2RVAA

Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
131
structure length
131
Chain Sequence
NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 9
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rvaA00
2ZEWA 2JDAA 3UESA 1OF3A 1RYYA 5JMOA 2J1RA 4BDVB 3NRUA 4ZZ5A 3WQBA 5IFPA 3CZJA 3VD9A 2VZVA 2VZQA 2W87A 3CIHA 3HN3A 2WAOA 5C70A 1JYXA 3EB7A 1YQ2A 2EIBA 4PQQA 4XUQA 4KI5M 3SEEA 1PX4A 3MV01 3DYOA 1SDDB 2W9XA 4QDSA 3C7EA 5HXMA 3HOBA 5J1XA 1JZ4A 3DYMA 3VD7A 1W8OA 3ABZA 1UXXX 5G05L 2VZOA 3LPGA 3SKJE 3VD3A 1UXZA 4YPJA 3WF0A 2EICA 5LA2A 4DXTA 5B4XA 2PQSA 2VZTA 2J1EA 2OKXA 2J1AA 3NJVA 2B4KA 1T2XA 4LHSA 4CU7A 3ZM8A 4Z2AA 2VO5A 4AG4A 1W8NA 2ORZA 4CUAA 1XNAA 1US2A 2YB7A 3T0DA 1XPWA 4DUWA 1OD3A 2VMEA 3WNOA 4ARXA 4BJ0A 2QBXA 1UY3A 3WF3A 3F2ZA 4M4RA 4ZXEA 4DEQA 4JHZA 2ZEZA 3K4ZA 4ET7A 1I5PA 4MOAA 4CUCA 3U37A 1JYNA 1O8SA 3DECA 2YG0A 2Y6KA 4OUEA 1UMHA 3K77A 2ORXA 5JXJA 2J1VA 5JXGA 3NNGA 4M4PA 2YC2A 2VZPA 4W50A 3ECQA 4RN5A 3HNMA 3UNPA 2VCAA 3WSOA 2Z4FA 3K4AA 5LA0A 4XVHA 5IHRA 4UOJA 1GNYA 3IAPA 1H6XA 2YC4A 2X09A 3GXUA 4RYDA 2VZSA 4A6OA 4TTGA 4MGQA 2VC9A 1TVGA 2J1TA 3OGSA 3OEBA 4KWUA 3T09A 3A22A 1CZVA 3WF2A 3FN9A 3T2OA 2VJXA 1SG3A 2W1SA 3ACGA 1W9SA 4ZY9A 4CU9A 4E8CA 1W99A 5G04L 2QQOA 4JKKA 4QX1A 3BN6A 2WDBA 3GDBA 2W46A 4QX3A 4P02B 3K4DA 4KMQA 3C7FA 3W5MA 1JU4A 4DXSA 3LQCA 2BBAA 2J1UA 4GZ9A 2E31A 1UY2A 1JYWA 2V72A 4PT6A 5C71A 2Y6GA 3FHAA 1OT5A 2WN2A 2DCKA 3LPFA 1JZ2A 2W1QA 2Y8KA 2XQXA 2VL4A 4JX0A 3CQOA 2DDUA 3NQHA 3JXSA 2VM9A 4DUVA 3OB8A 1HN1A 4HG6B 3I3DA 3FL7A 4D0QA 1US3A 2WYSA 2Y64A 3CKHA 3T2PA 4LPLA 1K3IA 3VDAA 3J7HA 2VTFA 2ZEXA 2W94A 4P5YA 4QX0A 3HEIA 2J1SA 1GOFA 4LKSA 2VR4A 4JKLA 1W9WA 4BXSV 2JKXA 2VQTA 3MBWA 3I2FA 1GUIA 2X05A 4XUPA 2QQNA 1WCQA 2VQUA 3I3EA 5LCWL 1UYXA 3K46A 4L0PA 1DLCA 1DYOA 3OGVA 3MUZ1 3A23A 1DP0A 3GGLA 1TG7A 3WF4A 4OYUA 3ACFA 2Y6LA 3IB3A 5HPOA 3C8XA 2ZXQA 1F4AA 1UZ0A 4ZZ8A 4MGSA 2WN3A 1JZ5A 3HPNA 3DYPA 2JE8A 3ACIA 5IYYA 1CZTA 4MADA 1CZSA 3C7GA 2C26A 2XONA 3ACHA 3AC0A 1NUKA 2R7EB 2WABA 1J84A 3HJRA 3W5NA 1JZ8A 3THCA 3T0AA 2VZ1A 2Y6JA 4ARYA 1O59A 2ID4A 1OF4A 2VCBA 4A45A 4P08A 2W91A 2WO3A 2VCCA 2LS6A 4FI9A 2VMCA 1K45A 2VZ3A 1GQPA 3THDA 3LEIA 5EIYB 2RV9A 4XURA 2CDOA 3OEAA 4MO3M 4UI9L 1WKYA 1UX7A 1NX9A 4W8JA 2RVAA 1D7PM 3K75B 1XNTA 5DN2A 1KEXA 1W0NA 4QB1A 4BK4A 3FHQA 3CMGA 2V4VA 1H6YA 2E32A 3C7HA 3I3BA 3E1F1 3A7QA 2QQMA 3EYPA 4CVUA 2E26A 5B4NA 3PUIA 1P8JA 2Y6HA 2WAAA 2VOTA 4A44A 5DPNA 3SEPA 1OH4A 4CU8A 2B9VA 2QQLA 3CZUA 2WQ8A 3IIIA 5JR2A 2WUHA 2W92A 5IJRA 2BERA 1UYYA 2VZRA 4IUGA 4OZOA 3LEKA 4XUTA 1F4HA 1J83A 3LEGA 2YFUA 1CIYA 3NJXA 4QB6A 3OBAA 2WO1A 1JI6A 3ETPA 3WF1A 2WZEA 3D3AA 5LA1A 5EJ1B 3PUHA 2X10A 3MUY1 2W1WA 1XC6A 1K12A 4XUOA 4D8MA 1GOHA 2VMDA 1UY0A 2BGOA 4W4ZA 1K42A 1UY4A 2BGPA 3T2QA 3P1IA 4LQRA 4QB2A 1LNSA 4DUXA 1UY1A 2ZEYA 3C7OA 3T0BA 1GU3A 3P6BA 1PMHX 3IAQA 3OG2A 4XUNA 3LE0A 3VD5A 2QQJA 2XOMA 3BGAA 1R64A 2E33A 2WZ8A 3HNBM 2YFZA 3MO4A 4QDRA 2XHNA 4CUBA 4A4AA 3I2KA 3WNMA 2QQIA 1IQDC 3I2IA 5DQ0A 3WNNA 3CDZB 4A42A 2VMFA 3I2JA 4JKMA 1O8PA 1JZ3A 5FUIA 3VDCA 1MPXA 3MV11 4UAPA 1NKGA 4A3ZA 1JHJA 1GOGA 5CYYA 2HYXA 1L7RA 2JD9A 1PX3A 4GWIA 2VZUA 1W9TA 4DXRA 3I2HA 4TXWA 3SKVA 2BZDA 2RJ2A 4QPWA 1EUTA 4E8DA 2C9KA 5I0DA 5DMYA 4QDQA 1NAEA 4XZUG 3UETA 1JU3A 1L7QA 2W47A 1JZ7A 5CZKA 4OMCA 1ULPA 3HNYM 2W95A 3WNKA 1SHWB 2J22A 4CU6A 5JUVA 1UYZA 2CDPA 1PMJX 1KGYA 2V5DA 3GM8A 1EUUA 1GMMA 2W3JA 5IFTA 3WNLA 4BK5A 3I97A 4DEVA 2J7MA 2WBKA 5F7UA 4QAWA 3WEZA 1UWWA 1ULOA 1UMIA 2W5FA 5JXIA 1JYVA 4OMDA 2WO2A 5JXHA 2L9LA 5EJZB 2KD7A 3A21A 5A1AA 3WNPA 4GWJA 2QQKA 3T08A 1JZ6A 5C7GA 1BHGA 3VDBA 3VD4A 2HLEA 4AAXA 4QX2A 4P00B 2DCJA 2C4XA 2EIDA 2EIEA 3OGRA 3I2GA 3IDAA 4A41A 2LW8A 1CX1A 2W1UA 4PF1A
chains in the Genus database with same CATH superfamily
2P5BA 4LLFA 3BU7A 3E5UA 5A3LA 2P6HA 3P5BA 5K9YA 2DV9A 1ND2A 1MR5A 4LA3A 4ZZ5A 4FPOB 3ZDVA 4YGCA 1LOFC 1VE0A 4LBQD 3VBUC 1L3JA 3GALA 1AR72 2JECA 1QEXA 3NV3A 4LK7A 3WG4A 1PNFA 4COWA 4HPKA 1A34A 4J6GA 4ZU5A 2D6KA 2WYFA 4O9GA 1XSQA 1NCQB 1GKBA 3BIWE 4Y1ZA 2Y6FA 2HKXA 4KI5M 4BU2A 1D2QA 4W6XA 1S2BA 1UPSA 4NOTA 4AW7A 1HDKA 2W9XA 3ES4A 4GULA 2WFF1 4MSVA 4WV8A 5FO9B 4QDSA 1REFA 3A0KA 3HOBA 1JZ4A 3DYMA 3VD7A 1W8OA 3D5OA 2XH6A 1QXJA 2AEZA 2VZOA 2KXLA 4LBQB 4OI1A 3U14A 3SNMA 3V56A 3VBFC 3WP4A 5GLZA 2ZHKA 1S0BA 2E7AA 2ZGNA 3VD3A 1BEV3 1J1TA 2R062 5F6KA 3VBHA 1AYN1 2BDRA 2HWC1 1CAWB 3MI8A 4CRQA 3VHPA 5LA2A 4YVSA 3CNAA 3AYCA 2PQSA 5FYMA 2J1EA 1GP5A 3UGGA 4MHRA 1MQTB 1T2XA 2B4KA 1FT9A 2XKOA 3NKGA 2W2IA 2EXJA 3GZTB 3S7EA 2VUJA 3N9MA 2HWD3 2RM23 4PCRA 1C1FA 4RHV2 5FP4A 1ST8A 3OBTA 1RUG3 2ORZA 2WQZC 3KMHA 4YVWA 3BIEA 2JENA 3AM2A 3VBSA 5C3OA 1G9FA 2YB7A 3T0DA 1W3VA 3WDYA 1ZBA1 2HEVF 5J3UA 2X5IC 5T5PA 2A6YA 3AZYA 1GZWA 3V0BA 2Y0IA 4MUVA 1RUJ3 4Q0SA 5JPMB 4GWNA 1PIV3 2VPVA 4KWLA 4ARXA 4D94A 2G9ZA 4BJ0A 2JWPA 3W59A 3ZSLA 1UY3A 4YNIA 4BIFA 5FZ9A 1EPWA 3VDDA 2XJUA 2YROA 4ITCA 2ZKNA 4S2DA 2VTXJ 1U0AA 4D7YA 4Q4X3 1S1AA 4CUCA 2H6BA 3U37A 2PLV2 1AL21 5DZGA 3TEXA 1QHDA 1JYNA 3DECA 1YI7A 3AKRA 5E8AA 5K0UA 1WMDA 3K77A 3OSDA 1IG0A 1BZWA 1OPMA 1PM4A 4M4PA 5JXGA 1EAH2 1LU2A 4LIVA 5IK8A 3S57A 4YM0A 1DGRN 4HXCA 1W8HA 4GMP3 3UNPA 1DGRA 4Q4V3 2P4EA 3H8XA 4QPYA 4Y5TA 1S0GA 1NCQC 2VNGA 4V2WA 1MS0A 1VBE3 3KT4A 4HKLA 5LA0A 1V6IA 3GZUC 4YM1A 1AF9A 1BK0A 1WA4A 2YC4A 1O6UA 2PHFA 2UU8A 2ZHNA 4CCKA 2WFF3 4DQAA 2VUDA 4QM9A 3NJZA 1MEC2 4IE6A 4MH0E 3ZYFA 2Q8OA 3RPQA 1NE6A 3B94A 1GR3A 4NRPA 2WNVA 5I0RA 1LOAA 3PUQA 3SLIA 3BKZA 1Y9QA 1MZ5A 1TVGA 3PURA 1AYN3 3JD71 3A22A 4JHTA 4A3XA 1U5ZA 2ES3A 3I7DA 1GZCA 2D6LX 3KCXA 5FZFA 4AFMA 1DZQA 4AVAA 2RHPA 2GC3A 1SG3A 4Q0QA 2EAKA 4NJ4A 4B1LA 1MQTC 4JKKA 4QX1A 3O1PA 5JIUA 5H9PA 3MGUA 1BMV1 2WNUB 2GC0A 2WDBA 2HEWF 1W2TA 1HJFA 1RUF1 4I0AA 3Q9OA 4P02B 4AEDA 2DWRA 5LATA 5CA6A 5FZDA 4JGZC 4AGGA 3H42B 2XJVA 1RUOA 1ZBA3 2J1UA 1FV2A 4FPEA 4GZ9A 4PLNA 5B2GB 1JYWA 5C6CA 4Z92B 3B9CA 5T5LA 2O1QA 3IDBB 2V72A 4PT6A 4RR3B 3MPBA 3SXWA 1TZOA 3AP6A 1YC61 4H7MA 2WN2A 3IPVB 3LPFA 2W1QA 4K1YA 1VBC3 3AMMA 5FYHA 1F31A 1YIPA 1BKZA 2VL4A 4NAOA 3J26N 2ZX3A 1LESA 1ZBE1 5HCFA 4AK3A 1R1A1 3NV1A 1VBB1 5C9AA 5FBZA 2NPIA 3WXPA 5A7OA 5KBFA 1HLCA 2VXJA 5GLWA 3OD0A 2A6WA 4JZRA 2JIGA 4ONUA 4Z07A 1AL23 2H0BA 5CKMA 4YW3A 1R082 4HK9A 4AAPA 2GH2A 4PLOA 1BLZA 1TMF1 2Y64A 1H2LA 5SV8A 1K3IA 4IEZA 1SLLA 3JBG2 3VDAA 3ZN5A 3N7MA 3O1MA 1RUE1 1H1AA 3MLKA 1CAXA 3HEIA 2HWF1 2J1SA 3V65A 4A7ZA 5JIAA 4LKSA 1O4YA 4IESA 2WA4A 1XU1A 2BOIA 4BYYA 1NE4A 4Z2WA 4IDZA 1UZWA 2JKXA 4Y5SA 3ZYIB 2VQTA 3UKTA 3ILNA 2E6VA 3LDBA 2F17A 5A3OA 2W08A 1W2NA 2VE1A 3I3EA 4RL7A 5LCWL 3WW3A 2Y0OA 3K46A 4LR4A 2KM2A 1LOEA 4NUBA 5AC91 1MZEA 4NE9A 2R6QA 3MIBA 4G4FA 4TLFA 3JD73 3A23A 4IQPA 2FZ2A 1GFF2 1DP0A 5F5AA 2R32A 2GN7A 3MLJA 3KM5A 5FWJA 2BV4A 5HV0A 3I3MA 2O8OA 2E9QA 2BPA2 4OYUA 2Y6LA 5JAXA 2D7FA 4QD2A 3B7MA 4PIZA 1ZZBA 2HWE2 4IEOA 3OUJA 4QT6A 4YZ3A 4MGSA 4KGGA 1HKDA 3DYPA 2WNUC 3PJYA 2AZ5A 1W05A 2JE8A 1RUF3 4XQDA 2WR9A 4OI2A 1Q8PA 4NROA 3U1XA 4FPKA 4NR1A 4Y4YA 1CZTA 4MADA 2BJSA 4FPHA 1GQHA 1FOD2 2K9ZA 2XJTA 3C7GA 4FFGA 3MF6A 2BVBA 2FDJA 2VNVA 3HJRA 1QJY2 4GMP0 4LBNA 4Q26A 4CPBD 2XJQA 5LBEA 1JZ8A 3I59B 4LJHA 2LALA 1KJLA 4RGGA 4RR3C 4PHZA 3THCA 3ZXJA 1AYM2 4CCLA 1GICA 3W9AA 3E5XA 5TSWA 2D6OX 2WQ4A 1OUSA 2VZ1A 2VECA 2Y6JA 4FBFA 4YFZA 5FLIA 1AXYA 3ZMNA 3H3LA 1ZBE3 5FY1A 1W6NB 1N1YA 4K8FA 1R1A3 1VRH2 2ZACA 5IAXA 2DVGA 4RS5A 4BLJA 1ODNA 4IEQA 3CJXA 1O59A 1DG6A 2CAVA 1UKGA 1RUH2 3G6JB 4LOTA 5D21A 1Z78A 4C91A 3KV4A 5I91A 4LUMA 4P08A 1G86A 4PJYA 3RSJA 1TMF3 4UBHA 2A70A 4MGZE 1ENQA 2VCCA 4I0BA 4UT5A 2LS6A 4FI9A 1XBFA 1TME2 3GYDA 2GNBA 2VMCA 3M8LA 2A3XA 4BE3A 1RUE3 4COVA 3N9NA 4HETA 1IQAA 3USUA 5JLVA 2HWF3 1PZ8A 1W2UA 2CDOA 3OEAA 1DYKA 5FYSA 4MO3M 4CXXA 2RS52 4UI9L 4CXWA 1ZVFA 3TEWA 2RDQA 3IM0A 1VBA2 3POWA 1A8MA 1XU2A 1ZX5A 4PIXA 5C8CB 3KV5A 1K5MB 3WT3A 4EZ4A 3TN91 2ZGLA 2PMWB 1CVNA 3KHBA 1PHMA 4M0NA 3ES1A 3POGA 2AGSA 5D8AB 4QQ2A 1VAKA 4RQPB 5FP9A 5FKBA 5JWPA 1OA2A 3EYPA 4CVUA 1BCXA 2XR4A 4XMIA 3SCFA 4F3JA 4QGMA 2BVVA 4ZXKA 4CCDA 4LO5B 5F3IA 1ENSA 4LHNA 5JDBA 1HW5A 1P8JA 2HH9A 4M3CE 2Q30A 1ZZ8A 4A44A 5J7MA 1PGL1 1Z7S2 4Y1UA 3VLBB 1O7FA 2JEMA 3ZSEA 4FFFA 4YZ2A 1CJDA 4QHZA 2D3PA 4RGKA 3F95A 3APBA 4YARA 1VIWB 3CL1A 5A7SA 5H9RA 2QQLA 1SLAA 2XG3A 2Y33A 5JR2A 2RS32 1DHKB 2WZPP 3T3YA 4C90A 2R072 3VBRB 1WW5A 5A3TA 1JXNA 5K7PA 4C0HA 3HMYA 4FXKB 5J96B 1OLME 1ZNPA 1QH7A 3UGHA 1UO9A 2F6BA 2P3YA 5CBLA 4N53B 3PU8A 5HCBA 2JB4A 5FUNA 5JOWA 1F4HA 3S7IA 2R0FA 1J83A 1OD5A 4FCAA 2YFUA 5FQ0B 1CIYA 4GB32 4PI2A 1ND3A 3K2OA 4QB6A 5JOYA 1SCSA 3OBAA 2AR6A 3GNEA 4OHXA 3WF1A 3B3QE 1JN2P 3R6SA 1HXS2 3D3AA 5LA1A 4EN6B 2FQPA 2DVFA 3H8OA 1MVEA 1OOPA 2X10A 3MW4A 5FXXA 1UOBA 2ARAA 2JDYA 3M3CA 4QPIC 2W1WA 3D0SA 1AR71 1AJKA 2W0XA 2XWJB 4XUOA 4LIUA 3LOIA 3ZN6A 3ZSKA 3KGZA 2BGOA 1QQP3 4CDWB 4QU2A 1UY4A 2BGPA 2ERFA 3PLQA 3T2QA 4J1XA 2ZAAA 1I9RA 1MS9A 2ZZQA 1LNSA 2VCMA 2P1BA 4WZCA 4M3CB 1QH6A 4BOWA 1HRV2 2AREA 5FK7A 2RR12 3C7OA 4XCBA 1YFYA 4E4DX 1PMHX 4COZA 5ACA2 2NZ9A 3OG2A 4CUGA 1JMUB 2ZGMA 1XNDA 3ETQA 4XDPA 4ZKTB 2QQJA 2XOMA 3BGAA 1V6KA 4U2AA 1REEA 2WZ8A 3POIA 2BWAA 1GZTA 4HN1A 3WDWA 4OULA 4BB3A 4BIOA 3HNBM 1AHSA 5C8CC 5EJ3A 1W06A 3MO4A 2UWBA 2R061 1K5MC 4XEZA 3TN93 2XHNA 1WMFA 1YFUA 2HJIA 4K20A 1RXFA 3S0MA 2QE3A 