PI6A 2A3BA 3PA7A 1ZBKA 3PRBA 3JYMA 1JNEA 4MSPA 2MLZA 3CHCA 4J4NA 1E6ZA 4NSBA 3B9DA 1HKMA 2F2DA 2KI3A 4QIBA 3WH0A 3AS2A 1FKDA 3B7XA 4DZ2A 1W1YA 4Z2IA 4Z2GA 1QPLA 3TCZA 2FAPA 5HKGA 4R0XA 3AS3A 3CH9A 1ZK6A 2M2AA 5GPGA 1J4RA 1W9VA 2MLYA 2PPNA 2MPHA 5HW6A 3ARTA 2VN1A 1UR9A 2N87A 1J4IA 1H0IA 1F8AB 1E6RA 1TCOC 2RQSA 2WK2A 2Y78A 1Q6UA 5DEZA 4WJXA 2DT1A 4L72B 1C9HA 3WD1A 2M1IA 3FXYA 5HW7A 2DT3A 1PINA 3AQUA 2WLYA 1FKKA 3JXVA 3NI6A 2LKNA 3KADA 2ZQUA 3RM8A 4QT3A 2M08A 1W1TA 5DIVA 2RURA 3UF8A 4DWSA 3UI4A 2XPAA 5HT1A 3WD0A 3GPKA 1NWUA 4Q7NA 4QZVB 4Z2LA 4MNJA 2ZQSA 4IT6A 3G6MA 2OFNA 4N19A 4Z2HA 1LL4A 1BKFA 1WNOA 1D7HA 4ODLA 1UR8A 4DRKA 2A3EA 2KE0A 3O5MA 4KR0B 2AWGA 2PPPA 3WL0A 4FAPA 1JNTA 2O9OA 1A7XA 4JFIA 1NMWA 4ODMA 1NWSA 4WK9A 4DRNA 1B6CA 4ODKA 4MNKA 1FKGA 4P8UA 4P8WA 4DH0A 1ITXA 4G50A 1FKJA 3O5RA 2XP3A 4ODOA 4MGVA 2PV2A 3TDBA 3PR9A 1NMVA 2DG4A 2ZR4A 1RD6A 1WB0A 3ARYA 1KT0A 2G41A 3PRDA 4P8VA 1R9HA 5HWBA 5DF0A 1K9TA 2F21A 2DT2A 1KFWA 2OLHA 4FN2A 3NRKA 3MDYB 1W26A 1FFQA 4DRJA 4ML4A 2PBCA 4DZ3A 3ARPA 1XHGA 2DSUA 4ZS6A 4TNSA 4LGXA 3JYJA 3UQBA 3UQAA 4DRPA 4MNMA 2WM0A 1X6NA 2LGOA 3ALGA 4IPXA 3O5PA 2QF8A 1CTNA 1J4HA 1W1VA 1JVWA 4W9QA 2YBTA 3RMEA 4W9OA 3O5EA 2MF9A 1FAPA 1H0GA 3WL1A 3KAHA 2ZR5A 4GIVA 1W9UA 1ZL1A 2DSWA 5I98A 2IUZA 2FKEA 4WIWA 2MLXA 1U79A 2RUCA 1ZBWA 4TX0A 5DIUA 1FFRA 1W9PA 3W4RA 3OOBA 4ODNA 1Y0OA 1ZCNA 3UI6A 3O5QA 5JH8A 4WKAA 2XP7A 2PPOA 3CGMA 3KAGA 4U86A 3UI5A 3WIJA 1D7IA 4DWSD 1T11A 5DITA 1W1PA 3WD4A 4LAVA 3OA5A 3CZ8A 4DT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNT A;  3O5D A;  1FKL A;  1A7X A;  1QPF A;  2RUQ A;  4JFK A;  4JFI A;  1NMW A;  4ODM A;  3KAF A;  4DRN A;  2UZ5 A;  1B6C A;  4ODK A;  1QZ2 A;  3IHZ A;  1FKG A;  1Q1C A;  4DH0 A;  2XP9 A;  4G50 A;  1FKJ A;  2Q5A A;  1EYM A;  1Q6I A;  3IKG A;  4O2T A;  3PA7 A;  3O5R A;  2XP3 A;  3PRB A;  3JYM A;  2PV2 A;  4MGV A;  4ODO A;  3TDB A;  1NMV A;  2DG4 A;  2MLZ A;  2ZR4 A;  3O5G A;  3O5J A;  4MSP A;  3TC5 A;  1PBK A;  5HW8 