2RURA

Solution structure of human pin1 ppiase c113s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
GSHMEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Allosteric Breakage of the Hydrogen Bond within the Dual-Histidine Motif in the Active Site of Human Pin1 PPIase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 117
sequence length 117
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2rurA00
2FAPA 1FD9A 5DIVA 3O5MA 4U84A 1L1PA 3IKGA 3O5LA 2VN1A 2XP8A 3NRKA 3ODKA 1T11A 3O5IA 2MF9A 2MLZA 3EY6A 2PV1A 1Q6HA 3KADA 3O5JA 4J4NA 4ODRA 3RGCA 3UI5A 4W9QA 2MPHA 1M5YA 3I6CA 4QT3A 2XP7A 4NNRA 1FKIA 4ODLA 2LJ4A 2ZR5A 1YW5A 2KGJA 1FKTA 2M2AA 2F21A 3TDBA 5HW7A 3O5QA 5HWCA 3UI4A 3IKDA 3PRDA 5HWBA 1HXVA 1J4HA 3FAPA 5HKGA 1TCOC 4JFMA 5DIUA 2OFNA 4G2PA 1NMWA 5HUAA 5B8IC 1YATA 4DRQA 4ODMA 4C02B 2RUQA 2ZQUA 1FKDA 1NSGA 3UI6A 2MLXA 4TX0A 4TW7A 4R0XA 4BF8A 4DH0A 1F40A 1BKFA 2LPVA 4U86A 2LGOA 3GPKA 3H9RB 1D7JA 2N87A 1JNTA 3IK8A 2MNTA 1W26A 1FKBA 5I98A 3KCEA 3O5OA 3CGNA 2MLYA 3KAIA 1ROUA 2F2DA 2DG3A 4TW6A 2ZQTA 5DITA 4IQCA 1Q6UA 4QT2A 3TC5A 5HTGA 1FKFA 2AWGA 1FKHA 4JFLA 4DRJA 4TNSA 1F8AB 1PINA 4ITZA 4DT4A 1B6CA 3JXVA 1D7HA 4TYOA 4DIPA 4DRIA 3O5GA 2LKNA 1QPFA 3KZ7A 3MDYB 3UQBA 2XPBA 3O5KA 1FKKA 2VCDA 3PRBA 1Q1CA 4JFJA 2KI3A 4LAYA 2IF4A 1FKLA 4DROA 3WH0A 1C9HA 2XP4A 4ODKA 1ROTA 4DRMA 4J4OA 1PBKA 3JYJA 4IPXA 3NTPA 1U79A 1FAPA 2PV2A 3NI6A 3VAWA 3O5EA 2K8IA 2F4EA 1N1AA 1R9HA 2PPNA 2ITKA 3O5DA 1FKRA 4ODPA 4DRNA 2M08A 3CGMA 3UQAA 2ZR4A 2ZQSA 1J4IA 3KACA 1Q6IA 4DRKA 3TCZA 3O5RA 3O5PA 1KT0A 3OOBA 1D6OA 4W9OA 1J6YA 4ODQA 1QZ2A 1D7IA 2RSEA 4ODNA 4FAPA 1J4RA 4DRPA 1FKSA 3UQIA 2FKEA 2UZ5A 2KR7A 1EQ3A 2ZR6A 2D9FA 2RURA 4N19A 3KABA 3PA7A 5J6EA 1FKGA 3IHZA 4LAXA 1QPLA 1EYMA 1Y0OA 4G50A 4O2TA 1ZCNA 3KAHA 3KAGA 4JFKA 4DZ3A 4LAVA 2L2SA 2Y78A 5BXJA 2KE0A 1JNSA 2PV3A 5D75A 1FJDA 5HW6A 4QIBA 2DG9A 2ZQVA 4U85A 3KAFA 1FKJA 1P5QA 1KT1A 2M1IA 4GIVA 4W9PA 5GPGA 5HT1A 2RUCA 1ZK6A 4FN2A 2XPAA 4DZ2A 1NMVA 2KO7A 3UF8A 1JVWA 3O5FA 3RFWA 4JYSA 2KFWA 4JFIA 2DG4A 5HW8A 2XP9A 4ODOA 2XP5A 2PPPA 2Q5AA 2PBCA 2RUDA 1BL4A 3LUOA 4TW8A 4DRHA 4MSPA 4LAWA 4MGVA 4GGQA 2XP6A 2PPOA 4IQ2A 2JZVA 2XP3A 3JYMA 3B7XA 1A7XA 2RQSA
chains in the Genus database with same CATH superfamily