4A4AA 1D4M2 5FJHA 1SFNA 3I2KA 5FXVA 1JYTA 5A6ZA 5D8AC 4RQPC 3HD8B 1WBFA 2CYFA 1LEMA 1ULFA 2OX0A 1N1TA 1MVQA 3H7YA 1RUD2 3N7KA 2ZMLA 4NVPA 4OZXA 3S30A 1MPXA 2V5YA 3VDCA 3D6EA 2CV6A 2OPKA 3WP3A 1XYNA 4UAPA 4AHZA 1FMD3 4YG0A 1O5UA 1GOGA 2G1MA 5J37A 3GZEA 4NHKA 4L97A 1PX3A 4BQWA 1H1IA 5F32A 4DXRA 2D40A 3I2OA 1NOVA 3RYRA 2WZR2 4TXWA 2JE9A 3TOJA 1ZREA 1IPJA 2RJ2A 4QPWA 1PO23 1Q43A 5JSPA 5GZCA 4Y20B 4XQ4A 1CAUB 1C5IA 1Q56A 1QXRA 2DVDA 3ATGA 4IE4A 4Y4RA 3VBRC 4BXFA 5A33B 3O1VA 3H8UA 5APAA 4CCNA 5F3GA 4WM8A 1NAEA 2HBUA 3FBYA 3UETA 1L7QA 2W47A 2PFWA 1GP4A 4N53C 2GMPA 4UF0A 1DZTA 4TWTA 5CZKA 3ROUA 3MIFA 4XE9A 4UW3A 3AMNA 2FDHA 2OIIA 5IVYA 4YW2A 1NLQA 5JZGB 1UYZA 2PHWA 1CX4A 1KGYA 2V5DA 1WBLA 5FREA 3RZMA 1RINA 1PGSA 2GN3A 3O0WA 3LAGA 1TQ5A 5T54A 1OVSA 5FPXA 3NO8A 4BK5A 1WMXA 2J7MA 4IV1B 5EZWA 4AI3A 3NNMA 3N4MA 4KU8A 2BQPA 2VNOA 4IEXA 1EAH1 1AR73 4QAWA 2C6SA 3VKMA 4E4ZA 5FPAA 4AOCA 1ULOA 5F3CA 1DQ5A 1V6MA 1JYVA 4OMDA 4BQ4A 4Y22A 5CNAA 4CDWC 5A6YA 3HQXA 1JW6A 2UY9A 2PN5A 3VL9A 1HB2A 3OD4A 3OYWA 3UL2A 1YI9A 1RVF2 4I02A 4JDNA 2IFWA 4IL7A 1PVC2 1IOAA 1JZ6A 4XABA 5FZ7A 1MEC1 2XBO2 3VDBA 1JYCA 3WP6A 1ZA7A 3AMHA 4AAXA 1V9U2 4QX2A 2OW4A 3POYA 5KXEA 2EIEA 4Z82A 1YLLA 4D6RA 1F8VA 5IW0A 1ZZ6A 2JDMA 3I2GA 3DXTA 1PGW2 3RQ0A 3CLPA 4CYDA 1FXZA 4CCOA 3PMSA 4OVEA 4FOVA 3N9LA 3UESA 2WS91 1RYYA 4BM8A 4CP9A 4Q2FA 4F7ZA 1RXGA 5DDJ1 1HN0A 3H50A 1G6NA 2BP6A 2R1DA 1YHFA 4E2SA 3FUOA 3OJBA 4NIIA 3WQ7A 2ZGPA 5IK4A 2RS11 4N7IA 1YO8A 2VZQA 1SMVA 2W87A 3O14A 1KRIA 5AVAA 4DY5A 1YJLA 2WAOA 4NWVA 1LOGA 2EXKA 1COV2 1SLBA 3FJSA 1C4RA 4SBVA 5IVEA 1JYXA 5DAQA 5KR7A 5L19A 4PQQA 1ULDA 2EIBA 2D5FA 2GNDA 4Z8BA 1KFUL 4CEWA 2PAMA 4FPLA 5GLVA 1ND2B 3DYOA 2QDNA 1IPSA 2B46X 2JKBA 3VV1A 5HXMA 1IHMA 3LOBA 3CJIA 4QM8A 4XBNA 5ISLA 5LWBA 2Y26A 5FZEA 4P9YA 5FZ4A 3FZ3A 4HPKB 1VALA 5JZGC 3AL6A 3I49A 1C8M2 2ZTNA 1DGWX 1UXZA 5A7WA 4BPZA 1HRI2 2JD4A 1URXA 2EICA 5B4XA 4AVTA 3OUIA 4IV1C 4O7XA 1HQWA 2VZTA 2I2SA 3JBG1 1NXMA 4P9JA 3LF7A 2GMEA 4YFWA 4KL1A 2NN8A 1FPN2 1KFXL 3ZKYA 3ZM8A 1KS4A 2VO5A 2VTXA 4IW3A 4LKFA 1AX1A 4HVQA 3HN1A 3VBOA 1W8NA 1WW7A 4UFLA 4AG4A 4EWEA 3VKFC 1RC6A 3VBHB 4CUAA 2DYCA 2LTNA 4FTSA 4P9GA 4M0HA 1XPWA 5A70A 4OLLA 3AKSA 3ZFGA 5L9VA 4QPGA 3FLRA 1NLSA 3PJQA 3AXDA 4UW4A 2A71A 5ABJA 2PXJA 4FTBA 3WF3A 4GA9A 3MDPA 4Q0UA 1UU5A 2WNOA 2OVUA 4NO4A 4H3WA 3U10A 4ET7A 5F39A 5FY5A 3M2MA 3VBSB 1I5PA 4AI8A 1AR92 2FBEA 2QUOA 5T5OA 2LM3A 2WS93 4YW1A 5FBJA 1O8SA 1YEWA 5DDJ3 1H4GA 1ALYA 1QDCA 2FHRA 4OUEA 1YQ6A 4AQSA 3V0BB 1GZWB 2HWE1 2J1VA 2NMOA 4XCAA 3DKQA 3SISA 5FYBA 2K0GA 3RJ2X 1QU0A 2RS13 2XUMA 2VZPA 3VZJA 1D0GA 3K48A 5GKAC 2CAUA 3I2DA 2DBNA 3ECQA 2JE7A 1W6MA 1GLHA 5F3EA 3VDDB 2EALA 1EV12 3KWVA 4HSJA 4AVBA 5IK5A 2Z4FA 4XVHA 2PQQA 4UOJA 3RYKA 2Q5TA 2WA3A 3BU0A 3ZDSA 1CONA 1GNYA 2X09A 1TEIA 2D3SA 3GXUA 4RYDA 1ND2C 3RDIA 5K0UB 1AYM1 1WUVA 1O4ZA 4EN0A 4FFHA 4XF9A 1LULA 4UWDA 3ZOIA 3ZYBA 4TTGA 1PO12 2VG9A 2WSUA 5DZEA 5FPLA 4HT1T 4AHXA 2DVBA 2D93A 5GZDA 1VRH1 4IE7A 2PHLA 5FZ0A 5CB7A 1PM7A 1RUH1 5JMCA 3I4IA 1CZVA 1MS5A 2VOXA 4Y26A 2XPJA 1FNYA 5LBBA 1I1EA 3FN9A 2BYVE 5BNPA 3X29B 4EWAA 3T2OA 2VJXA 2W1SA 3JBG3 5F1RA 4ZY9A 2MEV1 1YJKA 1W99A 4KNCA 2QQOA 1T6GC 4ZU7A 2FDKA 3VB9A 3BN6A 1LKNA 4AYUA 1Y3TA 3GDBA 4QX3A 1N47A 3BI3A 5CG8A 1VBD2 2RS51 1MS4A 4BISA 1SEFA 2QNKA 3J7MA 3PTRB 4BQYA 3VBHC 3RI8A 3LFMA 1RUC3 3PVEA 3LQCA 2BBAA 2C1FA 4DXSA 2D6PA 3NJYA 4QQLA 2E31A 4MGYE 4GAZA 4S2FA 3U4XA 2PHRA 5E1RA 5FZHA 2CY6A 4YVSC 2MHFA 1WLDA 5GLUA 5C71A 2Y6GA 3E6BA 1OT5A 2DCKA 3RS6A 2W68A 2E51A 1POV1 4O61A 4PBPA 1S0IA 3O1RA 1H2KA 3FC0A 4NPMA 2VMGA 1HB3A 4NPLA 3CQOA 2DDUA 4XIOA 3NQHA 4LO4B 4AEDB 1MS3A 3HBZA 5AFBA 1IZ3A 3FWEA 4YZ1A 4YVWC 3OB8A 3KCYA 3GZAA 3VBSC 1XXNA 3FL7A 1Z7S1 2UYAA 5GZGA 2ZGSA 4D0QA 3U0ZA 2ZOEB 3DPRA 1BVVA 2BNMA 4M3CF 2HWE3 3ELNA 2Y60A 1IKQA 3KZ4C 4BLIA 1WLCA 5FZ3A 1ASJ1 4OI4A 5FY8A 3LKJA 2R071 1KITA 2OUJA 3U4SA 3OBZA 4I3PA 1JBCA 4LITA 2RJKA 1RHI2 3VDDC 2OXBA 3LDRA 5C9AB 2P3IA 1X36A 3GCXA 2FDIA 4XFCA 5DXDA 2ZX0A 4FO9A 4PDWA 2D6NA 1AR61 3MBWA 3KD4A 2JJ6A 1H2MA 1AYM3 2RJLA 3DXUA 3KSCA 4DMIA 5K0UC 1OA4A 4NIGA 2VD7A 5D2AA 1NQDA 2AEYA 3ENRA 1UYXA 4CXYA 4RFRB 1HXS1 3ZLIA 1RITA 4Q0VA 3SH3A 4L0PA 1W6QA 4JGZB 5FZCA 1DLCA 5DAVA 2XL7A 1CAXB 1FV3A 2NP0A 1RUH3 2GSYA 1OKOA 3MICA 1BJQA 3DF0A 3KQRA 4B3NA 3ACFA 2OQ6A 1IKPA 2YPJA 1AJOA 2MEV3 4N8MA 2XLGA 4GH4A 2JG9A 3UGFA 1UZ0A 2YBKA 2WN3A 3P3NA 4AEKA 1JZ5A 2RR11 5FPBA 3BALA 4FOWA 3DGTA 2WNVC 2G9FA 3J9SA 5ACA1 2RE9A 4HANA 1O3SA 5IYYA 1SCRA 4XPVA 2BFUS 1CZSA 1T6BX 5I8YA 1REDA 4LEJA 5FDBA 2R7EB 3ZMOA 5LZ6A 4AI2A 2DF7A 3N9PA 4CE8A 3W5NA 4LO7A 4HZFA 5J98B 3MZHA 4JGYA 1O3TA 1DIWA 2VAUA 3ZYGA 3T0AA 3MEPA 5EQUA 1JUIA 1POV3 2TEPA 4LE4A 3T1MA 3B69A 4RSUA 4FPFA 1S0CA 2ARBA 1E5IA 1UIJA 4H14A 3VHNA 1NCRA 4LXLA 3USSA 4AEDC 4EN9B 5ANQA 3HT2A 2KA3A 2E63A 4FSJA 3OY8A 2ILMA 1OF4A 1GP6A 1E5RA 2WWSA 3AZXA 2F4PA 2R042 5EWSA 4A45A 4GJZA 1UMZA 4BQ3A 1QJU2 2WO3A 2XKPA 2WZR1 3OGGA 3NKTA 3AZVA 2VULA 2OPWA 1ASJ3 1UNBA 5T3NA 4QKDA 3FX3A 3NAPA 3FHIB 3RZZA 4A2UA 5L7OA 2R073 4XF0A 1GQPA 2D5HA 3LEIA 1FAYA 2HWC3 2RV9A 4INDA 4XURA 5LK5A 3AJZA 3V0AA 1UIKA 3T30A 4Q27A 4RS5B 3ZR6A 3JZVA 1WKYA 5C9AC 4W8JA 4K6BA 4S2HA 2XJSA 5L73A 3WQ0A 3M3IA 3WNXA 1JUHA 1D7PM 1F15A 3K75B 4LHLA 1X8EA 2GC1A 2HWB2 1AR63 2Z2SB 4K21A 3WG2A 4YSFA 5I8SA 1X9TA 5KXBA 5BYNA 1KEXA 5A3WA 4IV3A 4XFGA 2FZ1A 3QLQA 4QB1A 4MXWA 3WR0A 1ACCA 1HXS3 1MZ6A 4IETA 2V4VA 5A3NA 3ZIWA 3VHOA 3USUB 1LAJA 4YW7A 1N1SA 1WD3A 2UYBA 4K9SA 4FVVA 1H8VA 1NQJA 2B39A 1OI6A 2Y6HA 3QACA 4LE3A 2WT2A 2BOJA 3WUDA 4MGKE 2YBSA 4J1WA 3LEMA 3RGBA 4CTEA 2B9VA 1POQA 4CSWA 1S0EA 1WZXA 2C9AA 2WQ8A 2RR13 3IIIA 1PVC1 4XFHA 2K46A 3LD8A 3ZIXA 2BERA 2XBO1 4LBKA 5T52A 4ZS3A 1FI2A 4XTMA 3L2YA 1JHNA 4XUTA 2AACA 2XVLA 4N9HA 1EYBA 4LORA 5LY1A 5FYZA 3MIHA 3UKVA 1PGW1 2Q1MA 5LB6A 3O12A 2OS2A 2RMU2 4MG2A 2VVEA 4I3GA 4KG0A 1LGCA 5EYXA 4V2VA 1N3QA 3ETPA 4AR2A 1A6CA 4Q4W2 2BTVC 1CAWA 3PUHA 5EJ1B 1AL0G 2BEOA 2Z79A 4DO0A 3RRDA 2D97A 4JCKA 4OHZA 1H9WA 3UK9A 5IATA 1K12A 2JG8A 5AFEA 2GU9A 4MGTA 2DUPA 5IUQA 5FPZA 2VMDA 1HQNA 1UY0A 4DINB 1COV1 1UOJA 3PVBB 2OZJA 4CDXA 1LR5A 3P1IA 2EXIA 4Q1RA 3M3EA 5DAXA 4QB2A 1ND3B 3JB4C 4AHWA 5EXOA 4Q8KA 4P9IA 5LEKA 5JOXA 2Q8DA 3SMHA 2NQYA 1UY1A 4ES9A 5A6QA 2ZEYA 4R8HA 3T0BA 1GU3A 3UJOA 3I8TA 3IAQA 1OOPB 5DZFA 5A32A 3GBFA 4RS5C 3VD5A 2VOWA 2WL1A 2QQVA 2DTWA 3VKNA 4DB5A 3QH6A 1LGNA 3KF5A 2IXCA 3IN9A 4R9AA 4YYOA 3ZN6B 4UFJA 4OHYA 2WIIB 3WCRA 3S5AA 1ZYBA 3NSTA 2A6VA 4QDRA 1C8M1 5IWFA 4XAEA 5FXWA 2ZMNA 2CGPA 5KC5A 3MIDA 3WNMA 2QQIA 5FY9A 3I2IA 5DQ0A 2I07B 5LBCA 2VQ0A 3IWZA 2W52A 3ME2A 1NY72 2PHUA 2VMFA 3VL8A 5FZMA 2JDHA 3VN4A 5KHKA 4QKBA 4JKMA 1O8PA 1W39A 3TBDA 1XYPA 1FPN1 4IGPA 1XE7A 2VQAA 1NKGA 5BNNA 1FYUA 1JHJA 5A80A 2IXHA 5FY0A 3SC7X 4XFIA 2HYXA 1L7RA 4JTOA 4KGQA 4DFSA 4YZ5A 2VZUA 2XLFA 4XFFA 3ZFFA 4Z1VA 4LO8A 4XJ9A 3OF1A 1EUTA 1PVC3 1YIFA 1VB2A 1VBB3 2B7YA 4QPIB 1BEV2 2C9KA 2GNMA 2LUWA 2XBO3 2XXZA 5L9RA 5JCTA 1BBT1 5FZAA 2UWCA 2V09A 4J25A 4YW4A 2ZPXA 4OMCA 2W95A 3MW2A 3WNKA 1LEDA 4D69A 3RZJA 2J22A 2YGLA 3J8F2 5I0UA 2CDPA 3AFKA 5ERLA 3PU3A 1AR91 3BODA 4LK6A 1EUUA 1W04A 2HWD2 2RM22 4L8QA 2W3JA 5FYCA 3KGLA 5IFTA 4OI0A 1RUG2 1ODMA 4Y1VA 4IEUA 3WNLA 1LECA 3GBGA 3I97A 4DEVA 4TSVA 2BWCA 3TWIA 4WM8B 4FTEA 1EPZA 2ZHLA 4UF0B 1OC1A 1AZDA 2VOKA 4NMIA 2B9UA 5JXHA 1EV11 2L9LA 3IDEA 5EJZB 5EYYA 1YRZA 4Y3OA 1W8FA 3A21A 4AEJA 4EZHA 5F9TA 5A1AA 1ND3C 3K51A 3ZX7A 5AC93 2PHDA 1DFQA 3I54A 2OA2A 3AK0A 4UFHA 5I0TA 3WX5A 3O1OA 5KXDA 1GV9A 2UWAA 3AKPA 1OSGA 1BHGA 3WDUA 2DVAA 4NPRA 1OOPC 1W8WA 3IKWA 3L2HA 3R05A 3NMBA 1JOJA 2A3YA 1A78A 1PO11 1Z0HA 3BVCA 5FZBA 1QJFA 4MGIE 5H9QA 4UW5A 3IDAA 2Q0AA 1RJ8A 4E2GA 5HCHA 1FX5A 1C8M3 3LSDA 3OYWB 1SLTA 4P9WA 1OBNA 2LW8A 4OHVA 4Q4V2 4PF1A 2OQ7A 3S6PA 4BQ1A 2ZEWA 1OF3A 3D0JA 3VGIA 4G3YC 4AQTA 5DABA 3NRUA 4BDVB 1VBE2 4YW6A 3ZFEA 1RUI2 3WQBA 4PBOA 3IT8A 4HN0A 1KDMA 5JOZA 5IFPA 3CZJA 4IEYA 1OUXA 1FPN3 4WVVA 3WD5A 3VD9A 1OQ1A 2VZVA 1QOOA 2WFF2 2IC1A 1Y4WA 3PMEA 4XIKA 5BNOA 1JH5A 3R4UA 1X8MA 4QU1A 2XMLA 1LHNA 3EB7A 3JUUA 1U5IA 1YQ2A 2EAAA 1Q8VA 4B1MA 2Q4SA 3SEEA 2WLPA 4YG3A 1PX4A 4MXVA 5KWRA 3PIGA 1WA6X 4LMFA 1S0DA 1AYN2 4CP9B 3EO6A 1JS9A 4FOYA 1SDDB 2Y34A 1BBT3 3OUHA 5EV7A 4CDQA 5FP7A 3KHCA 3C7EA 5F37A 3AP4A 4XFBA 3AL5A 2PELA 1QJEA 3ABZA 4H7LA 1UXXX 5G05L 3SKJE 1DYPA 2ZGOA 3B00A 4WVWA 2XWBB 4XJAA 2AUYA 2QZ3A 4FP2A 4YPJA 4JDMA 3WF0A 1IS5A 3RWKX 2GAUA 1GYKA 3OPWA 4QGLA 4CEWB 4H55A 3DN7A 4OHWA 5JR7B 4JVAA 2OKXA 3OPTA 1ZBA2 5BPXA 3NJVA 4WM8C 4GJYA 1ULEA 3CJIB 4LHSA 3VZOA 1QGLA 4ATEA 4CU7A 1HB1A 4HONA 5T55A 1QKQA 2P34A 1M4WA 3WINE 4C8DA 2Z5WA 1DDLA 4DIQA 1W3XA 1B09A 1VBC2 3THPA 4JV4A 3LCPA 4QX5A 5CFCA 3WLUA 2A3WA 5CKNA 1US2A 5A7WB 4XTPA 3CF6E 4XXPA 5IVJA 1ONAA 3S5QA 5FYVA 4D7TA 1UU6A 5F8PA 5FPVA 3WNOA 1AL22 3KQ4B 1PO13 4RHV1 3I59A 2QFEA 1J3QA 1SBFA 2FCTA 1RGSA 1E57A 2XUEA 2DFCA 3LA3A 4AVVA 4M4RA 1ZM1A 4ZXEA 4DEQA 5IVBA 2XJRA 1GBGA 1Q3EA 4TZDA 3VBOB 1WCDJ 2ZEZA 4HVRA 3K4ZA 3ZO0B 4L2NA 3TAYA 4CCMA 4MOAA 2BNOA 3LGRA 4COUA 4ZONA 1YUDA 2Y6KA 2A6XA 5I0SA 1W2AX 2CNAA 3OPZA 4FXGB 4ISQA 1IPKA 1V6NA 1CPMA 4QPGB 1SLIA 2FDFA 5FCCA 3D82A 3AJYA 2VCAA 2Z42A 5HXVA 5L36A 2PLV1 4R9DA 3WSOA 1PZ9A 2NM1A 3FUQA 1SACA 4AFCA 1LHOA 3H3UA 5A3PA 4UFMA 3BTYA 3IAPA 1H6XA 