A;  4J4N A;  1N1A A;  1KT0 A;  4TYO A;  4NNR A;  3O5F A;  1M5Y A;  2F2D A;  3PRD A;  4J4O A;  2KI3 A;  1R9H A;  4QIB A;  3IKD A;  3O5I A;  5HWB A;  3WH0 A;  2DG3 A;  1P5Q A;  2F21 A;  4U84 A;  1KT1 A;  4ODR A;  1FKD A;  4ODP A;  4FN2 A;  3B7X A;  1BL4 A;  2KR7 A;  3NRK A;  4W9P A;  1D7J A;  4DZ2 A;  1FKR A;  3MDY B;  1W26 A;  5B8I C;  3O5O A;  4ITZ A;  3KAC A;  1QPL A;  3TCZ A;  2XP5 A;  2FAP A;  2PBC A;  4DRJ A;  4R0X A;  2XP8 A;  4IQC A;  4DZ3 A;  5HKG A;  5HUA A;  5HTG A;  5HWC A;  4TNS A;  5J6E A;  1FKT A;  4U85 A;  3UQI A;  1ROU A;  1ZK6 A;  3JYJ A;  4LAX A;  1F40 A;  2M2A A;  3EY6 A;  3KAI A;  4ODQ A;  5D75 A;  1J4R A;  2PPN A;  2MLY A;  3LUO A;  5GPG A;  2MPH A;  5HW6 A;  1NSG A;  4DRP A;  2PV3 A;  4LAW A;  3UQA A;  3UQB A;  2VN1 A;  3O5L A;  2L2S A;  4JFM A;  5BXJ A;  2N87 A;  1J4I A;  1YW5 A;  3KAB A;  1F8A B;  3RFW A;  3VAW A;  1FKH A;  1TCO C;  2LGO A;  2RQS A;  1ROT A;  3O5K A;  1YAT A;  2Y78 A;  4IPX A;  3O5P A;  4QT2 A;  3H9R B;  3I6C A;  1J4H A;  1Q6U A;  2ZR6 A;  1JVW A;  1J6Y A;  4JYS A;  4W9Q A;  1C9H A;  2M1I A;  1FKF A;  2JZV A;  4BF8 A;  5HW7 A;  2XPB A;  4W9O A;  3O5E A;  2MF9 A;  1PIN A;  4TW8 A;  4IQ2 A;  1FAP A;  3KZ7 A;  3RGC A;  4JFJ A;  4DRI A;  2K8I A;  2XP6 A;  3KAH A;  1FKK A;  3JXV A;  2LJ4 A;  2ZR5 A;  2RSE A;  1FKB A;  3NI6 A;  3NTP A;  2LKN A;  4GIV A;  3KAD A;  3KCE A;  1FKS A;  1FD9 A;  2ZQU A;  2ZQV A;  4QT3 A;  5I98 A;  4DRO A;  2M08 A;  4C02 B;  3FAP A;  2D9F A;  5DIV A;  1FJD A;  1Q6H A;  2RUR A;  2FKE A;  2RUD A;  2MLX A;  3IK8 A;  3UF8 A;  4G2P A;  3UI4 A;  2XPA A;  3CGN A;  2KO7 A;  5HT1 A;  4TW7 A;  1U79 A;  3GPK A;  2RUC A;  4TX0 A;  2DG9 A;  5DIU A;  2PV1 A;  4DRH A;  4DRQ A;  4JFL A;  2ZQS A;  2MNT A;  2ITK A;  3OOB A;  4ODN A;  1Y0O A;  2OFN A;  2ZQT A;  1ZCN A;  4N19 A;  4TW6 A;  3UI6 A;  3O5Q A;  2XP4 A;  4LAY A;  1JNS A;  2XP7 A;  2PPO A;  2IF4 A;  4DRM A;  4DIP A;  1EQ3 A;  2KFW A;  1BKF A;  3CGM A;  3KAG A;  4U86 A;  1FKI A;  1D7I A;  3UI5 A;  1D7H A;  4ODL A;  1HXV A;  4DRK A;  1D6O A;  1T11 A;  2F4E A;  4GGQ A;  5DIT A;  2KE0 A;  3ODK A;  3O5M A;  1L1P A;  2AWG A;  2LPV A;  2PPP A;  4LAV A;  2VCD A;  4FAP A;  4DT4 A;  2KGJ A; 