4ML4A 1W1PA 3AQUA 4DWSA 4U84A 1JNDA 1XRVA 1LL7A 3EY6A 1Q6HA 3KADA 4ODRA 3RGCA 1W9PA 3I6CA 3AS1A 2XP7A 2ZR5A 2KGJA 3WD4A 3O5QA 3WIJA 3PRDA 2EULA 1TCOC 4WK9A 1NMWA 5HUAA 4DRQA 2ZQUA 4UDMA 1HJXA 4R0XA 1ZBWA 4U86A 4L72B 3GPKA 4AY1A 2N87A 1EHNA 3CH9A 2MLYA 2ZQTA 1ZB5A 5DEZA 4DRJA 1F8AB 1LL6A 1B6CA 1D7HA 4Z2LA 1GOIA 4NSBA 4QZVB 3MDYB 3CHDA 2VCDA 2WK2A 2O92A 1HJWA 1GRJA 2XP4A 4PTMA 1W1VA 4Z2JA 4J4OA 4URIA 3NTPA 1FAPA 2PV2A 2DSWA 3B9DA 2PPNA 2DSZA 3AS0A 4P8VA 2ZQSA 4WJXA 3OOBA 1KT0A 1CTNA 4MNKA 1ZBCA 4W9OA 2RSEA 1ZL1A 3WD2A 4DRPA 2UZ5A 1NH6A 2KR7A 1EQ3A 2A3BA 2D9FA 3CZ8A 1FKGA 1TFVA 1Y0OA 3KAHA 3KAGA 5D75A 1FJDA 3CHEA 3KAFA 4W9PA 3W4RA 5HBFA 4FN2A 1ITXA 1FFQA 1KFWA 3AS2A 4NZCA 1NMVA 3QOKA 1HKJA 1W1YA 2KFWA 4JFIA 3WL1A 2YBTA 2XP9A 2PPPA 4DRHA 4MSPA 4LAWA 3ALFA 2XP6A 2JZVA 3AS3A 4MGVA 1FD9A 1HJVA 1L1PA 3IKGA 2XP8A 3NRKA 3ODKA 1T11A 3BXWA 1GUVA 2MPHA 1M5YA 1E6ZA 3ARUA 1OWQA 1WAWA 1FKIA 2LJ4A 2FDMA 3WD0A 5HW7A 4R5EA 3UI4A 1HXVA 5HWBA 5DIUA 3ARWA 2PN0A 5B8IC 1YATA 3ARXA 4C02B 1NSGA 1GPFA 3UI6A 1SYTA 4TW7A 4DH0A 1W9VA 2LPVA 1LG1A 3H9RB 1E6NA 1W26A 1FKBA 2DSVA 5I98A 3OA5A 4DWSC 4HARA 2F2DA 5HTGA 3TC5A 4HBOA 1Q6UA 4KR0B 1FKFA 1FKHA 1NWUA 1PINA 4TNSA 1UR9A 3JXVA 4WKAA 1IX5A 4DRIA 4MPKA 2LKNA 1QPFA 3O5KA 1FKKA 2WLZA 4LAYA 2KI3A 1FKLA 5GQBA 1ROTA 4Z2HA 2DT0A 1PBKA 1WNOA 3JYJA 1WB0A 3NI6A 3ARRA 1N1AA 5DO2A 4S3KA 1LL4A 4DRKA 3CHCA 1E6PA 4KQZA 4Z2GA 1D7IA 4FAPA 4DWSD 2RURA 3KABA 5J6EA 1LJYA 4MNJA 4LAXA 2Y78A 1JNSA 2PV3A 4QIBA 2DG9A 4U85A 1P5QA 3WQVA 3RM8A 2RUCA 1O6IA 3UF8A 1JVWA 1E6RA 3RFWA 4JYSA 4MAVA 3ARZA 4DZ2A 2PBCA 4GGQA 1HKIA 4ZPWR 2B5UB 2G41A 3RMEA 1JCHB 2PV1A 3UI5A 3AROA 1NWRA 4QT3A 3WD1A 4ODLA 4W5UA 1YW5A 1FKTA 2F21A 3TDBA 3IKDA 3GU0A 1J4HA 3FAPA 4MNLA 4JFMA 4G2PA 4HBEA 4ODMA 2O9OA 3G6LA 2MLXA 1F40A 1BKFA 1D7JA 1JNTA 2MNTA 1OGGA 3KCEA 1NWTA 1LG2A 2PI6A 4Z2IA 4ZS6A 1ROUA 5DITA 2DG3A 4DT4A 4QT2A 2P4VA 2WM0A 4XAKA 3ARYA 4DIPA 3O5GA 1ZBKA 3KZ7A 3UQBA 4P8WA 3PRBA 5DF0A 1Q1CA 2IF4A 3WH0A 1C9HA 1HKKA 2QF8A 3VAWA 3O5EA 3B9AA 1ZBVA 2ITKA 3O5DA 1FKRA 4ODPA 2B31A 3PR9A 2M08A 3UQAA 1J4IA 3KACA 3TCZA 1H0IA 4P8XA 5JH8A 4Q22A 4ODQA 1W9UA 4ODNA 3UQIA 5GPRA 1H0GA 2ZR6A 4N19A 1RD6A 3BMBA 4P8UA 3IHZA 4L3NA 1HKMA 1QPLA 4G50A 4DZ3A 2A3AA 5BXJA 3B8SA 1FKJA 2M1IA 3ARQA 4ZPVR 3PRAA 2DT3A 2KO7A 2F23A 3WQWA 4IT4A 2DG4A 2A3EA 2XP5A 2RUDA 1BL4A 2DT1A 4IQ2A 2G8ZA 2A3CA 3JYMA 2RQSA 2FAPA 5DIVA 3O5MA 2DT2A 3O5LA 4WKFA 2VN1A 3O5IA 2IUZA 2MF9A 2MLZA 3O5JA 4J4NA 4W9QA 2DPEA 4Q7NA 4NNRA 1D2KA 2M2AA 2AOSA 5HWCA 1X6LA 3CHFA 5HKGA 4LGXA 2YBUA 1SR0A 2OFNA 1ZU8A 2RUQA 1FKDA 1UR8A 4TX0A 4BF8A 2ESCA 2LGOA 3WL0A 3ALGA 3IK8A 3WKZA 3O5OA 3CGNA 3KAIA 1E15A 3FY1A 4TW6A 4IQCA 2AWGA 4JFLA 3RM9A 4ITZA 4MTVA 4S3JA 3ARTA 1E44A 4MNMA 4TYOA 2XPBA 4WKHA 4JFJA 3GTYX 4DROA 4ODKA 4DRMA 2OLHA 4IPXA 1LQ0A 1U79A 3EIPA 1EIBA 1EDQA 2K8IA 3WD3A 2F4EA 1R9HA 4DRNA 1FFRA 3CGMA 2ZR4A 4Z2KA 1K9TA 1Q6IA 4DWSB 3O5RA 1JNEA 3O5PA 3ARVA 1D6OA 1J6YA 1QZ2A 1J4RA 1FKSA 1OGBA 2FKEA 3G6MA 3FXYA 3PA7A 2WLYA 1EYMA 4IT6A 4O2TA 1ZCNA 2DSUA 4JFKA 1XHGA 4ZPTR 4LAVA 2L2SA 3B9EA 3ARSA 3RM4A 2KE0A 3ARPA 1W1TA 5HW6A 2ZQVA 4GIVA 5GPGA 1KT1A 5HT1A 1ZK6A 2XPAA 2ETNA 3O5FA 1X6NA 5HW8A 4ODOA 4WIWA 2Q5AA 3LUOA 4TW8A 2PPOA 1E9LA 2XP3A 1VF8A 3B7XA 1A7XA 1NWSA