5GZEA 1Q8SA 4DY3A 3ACLA 4Q29A 2VZSA 4QKNA 1XE0A 2Q8EA 5J09A 3BYWA 4QGNA 5FAXA 3N35A 4XXAA 3SHRA 4A6OA 5IVCA 1GANA 5FZ8A 3NVCA 3ITQA 4FPJA 4MGQA 4WVMA 1W6MB 2VC9A 5KC6A 2J1TA 3OGSA 3OEBA 1W03A 4XILA 5I8TA 1RUF2 1XQNA 2R041 4ISRA 5FZKA 2PAKA 2YYOA 2GMMA 3WF2A 2WKKA 3KV9A 4CEWC 1OFSA 4L92A 3ACGA 1MS8A 4JAAA 1W9SA 1CQ9A 4CU9A 5G04L 4LBOA 3WZ1A 5BV6A 2PHTA 4LTAA 4DRRA 1C5HA 3CJIC 2R063 3W58A 3N9OA 5IAVA 1LOBA 2HYKA 1I5ZA 1QWRA 4M01A 5GM0A 3ILRA 2YC0A 5C3RA 1V6JA 1V6LA 3C7FA 1JU4A 4LKDA 1ZBE2 4CEYA 5A6XA 2QQUA 1R1A2 2HWB1 3Q8AA 3LB9A 4XDQA 4QHBA 1U5YA 5CKQA 1ZZ9A 5HBAA 3FHAA 4RHV3 2OYZA 3GCWA 1J3PA 1TMF2 1E5SA 2QVSB 2Y8KA 3UYJA 2XQXA 4X6QB 4JX0A 4OQ8A 3URFA 4BQ5A 3WHTA 3JXSA 3VBOC 2DCYA 2CGOA 3I3QA 1RUE2 4KH9A 1NT0A 1C3HA 4AVSA 2CHHA 4D3WA 3I3DA 1BQPA 2HWF2 4URAA 5FR3A 1F2NA 4LA2A 4Y24A 3WQ1A 4IE5A 2WYSA 3UT0A 3HQUA 3ON7A 4PI0A 3ZFGC 1BXHA 4QPGC 4F8AA 2BU9A 5ABJC 2YZ4A 1PZ7A 4B4RA 2D3RA 4LNVA 2W94A 3KB5A 4JRLA 3B93A 4P5YA 2ZZJA 4GD4A 1OA3A 3W21A 4QX0A 3M7AA 4AL9A 2PLV3 1G9BA 4YG6A 1R081 1VAMA 1GOFA 3B9IA 3PUSA 2O14A 3AVRA 2VR4A 4JKLA 1UZYA 2VBDA 3AXEA 4Q4Y2 1YQ5A 4XZPA 1W9WA 4QX7A 5C4WA 1V6OA 2R16A 4META 1EAH3 5BUVA 3WP5A 4XJWA 2RMU1 3I2FA 1UZVA 4MX3A 3DPRB 2X05A 1SPPA 1N3OA 2QQNA 3RFRA 4AVCA 1WCQA 2VQUA 4O9EA 3FFZA 2SBAA 3J7LA 4Q4W1 5A7QA 1QY4A 5GLTA 3M3OA 2A1XA 4Q8LA 1LCLA 1DYOA 1S0FA 1W8UA 3OGVA 3NNJA 1WCSA 3MUZ1 1DQ2A 4LULA 5F2WA 4FOQA 4B7KA 3AYDA 1G9DA 2R043 3GGLA 5FFOC 4YVSB 5FZGA 1ZRFA 2WFPA 1QOTA 1MEC3 4FPCA 4A7KA 2UURA 1ULCA 2VNRA 3LFIA 4C0BA 4PDWB 5HPOA 2YV8A 3C8XA 3VZLA 5LASA 3HIFA 4XF4A 1F4AA 5EHDA 1D0HA 2IXJA 2VBBA 3ACIA 4N43A 2F4LA 2OZ6A 4YVWB 3WW4A 1W28A 1H8TA 1W6QB 4W6WA 4BZ4A 5EFUA 4IEVA 5FKCA 2P3KA 5HI0A 1D4VB 1RJ7A 2C26A 3MW3A 5FP8A 4HBNA 1MS1A 2E7QA 3ACHA 2WABA 2VW1A 4ASLA 1B35A 1PK6A 5BNPC 4OUSA 4R52A 1KXGA 3EXUA 3HQRA 4GH4B 3Q8FA 1UU4A 2JG9B 3DL3A 5CFDA 1C57A 1QQP2 3ZPOA 2WRAA 5FZOA 1VB4A 4PLMA 1UAIA 2EF6A 2R30A 4IGOA 2GH8A 2WWUA 3FMGA 4ARYA 1J58A 1FOD1 1NY71 1HV0A 1X82A 2TNFA 2ZGRA 3DV8A 3HVDA 3K3NA 4NWWA 2NMNA 1VR3A 4JRAA 4IV1A 1QJY1 3Q8BA 4IEPA 4WM7A 3ZXLA 4DXZA 2ID4A 3L9JT 4EN8B 4BQ2A 2VCBA 2RG4A 5HV4A 1M06G 1XRUA 1HJGA 2AC1A 1W9FA 1BK1A 4YM3A 3HR9A 1K45A 1UCXA 1BEV1 2VZ3A 3IIAA 5FUPA 3TN92 3KT7A 4N7UA 4DRVA 3THDA 2E53A 4ASMB 1NCRB 1A8DA 2ZS6B 1R083 2KR2A 1LU1A 1NA1A 4HMZA 4Y1XA 1UX7A 4W6YA 3OY8B 1F5FA 2P37A 5IVFA 3VZNA 4AQ2A 2JDPA 3O0VA 1EY2A 4XC9A 3E97A 2ADDA 1TME1 3MFCA 2XVGA 3J8F1 3JB8A 5DN2A 1LJ7A 3DPRC 3CHXA 3J7NA 3ALQA 2P2KA 4MV2A 1FMD2 1LRHA 2RM21 1SQ4A 2B5HA 1W0NA 2WNVB 4JC1A 5JI9A 1QNYA 3FHQA 3H0OA 2YBPA 1Q8QA 1XB9A 2E32A 3C7HA 3I3BA 3NAPB 1UN1A 4M00A 5GJ6A 2D44A 3E1F1 1X7NA 3A7QA 2QQMA 2QKDA 3E5QA 4CDUA 2E26A 5C3SA 5F5QA 3V0AB 1PO22 2ARXA 1VBA1 5FWEA 2JICA 4HSLA 2A7AA 4AFDA 3KVBA 3N9QA 1C8NA 2IXLA 2WAAA 2C24A 2VOTA 2G9GA 4FAGA 5DPNA 1DCSA 4PDWC 4QWNA 1O91A 4PQ9A 1OH4A 4CU8A 1V00A 2QCSB 4QX8A 4XJZA 4EV0A 5A7NA 1MZFA 5C3PA 1AXKA 1UOGA 1AUYA 2CTVA 3CZUA 4MXWB 4XFAA 3VZKA 3AVSA 2WUHA 2W92A 5C5TA 4JTNA 5IJRA 1OQEA 2FMDA 4A7YA 3AX4A 1I3HA 4IUGA 2BNNA 5E16A 5JI7A 3WCSA 1O4TA 4QHOA 5JSRA 3ZYRA 1UF2C 5CIRA 2AH2A 3H1YA 4XAAA 3LEGA 2ARCA 1DGLA 5IVVA 3NJXA 4BA6A 2RS31 4E2QA 1SFPA 4GMP1 4C1XA 4GH4C 1KJRA 2JG9C 2WO1A 3GJBA 1JI6A 1QNWA 1UOFA 2VVDA 4Q4V1 3RMXA 5J36A 3H1WA 1OURA 1LHUA 1WGPA 1FOD3 4BH9A 1VBE1 3A4UA 5L7OB 1RUI1 1VMJA 1W6OA 2ZGQA 1QJY3 1XYOA 3POBA 1XC6A 3AP9A 4GB31 3WUCA 3KV6A 5KHIA 1LODA 5FP3A 4P9XA 4D8MA 3KS7A 1GOHA 1ENRA 4MVTA 4W4ZA 4AGVA 3WDTA 1G9AA 2HBTA 3AP5A 1SLCA 3T4HB 3W5MA 4JGYC 2O0OA 4KBBA 3NNFA 2Q8CA 4UFKA 3WHUA 1VRH3 4FQZA 3NV2A 1NG0A 1S0JA 1WWYA 1WCKA 2DCTA 1H2NA 3P6BA 1YQ8A 2PHXA 4MYEA 3BB6A 4WVZA 1NCRC 1LOFA 4GIQA 4IE0A 3VBUA 3LE0A 1YFWA 5FY4A 2TUNA 1R64A 1YXWA 1X33A 2XDVA 5FRAA 2JG8B 1QDOA 1CAVA 1F35A 1TME3 2DUOA 3HBKA 2YXSA 3KT1A 3J8F3 4YLZA 2WNEA 1QMJA 3E6CC 1R092 1HRV1 2WT0A 4IERA 4CDXB 2ET7A 4CUBA 1RL3A 2ZGTA 1JOBA 5FJKA 1IQDC 5C8WA 2RS53 3NAPC 4EN7B 4EROA 2WT1A 2VH9A 5ANNA 3CDZB 3WNNA 5L7OC 3RI9A 2DURA 3T1LA 4DOUA 3I2JA 1QIQA 5A32B 4NAMA 1VBA3 3ST7A 1STMA 1JZ3A 3WVJA 5KHHA 1UKRA 3MV11 3LWCA 1AR82 4A3ZA 3U07A 2VGDA 3VBFA 4YW5A 1D4M1 5CYYA 4GWIA 4HKOA 1W9TA 1VBC1 3ZR5A 4QMAA 3TRSB 4XJ8A 3TNQA 5BNQA 2BZDA 1IS4A 4IV3C 1AVBA 3PVNA 1U5XA 1RUD1 3G7DA 2VY0A 1S2EA 2JXAA 3QD6A 5I0DA 5DMYA 3N7JA 3JQWA 4QDQA 1Z7S3 2XVKA 3POFA 5CISA 1BYHA 3AZWA 5BNNB 2YU2A 1H0BA 1ULPA 3EBRA 2RS33 1NYWA 3FE5A 1WW4A 4UBGA 3ZFFB 2QDRA 2JDUA 1VJ2A 2QZ2A 4V1PA 3NV4A 1IG3A 2X5IA 2EA7A 4GWMA 1APNA 1W6PA 2GNTA 1RUI3 2NLRA 3ZXEA 1YQCA 5CU1A 5FMCA 5GALA 1OKQA 4WBBA 4GB33 3AKQA 1QOSA 2W39A 3WEZA 4TLGA 1DF0A 4HOOA 2FDGA 3SCGA 2WO2A 1GWLA 1DQ6A 2KD7A 1OQDA 2DU0A 1NZCA 1K5JA 5FMDA 4GWJA 2QQKA 1UZZA 4XBQA 5DUXA 3T08A 4U36A 2QTWB 4L9BA 4LHKA 2DBIA 1HV1A 1DQ1A 2JDZA 1DBNA 1UD1A 5CAZA 3VD4A 2WS92 2HLEA 3MHZA 1W0OA 5DDJ2 1RVF1 2JG8C 3IZOA 3OGRA 4BMEA 3H9AA 5AVPA 1HRV3 4A41A 1QJX2 1JODA 2D98A 2RS12 1NCQA 3NL1A 4CDXC 4Q5OA 3CO2A 5ACA3 1CX1A 2CWMA 2JDAA 5JMOA 1CD3G 2NYYA 2ZA9A 1V9U1 2J1RA 2YDEA 3UV9A 3ZYPA 5IT6A 3QBQA 3SH5A 2CL2A 3TYJA 1CIWA 2BUKA 1CWPA 3AYEA 3PDQA 5LY2A 2K2SA 3CIHA 3MLLA 3HN3A 1KQRA 1D4M3 4LBQA 2ET1A 3O7OA 3O1TA 5DAWA 3POJA 1G8WA 2BBVA 2QJVA 1HIXA 5C70A 3LA7A 5K4LA 4XUQA 3NWKA 3DEMA 4AI0A 1UPIA 1RUD3 2V73A 2WC2A 3MV01 4XF1A 4EWDA 2X29A 1XJAA 3ZYJB 3ZFEB 1MQTA 3BOWA 5CVRA 1O3QA 2O8QA 1AXZA 3A0NA 5J1XA 1O5LA 2H0VA 4NN0A 1U12A 2ZHMA 2WZR3 1ULGA 2WJSA 4OCTA 5BNNC 5BNOB 2FCVA 3LPGA 4L11A 4D6QA 3WG1A 5CEHA 2WINB 3GHNA 1Y43B 1SFYA 4JGZA 5DG1A 3ZFFC 1CESA 4UFIA 5FMBA 1WCUA 3WW2A 1RMU2 2VUAA 3INAA 4XBLA 4C1WA 4DXTA 3N36A 3IMNA 4XACA 4BCUA 4HVOA 1HX6A 2DUQA 2PAEA 2R0HA 1RUC2 4CDQB 1XSRA 2J1AA 2A73B 1S2KA 2A75A 3AFGA 5FYTA 4KQ7A 5C3QA 2IFRA 2G19A 4Z2AA 1N1VA 2FCUA 4FP3A 1HRI1 1WW6A 1W8TA 2ZBJA 1DQ4A 4IXLA 4Q4Y1 4XMAA 2J42A 2PA7A 4LOSA 1SBDA 1OMIA 1XNAA 2ZABA 4I30A 4R4XA 4CP0A 2RDRA 4X6RB 4OQ9A 4G9SB 2B8MA 5A1LA 3OOXA 3LA2A 1XNBA 5DG2A 4K7JA 1KDKA 4DUWA 1OD3A 1POV0 1IS3A 2VMEA 1GNZA 4XDOA 1TNRA 1OLRA 1TE1B 3D4KA 2QBXA 3H1MA 1RIRA 2EIGA 1RVF3 1ZRIA 3EJKA 4QQPA 1GSLA 3F2ZA 5L9BA 5FZLA 1Y7BA 2G4IA 1SBEA 2I74A 4JHZA 4NIDA 2N7GA 3BPSA 3AMQA 1AX2A 3RMYA 2VUCA 4Q1PA 1HQLA 2BFUL 3RNSA 5CFCB 1G9CA 5FOBB 5F6LB 2D6MA 3BOPA 2ZMKA 3NNLA 1D2SA 1V9U3 1H4HA 2YG0A 5FTTC 1UMHA 3QCWA 3EQEA 4Y5Z0 2BW8A 5FYUA 5C5UA 2ORXA 5JXJA 5JVVA 3SCHA 4FQ4A 3RWNA 3NNGA 3POSA 5F5CA 2ZAHA 2YC2A 4GKXA 2BRTA 3E6DA 4W50A 2ETEA 1V0AA 1X50A 2SLIA 3R4DB 3HNMA 4NHXA 4RN5A 2GDFA 4XJUA 1GQGA 1J3RA 2UY8A 3VUOA 3K4AA 1R1ZA 4X8PA 1RB8G 1OPOA 3MIGA 4ZHNA 5IHRA 4K40A 2VOVA 2ZX2A 3QH7A 4O65A 3EMRA 4CA9A 4N90A 4AI9A 2GC2A 1QQP1 3M70A 3ZFEC 1COV3 1RUJ2 4A6SA 1PIV2 2WNUA 1J1LA 5FIXA 3VZMA 1XNCA 4R9BA 5LEJA 1DQ0A 2MEV2 2DTYA 3Q8EA 4ASKA 3VHRA 4E4SA 1VAVA 5BNOC 2VXRA 2Y38A 3J4UH 3PTYA 4GQ7A 4HKWA 3ZXDA 5T50A 4CCCA 2C5DA 4KWJA 5CADA 4B7EA 1WLWA 1NZIA 3DCQA 1S55A 3DUIA 4KWUA 4S2GA 3T09A 4TYSA 1V70A 2EVXA 4Q4X2 2OT7A 5FV3A 1A3KA 4DS0A 5FXZA 3ZSMA 4RR3A 3TEZA 1LHWA 1H30A 4CDQC 4E8CA 1YFXA 3IPVA 1ZRCA 2DCZA 1C1LA 4GXLA 3ZPYA 3HWJA 4Y22B 5C33A 2BGCA 1ZRRA 2W46A 2VVFA 1HRI3 3LIHA 3OCPA 3K4DA 3PHMA 4WVMB 2PYTA 4K3UA 2MNGA 4KMQA 4SLIA 3ZN4A 4Q4Y3 3W20A 4E4HA 2FMYA 4ZS2A 3RZHA 1IGOA 1OVPA 2VMIA 1XNKA 3LDKA 3CU7A 5LA9A 5BY5A 3PUAA 1UY2A 2WO7A 2JDKA 3SITA 2ENRA 3OGJA 2ZGUA 4LBLA 1FMD1 3BTAA 1DGWA 4RGAA 1ZZCA 3BPZA 4PF5A 1JZ2A 1VBD1 2VW2A 5FMOS 4EQVA 3POEA 4XF3A 3ILFA 4OUMA 5DUWA 4UYBA 1UYPA 4Q0PA 5A7PA 3NW4A 1W0PA 3QOPA 1ASJ2 1PO21 1ENXA 1SZBA 2VM9A 5LRRA 1YWKA 2XQRA 4DUVA 4UW6A 2VU9A 1HN1A 2IWGB 5CFCC 4FPGA 3M4FA 2HWC2 4FFIA 4HG6B 1F9KA 4CEYB 1FATA 1CPNA 1US3A 4DNYA 3CKHA 3T2PA 4EYUA 4LPLA 1GZ9A 3J7HA 1OHFA 1AR62 5SV5A 2VTFA 4YGDA 2CWSA 2ZEXA 3FLTA 4I2OA 2IUWA 4R9CA 5HCAA 2IZWA 3ZXAC 1AR93 1S4CA 1UQXA 3Q8CA 4FT8A 4NIAA 4HL0A 1ZZ7A 3AB0A 3LSEA 4I01A 4BXSV 4TN7A 2ZCWA 3EHKA 2P17A 1VMFA 1GUIA 1VRBA 2GALA 2ZJCA 4F83A 4XUPA 4YZ4A 4UXAA 1RUNA 2A6ZA 4HFSA 4CCEA 1J59A 1EV13 1RHI1 1NLRA 1CN1A 1ZA4A 2ZX4A 4QXHA 4AFAA 2AENA 2DU1A 2TBVA 1Q8OA 4HLTA 4YM2A 1VMHA 2YGMA 2Q1FA 4QKFA 4NRMA 3SH4A 5C4WB 5FO8B 1TG7A 3WF4A 4RD7A 2YY1A 3WW1A 3IB3A 5FO7B 4CCJA 1SPPB 2ZXQA 4DPNA 4QXBA 4ZZ8A 4ES8A 4KBZA 3HPNA 4L99A 2GP3A 4D6SA 4AXOA 4B4PA 3ZXGA 2XGXA 1MACA 1W6NA 3ZKUA 3KLSA 4QPIA 3BCWA 2IVIB 3H7JA 4CP1A 2OUHA 4NRQA 2WSVA 2XONA 4AWDA 3AC0A 1NUKA 4OFGA 5IK7A 3ZFGB 1J84A 1XE8A 5LBFA 1R091 3IMMA 3ZVXA 2ADEA 5ABJB 5CG9A 5J48A 1LHVA 2ZX1A 5FLJA 4CPBA 1VBD3 4MLOA 5F2SA 4Y33A 3R0RA 3ZXKA 3LZZA 1Y9MA 4LO6B 2VW0A 4HK8A 4N43B 5DAPA 4BHPA 3RZLA 1H8TB 3T2TA 3HT1A 4I09A 5FOJB 4K1ZA 1AR81 3JD72 5FZ1A 2QQPA 1GWKA 3ZYHA 3JQXA 3AYAA 4QXCA 4CEYC 5I93A 4NIHA 1NXD1 3CBNA 5C8CA 1B35B 1WD4A 1PK6B 1YCIA 2W91A 1K5MA 5FZIA 3PIJA 3PL0A 5A3UA 1UX6A 5CFDB 2DFBA 3R4SA 4RQPA 5D8AA 2Q1ZB 4IGQA 2HEYF 5FZOB 3C2UA 1BMV2 3FLPA 1YYNA 3B02A 2I45A 5EIYB 3O1UA 5GZFA 2WLQA 4W65A 1KD7A 4KWKA 5DUVA 1OH3A 1QJU1 4WM7B 1NX9A 2RVAA 4XHBA 3T4VA 4AGRA 2JX9A 4GKYA 3TNPB 5E6HA 4ATFA 1W2OA 3WDXA 1XNTA 4RA0A 2R49A 4YRDA 4CZSA 3IDCB 3VKLA 5M0TA 3BTXA 4BK4A 1RHI3 2QQWA 2XB6C 3CMGA 2YPDA 3D8CA 3U75A 1H6YA 5LK7B 4FPYA 3VBRA 5DUUA 4CP2A 1H9PA 2ATFA 1GNHA 5B4NA 3PUIA 5A1FA 1VBB2 1WLTA 1NA1B 4N53A 2XHKA 4LBMA 5BNPB 5C4WC 1LB2A 4YWAA 5FQ0A 5T5JA 3BTZA 