#chains in the Genus database with same CATH topology
 3O5D A;  1QPF A;  2RUQ A;  3IHZ A;  2ESC A;  1Q1C A;  2XP9 A;  2B31 A;  4AY1 A;  2A3A A;  1LL7 A;  4Z2J A;  3ARR A;  5HW8 A;  1ZBC A;  3TC5 A;  1HXV A;  3O5J A;  1PBK A;  1N1A A;  1XRV A;  1NH6 A;  1LJY A;  4TYO A;  3O5F A;  3ARU A;  1OWQ A;  3O5I A;  4MNL A;  2DG3 A;  1KT1 A;  5HUA A;  1BL4 A;  3AS1 A;  5B8I C;  3O5O A;  3ALF A;  1NWR A;  2XP5 A;  3GTY X;  2XP8 A;  4IQC A;  2YBU A;  2FDM A;  1FKT A;  3UQI A;  3EY6 A;  4ODQ A;  3KAI A;  2PV3 A;  4LAW A;  1EHN A;  3CHE A;  5BXJ A;  3WQW A;  1YW5 A;  3KAB A;  3RFW A;  3VAW A;  1FKH A;  1IX5 A;  1ROT A;  1YAT A;  4QT2 A;  4ZPW R;  2DSV A;  4BF8 A;  2XPB A;  4MPK A;  1HKK A;  1HKI A;  4TW8 A;  3KZ7 A;  1LG1 A;  1NWT A;  3RGC A;  4JFJ A;  4P8X A;  4DRI A;  2WLZ A;  2K8I A;  2XP6 A;  4ZPT R;  3RM4 A;  3WD3 A;  2AOS A;  2LJ4 A;  1X6L A;  4NZC A;  1D2K A;  1FKB A;  3NTP A;  3KCE A;  2ZQV A;  2O92 A;  3FAP A;  2D9F A;  4HAR A;  1FJD A;  1Q6H A;  2RUD A;  3IK8 A;  4G2P A;  1OGB A;  3CGN A;  4L3N A;  2KO7 A;  5DO2 A;  4WKF A;  3CHF A;  2DG9 A;  3WKZ A;  4DRQ A;  4DWS B;  4HBO A;  3ARZ A;  4URI A;  2MNT A;  1TFV A;  2ITK A;  3BXW A;  3G6L A;  4LAY A;  3B9A A;  2P4V A;  4DRM A;  2KFW A;  1GUV A;  1D6O A;  4GGQ A;  3ODK A;  1L1P A;  2A3C A;  1LQ0 A;  1E9L A;  2KGJ A;  1ZB5 A;  1O6I A;  4JFK A;  3ARO A;  3ARX A;  4DWS C;  2UZ5 A;  1WAW A;  1ZU8 A;  1E15 A;  1GRJ A;  3QOK A;  1EYM A;  1Q6I A;  3IKG A;  3RM9 A;  1HJX A;  3O5G A;  3ARW A;  1HJV A;  3B8S A;  4KQZ A;  1EIB A;  2VCD A;  4NNR A;  1M5Y A;  4J4O A;  4PTM A;  4Q22 A;  3ARS A;  3AS0 A;  1E6P A;  3IKD A;  1P5Q A;  4U84 A;  4ODR A;  4ODP A;  4W9P A;  2KR7 A;  5GPR A;  1D7J A;  1FKR A;  4ITZ A;  3KAC A;  4ZPV R;  5GQB A;  5HTG A;  5HWC