chains in the Genus database with same CATH topology
4ML4A 1W1PA 3AQUA 4DWSA 4U84A 1JNDA 1XRVA 1LL7A 3EY6A 1Q6HA 3KADA 4ODRA 3RGCA 1W9PA 3I6CA 3AS1A 2XP7A 2ZR5A 2KGJA 3WD4A 3O5QA 3WIJA 3PRDA 1TCOC 4WK9A 1NMWA 5HUAA 4DRQA 2ZQUA 1HJXA 4R0XA 1ZBWA 4U86A 4L72B 3GPKA 4AY1A 2N87A 1EHNA 3CH9A 2MLYA 2ZQTA 1ZB5A 5DEZA 4DRJA 1F8AB 1LL6A 1B6CA 1D7HA 4Z2LA 1GOIA 4NSBA 4QZVB 3MDYB 3CHDA 2VCDA 2WK2A 2O92A 1HJWA 2XP4A 4PTMA 1W1VA 4Z2JA 4J4OA 4URIA 3NTPA 1FAPA 2PV2A 2DSWA 3B9DA 2PPNA 2DSZA 3AS0A 4P8VA 2ZQSA 4WJXA 3OOBA 1KT0A 1CTNA 4MNKA 1ZBCA 4W9OA 2RSEA 1ZL1A 3WD2A 4DRPA 2UZ5A 1NH6A 2KR7A 1EQ3A 2A3BA 2D9FA 3CZ8A 1FKGA 1TFVA 1Y0OA 3KAHA 3KAGA 5D75A 1FJDA 3CHEA 3KAFA 4W9PA 3W4RA 5HBFA 4FN2A 1ITXA 1FFQA 1KFWA 3AS2A 4NZCA 1NMVA 3QOKA 1HKJA 1W1YA 2KFWA 4JFIA 3WL1A 2YBTA 2XP9A 2PPPA 4DRHA 4MSPA 4LAWA 3ALFA 2XP6A 2JZVA 3AS3A 4MGVA 1FD9A 1HJVA 1L1PA 3IKGA 2XP8A 3NRKA 3ODKA 1T11A 3BXWA 1GUVA 2MPHA 1M5YA 1E6ZA 3ARUA 1OWQA 1WAWA 1FKIA 2LJ4A 2FDMA 3WD0A 5HW7A 4R5EA 3UI4A 1HXVA 5HWBA 5DIUA 3ARWA 5B8IC 1YATA 3ARXA 4C02B 1NSGA 1GPFA 3UI6A 1SYTA 4TW7A 4DH0A 1W9VA 2LPVA 1LG1A 3H9RB 1E6NA 1W26A 1FKBA 2DSVA 5I98A 3OA5A 4DWSC 4HARA 2F2DA 5HTGA 3TC5A 4HBOA 1Q6UA 4KR0B 1FKFA 1FKHA 1NWUA 1PINA 4TNSA 1UR9A 3JXVA 4WKAA 1IX5A 4DRIA 4MPKA 2LKNA 1QPFA 3O5KA 1FKKA 2WLZA 4LAYA 2KI3A 1FKLA 5GQBA 1ROTA 4Z2HA 2DT0A 1PBKA 1WNOA 3JYJA 1WB0A 3NI6A 3ARRA 1N1AA 5DO2A 4S3KA 1LL4A 4DRKA 3CHCA 1E6PA 4KQZA 4Z2GA 1D7IA 4FAPA 4DWSD 2RURA 3KABA 5J6EA 1LJYA 4MNJA 4LAXA 2Y78A 1JNSA 2PV3A 4QIBA 2DG9A 4U85A 1P5QA 3WQVA 3RM8A 2RUCA 1O6IA 3UF8A 1JVWA 1E6RA 3RFWA 4JYSA 4MAVA 3ARZA 4DZ2A 2PBCA 4GGQA 1HKIA 4ZPWR 2G41A 3RMEA 2PV1A 3UI5A 3AROA 1NWRA 4QT3A 3WD1A 4ODLA 4W5UA 1YW5A 1FKTA 2F21A 3TDBA 3IKDA 1J4HA 3FAPA 4MNLA 4JFMA 4G2PA 4HBEA 4ODMA 2O9OA 3G6LA 2MLXA 1F40A 1BKFA 1D7JA 1JNTA 2MNTA 1OGGA 3KCEA 1NWTA 1LG2A 2PI6A 4Z2IA 4ZS6A 1ROUA 5DITA 2DG3A 4DT4A 4QT2A 2WM0A 4XAKA 3ARYA 4DIPA 3O5GA 1ZBKA 3KZ7A 3UQBA 4P8WA 3PRBA 5DF0A 1Q1CA 2IF4A 3WH0A 1C9HA 1HKKA 2QF8A 3VAWA 3O5EA 3B9AA 1ZBVA 2ITKA 3O5DA 1FKRA 4ODPA 2B31A 3PR9A 2M08A 3UQAA 1J4IA 3KACA 3TCZA 1H0IA 4P8XA 5JH8A 4Q22A 4ODQA 1W9UA 4ODNA 3UQIA 5GPRA 1H0GA 2ZR6A 4N19A 1RD6A 4P8UA 3IHZA 4L3NA 1HKMA 1QPLA 4G50A 4DZ3A 2A3AA 5BXJA 3B8SA 1FKJA 2M1IA 3ARQA 4ZPVR 3PRAA 2DT3A 2KO7A 3WQWA 4IT4A 2DG4A 2A3EA 2XP5A 2RUDA 1BL4A 2DT1A 4IQ2A 2G8ZA 2A3CA 3JYMA 2RQSA 2FAPA 5DIVA 3O5MA 2DT2A 3O5LA 4WKFA 2VN1A 3O5IA 2IUZA 2MF9A 2MLZA 