4ZU4A 1LENA 5FYYA 3SEPA 2GP5A 1XOYA 3ORJA 3B5LB 4KU7A 4E9KA 3ZXFA 2XLAA 1RTVA 1BVP1 3GJAA 1DU3D 2R1BA 2VMHA 3AP7A 4IEWA 4CDUB 3GBWA 1F5JA 1WMEA 1UYYA 2VZRA 4JQRA 4OZOA 3K3OA 3THTA 4ORFA 3LEKA 4LLOA 3DKWA 5H9SA 4B4QA 4B29A 5BXXA 1AX0A 4P14A 5JPNB 1UL9A 2Z69A 4H2AA 4WZFA 2JIJA 4AQ6A 4CDWA 1PMIA 1R093 5E88A 1QJX1 3LIGA 5FMOL 4BWOA 2CU5A 4LBJA 4M3CA 4XW3A 4YGEA 2LROA 3M1HA 4Y1YA 2WZEA 1QXPA 1W9YA 3WV6A 4N43C 4B8EA 4LKEA 1UW8A 4X8NA 5EP9A 1H8TC 3H3ZA 3MUY1 4KG8A 5A3MA 5AC92 2B45X 4I0WB 1OLQA 3O1SA 1AR83 4NHYA 3U11A 4N9IA 4URTA 2EXHA 5E89A 1K42A 3OTFA 1B35C 1OLMA 1PK6C 1YNAA 4MHUA 4FAHA 4LQRA 3V64A 4E27A 3RG0A 3JCIA 4AFBA 2WWJA 1PVXA 4DZGA 2D43A 3TB0A 4DUXA 5CFDC 2CGNA 1CJPA 3GHMA 4NHLA 3P3PA 3PVOA 4R4ZA 1W90A 4BQXA 3FBMA 3BUCA 3WG3A 2CSGA 1L7LA 2VBPA 1W6OB 2YHJA 4XUNA 1H1MA 1QJU3 4AZZA 1JYIA 4WM7C 4XYXA 2E33A 4LUKA 5FPUA 1I6XA 3CEWA 2X8KA 3WDVA 2YFZA 4COYA 1GWMA 2P6CA 2RDSA 3UJQA 3WOGA 4NHMA 2V4AA 2IXIA 1RMU1 4QQOA 4MZUA 1QJZA 4XOGA 4Y20A 1CAUA 5A33A 3MFAA 1C28A 2XJPA 1RUC1 4EJRA 4A42A 3AZZA 2HWB3 3VBUB 5F5IA 5FUIA 3B01A 1NA1C 3N7LA 2JDNA 5FK8A 1LGBA 3ZSJA 5D1IA 4GALA 3RZKA 1PNGA 1X9PA 1BBT2 2A5ZA 3H8RA 1CAVB 1QF3A 1VPHA 2JD9A 5JSOA 4BMBA 5JZGA 2ZKLA 3MYXA 1EP0A 1JTZX 3JU9A 3I2HA 1FNZA 3MF9A 3SKVA 2YMZA 4E8DA 2IVJA 4PIYA 5FLHA 3RVHA 5KHGA 4CDUC 1VP6A 2XL9A 4ZPIA 2JB8A 4AHYA 2YUEA 4XZUG 3KF3A 5FZ6A 5KHJA 5LRSA 1JU3A 1JZ7A 1CR7A 3HNYM 3KCCA 4JGYB 5FYIA 3VBFB 1O3RA 1QJX3 5LW9A 1SHWB 3IBMA 4QXKA 4CU6A 3KVAA 2B42B 1ZRDA 3MIEA 2GZWA 5JUVA 1PMJX 3O5SA 2FD8A 3AKTA 3C3VA 1OXCA 3GM8A 4JDOA 1DZRA 1GMMA 4AF9A 1N3PA 3FFQA 1TNFA 4AI1A 4D7SA 4RFT0 2LRPA 1DLLA 3GF6A 1E5HA 5KXCA 4XETA 2WBKA 5F7UA 3PNAA 3RZGA 4LT5A 1Y9GA 4EE2A 3TEYA 2RMU3 1KS5A 3AMPA 1LOCA 1UWWA 2W5FA 1UMIA 1HB4A 5JXIA 2P3JA 1CGPA 2C0ZA 4AE2A 2HWD1 2MPFA 5EPAA 4P9LA 1PGL2 1RUG1 4Q4W3 4XHXA 1OFNA 2E7TA 3VKOA 3WNPA 1Q5OA 3UKNA 3M3QA 4K8RB 1LTEA 3RJRA 1SDWA 4YGBA 2X5IB 2X53S 4XQWA 1W6PB 5FY7A 2YU1A 5C7GA 4P5HA 1JOPA 4AEMA 1RUJ1 3SQOA 1PIV1 4QQHA 3N3HA 4P00B 2DCJA 2C4XA 1G7YA 2EIDA 3ASIA 1W8ZA 3MPPG 1VLNA 2IXKA 5K8SA 2RDNA 3OBRA 2PTMA 4IV3B 3WY6A 3HAGA 2H6CA 2ZGKA 2AYHA 3RYPA 3U78A 1IS6A 4JQTA 1RMU3 2W1UA 4Q4X1 3O0XA
chains in the Genus database with same CATH topology
2ZEWA 2JDAA 3UESA 1OF3A 1RYYA 5JMOA 2J1RA 4BDVB 3NRUA 4ZZ5A 3WQBA 5IFPA 3CZJA 3VD9A 2VZVA 2VZQA 2W87A 3CIHA 3HN3A 2WAOA 5C70A 1JYXA 3EB7A 1YQ2A 2EIBA 4PQQA 4XUQA 4KI5M 3SEEA 1PX4A 3MV01 3DYOA 1SDDB 2W9XA 4QDSA 3C7EA 5HXMA 3HOBA 5J1XA 1JZ4A 3DYMA 3VD7A 1W8OA 3ABZA 1UXXX 5G05L 2VZOA 3LPGA 3SKJE 3VD3A 1UXZA 4YPJA 3WF0A 2EICA 5LA2A 4DXTA 5B4XA 2PQSA 2VZTA 2J1EA 2OKXA 2J1AA 3NJVA 2B4KA 1T2XA 4LHSA 4CU7A 3ZM8A 4Z2AA 2VO5A 4AG4A 1W8NA 2ORZA 4CUAA 1XNAA 1US2A 2YB7A 3T0DA 1XPWA 4DUWA 1OD3A 2VMEA 3WNOA 4ARXA 4BJ0A 2QBXA 1UY3A 3WF3A 3F2ZA 4M4RA 4ZXEA 4DEQA 4JHZA 2ZEZA 3K4ZA 4ET7A 1I5PA 4MOAA 4CUCA 3U37A 1JYNA 1O8SA 3DECA 2YG0A 2Y6KA 4OUEA 1UMHA 3K77A 2ORXA 5JXJA 2J1VA 5JXGA 3NNGA 4M4PA 2YC2A 2VZPA 4W50A 3ECQA 4RN5A 3HNMA 3UNPA 2VCAA 3WSOA 2Z4FA 3K4AA 5LA0A 4XVHA 5IHRA 4UOJA 1GNYA 3IAPA 1H6XA 2YC4A 2X09A 3GXUA 4RYDA 2VZSA 4A6OA 4TTGA 4MGQA 2VC9A 1TVGA 2J1TA 3OGSA 3OEBA 4KWUA 3T09A 3A22A 1CZVA 3WF2A 3FN9A 3T2OA 2VJXA 1SG3A 2W1SA 3ACGA 1W9SA 4ZY9A 4CU9A 4E8CA 1W99A 5G04L 2QQOA 4JKKA 4QX1A 3BN6A 2WDBA 3GDBA 2W46A 4QX3A 4P02B 3K4DA 4KMQA 3C7FA 3W5MA 1JU4A 4DXSA 3LQCA 2BBAA 2J1UA 4GZ9A 2E31A 1UY2A 1JYWA 2V72A 4PT6A 5C71A 2Y6GA 3FHAA 1OT5A 2WN2A 2DCKA 3LPFA 1JZ2A 2W1QA 2Y8KA 2XQXA 2VL4A 4JX0A 3CQOA 2DDUA 3NQHA 3JXSA 2VM9A 4DUVA 3OB8A 1HN1A 4HG6B 3I3DA 3FL7A 4D0QA 1US3A 2WYSA 2Y64A 3CKHA 3T2PA 4LPLA 1K3IA 3VDAA 3J7HA 2VTFA 2ZEXA 2W94A 4P5YA 4QX0A 3HEIA 2J1SA 1GOFA 4LKSA 2VR4A 4JKLA 1W9WA 4BXSV 2JKXA 2VQTA 3MBWA 3I2FA 1GUIA 2X05A 4XUPA 2QQNA 1WCQA 2VQUA 3I3EA 5LCWL 1UYXA 3K46A 4L0PA 1DLCA 1DYOA 3OGVA 3MUZ1 3A23A 1DP0A 3GGLA 1TG7A 3WF4A 4OYUA 3ACFA 2Y6LA 3IB3A 5HPOA 3C8XA 2ZXQA 1F4AA 1UZ0A 4ZZ8A 4MGSA 2WN3A 1JZ5A 3HPNA 3DYPA 2JE8A 3ACIA 5IYYA 1CZTA 4MADA 1CZSA 3C7GA 2C26A 2XONA 3ACHA 3AC0A 1NUKA 2R7EB 2WABA 1J84A 3HJRA 3W5NA 1JZ8A 3THCA 3T0AA 2VZ1A 2Y6JA 4ARYA 1O59A 2ID4A 1OF4A 2VCBA 4A45A 4P08A 2W91A 2WO3A 2VCCA 2LS6A 4FI9A 2VMCA 1K45A 2VZ3A 1GQPA 3THDA 3LEIA 5EIYB 2RV9A 4XURA 2CDOA 3OEAA 4MO3M 4UI9L 1WKYA 1UX7A 1NX9A 4W8JA 2RVAA 1D7PM 3K75B 1XNTA 5DN2A 1KEXA 1W0NA 4QB1A 4BK4A 3FHQA 3CMGA 2V4VA 1H6YA 2E32A 3C7HA 3I3BA 3E1F1 3A7QA 2QQMA 3EYPA 4CVUA 2E26A 5B4NA 3PUIA 1P8JA 2Y6HA 2WAAA 2VOTA 4A44A 5DPNA 3SEPA 1OH4A 4CU8A 2B9VA 2QQLA 3CZUA 2WQ8A 3IIIA 5JR2A 2WUHA 2W92A 5IJRA 2BERA 1UYYA 2VZRA 4IUGA 4OZOA 3LEKA 4XUTA 1F4HA 1J83A 3LEGA 2YFUA 1CIYA 3NJXA 4QB6A 3OBAA 2WO1A 1JI6A 3ETPA 3WF1A 2WZEA 3D3AA 5LA1A 5EJ1B 3PUHA 2X10A 3MUY1 2W1WA 1XC6A 1K12A 4XUOA 4D8MA 1GOHA 2VMDA 1UY0A 2BGOA 4W4ZA 1K42A 1UY4A 2BGPA 3T2QA 3P1IA 4LQRA 4QB2A 1LNSA 4DUXA 1UY1A 2ZEYA 3C7OA 3T0BA 1GU3A 3P6BA 1PMHX 3IAQA 3OG2A 4XUNA 3LE0A 3VD5A 2QQJA 2XOMA 3BGAA 1R64A 2E33A 2WZ8A 3HNBM 2YFZA 3MO4A 4QDRA 2XHNA 4CUBA 4A4AA 3I2KA 3WNMA 2QQIA 1IQDC 3I2IA 5DQ0A 3WNNA 3CDZB 4A42A 2VMFA 3I2JA 4JKMA 1O8PA 1JZ3A 5FUIA 3VDCA 1MPXA 3MV11 4UAPA 1NKGA 4A3ZA 1JHJA 1GOGA 5CYYA 2HYXA 1L7RA 2JD9A 1PX3A 4GWIA 2VZUA 1W9TA 4DXRA 3I2HA 4TXWA 3SKVA 2BZDA 2RJ2A 4QPWA 1EUTA 4E8DA 2C9KA 5I0DA 5DMYA 4QDQA 1NAEA 4XZUG 3UETA 1JU3A 1L7QA 2W47A 1JZ7A 5CZKA 4OMCA 1ULPA 3HNYM 2W95A 3WNKA 1SHWB 2J22A 4CU6A 5JUVA 1UYZA 2CDPA 1PMJX 1KGYA 2V5DA 3GM8A 1EUUA 1GMMA 2W3JA 5IFTA 3WNLA 4BK5A 3I97A 4DEVA 2J7MA 2WBKA 5F7UA 4QAWA 3WEZA 1UWWA 1ULOA 1UMIA 2W5FA 5JXIA 1JYVA 4OMDA 2WO2A 5JXHA 2L9LA 5EJZB 2KD7A 3A21A 5A1AA 3WNPA 4GWJA 2QQKA 3T08A 1JZ6A 5C7GA 1BHGA 3VDBA 3VD4A 2HLEA 4AAXA 4QX2A 4P00B 2DCJA 2C4XA 2EIDA 2EIEA 3OGRA 3I2GA 3IDAA 4A41A 2LW8A 1CX1A 2W1UA 4PF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEW A;  2JDA A;  3UES A;  1OF3 A;  1RYY A;  5JMO A;  2J1R A;  4BDV B;  3NRU A;  4ZZ5 A;  3WQB A;  5IFP A;  3CZJ A;  3VD9 A;  2VZV A;  2VZQ A;  2W87 A;  3CIH A;  3HN3 A;  2WAO A;  5C70 A;  1JYX A;  3EB7 A;  1YQ2 A;  2EIB A;  4PQQ A;  4XUQ A;  4KI5 M;  3SEE A;  1PX4 A;  3MV0 1;  3DYO A;  1SDD B;  2W9X A;  4QDS A;  3C7E A;  5HXM A;  3HOB A;  5J1X A;  1JZ4 A;  3DYM A;  3VD7 A;  1W8O A;  3ABZ A;  1UXX X;  5G05 L;  2VZO A;  3LPG A;  3SKJ E;  3VD3 A;  1UXZ A;  4YPJ A;  3WF0 A;  2EIC A;  5LA2 A;  4DXT A;  5B4X A;  2PQS A;  2VZT A;  2J1E A;  2OKX A;  2J1A A;  3NJV A;  2B4K A;  1T2X A;  4LHS A;  4CU7 A;  3ZM8 A;  4Z2A A;  2VO5 A;  4AG4 A;  1W8N A;  2ORZ A;  4CUA A;  1XNA A;  1US2 A;  2YB7 A;  3T0D A;  1XPW A;  4DUW A;  1OD3 A;  2VME A;  3WNO A;  4ARX A;  4BJ0 A;  2QBX A;  1UY3 A;  3WF3 A;  3F2Z A;  4M4R A;  4ZXE A;  4DEQ A;  4JHZ A;  2ZEZ A;  3K4Z A;  4ET7 A;  1I5P A;  4MOA A;  4CUC A;  3U37 A;  1JYN A;  1O8S A;  3DEC A;  2YG0 A;  2Y6K A;  4OUE A;  1UMH A;  3K77 A;  2ORX A;  5JXJ A;  2J1V A;  5JXG A;  3NNG A;  4M4P A;  2YC2 A;  2VZP A;  4W50 A;  3ECQ A;  4RN5 A;  3HNM A;  3UNP A;  2VCA A;  3WSO A;  2Z4F A;  3K4A A;  5LA0 A;  4XVH A;  5IHR A;  4UOJ A;  1GNY A;  3IAP A;  1H6X A;  2YC4 A;  2X09 A;  3GXU A;  4RYD A;  2VZS A;  4A6O A;  4TTG A;  4MGQ A;  2VC9 A;  1TVG A;  2J1T A;  3OGS A;  3OEB A;  4KWU A;  3T09 A;  3A22 A;  1CZV A;  3WF2 A;  3FN9 A;  3T2O A;  2VJX A;  1SG3 A;  2W1S A;  3ACG A;  1W9S A;  4ZY9 A;  4CU9 A;  4E8C A;  1W99 A;  5G04 L;  2QQO A;  4JKK A;  4QX1 A;  3BN6 A;  2WDB A;  3GDB A;  2W46 A;  4QX3 A;  4P02 B;  3K4D A;  4KMQ A;  3C7F A;  3W5M A;  1JU4 A;  4DXS A;  3LQC A;  2BBA A;  2J1U A;  4GZ9 A;  2E31 A;  1UY2 A;  1JYW A;  2V72 A;  4PT6 A;  5C71 A;  2Y6G A;  3FHA A;  1OT5 A;  2WN2 A;  2DCK A;  3LPF A;  1JZ2 A;  2W1Q A;  2Y8K A;  2XQX A;  2VL4 A;  4JX0 A;  3CQO A;  2DDU A;  3NQH A;  3JXS A;  2VM9 A;  4DUV A;  3OB8 A;  1HN1 A;  4HG6 B;  3I3D A;  3FL7 A;  4D0Q A;  1US3 A;  2WYS A;  2Y64 A;  3CKH A;  3T2P A;  4LPL A;  1K3I A;  3VDA A;  3J7H A;  2VTF A;  2ZEX A;  2W94 A;  4P5Y A;  4QX0 A;  3HEI A;  2J1S A;  1GOF A;  4LKS A;  2VR4 A;  4JKL A;  1W9W A;  4BXS V;  2JKX A;  2VQT A;  3MBW A;  3I2F A;  1GUI A;  2X05 A;  4XUP A;  2QQN A;  1WCQ A;  2VQU A;  3I3E A;  5LCW L;  1UYX A;  3K46 A;  4L0P A;  1DLC A;  1DYO A;  3OGV A;  3MUZ 1;  3A23 A;  1DP0 A;  3GGL A;  1TG7 A;  3WF4 A;  4OYU A;  3ACF A;  2Y6L A;  3IB3 A;  5HPO A;  3C8X A;  2ZXQ A;  1F4A A;  1UZ0 A;  4ZZ8 A;  4MGS A;  2WN3 A;  1JZ5 A;  3HPN A;  3DYP A;  2JE8 A;  3ACI A;  5IYY A;  1CZT A;  4MAD A;  1CZS A;  3C7G A;  2C26 A;  2XON A;  3ACH A;  3AC0 A;  1NUK A;  2R7E B;  2WAB A;  1J84 A;  3HJR A;  3W5N A;  1JZ8 A;  3THC A;  3T0A A;  2VZ1 A;  2Y6J A;  4ARY A;  1O59 A;  2ID4 A;  1OF4 A;  2VCB A;  4A45 A;  4P08 A;  2W91 A;  2WO3 A;  2VCC A;  2LS6 A;  4FI9 A;  2VMC A;  1K45 A;  2VZ3 A;  1GQP A;  3THD A;  3LEI A;  5EIY B;  2RV9 A;  4XUR A;  2CDO A;  3OEA A;  4MO3 M;  4UI9 L;  1WKY A;  1UX7 A;  1NX9 A;  4W8J A;  2RVA A;  1D7P M;  3K75 B;  1XNT A;  5DN2 A;  1KEX A;  1W0N A;  4QB1 A;  4BK4 A;  3FHQ A;  3CMG A;  2V4V A;  1H6Y A;  2E32 A;  3C7H A;  3I3B A;  3E1F 1;  3A7Q A;  2QQM A;  3EYP A;  4CVU A;  2E26 A;  5B4N A;  3PUI A;  1P8J A;  2Y6H A;  2WAA A;  2VOT A;  4A44 A;  5DPN A;  3SEP A;  1OH4 A;  4CU8 A;  2B9V A;  2QQL A;  3CZU A;  2WQ8 A;  3III A;  5JR2 