A;  5J6E A;  4U85 A;  1ROU A;  3CHD A;  4LAX A;  4R5E A;  1F40 A;  5D75 A;  3LUO A;  4WKH A;  1NSG A;  3O5L A;  2L2S A;  4JFM A;  4IT4 A;  1HKJ A;  3O5K A;  1VF8 A;  2B5U B;  3H9R B;  3I6C A;  3B9E A;  4Z2K A;  2ZR6 A;  1J6Y A;  4JYS A;  4MTV A;  1FKF A;  1SYT A;  2PN0 A;  1E44 A;  4S3K A;  3EIP A;  4IQ2 A;  3FY1 A;  1GPF A;  1E6N A;  3WD2 A;  3PRA A;  2RSE A;  1GOI A;  1LL6 A;  3ARV A;  1FKS A;  1FD9 A;  4DRO A;  4C02 B;  4XAK A;  4HBE A;  3WQV A;  2DPE A;  4TW7 A;  1HJW A;  5HBF A;  2G8Z A;  2PV1 A;  2DSZ A;  4DRH A;  4JFL A;  4S3J A;  2ZQT A;  4TW6 A;  1ZBV A;  1SR0 A;  2XP4 A;  1JNS A;  2IF4 A;  4DIP A;  1EQ3 A;  1LG2 A;  1FKI A;  4W5U A;  2F4E A;  1EDQ A;  4MAV A;  3ARQ A;  1OGG A;  2LPV A;  2JZV A;  1FKL A;  3KAF A;  1QZ2 A;  2DT0 A;  2Q5A A;  1JND A;  4O2T A;  2EUL A;  2PI6 A;  2A3B A;  3PA7 A;  1ZBK A;  3PRB A;  3JYM A;  1JNE A;  4MSP A;  2MLZ A;  3CHC A;  4J4N A;  1E6Z A;  4NSB A;  3B9D A;  1HKM A;  2F2D A;  2KI3 A;  4QIB A;  3WH0 A;  3AS2 A;  4UDM A;  1FKD A;  3B7X A;  4DZ2 A;  1W1Y A;  4Z2I A;  4Z2G A;  1QPL A;  3TCZ A;  2FAP A;  5HKG A;  4R0X A;  3AS3 A;  3CH9 A;  1ZK6 A;  2M2A A;  5GPG A;  1J4R A;  1W9V A;  2MLY A;  2PPN A;  2MPH A;  5HW6 A;  3ART A;  2VN1 A;  1UR9 A;  2N87 A;  1J4I A;  1H0I A;  1F8A B;  1E6R A;  1TCO C;  2RQS A;  2WK2 A;  2Y78 A;  1Q6U A;  5DEZ A;  4WJX A;  2DT1 A;  4L72 B;  1C9H A;  3WD1 A;  2M1I A;  3FXY A;  5HW7 A;  1JCH B;  2DT3 A;  1PIN A;  3AQU A;  2WLY A;  1FKK A;  3JXV A;  3NI6 A;  2LKN A;  3KAD A;  2ZQU A;  3RM8 A;  4QT3 A;  2M08 A;  1W1T A;  5DIV A;  2RUR A;  3UF8 A;  4DWS A;  3UI4 A;  2XPA A;  5HT1 A;  3WD0 A;  3GPK A;  1NWU A;  4Q7N A;  4QZV B;  4Z2L A;  4MNJ A;  2ZQS A;  4IT6 A;  3G6M A;  2OFN A;  4N19 A;  4Z2H A;  1LL4 A;  1BKF A;  1WNO A;  1D7H A;  4ODL A;  1UR8 A;  4DRK A;  2A3E A;  2KE0 A;  3O5M A;  4KR0 B;  2AWG A;  2PPP A;  3WL0 A;  4FAP A;  2ETN A;  1JNT A;  2O9O A;  1A7X A;  4JFI A;  1NMW A;  3GU0 A;  4ODM A;  1NWS A;  4WK9 A;  