3O5JA 4J4NA 4W9QA 2DPEA 4Q7NA 4NNRA 1D2KA 2M2AA 2AOSA 5HWCA 1X6LA 3CHFA 5HKGA 4LGXA 2YBUA 1SR0A 2OFNA 1ZU8A 2RUQA 1FKDA 1UR8A 4TX0A 4BF8A 2ESCA 2LGOA 3WL0A 3ALGA 3IK8A 3WKZA 3O5OA 3CGNA 3KAIA 1E15A 3FY1A 4TW6A 4IQCA 2AWGA 4JFLA 3RM9A 4ITZA 4MTVA 4S3JA 3ARTA 4MNMA 4TYOA 2XPBA 4WKHA 4JFJA 4DROA 4ODKA 4DRMA 2OLHA 4IPXA 1LQ0A 1U79A 1EIBA 1EDQA 2K8IA 3WD3A 2F4EA 1R9HA 4DRNA 1FFRA 3CGMA 2ZR4A 4Z2KA 1K9TA 1Q6IA 4DWSB 3O5RA 1JNEA 3O5PA 3ARVA 1D6OA 1J6YA 1QZ2A 1J4RA 1FKSA 1OGBA 2FKEA 3G6MA 3FXYA 3PA7A 2WLYA 1EYMA 4IT6A 4O2TA 1ZCNA 2DSUA 4JFKA 1XHGA 4ZPTR 4LAVA 2L2SA 3B9EA 3ARSA 3RM4A 2KE0A 3ARPA 1W1TA 5HW6A 2ZQVA 4GIVA 5GPGA 1KT1A 5HT1A 1ZK6A 2XPAA 3O5FA 1X6NA 5HW8A 4ODOA 4WIWA 2Q5AA 3LUOA 4TW8A 2PPOA 1E9LA 2XP3A 1VF8A 3B7XA 1A7XA 1NWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP A;  1FD9 A;  5DIV A;  3O5M A;  4U84 A;  1L1P A;  3IKG A;  3O5L A;  2VN1 A;  2XP8 A;  3NRK A;  3ODK A;  1T11 A;  3O5I A;  2MF9 A;  2MLZ A;  3EY6 A;  2PV1 A;  1Q6H A;  3KAD A;  3O5J A;  4J4N A;  4ODR A;  3RGC A;  3UI5 A;  4W9Q A;  2MPH A;  1M5Y A;  3I6C A;  4QT3 A;  2XP7 A;  4NNR A;  1FKI A;  4ODL A;  2LJ4 A;  2ZR5 A;  1YW5 A;  2KGJ A;  1FKT A;  2M2A A;  2F21 A;  3TDB A;  5HW7 A;  3O5Q A;  5HWC A;  3UI4 A;  3IKD A;  3PRD A;  5HWB A;  1HXV A;  1J4H A;  3FAP A;  5HKG A;  1TCO C;  4JFM A;  5DIU A;  2OFN A;  4G2P A;  1NMW A;  5HUA A;  5B8I C;  1YAT A;  4DRQ A;  4ODM A;  4C02 B;  2RUQ A;  2ZQU A;  1FKD A;  1NSG A;  3UI6 A;  2MLX A;  4TX0 A;  4TW7 A;  4R0X A;  4BF8 A;  4DH0 A;  1F40 A;  1BKF A;  2LPV A;  4U86 A;  2LGO A;  3GPK A;  3H9R B;  1D7J A;  2N87 A;  1JNT A;  3IK8 A;  2MNT A;  1W26 A;  1FKB A;  5I98 A;  3KCE A;  3O5O A;  3CGN A;  2MLY A;  3KAI A;  1ROU A;  2F2D A;  2DG3 A;  4TW6 A;  2ZQT A;  5DIT A;  4IQC A;  1Q6U A;  4QT2 A;  3TC5 A;  5HTG A;  1FKF A;  2AWG A;  1FKH A;  4JFL A;  4DRJ A;  4TNS A;  1F8A B;  1PIN A;  4ITZ A;  4DT4 A;  1B6C A;  3JXV A;  1D7H A;  4TYO A;  4DIP A;  4DRI A;  3O5G A;  2LKN A;  1QPF A;  3KZ7 A;  3MDY B;  3UQB A;  2XPB A;  3O5K A;  1FKK A;  2VCD A;  3PRB A;  1Q1C A;  4JFJ A;  2KI3 A;  4LAY A;  2IF4 A;  1FKL A;  4DRO A;  3WH0 A;  1C9H A;  2XP4 A;  4ODK A;  1ROT A;  4DRM A;  4J4O A;  1PBK A;  3JYJ A;  4IPX A;  3NTP A;  1U79 A;  1FAP A;  2PV2 A;  3NI6 A;  3VAW A;  3O5E A;  2K8I A;  2F4E A;  1N1A A;  1R9H A;  2PPN A;  2ITK A;  3O5D A;  1FKR A;  4ODP A;  4DRN A;  2M08 A;  3CGM A;  3UQA A;  2ZR4 A;  2ZQS A;  1J4I A;  3KAC A;  1Q6I A;  4DRK A;  3TCZ A;  3O5R A;  3O5P A;  1KT0 A;  3OOB A;  1D6O A;  4W9O A;  1J6Y A;  4ODQ A;  1QZ2 A;  1D7I A;  2RSE A;  4ODN A;  4FAP A;  1J4R A;  4DRP A;  1FKS A;  3UQI