A;  2WUH A;  2W92 A;  5IJR A;  2BER A;  1UYY A;  2VZR A;  4IUG A;  4OZO A;  3LEK A;  4XUT A;  1F4H A;  1J83 A;  3LEG A;  2YFU A;  1CIY A;  3NJX A;  4QB6 A;  3OBA A;  2WO1 A;  1JI6 A;  3ETP A;  3WF1 A;  2WZE A;  3D3A A;  5LA1 A;  5EJ1 B;  3PUH A;  2X10 A;  3MUY 1;  2W1W A;  1XC6 A;  1K12 A;  4XUO A;  4D8M A;  1GOH A;  2VMD A;  1UY0 A;  2BGO A;  4W4Z A;  1K42 A;  1UY4 A;  2BGP A;  3T2Q A;  3P1I A;  4LQR A;  4QB2 A;  1LNS A;  4DUX A;  1UY1 A;  2ZEY A;  3C7O A;  3T0B A;  1GU3 A;  3P6B A;  1PMH X;  3IAQ A;  3OG2 A;  4XUN A;  3LE0 A;  3VD5 A;  2QQJ A;  2XOM A;  3BGA A;  1R64 A;  2E33 A;  2WZ8 A;  3HNB M;  2YFZ A;  3MO4 A;  4QDR A;  2XHN A;  4CUB A;  4A4A A;  3I2K A;  3WNM A;  2QQI A;  1IQD C;  3I2I A;  5DQ0 A;  3WNN A;  3CDZ B;  4A42 A;  2VMF A;  3I2J A;  4JKM A;  1O8P A;  1JZ3 A;  5FUI A;  3VDC A;  1MPX A;  3MV1 1;  4UAP A;  1NKG A;  4A3Z A;  1JHJ A;  1GOG A;  5CYY A;  2HYX A;  1L7R A;  2JD9 A;  1PX3 A;  4GWI A;  2VZU A;  1W9T A;  4DXR A;  3I2H A;  4TXW A;  3SKV A;  2BZD A;  2RJ2 A;  4QPW A;  1EUT A;  4E8D A;  2C9K A;  5I0D A;  5DMY A;  4QDQ A;  1NAE A;  4XZU G;  3UET A;  1JU3 A;  1L7Q A;  2W47 A;  1JZ7 A;  5CZK A;  4OMC A;  1ULP A;  3HNY M;  2W95 A;  3WNK A;  1SHW B;  2J22 A;  4CU6 A;  5JUV A;  1UYZ A;  2CDP A;  1PMJ X;  1KGY A;  2V5D A;  3GM8 A;  1EUU A;  1GMM A;  2W3J A;  5IFT A;  3WNL A;  4BK5 A;  3I97 A;  4DEV A;  2J7M A;  2WBK A;  5F7U A;  4QAW A;  3WEZ A;  1UWW A;  1ULO A;  1UMI A;  2W5F A;  5JXI A;  1JYV A;  4OMD A;  2WO2 A;  5JXH A;  2L9L A;  5EJZ B;  2KD7 A;  3A21 A;  5A1A A;  3WNP A;  4GWJ A;  2QQK A;  3T08 A;  1JZ6 A;  5C7G A;  1BHG A;  3VDB A;  3VD4 A;  2HLE A;  4AAX A;  4QX2 A;  4P00 B;  2DCJ A;  2C4X A;  2EID A;  2EIE A;  3OGR A;  3I2G A;  3IDA A;  4A41 A;  2LW8 A;  1CX1 A;  2W1U A;  4PF1 A; 
#chains in the Genus database with same CATH topology
 2P5B A;  4LLF A;  3BU7 A;  3E5U A;  5A3L A;  2P6H A;  3P5B A;  5K9Y A;  2DV9 A;  1ND2 A;  1MR5 A;  4LA3 A;  4ZZ5 A;  4FPO B;  3ZDV A;  4YGC A;  1LOF C;  1VE0 A;  4LBQ D;  3VBU C;  1L3J A;  3GAL A;  1AR7 2;  2JEC A;  1QEX A;  3NV3 A;  4LK7 A;  3WG4 A;  1PNF A;  4COW A;  4HPK A;  1A34 A;  4J6G A;  4ZU5 A;  2D6K A;  2WYF A;  4O9G A;  1XSQ A;  1NCQ B;  1GKB A;  3BIW E;  4Y1Z A;  2Y6F A;  2HKX A;  4KI5 M;  4BU2 A;  1D2Q A;  4W6X A;  1S2B A;  1UPS A;  4NOT A;  4AW7 A;  1HDK A;  2W9X A;  3ES4 A;  4GUL A;  2WFF 1;  4MSV A;  4WV8 A;  5FO9 B;  4QDS A;  1REF A;  3A0K A;  3HOB A;  1JZ4 A;  3DYM A;  3VD7 A;  1W8O A;  3D5O A;  2XH6 A;  1QXJ A;  2AEZ A;  2VZO A;  2KXL A;  4LBQ B;  4OI1 A;  3U14 A;  3SNM A;  3V56 A;  3VBF C;  3WP4 A;  5GLZ A;  2ZHK A;  1S0B A;  2E7A A;  2ZGN A;  3VD3 A;  1BEV 3;  1J1T A;  2R06 2;  5F6K A;  3VBH A;  1AYN 1;  2BDR A;  2HWC 1;  1CAW B;  3MI8 A;  4CRQ A;  3VHP A;  5LA2 A;  4YVS A;  3CNA A;  3AYC A;  2PQS A;  5FYM A;  2J1E A;  1GP5 A;  3UGG A;  4MHR A;  1MQT B;  1T2X A;  2B4K A;  1FT9 A;  2XKO A;  3NKG A;  2W2I A;  2EXJ A;  3GZT B;  3S7E A;  2VUJ A;  3N9M A;  2HWD 3;  2RM2 3;  4PCR A;  1C1F A;  4RHV 2;  5FP4 A;  1ST8 A;  3OBT A;  1RUG 3;  2ORZ A;  2WQZ C;  3KMH A;  4YVW A;  3BIE A;  2JEN A;  3AM2 A;  3VBS A;  5C3O A;  1G9F A;  2YB7 A;  3T0D A;  1W3V A;  3WDY A;  1ZBA 1;  2HEV F;  5J3U A;  2X5I C;  5T5P A;  2A6Y A;  3AZY A;  1GZW A;  3V0B A;  2Y0I A;  4MUV A;  1RUJ 3;  4Q0S A;  5JPM B;  4GWN A;  1PIV 3;  2VPV A;  4KWL A;  4ARX A;  4D94 A;  2G9Z A;  4BJ0 A;  2JWP A;  3W59 A;  3ZSL A;  1UY3 A;  4YNI A;  4BIF A;  5FZ9 A;  1EPW A;  3VDD A;  2XJU A;  2YRO A;  4ITC A;  2ZKN A;  4S2D A;  2VTX J;  1U0A A;  4D7Y A;  4Q4X 3;  1S1A A;  4CUC A;  2H6B A;  3U37 A;  2PLV 2;  1AL2 1;  5DZG A;  3TEX A;  1QHD A;  1JYN A;  3DEC A;  1YI7 A;  3AKR A;  5E8A A;  5K0U A;  1WMD A;  3K77 A;  3OSD A;  1IG0 A;  1BZW A;  1OPM A;  1PM4 A;  4M4P A;  5JXG A;  1EAH 2;  1LU2 A;  4LIV A;  5IK8 A;  3S57 A;  4YM0 A;  1DGR N;  4HXC A;  1W8H A;  4GMP 3;  3UNP A;  1DGR A;  4Q4V 3;  2P4E A;  3H8X A;  4QPY A;  4Y5T A;  1S0G A;  1NCQ C;  2VNG A;  4V2W A;  1MS0 A;  1VBE 3;  3KT4 A;  4HKL A;  5LA0 A;  1V6I A;  3GZU C;  4YM1 A;  1AF9 A;  1BK0 A;  1WA4 A;  2YC4 A;  1O6U A;  2PHF A;  2UU8 A;  2ZHN A;  4CCK A;  2WFF 3;  4DQA A;  2VUD A;  4QM9 A;  3NJZ A;  1MEC 2;  4IE6 A;  4MH0 E;  3ZYF A;  2Q8O A;  3RPQ A;  1NE6 A;  3B94 A;  1GR3 A;  4NRP A;  2WNV A;  5I0R A;  1LOA A;  3PUQ A;  3SLI A;  3BKZ A;  1Y9Q A;  1MZ5 A;  1TVG A;  3PUR A;  1AYN 3;  3JD7 1;  3A22 A;  4JHT A;  4A3X A;  1U5Z A;  2ES3 A;  3I7D A;  1GZC A;  2D6L X;  3KCX A;  5FZF A;  4AFM A;  1DZQ A;  4AVA A;  2RHP A;  2GC3 A;  1SG3 A;  4Q0Q A;  2EAK A;  4NJ4 A;  4B1L A;  1MQT C;  4JKK A;  4QX1 A;  3O1P A;  5JIU A;  5H9P A;  3MGU A;  1BMV 1;  2WNU B;  2GC0 A;  2WDB A;  2HEW F;  1W2T A;  1HJF A;  1RUF 1;  4I0A A;  3Q9O A;  4P02 B;  4AED A;  2DWR A;  5LAT A;  5CA6 A;  5FZD A;  4JGZ C;  4AGG A;  3H42 B;  2XJV A;  1RUO A;  1ZBA 3;  2J1U A;  1FV2 A;  4FPE A;  4GZ9 A;  4PLN A;  5B2G B;  1JYW A;  5C6C A;  4Z92 B;  3B9C A;  5T5L A;  2O1Q A;  3IDB B;  2V72 A;  4PT6 A;  4RR3 B;  3MPB A;  3SXW A;  1TZO A;  3AP6 A;  1YC6 1;  4H7M A;  2WN2 A;  3IPV B;  3LPF A;  2W1Q A;  4K1Y A;  1VBC 3;  3AMM A;  5FYH A;  1F31 A;  1YIP A;  1BKZ A;  2VL4 A;  4NAO A;  3J26 N;  2ZX3 A;  1LES A;  1ZBE 1;  5HCF A;  4AK3 A;  1R1A 1;  3NV1 A;  1VBB 1;  5C9A A;  5FBZ A;  2NPI A;  3WXP A;  5A7O A;  5KBF A;  1HLC A;  2VXJ A;  5GLW A;  3OD0 A;  2A6W A;  4JZR A;  2JIG A;  4ONU A;  4Z07 A;  1AL2 3;  2H0B A;  5CKM A;  4YW3 A;  1R08 2;  4HK9 A;  4AAP A;  2GH2 A;  4PLO A;  1BLZ A;  1TMF 1;  2Y64 A;  1H2L A;  5SV8 A;  1K3I A;  4IEZ A;  1SLL A;  3JBG 2;  3VDA A;  3ZN5 A;  3N7M A;  3O1M A;  1RUE 1;  1H1A A;  3MLK A;  1CAX A;  3HEI A;  2HWF 1;  2J1S A;  3V65 A;  4A7Z A;  5JIA A;  4LKS A;  1O4Y A;  4IES A;  2WA4 A;  1XU1 A;  2BOI A;  4BYY A;  1NE4 A;  4Z2W A;  4IDZ A;  1UZW A;  2JKX A;  4Y5S A;  3ZYI B;  2VQT A;  3UKT A;  3ILN A;  2E6V A;  3LDB A;  2F17 A;  5A3O A;  2W08 A;  1W2N A;  2VE1 A;  3I3E A;  4RL7 A;  5LCW L;  3WW3 A;  2Y0O A;  3K46 A;  4LR4 A;  2KM2 A;  1LOE A;  4NUB A;  5AC9 1;  1MZE A;  4NE9 A;  2R6Q A;  3MIB A;  4G4F A;  4TLF A;  3JD7 3;  3A23 A;  4IQP A;  2FZ2 A;  1GFF 2;  1DP0 A;  5F5A A;  2R32 A;  2GN7 A;  3MLJ A;  3KM5 A;  5FWJ A;  2BV4 A;  5HV0 A;  3I3M A;  2O8O A;  2E9Q A;  2BPA 2;  4OYU A;  2Y6L A;  5JAX A;  2D7F A;  4QD2 A;  3B7M A;  4PIZ A;  1ZZB A;  2HWE 2;  4IEO A;  3OUJ A;  4QT6 A;  4YZ3 A;  4MGS A;  4KGG A;  1HKD A;  3DYP A;  2WNU C;  3PJY A;  2AZ5 A;  1W05 A;  2JE8 A;  1RUF 3;  4XQD A;  2WR9 A;  4OI2 A;  1Q8P A;  4NRO A;  3U1X A;  4FPK A;  4NR1 A;  4Y4Y A;  1CZT A;  4MAD A;  2BJS A;  4FPH A;  1GQH A;  1FOD 2;  2K9Z A;  2XJT A;  3C7G A;  4FFG A;  3MF6 A;  2BVB A;  2FDJ A;  2VNV A;  3HJR A;  1QJY 2;  4GMP 0;  4LBN A;  4Q26 A;  4CPB D;  2XJQ A;  5LBE A;  1JZ8 A;  3I59 B;  4LJH A;  2LAL A;  1KJL A;  4RGG A;  4RR3 C;  4PHZ A;  3THC A;  3ZXJ A;  1AYM 2;  4CCL A;  1GIC A;  3W9A A;  3E5X A;  5TSW A;  2D6O X;  2WQ4 A;  1OUS A;  2VZ1 A;  2VEC A;  2Y6J A;  4FBF A;  4YFZ A;  5FLI A;  1AXY A;  3ZMN A;  3H3L A;  1ZBE 3;  5FY1 A;  1W6N B;  1N1Y A;  4K8F A;  1R1A 3;  1VRH 2;  2ZAC A;  5IAX A;  2DVG A;  4RS5 A;  4BLJ A;  1ODN A;  4IEQ A;  3CJX A;  1O59 A;  1DG6 A;  2CAV A;  1UKG A;  1RUH 2;  3G6J B;  4LOT A;  5D21 A;  1Z78 A;  4C91 A;  3KV4 A;  5I91 A;  4LUM A;  4P08 A;  1G86 A;  4PJY A;  3RSJ A;  1TMF 3;  4UBH A;  2A70 A;  4MGZ E;  1ENQ A;  2VCC A;  4I0B A;  4UT5 A;  2LS6 A;  4FI9 A;  1XBF A;  1TME 2;  3GYD A;  2GNB A;  2VMC A;  3M8L A;  2A3X A;  4BE3 A;  1RUE 3;  4COV A;  3N9N A;  4HET A;  1IQA A;  3USU A;  5JLV A;  2HWF 3;  1PZ8 A;  1W2U A;  2CDO A;  3OEA A;  1DYK A;  5FYS A;  4MO3 M;  4CXX A;  2RS5 2;  4UI9 L;  4CXW A;  1ZVF A;  3TEW A;  2RDQ A;  3IM0 A;  1VBA 2;  3POW A;  1A8M A;  1XU2 A;  1ZX5 A;  4PIX A;  5C8C B;  3KV5 A;  1K5M B;  3WT3 A;  4EZ4 A;  3TN9 1;  2ZGL A;  2PMW B;  1CVN A;  3KHB A;  1PHM A;  4M0N A;  3ES1 A;  3POG A;  2AGS A;  5D8A B;  4QQ2 A;  1VAK A;  4RQP B;  5FP9 A;  5FKB A;  5JWP A;  1OA2 A;  3EYP A;  4CVU A;  1BCX A;  2XR4 A;  4XMI A;  3SCF A;  4F3J A;  4QGM A;  2BVV A;  4ZXK A;  4CCD A;  4LO5 B;  5F3I A;  1ENS A;  4LHN A;  5JDB A;  1HW5 A;  1P8J A;  2HH9 A;  4M3C E;  2Q30 A;  1ZZ8 A;  4A44 A;  5J7M A;  1PGL 1;  1Z7S 2;  4Y1U A;  3VLB B;  1O7F A;  2JEM A;  3ZSE A;  4FFF A;  4YZ2 A;  1CJD A;  4QHZ A;  2D3P A;  4RGK A;  3F95 A;  3APB A;  4YAR A;  1VIW B;  3CL1 A;  5A7S A;  5H9R A;  2QQL A;  1SLA A;  2XG3 A;  2Y33 A;  5JR2 A;  2RS3 2;  1DHK B;  2WZP P;  3T3Y A;  4C90 A;  2R07 2;  3VBR B;  1WW5 A;  5A3T A;  1JXN A;  5K7P A;  4C0H A;  3HMY A;  4FXK B;  5J96 B;  1OLM E;  1ZNP A;  1QH7 A;  3UGH A;  1UO9 A;  2F6B A;  2P3Y A;  5CBL A;  4N53 B;  3PU8 A;  5HCB A;  2JB4 A;  5FUN A;  5JOW A;  1F4H A;  3S7I A;  2R0F A;  1J83 A;  1OD5 A;  4FCA A;  2YFU A;  5FQ0 B;  1CIY A;  4GB3 2;  4PI2 A;  1ND3 A;  3K2O A;  4QB6 A;  5JOY A;  1SCS A;  3OBA A;  2AR6 A;  3GNE A;  4OHX A;  3WF1 A;  3B3Q E;  1JN2 P;  3R6S A;  1HXS 2;  3D3A A;  5LA1 A;  4EN6 B;  2FQP A;  2DVF A;  3H8O A;  1MVE A;  1OOP A;  2X10 A;  3MW4 A;  5FXX A;  1UOB A;  2ARA A;  2JDY A;  3M3C A;  4QPI C;  2W1W A;  