4DRN A;  1B6C A;  4ODK A;  4MNK A;  1FKG A;  4P8U A;  4P8W A;  4DH0 A;  1ITX A;  4G50 A;  1FKJ A;  3O5R A;  2XP3 A;  4ODO A;  4MGV A;  2PV2 A;  3TDB A;  3PR9 A;  1NMV A;  2DG4 A;  2ZR4 A;  1RD6 A;  1WB0 A;  3ARY A;  1KT0 A;  2G41 A;  3PRD A;  4P8V A;  1R9H A;  5HWB A;  5DF0 A;  1K9T A;  2F21 A;  2DT2 A;  1KFW A;  2OLH A;  4FN2 A;  3NRK A;  3MDY B;  1W26 A;  1FFQ A;  4DRJ A;  4ML4 A;  2PBC A;  4DZ3 A;  3ARP A;  1XHG A;  2DSU A;  4ZS6 A;  4TNS A;  4LGX A;  3JYJ A;  3UQB A;  3UQA A;  4DRP A;  4MNM A;  2WM0 A;  1X6N A;  2LGO A;  3ALG A;  3BMB A;  4IPX A;  3O5P A;  2QF8 A;  1CTN A;  1J4H A;  1W1V A;  1JVW A;  4W9Q A;  2YBT A;  3RME A;  4W9O A;  2F23 A;  3O5E A;  2MF9 A;  1FAP A;  1H0G A;  3WL1 A;  3KAH A;  2ZR5 A;  4GIV A;  1W9U A;  1ZL1 A;  2DSW A;  5I98 A;  2IUZ A;  2FKE A;  4WIW A;  2MLX A;  1U79 A;  2RUC A;  1ZBW A;  4TX0 A;  5DIU A;  1FFR A;  1W9P A;  3W4R A;  3OOB A;  4ODN A;  1Y0O A;  1ZCN A;  3UI6 A;  3O5Q A;  5JH8 A;  4WKA A;  2XP7 A;  2PPO A;  3CGM A;  3KAG A;  4U86 A;  3UI5 A;  3WIJ A;  1D7I A;  4DWS D;  1T11 A;  5DIT A;  1W1P A;  3WD4 A;  4LAV A;  3OA5 A;  3CZ8 A;  4DT4 A; 
#chains in the Genus database with same CATH homology
 3O5D A;  1QPF A;  2RUQ A;  3IHZ A;  2ESC A;  1Q1C A;  2XP9 A;  2B31 A;  4AY1 A;  2A3A A;  1LL7 A;  4Z2J A;  3ARR A;  5HW8 A;  1ZBC A;  3TC5 A;  1HXV A;  3O5J A;  1PBK A;  1N1A A;  1XRV A;  1NH6 A;  1LJY A;  4TYO A;  3O5F A;  3ARU A;  1OWQ A;  3O5I A;  4MNL A;  2DG3 A;  1KT1 A;  5HUA A;  1BL4 A;  3AS1 A;  5B8I C;  3O5O A;  3ALF A;  1NWR A;  2XP5 A;  2XP8 A;  4IQC A;  2YBU A;  2FDM A;  1FKT A;  3UQI A;  3EY6 A;  4ODQ A;  3KAI A;  2PV3 A;  4LAW A;  1EHN A;  3CHE A;  5BXJ A;  3WQW A;  1YW5 A;  3KAB A;  3RFW A;  3VAW A;  1FKH A;  1IX5 A;  1ROT A;  1YAT A;  4QT2 A;  4ZPW R;  2DSV A;  4BF8 A;  2XPB A;  4MPK A;  1HKK A;  1HKI A;  4TW8 A;  3KZ7 A;  1LG1 A;  1NWT A;  3RGC A;  4JFJ A;  4P8X A;  4DRI A;  2WLZ A;  2K8I A;  2XP6 A;  4ZPT R;  3RM4 A;  3WD3 A;  2AOS