A;  2FKE A;  2UZ5 A;  2KR7 A;  1EQ3 A;  2ZR6 A;  2D9F A;  2RUR A;  4N19 A;  3KAB A;  3PA7 A;  5J6E A;  1FKG A;  3IHZ A;  4LAX A;  1QPL A;  1EYM A;  1Y0O A;  4G50 A;  4O2T A;  1ZCN A;  3KAH A;  3KAG A;  4JFK A;  4DZ3 A;  4LAV A;  2L2S A;  2Y78 A;  5BXJ A;  2KE0 A;  1JNS A;  2PV3 A;  5D75 A;  1FJD A;  5HW6 A;  4QIB A;  2DG9 A;  2ZQV A;  4U85 A;  3KAF A;  1FKJ A;  1P5Q A;  1KT1 A;  2M1I A;  4GIV A;  4W9P A;  5GPG A;  5HT1 A;  2RUC A;  1ZK6 A;  4FN2 A;  2XPA A;  4DZ2 A;  1NMV A;  2KO7 A;  3UF8 A;  1JVW A;  3O5F A;  3RFW A;  4JYS A;  2KFW A;  4JFI A;  2DG4 A;  5HW8 A;  2XP9 A;  4ODO A;  2XP5 A;  2PPP A;  2Q5A A;  2PBC A;  2RUD A;  1BL4 A;  3LUO A;  4TW8 A;  4DRH A;  4MSP A;  4LAW A;  4MGV A;  4GGQ A;  2XP6 A;  2PPO A;  4IQ2 A;  2JZV A;  2XP3 A;  3JYM A;  3B7X A;  1A7X A;  2RQS A; 
#chains in the Genus database with same CATH topology
 4ML4 A;  1W1P A;  3AQU A;  4DWS A;  4U84 A;  1JND A;  1XRV A;  1LL7 A;  3EY6 A;  1Q6H A;  3KAD A;  4ODR A;  3RGC A;  1W9P A;  3I6C A;  3AS1 A;  2XP7 A;  2ZR5 A;  2KGJ A;  3WD4 A;  3O5Q A;  3WIJ A;  3PRD A;  2EUL A;  1TCO C;  4WK9 A;  1NMW A;  5HUA A;  4DRQ A;  2ZQU A;  4UDM A;  1HJX A;  4R0X A;  1ZBW A;  4U86 A;  4L72 B;  3GPK A;  4AY1 A;  2N87 A;  1EHN A;  3CH9 A;  2MLY A;  2ZQT A;  1ZB5 A;  5DEZ A;  4DRJ A;  1F8A B;  1LL6 A;  1B6C A;  1D7H A;  4Z2L A;  1GOI A;  4NSB A;  4QZV B;  3MDY B;  3CHD A;  2VCD A;  2WK2 A;  2O92 A;  1HJW A;  1GRJ A;  2XP4 A;  4PTM A;  1W1V A;  4Z2J A;  4J4O A;  4URI A;  3NTP A;  1FAP A;  2PV2 A;  2DSW A;  3B9D A;  2PPN A;  2DSZ A;  3AS0 A;  4P8V A;  2ZQS A;  4WJX A;  3OOB A;  1KT0 A;  1CTN A;  4MNK A;  1ZBC A;  4W9O A;  2RSE A;  1ZL1 A;  3WD2 A;  4DRP A;  2UZ5 A;  1NH6 A;  2KR7 A;  1EQ3 A;  2A3B A;  2D9F A;  3CZ8 A;  1FKG A;  1TFV A;  1Y0O A;  3KAH A;  3KAG A;  5D75 A;  1FJD A;  3CHE A;  3KAF A;  4W9P A;  3W4R A;  5HBF A;  4FN2 A;  1ITX A;  1FFQ A;  1KFW A;  3AS2 A;  4NZC A;  1NMV A;  3QOK A;  1HKJ A;  1W1Y A;  2KFW A;  4JFI A;  3WL1 A;  2YBT A;  2XP9 A;  2PPP A;  4DRH A;  4MSP A;  4LAW A;  3ALF A;  2XP6 A;  2JZV A;  3AS3 A;  4MGV A;  1FD9 A;  1HJV A;  1L1P A;  3IKG A;  2XP8 A;  3NRK A;  3ODK A;  1T11 A;  3BXW A;  1GUV A;  2MPH A;  1M5Y A;  1E6Z A;  3ARU A;  1OWQ A;  1WAW A;  1FKI A;  2LJ4 A;  2FDM A;  3WD0 A;  5HW7 A;  4R5E A;  3UI4 A;  1HXV A;  5HWB A;  5DIU A;  3ARW A;  2PN0 A;  5B8I C;  1YAT A;  3ARX A;  4C02 B;  1NSG A;  1GPF A;  3UI6 A;  1SYT A;  4TW7 A;  4DH0 A;  1W9V A;  2LPV A;  1LG1 A;  3H9R B;  1E6N A;  1W26 A;  1FKB A;  2DSV A;  5I98 A;  3OA5 A;  4DWS C;  4HAR A;  2F2D A;  5HTG A;  3TC5 A;  4HBO A;  1Q6U A;  4KR0 B;  1FKF A;  