3D0S A;  1AR7 1;  1AJK A;  2W0X A;  2XWJ B;  4XUO A;  4LIU A;  3LOI A;  3ZN6 A;  3ZSK A;  3KGZ A;  2BGO A;  1QQP 3;  4CDW B;  4QU2 A;  1UY4 A;  2BGP A;  2ERF A;  3PLQ A;  3T2Q A;  4J1X A;  2ZAA A;  1I9R A;  1MS9 A;  2ZZQ A;  1LNS A;  2VCM A;  2P1B A;  4WZC A;  4M3C B;  1QH6 A;  4BOW A;  1HRV 2;  2ARE A;  5FK7 A;  2RR1 2;  3C7O A;  4XCB A;  1YFY A;  4E4D X;  1PMH X;  4COZ A;  5ACA 2;  2NZ9 A;  3OG2 A;  4CUG A;  1JMU B;  2ZGM A;  1XND A;  3ETQ A;  4XDP A;  4ZKT B;  2QQJ A;  2XOM A;  3BGA A;  1V6K A;  4U2A A;  1REE A;  2WZ8 A;  3POI A;  2BWA A;  1GZT A;  4HN1 A;  3WDW A;  4OUL A;  4BB3 A;  4BIO A;  3HNB M;  1AHS A;  5C8C C;  5EJ3 A;  1W06 A;  3MO4 A;  2UWB A;  2R06 1;  1K5M C;  4XEZ A;  3TN9 3;  2XHN A;  1WMF A;  1YFU A;  2HJI A;  4K20 A;  1RXF A;  3S0M A;  2QE3 A;  4A4A A;  1D4M 2;  5FJH A;  1SFN A;  3I2K A;  5FXV A;  1JYT A;  5A6Z A;  5D8A C;  4RQP C;  3HD8 B;  1WBF A;  2CYF A;  1LEM A;  1ULF A;  2OX0 A;  1N1T A;  1MVQ A;  3H7Y A;  1RUD 2;  3N7K A;  2ZML A;  4NVP A;  4OZX A;  3S30 A;  1MPX A;  2V5Y A;  3VDC A;  3D6E A;  2CV6 A;  2OPK A;  3WP3 A;  1XYN A;  4UAP A;  4AHZ A;  1FMD 3;  4YG0 A;  1O5U A;  1GOG A;  2G1M A;  5J37 A;  3GZE A;  4NHK A;  4L97 A;  1PX3 A;  4BQW A;  1H1I A;  5F32 A;  4DXR A;  2D40 A;  3I2O A;  1NOV A;  3RYR A;  2WZR 2;  4TXW A;  2JE9 A;  3TOJ A;  1ZRE A;  1IPJ A;  2RJ2 A;  4QPW A;  1PO2 3;  1Q43 A;  5JSP A;  5GZC A;  4Y20 B;  4XQ4 A;  1CAU B;  1C5I A;  1Q56 A;  1QXR A;  2DVD A;  3ATG A;  4IE4 A;  4Y4R A;  3VBR C;  4BXF A;  5A33 B;  3O1V A;  3H8U A;  5APA A;  4CCN A;  5F3G A;  4WM8 A;  1NAE A;  2HBU A;  3FBY A;  3UET A;  1L7Q A;  2W47 A;  2PFW A;  1GP4 A;  4N53 C;  2GMP A;  4UF0 A;  1DZT A;  4TWT A;  5CZK A;  3ROU A;  3MIF A;  4XE9 A;  4UW3 A;  3AMN A;  2FDH A;  2OII A;  5IVY A;  4YW2 A;  1NLQ A;  5JZG B;  1UYZ A;  2PHW A;  1CX4 A;  1KGY A;  2V5D A;  1WBL A;  5FRE A;  3RZM A;  1RIN A;  1PGS A;  2GN3 A;  3O0W A;  3LAG A;  1TQ5 A;  5T54 A;  1OVS A;  5FPX A;  3NO8 A;  4BK5 A;  1WMX A;  2J7M A;  4IV1 B;  5EZW A;  4AI3 A;  3NNM A;  3N4M A;  4KU8 A;  2BQP A;  2VNO A;  4IEX A;  1EAH 1;  1AR7 3;  4QAW A;  2C6S A;  3VKM A;  4E4Z A;  5FPA A;  4AOC A;  1ULO A;  5F3C A;  1DQ5 A;  1V6M A;  1JYV A;  4OMD A;  4BQ4 A;  4Y22 A;  5CNA A;  4CDW C;  5A6Y A;  3HQX A;  1JW6 A;  2UY9 A;  2PN5 A;  3VL9 A;  1HB2 A;  3OD4 A;  3OYW A;  3UL2 A;  1YI9 A;  1RVF 2;  4I02 A;  4JDN A;  2IFW A;  4IL7 A;  1PVC 2;  1IOA A;  1JZ6 A;  4XAB A;  5FZ7 A;  1MEC 1;  2XBO 2;  3VDB A;  1JYC A;  3WP6 A;  1ZA7 A;  3AMH A;  4AAX A;  1V9U 2;  4QX2 A;  2OW4 A;  3POY A;  5KXE A;  2EIE A;  4Z82 A;  1YLL A;  4D6R A;  1F8V A;  5IW0 A;  1ZZ6 A;  2JDM A;  3I2G A;  3DXT A;  1PGW 2;  3RQ0 A;  3CLP A;  4CYD A;  1FXZ A;  4CCO A;  3PMS A;  4OVE A;  4FOV A;  3N9L A;  3UES A;  2WS9 1;  1RYY A;  4BM8 A;  4CP9 A;  4Q2F A;  4F7Z A;  1RXG A;  5DDJ 1;  1HN0 A;  3H50 A;  1G6N A;  2BP6 A;  2R1D A;  1YHF A;  4E2S A;  3FUO A;  3OJB A;  4NII A;  3WQ7 A;  2ZGP A;  5IK4 A;  2RS1 1;  4N7I A;  1YO8 A;  2VZQ A;  1SMV A;  2W87 A;  3O14 A;  1KRI A;  5AVA A;  4DY5 A;  1YJL A;  2WAO A;  4NWV A;  1LOG A;  2EXK A;  1COV 2;  1SLB A;  3FJS A;  1C4R A;  4SBV A;  5IVE A;  1JYX A;  5DAQ A;  5KR7 A;  5L19 A;  4PQQ A;  1ULD A;  2EIB A;  2D5F A;  2GND A;  4Z8B A;  1KFU L;  4CEW A;  2PAM A;  4FPL A;  5GLV A;  1ND2 B;  3DYO A;  2QDN A;  1IPS A;  2B46 X;  2JKB A;  3VV1 A;  5HXM A;  1IHM A;  3LOB A;  3CJI A;  4QM8 A;  4XBN A;  5ISL A;  5LWB A;  2Y26 A;  5FZE A;  4P9Y A;  5FZ4 A;  3FZ3 A;  4HPK B;  1VAL A;  5JZG C;  3AL6 A;  3I49 A;  1C8M 2;  2ZTN A;  1DGW X;  1UXZ A;  5A7W A;  4BPZ A;  1HRI 2;  2JD4 A;  1URX A;  2EIC A;  5B4X A;  4AVT A;  3OUI A;  4IV1 C;  4O7X A;  1HQW A;  2VZT A;  2I2S A;  3JBG 1;  1NXM A;  4P9J A;  3LF7 A;  2GME A;  4YFW A;  4KL1 A;  2NN8 A;  1FPN 2;  1KFX L;  3ZKY A;  3ZM8 A;  1KS4 A;  2VO5 A;  2VTX A;  4IW3 A;  4LKF A;  1AX1 A;  4HVQ A;  3HN1 A;  3VBO A;  1W8N A;  1WW7 A;  4UFL A;  4AG4 A;  4EWE A;  3VKF C;  1RC6 A;  3VBH B;  4CUA A;  2DYC A;  2LTN A;  4FTS A;  4P9G A;  4M0H A;  1XPW A;  5A70 A;  4OLL A;  3AKS A;  3ZFG A;  5L9V A;  4QPG A;  3FLR A;  1NLS A;  3PJQ A;  3AXD A;  4UW4 A;  2A71 A;  5ABJ A;  2PXJ A;  4FTB A;  3WF3 A;  4GA9 A;  3MDP A;  4Q0U A;  1UU5 A;  2WNO A;  2OVU A;  4NO4 A;  4H3W A;  3U10 A;  4ET7 A;  5F39 A;  5FY5 A;  3M2M A;  3VBS B;  1I5P A;  4AI8 A;  1AR9 2;  2FBE A;  2QUO A;  5T5O A;  2LM3 A;  2WS9 3;  4YW1 A;  5FBJ A;  1O8S A;  1YEW A;  5DDJ 3;  1H4G A;  1ALY A;  1QDC A;  2FHR A;  4OUE A;  1YQ6 A;  4AQS A;  3V0B B;  1GZW B;  2HWE 1;  2J1V A;  2NMO A;  4XCA A;  3DKQ A;  3SIS A;  5FYB A;  2K0G A;  3RJ2 X;  1QU0 A;  2RS1 3;  2XUM A;  2VZP A;  3VZJ A;  1D0G A;  3K48 A;  5GKA C;  2CAU A;  3I2D A;  2DBN A;  3ECQ A;  2JE7 A;  1W6M A;  1GLH A;  5F3E A;  3VDD B;  2EAL A;  1EV1 2;  3KWV A;  4HSJ A;  4AVB A;  5IK5 A;  2Z4F A;  4XVH A;  2PQQ A;  4UOJ A;  3RYK A;  2Q5T A;  2WA3 A;  3BU0 A;  3ZDS A;  1CON A;  1GNY A;  2X09 A;  1TEI A;  2D3S A;  3GXU A;  4RYD A;  1ND2 C;  3RDI A;  5K0U B;  1AYM 1;  1WUV A;  1O4Z A;  4EN0 A;  4FFH A;  4XF9 A;  1LUL A;  4UWD A;  3ZOI A;  3ZYB A;  4TTG A;  1PO1 2;  2VG9 A;  2WSU A;  5DZE A;  5FPL A;  4HT1 T;  4AHX A;  2DVB A;  2D93 A;  5GZD A;  1VRH 1;  4IE7 A;  2PHL A;  5FZ0 A;  5CB7 A;  1PM7 A;  1RUH 1;  5JMC A;  3I4I A;  1CZV A;  1MS5 A;  2VOX A;  4Y26 A;  2XPJ A;  1FNY A;  5LBB A;  1I1E A;  3FN9 A;  2BYV E;  5BNP A;  3X29 B;  4EWA A;  3T2O A;  2VJX A;  2W1S A;  3JBG 3;  5F1R A;  4ZY9 A;  2MEV 1;  1YJK A;  1W99 A;  4KNC A;  2QQO A;  1T6G C;  4ZU7 A;  2FDK A;  3VB9 A;  3BN6 A;  1LKN A;  4AYU A;  1Y3T A;  3GDB A;  4QX3 A;  1N47 A;  3BI3 A;  5CG8 A;  1VBD 2;  2RS5 1;  1MS4 A;  4BIS A;  1SEF A;  2QNK A;  3J7M A;  3PTR B;  4BQY A;  3VBH C;  3RI8 A;  3LFM A;  1RUC 3;  3PVE A;  3LQC A;  2BBA A;  2C1F A;  4DXS A;  2D6P A;  3NJY A;  4QQL A;  2E31 A;  4MGY E;  4GAZ A;  4S2F A;  3U4X A;  2PHR A;  5E1R A;  5FZH A;  2CY6 A;  4YVS C;  2MHF A;  1WLD A;  5GLU A;  5C71 A;  2Y6G A;  3E6B A;  1OT5 A;  2DCK A;  3RS6 A;  2W68 A;  2E51 A;  1POV 1;  4O61 A;  4PBP A;  1S0I A;  3O1R A;  1H2K A;  3FC0 A;  4NPM A;  2VMG A;  1HB3 A;  4NPL A;  3CQO A;  2DDU A;  4XIO A;  3NQH A;  4LO4 B;  4AED B;  1MS3 A;  3HBZ A;  5AFB A;  1IZ3 A;  3FWE A;  4YZ1 A;  4YVW C;  3OB8 A;  3KCY A;  3GZA A;  3VBS C;  1XXN A;  3FL7 A;  1Z7S 1;  2UYA A;  5GZG A;  2ZGS A;  4D0Q A;  3U0Z A;  2ZOE B;  3DPR A;  1BVV A;  2BNM A;  4M3C F;  2HWE 3;  3ELN A;  2Y60 A;  1IKQ A;  3KZ4 C;  4BLI A;  1WLC A;  5FZ3 A;  1ASJ 1;  4OI4 A;  5FY8 A;  3LKJ A;  2R07 1;  1KIT A;  2OUJ A;  3U4S A;  3OBZ A;  4I3P A;  1JBC A;  4LIT A;  2RJK A;  1RHI 2;  3VDD C;  2OXB A;  3LDR A;  5C9A B;  2P3I A;  1X36 A;  3GCX A;  2FDI A;  4XFC A;  5DXD A;  2ZX0 A;  4FO9 A;  4PDW A;  2D6N A;  1AR6 1;  3MBW A;  3KD4 A;  2JJ6 A;  1H2M A;  1AYM 3;  2RJL A;  3DXU A;  3KSC A;  4DMI A;  5K0U C;  1OA4 A;  4NIG A;  2VD7 A;  5D2A A;  1NQD A;  2AEY A;  3ENR A;  1UYX A;  4CXY A;  4RFR B;  1HXS 1;  3ZLI A;  1RIT A;  4Q0V A;  3SH3 A;  4L0P A;  1W6Q A;  4JGZ B;  5FZC A;  1DLC A;  5DAV A;  2XL7 A;  1CAX B;  1FV3 A;  2NP0 A;  1RUH 3;  2GSY A;  1OKO A;  3MIC A;  1BJQ A;  3DF0 A;  3KQR A;  4B3N A;  3ACF A;  2OQ6 A;  1IKP A;  2YPJ A;  1AJO A;  2MEV 3;  4N8M A;  2XLG A;  4GH4 A;  2JG9 A;  3UGF A;  1UZ0 A;  2YBK A;  2WN3 A;  3P3N A;  4AEK A;  1JZ5 A;  2RR1 1;  5FPB A;  3BAL A;  4FOW A;  3DGT A;  2WNV C;  2G9F A;  3J9S A;  5ACA 1;  2RE9 A;  4HAN A;  1O3S A;  5IYY A;  1SCR A;  4XPV A;  2BFU S;  1CZS A;  1T6B X;  5I8Y A;  1RED A;  4LEJ A;  5FDB A;  2R7E B;  3ZMO A;  5LZ6 A;  4AI2 A;  2DF7 A;  3N9P A;  4CE8 A;  3W5N A;  4LO7 A;  4HZF A;  5J98 B;  3MZH A;  4JGY A;  1O3T A;  1DIW A;  2VAU A;  3ZYG A;  3T0A A;  3MEP A;  5EQU A;  1JUI A;  1POV 3;  2TEP A;  4LE4 A;  3T1M A;  3B69 A;  4RSU A;  4FPF A;  1S0C A;  2ARB A;  1E5I A;  1UIJ A;  4H14 A;  3VHN A;  1NCR A;  4LXL A;  3USS A;  4AED C;  4EN9 B;  5ANQ A;  3HT2 A;  2KA3 A;  2E63 A;  4FSJ A;  3OY8 A;  2ILM A;  1OF4 A;  1GP6 A;  1E5R A;  2WWS A;  3AZX A;  2F4P A;  2R04 2;  5EWS A;  4A45 A;  4GJZ A;  1UMZ A;  4BQ3 A;  1QJU 2;  2WO3 A;  2XKP A;  2WZR 1;  3OGG A;  3NKT A;  3AZV A;  2VUL A;  2OPW A;  1ASJ 3;  1UNB A;  5T3N A;  4QKD A;  3FX3 A;  3NAP A;  3FHI B;  3RZZ A;  4A2U A;  5L7O A;  2R07 3;  4XF0 A;  1GQP A;  2D5H A;  3LEI A;  1FAY A;  2HWC 3;  2RV9 A;  4IND A;  4XUR A;  5LK5 A;  3AJZ A;  3V0A A;  1UIK A;  3T30 A;  4Q27 A;  4RS5 B;  3ZR6 A;  3JZV A;  1WKY A;  5C9A C;  4W8J A;  4K6B A;  4S2H A;  2XJS A;  5L73 A;  3WQ0 A;  3M3I A;  3WNX A;  1JUH A;  1D7P M;  1F15 A;  3K75 B;  4LHL A;  1X8E A;  2GC1 A;  2HWB 2;  1AR6 3;  2Z2S B;  4K21 A;  3WG2 A;  4YSF A;  5I8S A;  1X9T A;  5KXB A;  5BYN A;  1KEX A;  5A3W A;  4IV3 A;  4XFG A;  2FZ1 A;  3QLQ A;  4QB1 A;  4MXW A;  3WR0 A;  1ACC A;  1HXS 3;  1MZ6 A;  4IET A;  2V4V A;  5A3N A;  3ZIW A;  3VHO A;  3USU B;  1LAJ A;  4YW7 A;  1N1S A;  1WD3 A;  2UYB A;  4K9S A;  4FVV A;  1H8V A;  1NQJ A;  2B39 A;  1OI6 A;  2Y6H A;  3QAC A;  4LE3 A;  2WT2 A;  2BOJ A;  3WUD A;  4MGK E;  2YBS A;  4J1W A;  3LEM A;  3RGB A;  4CTE A;  2B9V A;  1POQ A;  4CSW A;  1S0E A;  1WZX A;  