A;  2LJ4 A;  1X6L A;  4NZC A;  1D2K A;  1FKB A;  3NTP A;  3KCE A;  2ZQV A;  2O92 A;  3FAP A;  2D9F A;  4HAR A;  1FJD A;  1Q6H A;  2RUD A;  3IK8 A;  4G2P A;  1OGB A;  3CGN A;  4L3N A;  2KO7 A;  5DO2 A;  4WKF A;  3CHF A;  2DG9 A;  3WKZ A;  4DRQ A;  4DWS B;  4HBO A;  3ARZ A;  4URI A;  2MNT A;  1TFV A;  2ITK A;  3BXW A;  3G6L A;  4LAY A;  3B9A A;  4DRM A;  2KFW A;  1GUV A;  1D6O A;  4GGQ A;  3ODK A;  1L1P A;  2A3C A;  1LQ0 A;  1E9L A;  2KGJ A;  1ZB5 A;  1O6I A;  4JFK A;  3ARO A;  3ARX A;  4DWS C;  2UZ5 A;  1WAW A;  1ZU8 A;  1E15 A;  3QOK A;  1EYM A;  1Q6I A;  3IKG A;  3RM9 A;  1HJX A;  3O5G A;  3ARW A;  1HJV A;  3B8S A;  4KQZ A;  1EIB A;  2VCD A;  4NNR A;  1M5Y A;  4J4O A;  4PTM A;  4Q22 A;  3ARS A;  3AS0 A;  1E6P A;  3IKD A;  1P5Q A;  4U84 A;  4ODR A;  4ODP A;  4W9P A;  2KR7 A;  5GPR A;  1D7J A;  1FKR A;  4ITZ A;  3KAC A;  4ZPV R;  5GQB A;  5HTG A;  5HWC A;  5J6E A;  4U85 A;  1ROU A;  3CHD A;  4LAX A;  4R5E A;  1F40 A;  5D75 A;  3LUO A;  4WKH A;  1NSG A;  3O5L A;  2L2S A;  4JFM A;  4IT4 A;  1HKJ A;  3O5K A;  1VF8 A;  3H9R B;  3I6C A;  3B9E A;  4Z2K A;  2ZR6 A;  1J6Y A;  4JYS A;  4MTV A;  1FKF A;  1SYT A;  4S3K A;  4IQ2 A;  3FY1 A;  1GPF A;  1E6N A;  3WD2 A;  3PRA A;  2RSE A;  1GOI A;  1LL6 A;  3ARV A;  1FKS A;  1FD9 A;  4DRO A;  4C02 B;  4XAK A;  4HBE A;  3WQV A;  2DPE A;  4TW7 A;  1HJW A;  5HBF A;  2G8Z A;  2PV1 A;  2DSZ A;  4DRH A;  4JFL A;  4S3J A;  2ZQT A;  4TW6 A;  1ZBV A;  1SR0 A;  2XP4 A;  1JNS A;  2IF4 A;  4DIP A;  1EQ3 A;  1LG2 A;  1FKI A;  4W5U A;  2F4E A;  1EDQ A;  4MAV A;  3ARQ A;  1OGG A;  2LPV A;  2JZV A;  1FKL A;  3KAF A;  1QZ2 A;  2DT0 A;  2Q5A A;  1JND A;  4O2T A;  2PI6 A;  2A3B A;  3PA7 A;  1ZBK A;  3PRB A;  3JYM A;  1JNE A;  4MSP A;  2MLZ A;  3CHC A;  4J4N A;  1E6Z A;  4NSB A;  3B9D A;  1HKM A;  2F2D A;  2KI3 A;  4QIB A;  3WH0 A;  3AS2 A;  1FKD A;  3B7X A;  4DZ2 A;  1W1Y A;  4Z2I A;  4Z2G A;  1QPL A;  3TCZ A;  2FAP A;  5HKG A;  4R0X A;  3AS3 A;  3CH9 A;  1ZK6 A;  