1FKH A;  1NWU A;  1PIN A;  4TNS A;  1UR9 A;  3JXV A;  4WKA A;  1IX5 A;  4DRI A;  4MPK A;  2LKN A;  1QPF A;  3O5K A;  1FKK A;  2WLZ A;  4LAY A;  2KI3 A;  1FKL A;  5GQB A;  1ROT A;  4Z2H A;  2DT0 A;  1PBK A;  1WNO A;  3JYJ A;  1WB0 A;  3NI6 A;  3ARR A;  1N1A A;  5DO2 A;  4S3K A;  1LL4 A;  4DRK A;  3CHC A;  1E6P A;  4KQZ A;  4Z2G A;  1D7I A;  4FAP A;  4DWS D;  2RUR A;  3KAB A;  5J6E A;  1LJY A;  4MNJ A;  4LAX A;  2Y78 A;  1JNS A;  2PV3 A;  4QIB A;  2DG9 A;  4U85 A;  1P5Q A;  3WQV A;  3RM8 A;  2RUC A;  1O6I A;  3UF8 A;  1JVW A;  1E6R A;  3RFW A;  4JYS A;  4MAV A;  3ARZ A;  4DZ2 A;  2PBC A;  4GGQ A;  1HKI A;  4ZPW R;  2B5U B;  2G41 A;  3RME A;  1JCH B;  2PV1 A;  3UI5 A;  3ARO A;  1NWR A;  4QT3 A;  3WD1 A;  4ODL A;  4W5U A;  1YW5 A;  1FKT A;  2F21 A;  3TDB A;  3IKD A;  3GU0 A;  1J4H A;  3FAP A;  4MNL A;  4JFM A;  4G2P A;  4HBE A;  4ODM A;  2O9O A;  3G6L A;  2MLX A;  1F40 A;  1BKF A;  1D7J A;  1JNT A;  2MNT A;  1OGG A;  3KCE A;  1NWT A;  1LG2 A;  2PI6 A;  4Z2I A;  4ZS6 A;  1ROU A;  5DIT A;  2DG3 A;  4DT4 A;  4QT2 A;  2P4V A;  2WM0 A;  4XAK A;  3ARY A;  4DIP A;  3O5G A;  1ZBK A;  3KZ7 A;  3UQB A;  4P8W A;  3PRB A;  5DF0 A;  1Q1C A;  2IF4 A;  3WH0 A;  1C9H A;  1HKK A;  2QF8 A;  3VAW A;  3O5E A;  3B9A A;  1ZBV A;  2ITK A;  3O5D A;  1FKR A;  4ODP A;  2B31 A;  3PR9 A;  2M08 A;  3UQA A;  1J4I A;  3KAC A;  3TCZ A;  1H0I A;  4P8X A;  5JH8 A;  4Q22 A;  4ODQ A;  1W9U A;  4ODN A;  3UQI A;  5GPR A;  1H0G A;  2ZR6 A;  4N19 A;  1RD6 A;  3BMB A;  4P8U A;  3IHZ A;  4L3N A;  1HKM A;  1QPL A;  4G50 A;  4DZ3 A;  2A3A A;  5BXJ A;  3B8S A;  1FKJ A;  2M1I A;  3ARQ A;  4ZPV R;  3PRA A;  2DT3 A;  2KO7 A;  2F23 A;  3WQW A;  4IT4 A;  2DG4 A;  2A3E A;  2XP5 A;  2RUD A;  1BL4 A;  2DT1 A;  4IQ2 A;  2G8Z A;  2A3C A;  3JYM A;  2RQS A;  2FAP A;  5DIV A;  3O5M A;  2DT2 A;  3O5L A;  4WKF A;  2VN1 A;  3O5I A;  2IUZ A;  2MF9 A;  2MLZ A;  3O5J A;  4J4N A;  4W9Q A;  2DPE A;  4Q7N A;  4NNR A;  1D2K A;  2M2A A;  2AOS A;  5HWC A;  1X6L A;  3CHF A;  5HKG A;  4LGX A;  2YBU A;  1SR0 A;  2OFN A;  1ZU8 A;  2RUQ A;  1FKD A;  1UR8 A;  4TX0 A;  4BF8 A;  2ESC A;  2LGO A;  3WL0 A;  3ALG A;  3IK8 A;  3WKZ A;  3O5O A;  3CGN A;  3KAI A;  1E15 A;  3FY1 A;  4TW6 A;  4IQC A;  2AWG A;  4JFL A;  3RM9 A;  4ITZ A;  4MTV A;  4S3J A;  3ART A;  1E44 A;  4MNM A;  4TYO A;  2XPB A;  4WKH A;  4JFJ A;  3GTY X;  4DRO A;  4ODK A;  4DRM A;  2OLH A;  4IPX A;  1LQ0 A;  1U79 A;  3EIP A;  1EIB A;  1EDQ A;  2K8I A;  3WD3 A;  2F4E A;  1R9H A;  4DRN A;  1FFR A;  3CGM A;  2ZR4 A;  4Z2K A;  1K9T A;  1Q6I A;  4DWS B;  3O5R A;  1JNE A;  3O5P A;  3ARV A;  1D6O A;  1J6Y A;  1QZ2 A;  