2C9A A;  2WQ8 A;  2RR1 3;  3III A;  1PVC 1;  4XFH A;  2K46 A;  3LD8 A;  3ZIX A;  2BER A;  2XBO 1;  4LBK A;  5T52 A;  4ZS3 A;  1FI2 A;  4XTM A;  3L2Y A;  1JHN A;  4XUT A;  2AAC A;  2XVL A;  4N9H A;  1EYB A;  4LOR A;  5LY1 A;  5FYZ A;  3MIH A;  3UKV A;  1PGW 1;  2Q1M A;  5LB6 A;  3O12 A;  2OS2 A;  2RMU 2;  4MG2 A;  2VVE A;  4I3G A;  4KG0 A;  1LGC A;  5EYX A;  4V2V A;  1N3Q A;  3ETP A;  4AR2 A;  1A6C A;  4Q4W 2;  2BTV C;  1CAW A;  3PUH A;  5EJ1 B;  1AL0 G;  2BEO A;  2Z79 A;  4DO0 A;  3RRD A;  2D97 A;  4JCK A;  4OHZ A;  1H9W A;  3UK9 A;  5IAT A;  1K12 A;  2JG8 A;  5AFE A;  2GU9 A;  4MGT A;  2DUP A;  5IUQ A;  5FPZ A;  2VMD A;  1HQN A;  1UY0 A;  4DIN B;  1COV 1;  1UOJ A;  3PVB B;  2OZJ A;  4CDX A;  1LR5 A;  3P1I A;  2EXI A;  4Q1R A;  3M3E A;  5DAX A;  4QB2 A;  1ND3 B;  3JB4 C;  4AHW A;  5EXO A;  4Q8K A;  4P9I A;  5LEK A;  5JOX A;  2Q8D A;  3SMH A;  2NQY A;  1UY1 A;  4ES9 A;  5A6Q A;  2ZEY A;  4R8H A;  3T0B A;  1GU3 A;  3UJO A;  3I8T A;  3IAQ A;  1OOP B;  5DZF A;  5A32 A;  3GBF A;  4RS5 C;  3VD5 A;  2VOW A;  2WL1 A;  2QQV A;  2DTW A;  3VKN A;  4DB5 A;  3QH6 A;  1LGN A;  3KF5 A;  2IXC A;  3IN9 A;  4R9A A;  4YYO A;  3ZN6 B;  4UFJ A;  4OHY A;  2WII B;  3WCR A;  3S5A A;  1ZYB A;  3NST A;  2A6V A;  4QDR A;  1C8M 1;  5IWF A;  4XAE A;  5FXW A;  2ZMN A;  2CGP A;  5KC5 A;  3MID A;  3WNM A;  2QQI A;  5FY9 A;  3I2I A;  5DQ0 A;  2I07 B;  5LBC A;  2VQ0 A;  3IWZ A;  2W52 A;  3ME2 A;  1NY7 2;  2PHU A;  2VMF A;  3VL8 A;  5FZM A;  2JDH A;  3VN4 A;  5KHK A;  4QKB A;  4JKM A;  1O8P A;  1W39 A;  3TBD A;  1XYP A;  1FPN 1;  4IGP A;  1XE7 A;  2VQA A;  1NKG A;  5BNN A;  1FYU A;  1JHJ A;  5A80 A;  2IXH A;  5FY0 A;  3SC7 X;  4XFI A;  2HYX A;  1L7R A;  4JTO A;  4KGQ A;  4DFS A;  4YZ5 A;  2VZU A;  2XLF A;  4XFF A;  3ZFF A;  4Z1V A;  4LO8 A;  4XJ9 A;  3OF1 A;  1EUT A;  1PVC 3;  1YIF A;  1VB2 A;  1VBB 3;  2B7Y A;  4QPI B;  1BEV 2;  2C9K A;  2GNM A;  2LUW A;  2XBO 3;  2XXZ A;  5L9R A;  5JCT A;  1BBT 1;  5FZA A;  2UWC A;  2V09 A;  4J25 A;  4YW4 A;  2ZPX A;  4OMC A;  2W95 A;  3MW2 A;  3WNK A;  1LED A;  4D69 A;  3RZJ A;  2J22 A;  2YGL A;  3J8F 2;  5I0U A;  2CDP A;  3AFK A;  5ERL A;  3PU3 A;  1AR9 1;  3BOD A;  4LK6 A;  1EUU A;  1W04 A;  2HWD 2;  2RM2 2;  4L8Q A;  2W3J A;  5FYC A;  3KGL A;  5IFT A;  4OI0 A;  1RUG 2;  1ODM A;  4Y1V A;  4IEU A;  3WNL A;  1LEC A;  3GBG A;  3I97 A;  4DEV A;  4TSV A;  2BWC A;  3TWI A;  4WM8 B;  4FTE A;  1EPZ A;  2ZHL A;  4UF0 B;  1OC1 A;  1AZD A;  2VOK A;  4NMI A;  2B9U A;  5JXH A;  1EV1 1;  2L9L A;  3IDE A;  5EJZ B;  5EYY A;  1YRZ A;  4Y3O A;  1W8F A;  3A21 A;  4AEJ A;  4EZH A;  5F9T A;  5A1A A;  1ND3 C;  3K51 A;  3ZX7 A;  5AC9 3;  2PHD A;  1DFQ A;  3I54 A;  2OA2 A;  3AK0 A;  4UFH A;  5I0T A;  3WX5 A;  3O1O A;  5KXD A;  1GV9 A;  2UWA A;  3AKP A;  1OSG A;  1BHG A;  3WDU A;  2DVA A;  4NPR A;  1OOP C;  1W8W A;  3IKW A;  3L2H A;  3R05 A;  3NMB A;  1JOJ A;  2A3Y A;  1A78 A;  1PO1 1;  1Z0H A;  3BVC A;  5FZB A;  1QJF A;  4MGI E;  5H9Q A;  4UW5 A;  3IDA A;  2Q0A A;  1RJ8 A;  4E2G A;  5HCH A;  1FX5 A;  1C8M 3;  3LSD A;  3OYW B;  1SLT A;  4P9W A;  1OBN A;  2LW8 A;  4OHV A;  4Q4V 2;  4PF1 A;  2OQ7 A;  3S6P A;  4BQ1 A;  2ZEW A;  1OF3 A;  3D0J A;  3VGI A;  4G3Y C;  4AQT A;  5DAB A;  3NRU A;  4BDV B;  1VBE 2;  4YW6 A;  3ZFE A;  1RUI 2;  3WQB A;  4PBO A;  3IT8 A;  4HN0 A;  1KDM A;  5JOZ A;  5IFP A;  3CZJ A;  4IEY A;  1OUX A;  1FPN 3;  4WVV A;  3WD5 A;  3VD9 A;  1OQ1 A;  2VZV A;  1QOO A;  2WFF 2;  2IC1 A;  1Y4W A;  3PME A;  4XIK A;  5BNO A;  1JH5 A;  3R4U A;  1X8M A;  4QU1 A;  2XML A;  1LHN A;  3EB7 A;  3JUU A;  1U5I A;  1YQ2 A;  2EAA A;  1Q8V A;  4B1M A;  2Q4S A;  3SEE A;  2WLP A;  4YG3 A;  1PX4 A;  4MXV A;  5KWR A;  3PIG A;  1WA6 X;  4LMF A;  1S0D A;  1AYN 2;  4CP9 B;  3EO6 A;  1JS9 A;  4FOY A;  1SDD B;  2Y34 A;  1BBT 3;  3OUH A;  5EV7 A;  4CDQ A;  5FP7 A;  3KHC A;  3C7E A;  5F37 A;  3AP4 A;  4XFB A;  3AL5 A;  2PEL A;  1QJE A;  3ABZ A;  4H7L A;  1UXX X;  5G05 L;  3SKJ E;  1DYP A;  2ZGO A;  3B00 A;  4WVW A;  2XWB B;  4XJA A;  2AUY A;  2QZ3 A;  4FP2 A;  4YPJ A;  4JDM A;  3WF0 A;  1IS5 A;  3RWK X;  2GAU A;  1GYK A;  3OPW A;  4QGL A;  4CEW B;  4H55 A;  3DN7 A;  4OHW A;  5JR7 B;  4JVA A;  2OKX A;  3OPT A;  1ZBA 2;  5BPX A;  3NJV A;  4WM8 C;  4GJY A;  1ULE A;  3CJI B;  4LHS A;  3VZO A;  1QGL A;  4ATE A;  4CU7 A;  1HB1 A;  4HON A;  5T55 A;  1QKQ A;  2P34 A;  1M4W A;  3WIN E;  4C8D A;  2Z5W A;  1DDL A;  4DIQ A;  1W3X A;  1B09 A;  1VBC 2;  3THP A;  4JV4 A;  3LCP A;  4QX5 A;  5CFC A;  3WLU A;  2A3W A;  5CKN A;  1US2 A;  5A7W B;  4XTP A;  3CF6 E;  4XXP A;  5IVJ A;  1ONA A;  3S5Q A;  5FYV A;  4D7T A;  1UU6 A;  5F8P A;  5FPV A;  3WNO A;  1AL2 2;  3KQ4 B;  1PO1 3;  4RHV 1;  3I59 A;  2QFE A;  1J3Q A;  1SBF A;  2FCT A;  1RGS A;  1E57 A;  2XUE A;  2DFC A;  3LA3 A;  4AVV A;  4M4R A;  1ZM1 A;  4ZXE A;  4DEQ A;  5IVB A;  2XJR A;  1GBG A;  1Q3E A;  4TZD A;  3VBO B;  1WCD J;  2ZEZ A;  4HVR A;  3K4Z A;  3ZO0 B;  4L2N A;  3TAY A;  4CCM A;  4MOA A;  2BNO A;  3LGR A;  4COU A;  4ZON A;  1YUD A;  2Y6K A;  2A6X A;  5I0S A;  1W2A X;  2CNA A;  3OPZ A;  4FXG B;  4ISQ A;  1IPK A;  1V6N A;  1CPM A;  4QPG B;  1SLI A;  2FDF A;  5FCC A;  3D82 A;  3AJY A;  2VCA A;  2Z42 A;  5HXV A;  5L36 A;  2PLV 1;  4R9D A;  3WSO A;  1PZ9 A;  2NM1 A;  3FUQ A;  1SAC A;  4AFC A;  1LHO A;  3H3U A;  5A3P A;  4UFM A;  3BTY A;  3IAP A;  1H6X A;  5GZE A;  1Q8S A;  4DY3 A;  3ACL A;  4Q29 A;  2VZS A;  4QKN A;  1XE0 A;  2Q8E A;  5J09 A;  3BYW A;  4QGN A;  5FAX A;  3N35 A;  4XXA A;  3SHR A;  4A6O A;  5IVC A;  1GAN A;  5FZ8 A;  3NVC A;  3ITQ A;  4FPJ A;  4MGQ A;  4WVM A;  1W6M B;  2VC9 A;  5KC6 A;  2J1T A;  3OGS A;  3OEB A;  1W03 A;  4XIL A;  5I8T A;  1RUF 2;  1XQN A;  2R04 1;  4ISR A;  5FZK A;  2PAK A;  2YYO A;  2GMM A;  3WF2 A;  2WKK A;  3KV9 A;  4CEW C;  1OFS A;  4L92 A;  3ACG A;  1MS8 A;  4JAA A;  1W9S A;  1CQ9 A;  4CU9 A;  5G04 L;  4LBO A;  3WZ1 A;  5BV6 A;  2PHT A;  4LTA A;  4DRR A;  1C5H A;  3CJI C;  2R06 3;  3W58 A;  3N9O A;  5IAV A;  1LOB A;  2HYK A;  1I5Z A;  1QWR A;  4M01 A;  5GM0 A;  3ILR A;  2YC0 A;  5C3R A;  1V6J A;  1V6L A;  3C7F A;  1JU4 A;  4LKD A;  1ZBE 2;  4CEY A;  5A6X A;  2QQU A;  1R1A 2;  2HWB 1;  3Q8A A;  3LB9 A;  4XDQ A;  4QHB A;  1U5Y A;  5CKQ A;  1ZZ9 A;  5HBA A;  3FHA A;  4RHV 3;  2OYZ A;  3GCW A;  1J3P A;  1TMF 2;  1E5S A;  2QVS B;  2Y8K A;  3UYJ A;  2XQX A;  4X6Q B;  4JX0 A;  4OQ8 A;  3URF A;  4BQ5 A;  3WHT A;  3JXS A;  3VBO C;  2DCY A;  2CGO A;  3I3Q A;  1RUE 2;  4KH9 A;  1NT0 A;  1C3H A;  4AVS A;  2CHH A;  4D3W A;  3I3D A;  1BQP A;  2HWF 2;  4URA A;  5FR3 A;  1F2N A;  4LA2 A;  4Y24 A;  3WQ1 A;  4IE5 A;  2WYS A;  3UT0 A;  3HQU A;  3ON7 A;  4PI0 A;  3ZFG C;  1BXH A;  4QPG C;  4F8A A;  2BU9 A;  5ABJ C;  2YZ4 A;  1PZ7 A;  4B4R A;  2D3R A;  4LNV A;  2W94 A;  3KB5 A;  4JRL A;  3B93 A;  4P5Y A;  2ZZJ A;  4GD4 A;  1OA3 A;  3W21 A;  4QX0 A;  3M7A A;  4AL9 A;  2PLV 3;  1G9B A;  4YG6 A;  1R08 1;  1VAM A;  1GOF A;  3B9I A;  3PUS A;  2O14 A;  3AVR A;  2VR4 A;  4JKL A;  1UZY A;  2VBD A;  3AXE A;  4Q4Y 2;  1YQ5 A;  4XZP A;  1W9W A;  4QX7 A;  5C4W A;  1V6O A;  2R16 A;  4MET A;  1EAH 3;  5BUV A;  3WP5 A;  4XJW A;  2RMU 1;  3I2F A;  1UZV A;  4MX3 A;  3DPR B;  2X05 A;  1SPP A;  1N3O A;  2QQN A;  3RFR A;  4AVC A;  1WCQ A;  2VQU A;  4O9E A;  3FFZ A;  2SBA A;  3J7L A;  4Q4W 1;  5A7Q A;  1QY4 A;  5GLT A;  3M3O A;  2A1X A;  4Q8L A;  1LCL A;  1DYO A;  1S0F A;  1W8U A;  3OGV A;  3NNJ A;  1WCS A;  3MUZ 1;  1DQ2 A;  4LUL A;  5F2W A;  4FOQ A;  4B7K A;  3AYD A;  1G9D A;  2R04 3;  3GGL A;  5FFO C;  4YVS B;  5FZG A;  1ZRF A;  2WFP A;  1QOT A;  1MEC 3;  4FPC A;  4A7K A;  2UUR A;  1ULC A;  2VNR A;  3LFI A;  4C0B A;  4PDW B;  5HPO A;  2YV8 A;  3C8X A;  3VZL A;  5LAS A;  3HIF A;  4XF4 A;  1F4A A;  5EHD A;  1D0H A;  2IXJ A;  2VBB A;  3ACI A;  4N43 A;  2F4L A;  2OZ6 A;  4YVW B;  3WW4 A;  1W28 A;  1H8T A;  1W6Q B;  4W6W A;  4BZ4 A;  5EFU A;  4IEV A;  5FKC A;  2P3K A;  5HI0 A;  1D4V B;  1RJ7 A;  2C26 A;  3MW3 A;  5FP8 A;  4HBN A;  1MS1 A;  2E7Q A;  3ACH A;  2WAB A;  2VW1 A;  4ASL A;  1B35 A;  1PK6 A;  5BNP C;  4OUS A;  4R52 A;  1KXG A;  3EXU A;  3HQR A;  4GH4 B;  3Q8F A;  1UU4 A;  2JG9 B;  3DL3 A;  5CFD A;  1C57 A;  1QQP 2;  3ZPO A;  2WRA A;  5FZO A;  1VB4 A;  4PLM A;  1UAI A;  2EF6 A;  2R30 A;  4IGO A;  2GH8 A;  2WWU A;  3FMG A;  4ARY A;  1J58 A;  1FOD 1;  1NY7 1;  1HV0 A;  1X82 A;  2TNF A;  2ZGR A;  3DV8 A;  3HVD A;  3K3N A;  4NWW A;  2NMN A;  1VR3 A;  4JRA A;  4IV1 A;  1QJY 1;  3Q8B A;  4IEP A;  4WM7 A;  3ZXL A;  4DXZ A;  2ID4 A;  3L9J T;  4EN8 B;  4BQ2 A;  2VCB A;  2RG4 A;  5HV4 A;  1M06 G;  1XRU A;  1HJG A;  2AC1 A;  1W9F A;  1BK1 A;  4YM3 A;  3HR9 A;  1K45 A;  1UCX A;  1BEV 1;  2VZ3 A;  3IIA A;  5FUP A;  3TN9 2;  3KT7 A;  4N7U A;  4DRV A;  3THD A;  2E53 A;  4ASM B;  1NCR B;  1A8D A;  2ZS6 B;  1R08 3;  2KR2 A;  1LU1 A;  1NA1 A;  4HMZ A;  4Y1X A;  1UX7 A;  4W6Y A;  3OY8 B;  1F5F A;  2P37 A;  5IVF A;  3VZN A;  4AQ2 A;  2JDP A;  3O0V A;  1EY2 A;  4XC9 A;  3E97 A;  2ADD A;  1TME 1;  3MFC A;  2XVG A;  3J8F 1;  3JB8 A;  5DN2 A;  1LJ7 A;  3DPR C;  3CHX A;  3J7N A;  3ALQ A;  2P2K A;  4MV2 A;  1FMD 2;  1LRH