2M2A A;  5GPG A;  1J4R A;  1W9V A;  2MLY A;  2PPN A;  2MPH A;  5HW6 A;  3ART A;  2VN1 A;  1UR9 A;  2N87 A;  1J4I A;  1H0I A;  1F8A B;  1E6R A;  1TCO C;  2RQS A;  2WK2 A;  2Y78 A;  1Q6U A;  5DEZ A;  4WJX A;  2DT1 A;  4L72 B;  1C9H A;  3WD1 A;  2M1I A;  3FXY A;  5HW7 A;  2DT3 A;  1PIN A;  3AQU A;  2WLY A;  1FKK A;  3JXV A;  3NI6 A;  2LKN A;  3KAD A;  2ZQU A;  3RM8 A;  4QT3 A;  2M08 A;  1W1T A;  5DIV A;  2RUR A;  3UF8 A;  4DWS A;  3UI4 A;  2XPA A;  5HT1 A;  3WD0 A;  3GPK A;  1NWU A;  4Q7N A;  4QZV B;  4Z2L A;  4MNJ A;  2ZQS A;  4IT6 A;  3G6M A;  2OFN A;  4N19 A;  4Z2H A;  1LL4 A;  1BKF A;  1WNO A;  1D7H A;  4ODL A;  1UR8 A;  4DRK A;  2A3E A;  2KE0 A;  3O5M A;  4KR0 B;  2AWG A;  2PPP A;  3WL0 A;  4FAP A;  1JNT A;  2O9O A;  1A7X A;  4JFI A;  1NMW A;  4ODM A;  1NWS A;  4WK9 A;  4DRN A;  1B6C A;  4ODK A;  4MNK A;  1FKG A;  4P8U A;  4P8W A;  4DH0 A;  1ITX A;  4G50 A;  1FKJ A;  3O5R A;  2XP3 A;  4ODO A;  4MGV A;  2PV2 A;  3TDB A;  3PR9 A;  1NMV A;  2DG4 A;  2ZR4 A;  1RD6 A;  1WB0 A;  3ARY A;  1KT0 A;  2G41 A;  3PRD A;  4P8V A;  1R9H A;  5HWB A;  5DF0 A;  1K9T A;  2F21 A;  2DT2 A;  1KFW A;  2OLH A;  4FN2 A;  3NRK A;  3MDY B;  1W26 A;  1FFQ A;  4DRJ A;  4ML4 A;  2PBC A;  4DZ3 A;  3ARP A;  1XHG A;  2DSU A;  4ZS6 A;  4TNS A;  4LGX A;  3JYJ A;  3UQB A;  3UQA A;  4DRP A;  4MNM A;  2WM0 A;  1X6N A;  2LGO A;  3ALG A;  4IPX A;  3O5P A;  2QF8 A;  1CTN A;  1J4H A;  1W1V A;  1JVW A;  4W9Q A;  2YBT A;  3RME A;  4W9O A;  3O5E A;  2MF9 A;  1FAP A;  1H0G A;  3WL1 A;  3KAH A;  2ZR5 A;  4GIV A;  1W9U A;  1ZL1 A;  2DSW A;  5I98 A;  2IUZ A;  2FKE A;  4WIW A;  2MLX A;  1U79 A;  2RUC A;  1ZBW A;  4TX0 A;  5DIU A;  1FFR A;  1W9P A;  3W4R A;  3OOB A;  4ODN A;  1Y0O A;  1ZCN A;  3UI6 A;  3O5Q A;  5JH8 A;  4WKA A;  2XP7 A;  2PPO A;  3CGM A;  3KAG A;  4U86 A;  3UI5 A;  3WIJ A;  1D7I A;  4DWS D;  1T11 A;  5DIT A;  1W1P A;  3WD4 A;  4LAV A;  3OA5 A;  3CZ8 A;  4DT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...