1J4R A;  1FKS A;  1OGB A;  2FKE A;  3G6M A;  3FXY A;  3PA7 A;  2WLY A;  1EYM A;  4IT6 A;  4O2T A;  1ZCN A;  2DSU A;  4JFK A;  1XHG A;  4ZPT R;  4LAV A;  2L2S A;  3B9E A;  3ARS A;  3RM4 A;  2KE0 A;  3ARP A;  1W1T A;  5HW6 A;  2ZQV A;  4GIV A;  5GPG A;  1KT1 A;  5HT1 A;  1ZK6 A;  2XPA A;  2ETN A;  3O5F A;  1X6N A;  5HW8 A;  4ODO A;  4WIW A;  2Q5A A;  3LUO A;  4TW8 A;  2PPO A;  1E9L A;  2XP3 A;  1VF8 A;  3B7X A;  1A7X A;  1NWS A; 
#chains in the Genus database with same CATH homology
 4ML4 A;  1W1P A;  3AQU A;  4DWS A;  4U84 A;  1JND A;  1XRV A;  1LL7 A;  3EY6 A;  1Q6H A;  3KAD A;  4ODR A;  3RGC A;  1W9P A;  3I6C A;  3AS1 A;  2XP7 A;  2ZR5 A;  2KGJ A;  3WD4 A;  3O5Q A;  3WIJ A;  3PRD A;  1TCO C;  4WK9 A;  1NMW A;  5HUA A;  4DRQ A;  2ZQU A;  1HJX A;  4R0X A;  1ZBW A;  4U86 A;  4L72 B;  3GPK A;  4AY1 A;  2N87 A;  1EHN A;  3CH9 A;  2MLY A;  2ZQT A;  1ZB5 A;  5DEZ A;  4DRJ A;  1F8A B;  1LL6 A;  1B6C A;  1D7H A;  4Z2L A;  1GOI A;  4NSB A;  4QZV B;  3MDY B;  3CHD A;  2VCD A;  2WK2 A;  2O92 A;  1HJW A;  2XP4 A;  4PTM A;  1W1V A;  4Z2J A;  4J4O A;  4URI A;  3NTP A;  1FAP A;  2PV2 A;  2DSW A;  3B9D A;  2PPN A;  2DSZ A;  3AS0 A;  4P8V A;  2ZQS A;  4WJX A;  3OOB A;  1KT0 A;  1CTN A;  4MNK A;  1ZBC A;  4W9O A;  2RSE A;  1ZL1 A;  3WD2 A;  4DRP A;  2UZ5 A;  1NH6 A;  2KR7 A;  1EQ3 A;  2A3B A;  2D9F A;  3CZ8 A;  1FKG A;  1TFV A;  1Y0O A;  3KAH A;  3KAG A;  5D75 A;  1FJD A;  3CHE A;  3KAF A;  4W9P A;  3W4R A;  5HBF A;  4FN2 A;  1ITX A;  1FFQ A;  1KFW A;  3AS2 A;  4NZC A;  1NMV A;  3QOK A;  1HKJ A;  1W1Y A;  2KFW A;  4JFI A;  3WL1 A;  2YBT A;  2XP9 A;  2PPP A;  4DRH A;  4MSP A;  4LAW A;  3ALF A;  2XP6 A;  2JZV A;  3AS3 A;  4MGV A;  1FD9 A;  1HJV A;  1L1P A;  3IKG A;  2XP8 A;  3NRK A;  3ODK A;  1T11 A;  3BXW A;  1GUV A;  2MPH A;  1M5Y A;  1E6Z A;  3ARU A;  1OWQ A;  1WAW A;  1FKI A;  2LJ4 A;  2FDM A;  3WD0 A;  5HW7 A;  4R5E A;  3UI4 A;  1HXV A;  5HWB A;  5DIU A;  3ARW A;  5B8I C;  1YAT A;  3ARX A;  4C02 B;  1NSG A;  1GPF A;  3UI6 A;  1SYT A;  4TW7 A;  4DH0 A;  1W9V A;  2LPV A;  1LG1 A;  3H9R B;  1E6N A;  1W26 A;  1FKB A;  2DSV A;  5I98 A;  3OA5 A;  4DWS C;  4HAR A;  2F2D A;  5HTG A;  3TC5 A;  4HBO A;  1Q6U A;  4KR0 B;  1FKF A;  1FKH A;  1NWU A;  1PIN A;  4TNS A;  1UR9 A;  3JXV A;  4WKA A;  1IX5 A;  4DRI A;  4MPK A;  2LKN A;  1QPF A;  3O5K A;  1FKK A;  2WLZ A;  4LAY A;  2KI3 A;  1FKL A;  5GQB A;  1ROT A;  4Z2H A;  2DT0 A;  1PBK A;  1WNO A;  3JYJ A;  1WB0 A;  3NI6 A;  3ARR A;  1N1A A;  5DO2 A;  4S3K A;  1LL4 A;  4DRK A;  3CHC A;  1E6P A;  4KQZ A;  4Z2G A;  1D7I A;  4FAP A;  4DWS D;  2RUR A;  3KAB A;  5J6E A;  1LJY A;  4MNJ A;  4LAX A;  2Y78 A;  1JNS A;  2PV3 A;  4QIB A;  2DG9 A;  4U85 A;  1P5Q A;  3WQV A;  3RM8 A;  2RUC A;  1O6I A;  3UF8 A;  1JVW A;  1E6R A;  3RFW A;  4JYS A;  4MAV A;  3ARZ A;  4DZ2 A;  2PBC A;  4GGQ A;  1HKI A;  4ZPW R;  2G41 A;  3RME A;  2PV1 A;  3UI5 A;  3ARO A;  1NWR A;  4QT3 A;  3WD1 A;  4ODL A;  4W5U A;  1YW5 A;  1FKT A;  2F21 A;  3TDB A;  3IKD A;  1J4H A;  3FAP A;  4MNL A;  4JFM A;  4G2P A;  4HBE A;  4ODM A;  2O9O A;  3G6L A;  2MLX A;  1F40 A;  1BKF A;  1D7J A;  1JNT A;  2MNT A;  1OGG A;  3KCE A;  1NWT A;  1LG2 A;  2PI6 A;  4Z2I A;  4ZS6 A;  1ROU A;  5DIT A;  2DG3 A;  4DT4 A;  4QT2 A;  2WM0 A;  4XAK A;  3ARY A;  4DIP A;  3O5G A;  1ZBK A;  3KZ7 A;  3UQB A;  4P8W A;  3PRB A;  5DF0 A;  1Q1C A;  2IF4 A;  3WH0 A;  1C9H A;  1HKK A;  2QF8 A;  3VAW A;  3O5E A;  3B9A A;  1ZBV A;  2ITK A;  3O5D A;  1FKR A;  4ODP A;  2B31 A;  3PR9 A;  2M08 A;  3UQA A;  1J4I A;  3KAC A;  3TCZ A;  1H0I A;  4P8X A;  5JH8 A;  4Q22 A;  4ODQ A;  1W9U A;  4ODN A;  3UQI A;  5GPR A;  1H0G A;  2ZR6 A;  4N19 A;  1RD6 A;  4P8U A;  3IHZ A;  4L3N A;  1HKM A;  1QPL A;  4G50 A;  4DZ3 A;  2A3A A;  5BXJ A;  3B8S A;  1FKJ A;  2M1I A;  3ARQ A;  4ZPV R;  3PRA A;  2DT3 A;  2KO7 A;  3WQW A;  4IT4 A;  2DG4 A;  2A3E A;  2XP5 A;  2RUD A;  1BL4 A;  2DT1 A;  4IQ2 A;  2G8Z A;  2A3C A;  3JYM A;  2RQS A;  2FAP A;  5DIV A;  3O5M A;  2DT2 A;  3O5L A;  4WKF A;  2VN1 A;  3O5I A;  2IUZ A;  2MF9 A;  2MLZ A;  3O5J A;  4J4N A;  4W9Q A;  2DPE A;  4Q7N A;  4NNR A;  1D2K A;  2M2A A;  2AOS A;  5HWC A;  1X6L A;  3CHF A;  5HKG A;  4LGX A;  2YBU A;  1SR0 A;  2OFN A;  1ZU8 A;  2RUQ A;  1FKD A;  1UR8 A;  4TX0 A;  4BF8 A;  2ESC A;  2LGO A;  3WL0 A;  3ALG A;  3IK8 A;  3WKZ A;  3O5O A;  3CGN A;  3KAI A;  1E15 A;  3FY1 A;  4TW6 A;  4IQC A;  2AWG A;  4JFL A;  3RM9 A;  4ITZ A;  4MTV A;  4S3J A;  3ART A;  4MNM A;  4TYO A;  2XPB A;  4WKH A;  4JFJ A;  4DRO A;  4ODK A;  4DRM A;  2OLH A;  4IPX A;  1LQ0 A;  1U79 A;  1EIB A;  1EDQ A;  2K8I A;  3WD3 A;  2F4E A;  1R9H A;  4DRN A;  1FFR A;  3CGM A;  2ZR4 A;  4Z2K A;  1K9T A;  1Q6I A;  4DWS B;  3O5R A;  1JNE A;  3O5P A;  3ARV A;  1D6O A;  1J6Y A;  1QZ2 A;  1J4R A;  1FKS A;  1OGB A;  2FKE A;  3G6M A;  3FXY A;  3PA7 A;  2WLY A;  1EYM A;  4IT6 A;  4O2T A;  1ZCN A;  2DSU A;  4JFK A;  1XHG A;  4ZPT R;  4LAV A;  2L2S A;  3B9E A;  3ARS A;  3RM4 A;  2KE0 A;  3ARP A;  1W1T A;  5HW6 A;  2ZQV A;  4GIV A;  5GPG A;  1KT1 A;  5HT1 A;  1ZK6 A;  2XPA A;  3O5F A;  1X6N A;  5HW8 A;  4ODO A;  4WIW A;  2Q5A A;  3LUO A;  4TW8 A;  2PPO A;  1E9L A;  2XP3 A;  1VF8 A;  3B7X A;  1A7X A;  1NWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...