A;  2RM2 1;  1SQ4 A;  2B5H A;  1W0N A;  2WNV B;  4JC1 A;  5JI9 A;  1QNY A;  3FHQ A;  3H0O A;  2YBP A;  1Q8Q A;  1XB9 A;  2E32 A;  3C7H A;  3I3B A;  3NAP B;  1UN1 A;  4M00 A;  5GJ6 A;  2D44 A;  3E1F 1;  1X7N A;  3A7Q A;  2QQM A;  2QKD A;  3E5Q A;  4CDU A;  2E26 A;  5C3S A;  5F5Q A;  3V0A B;  1PO2 2;  2ARX A;  1VBA 1;  5FWE A;  2JIC A;  4HSL A;  2A7A A;  4AFD A;  3KVB A;  3N9Q A;  1C8N A;  2IXL A;  2WAA A;  2C24 A;  2VOT A;  2G9G A;  4FAG A;  5DPN A;  1DCS A;  4PDW C;  4QWN A;  1O91 A;  4PQ9 A;  1OH4 A;  4CU8 A;  1V00 A;  2QCS B;  4QX8 A;  4XJZ A;  4EV0 A;  5A7N A;  1MZF A;  5C3P A;  1AXK A;  1UOG A;  1AUY A;  2CTV A;  3CZU A;  4MXW B;  4XFA A;  3VZK A;  3AVS A;  2WUH A;  2W92 A;  5C5T A;  4JTN A;  5IJR A;  1OQE A;  2FMD A;  4A7Y A;  3AX4 A;  1I3H A;  4IUG A;  2BNN A;  5E16 A;  5JI7 A;  3WCS A;  1O4T A;  4QHO A;  5JSR A;  3ZYR A;  1UF2 C;  5CIR A;  2AH2 A;  3H1Y A;  4XAA A;  3LEG A;  2ARC A;  1DGL A;  5IVV A;  3NJX A;  4BA6 A;  2RS3 1;  4E2Q A;  1SFP A;  4GMP 1;  4C1X A;  4GH4 C;  1KJR A;  2JG9 C;  2WO1 A;  3GJB A;  1JI6 A;  1QNW A;  1UOF A;  2VVD A;  4Q4V 1;  3RMX A;  5J36 A;  3H1W A;  1OUR A;  1LHU A;  1WGP A;  1FOD 3;  4BH9 A;  1VBE 1;  3A4U A;  5L7O B;  1RUI 1;  1VMJ A;  1W6O A;  2ZGQ A;  1QJY 3;  1XYO A;  3POB A;  1XC6 A;  3AP9 A;  4GB3 1;  3WUC A;  3KV6 A;  5KHI A;  1LOD A;  5FP3 A;  4P9X A;  4D8M A;  3KS7 A;  1GOH A;  1ENR A;  4MVT A;  4W4Z A;  4AGV A;  3WDT A;  1G9A A;  2HBT A;  3AP5 A;  1SLC A;  3T4H B;  3W5M A;  4JGY C;  2O0O A;  4KBB A;  3NNF A;  2Q8C A;  4UFK A;  3WHU A;  1VRH 3;  4FQZ A;  3NV2 A;  1NG0 A;  1S0J A;  1WWY A;  1WCK A;  2DCT A;  1H2N A;  3P6B A;  1YQ8 A;  2PHX A;  4MYE A;  3BB6 A;  4WVZ A;  1NCR C;  1LOF A;  4GIQ A;  4IE0 A;  3VBU A;  3LE0 A;  1YFW A;  5FY4 A;  2TUN A;  1R64 A;  1YXW A;  1X33 A;  2XDV A;  5FRA A;  2JG8 B;  1QDO A;  1CAV A;  1F35 A;  1TME 3;  2DUO A;  3HBK A;  2YXS A;  3KT1 A;  3J8F 3;  4YLZ A;  2WNE A;  1QMJ A;  3E6C C;  1R09 2;  1HRV 1;  2WT0 A;  4IER A;  4CDX B;  2ET7 A;  4CUB A;  1RL3 A;  2ZGT A;  1JOB A;  5FJK A;  1IQD C;  5C8W A;  2RS5 3;  3NAP C;  4EN7 B;  4ERO A;  2WT1 A;  2VH9 A;  5ANN A;  3CDZ B;  3WNN A;  5L7O C;  3RI9 A;  2DUR A;  3T1L A;  4DOU A;  3I2J A;  1QIQ A;  5A32 B;  4NAM A;  1VBA 3;  3ST7 A;  1STM A;  1JZ3 A;  3WVJ A;  5KHH A;  1UKR A;  3MV1 1;  3LWC A;  1AR8 2;  4A3Z A;  3U07 A;  2VGD A;  3VBF A;  4YW5 A;  1D4M 1;  5CYY A;  4GWI A;  4HKO A;  1W9T A;  1VBC 1;  3ZR5 A;  4QMA A;  3TRS B;  4XJ8 A;  3TNQ A;  5BNQ A;  2BZD A;  1IS4 A;  4IV3 C;  1AVB A;  3PVN A;  1U5X A;  1RUD 1;  3G7D A;  2VY0 A;  1S2E A;  2JXA A;  3QD6 A;  5I0D A;  5DMY A;  3N7J A;  3JQW A;  4QDQ A;  1Z7S 3;  2XVK A;  3POF A;  5CIS A;  1BYH A;  3AZW A;  5BNN B;  2YU2 A;  1H0B A;  1ULP A;  3EBR A;  2RS3 3;  1NYW A;  3FE5 A;  1WW4 A;  4UBG A;  3ZFF B;  2QDR A;  2JDU A;  1VJ2 A;  2QZ2 A;  4V1P A;  3NV4 A;  1IG3 A;  2X5I A;  2EA7 A;  4GWM A;  1APN A;  1W6P A;  2GNT A;  1RUI 3;  2NLR A;  3ZXE A;  1YQC A;  5CU1 A;  5FMC A;  5GAL A;  1OKQ A;  4WBB A;  4GB3 3;  3AKQ A;  1QOS A;  2W39 A;  3WEZ A;  4TLG A;  1DF0 A;  4HOO A;  2FDG A;  3SCG A;  2WO2 A;  1GWL A;  1DQ6 A;  2KD7 A;  1OQD A;  2DU0 A;  1NZC A;  1K5J A;  5FMD A;  4GWJ A;  2QQK A;  1UZZ A;  4XBQ A;  5DUX A;  3T08 A;  4U36 A;  2QTW B;  4L9B A;  4LHK A;  2DBI A;  1HV1 A;  1DQ1 A;  2JDZ A;  1DBN A;  1UD1 A;  5CAZ A;  3VD4 A;  2WS9 2;  2HLE A;  3MHZ A;  1W0O A;  5DDJ 2;  1RVF 1;  2JG8 C;  3IZO A;  3OGR A;  4BME A;  3H9A A;  5AVP A;  1HRV 3;  4A41 A;  1QJX 2;  1JOD A;  2D98 A;  2RS1 2;  1NCQ A;  3NL1 A;  4CDX C;  4Q5O A;  3CO2 A;  5ACA 3;  1CX1 A;  2CWM A;  2JDA A;  5JMO A;  1CD3 G;  2NYY A;  2ZA9 A;  1V9U 1;  2J1R A;  2YDE A;  3UV9 A;  3ZYP A;  5IT6 A;  3QBQ A;  3SH5 A;  2CL2 A;  3TYJ A;  1CIW A;  2BUK A;  1CWP A;  3AYE A;  3PDQ A;  5LY2 A;  2K2S A;  3CIH A;  3MLL A;  3HN3 A;  1KQR A;  1D4M 3;  4LBQ A;  2ET1 A;  3O7O A;  3O1T A;  5DAW A;  3POJ A;  1G8W A;  2BBV A;  2QJV A;  1HIX A;  5C70 A;  3LA7 A;  5K4L A;  4XUQ A;  3NWK A;  3DEM A;  4AI0 A;  1UPI A;  1RUD 3;  2V73 A;  2WC2 A;  3MV0 1;  4XF1 A;  4EWD A;  2X29 A;  1XJA A;  3ZYJ B;  3ZFE B;  1MQT A;  3BOW A;  5CVR A;  1O3Q A;  2O8Q A;  1AXZ A;  3A0N A;  5J1X A;  1O5L A;  2H0V A;  4NN0 A;  1U12 A;  2ZHM A;  2WZR 3;  1ULG A;  2WJS A;  4OCT A;  5BNN C;  5BNO B;  2FCV A;  3LPG A;  4L11 A;  4D6Q A;  3WG1 A;  5CEH A;  2WIN B;  3GHN A;  1Y43 B;  1SFY A;  4JGZ A;  5DG1 A;  3ZFF C;  1CES A;  4UFI A;  5FMB A;  1WCU A;  3WW2 A;  1RMU 2;  2VUA A;  3INA A;  4XBL A;  4C1W A;  4DXT A;  3N36 A;  3IMN A;  4XAC A;  4BCU A;  4HVO A;  1HX6 A;  2DUQ A;  2PAE A;  2R0H A;  1RUC 2;  4CDQ B;  1XSR A;  2J1A A;  2A73 B;  1S2K A;  2A75 A;  3AFG A;  5FYT A;  4KQ7 A;  5C3Q A;  2IFR A;  2G19 A;  4Z2A A;  1N1V A;  2FCU A;  4FP3 A;  1HRI 1;  1WW6 A;  1W8T A;  2ZBJ A;  1DQ4 A;  4IXL A;  4Q4Y 1;  4XMA A;  2J42 A;  2PA7 A;  4LOS A;  1SBD A;  1OMI A;  1XNA A;  2ZAB A;  4I30 A;  4R4X A;  4CP0 A;  2RDR A;  4X6R B;  4OQ9 A;  4G9S B;  2B8M A;  5A1L A;  3OOX A;  3LA2 A;  1XNB A;  5DG2 A;  4K7J A;  1KDK A;  4DUW A;  1OD3 A;  1POV 0;  1IS3 A;  2VME A;  1GNZ A;  4XDO A;  1TNR A;  1OLR A;  1TE1 B;  3D4K A;  2QBX A;  3H1M A;  1RIR A;  2EIG A;  1RVF 3;  1ZRI A;  3EJK A;  4QQP A;  1GSL A;  3F2Z A;  5L9B A;  5FZL A;  1Y7B A;  2G4I A;  1SBE A;  2I74 A;  4JHZ A;  4NID A;  2N7G A;  3BPS A;  3AMQ A;  1AX2 A;  3RMY A;  2VUC A;  4Q1P A;  1HQL A;  2BFU L;  3RNS A;  5CFC B;  1G9C A;  5FOB B;  5F6L B;  2D6M A;  3BOP A;  2ZMK A;  3NNL A;  1D2S A;  1V9U 3;  1H4H A;  2YG0 A;  5FTT C;  1UMH A;  3QCW A;  3EQE A;  4Y5Z 0;  2BW8 A;  5FYU A;  5C5U A;  2ORX A;  5JXJ A;  5JVV A;  3SCH A;  4FQ4 A;  3RWN A;  3NNG A;  3POS A;  5F5C A;  2ZAH A;  2YC2 A;  4GKX A;  2BRT A;  3E6D A;  4W50 A;  2ETE A;  1V0A A;  1X50 A;  2SLI A;  3R4D B;  3HNM A;  4NHX A;  4RN5 A;  2GDF A;  4XJU A;  1GQG A;  1J3R A;  2UY8 A;  3VUO A;  3K4A A;  1R1Z A;  4X8P A;  1RB8 G;  1OPO A;  3MIG A;  4ZHN A;  5IHR A;  4K40 A;  2VOV A;  2ZX2 A;  3QH7 A;  4O65 A;  3EMR A;  4CA9 A;  4N90 A;  4AI9 A;  2GC2 A;  1QQP 1;  3M70 A;  3ZFE C;  1COV 3;  1RUJ 2;  4A6S A;  1PIV 2;  2WNU A;  1J1L A;  5FIX A;  3VZM A;  1XNC A;  4R9B A;  5LEJ A;  1DQ0 A;  2MEV 2;  2DTY A;  3Q8E A;  4ASK A;  3VHR A;  4E4S A;  1VAV A;  5BNO C;  2VXR A;  2Y38 A;  3J4U H;  3PTY A;  4GQ7 A;  4HKW A;  3ZXD A;  5T50 A;  4CCC A;  2C5D A;  4KWJ A;  5CAD A;  4B7E A;  1WLW A;  1NZI A;  3DCQ A;  1S55 A;  3DUI A;  4KWU A;  4S2G A;  3T09 A;  4TYS A;  1V70 A;  2EVX A;  4Q4X 2;  2OT7 A;  5FV3 A;  1A3K A;  4DS0 A;  5FXZ A;  3ZSM A;  4RR3 A;  3TEZ A;  1LHW A;  1H30 A;  4CDQ C;  4E8C A;  1YFX A;  3IPV A;  1ZRC A;  2DCZ A;  1C1L A;  4GXL A;  3ZPY A;  3HWJ A;  4Y22 B;  5C33 A;  2BGC A;  1ZRR A;  2W46 A;  2VVF A;  1HRI 3;  3LIH A;  3OCP A;  3K4D A;  3PHM A;  4WVM B;  2PYT A;  4K3U A;  2MNG A;  4KMQ A;  4SLI A;  3ZN4 A;  4Q4Y 3;  3W20 A;  4E4H A;  2FMY A;  4ZS2 A;  3RZH A;  1IGO A;  1OVP A;  2VMI A;  1XNK A;  3LDK A;  3CU7 A;  5LA9 A;  5BY5 A;  3PUA A;  1UY2 A;  2WO7 A;  2JDK A;  3SIT A;  2ENR A;  3OGJ A;  2ZGU A;  4LBL A;  1FMD 1;  3BTA A;  1DGW A;  4RGA A;  1ZZC A;  3BPZ A;  4PF5 A;  1JZ2 A;  1VBD 1;  2VW2 A;  5FMO S;  4EQV A;  3POE A;  4XF3 A;  3ILF A;  4OUM A;  5DUW A;  4UYB A;  1UYP A;  4Q0P A;  5A7P A;  3NW4 A;  1W0P A;  3QOP A;  1ASJ 2;  1PO2 1;  1ENX A;  1SZB A;  2VM9 A;  5LRR A;  1YWK A;  2XQR A;  4DUV A;  4UW6 A;  2VU9 A;  1HN1 A;  2IWG B;  5CFC C;  4FPG A;  3M4F A;  2HWC 2;  4FFI A;  4HG6 B;  1F9K A;  4CEY B;  1FAT A;  1CPN A;  1US3 A;  4DNY A;  3CKH A;  3T2P A;  4EYU A;  4LPL A;  1GZ9 A;  3J7H A;  1OHF A;  1AR6 2;  5SV5 A;  2VTF A;  4YGD A;  2CWS A;  2ZEX A;  3FLT A;  4I2O A;  2IUW A;  4R9C A;  5HCA A;  2IZW A;  3ZXA C;  1AR9 3;  1S4C A;  1UQX A;  3Q8C A;  4FT8 A;  4NIA A;  4HL0 A;  1ZZ7 A;  3AB0 A;  3LSE A;  4I01 A;  4BXS V;  4TN7 A;  2ZCW A;  3EHK A;  2P17 A;  1VMF A;  1GUI A;  1VRB A;  2GAL A;  2ZJC A;  4F83 A;  4XUP A;  4YZ4 A;  4UXA A;  1RUN A;  2A6Z A;  4HFS A;  4CCE A;  1J59 A;  1EV1 3;  1RHI 1;  1NLR A;  1CN1 A;  1ZA4 A;  2ZX4 A;  4QXH A;  4AFA A;  2AEN A;  2DU1 A;  2TBV A;  1Q8O A;  4HLT A;  4YM2 A;  1VMH A;  2YGM A;  2Q1F A;  4QKF A;  4NRM A;  3SH4 A;  5C4W B;  5FO8 B;  1TG7 A;  3WF4 A;  4RD7 A;  2YY1 A;  3WW1 A;  3IB3 A;  5FO7 B;  4CCJ A;  1SPP B;  2ZXQ A;  4DPN A;  4QXB A;  4ZZ8 A;  4ES8 A;  4KBZ A;  3HPN A;  4L99 A;  2GP3 A;  4D6S A;  4AXO A;  4B4P A;  3ZXG A;  2XGX A;  1MAC A;  1W6N A;  3ZKU A;  3KLS A;  4QPI A;  3BCW A;  2IVI B;  3H7J A;  4CP1 A;  2OUH A;  4NRQ A;  2WSV A;  2XON A;  4AWD A;  3AC0 A;  1NUK A;  4OFG A;  5IK7 A;  3ZFG B;  1J84 A;  1XE8 A;  5LBF A;  1R09 1;  3IMM A;  3ZVX A;  2ADE A;  5ABJ B;  5CG9 A;  5J48 A;  1LHV A;  2ZX1 A;  5FLJ A;  4CPB A;  1VBD 3;  4MLO A;  5F2S A;  4Y33 A;  3R0R A;  3ZXK A;  3LZZ A;  1Y9M A;  4LO6 B;  2VW0 A;  4HK8 A;  4N43 B;  5DAP A;  4BHP A;  3RZL A;  1H8T B;  3T2T A;  3HT1 A;  4I09 A;  5FOJ B;  4K1Z A;  1AR8 1;  3JD7 2;  5FZ1 A;  2QQP A;  1GWK A;  3ZYH A;  3JQX A;  3AYA A;  4QXC A;  4CEY C;  5I93 A;  4NIH A;  1NXD 1;  3CBN A;  5C8C A;  1B35 B;  1WD4 A;  1PK6 B;  1YCI A;  2W91 A;  1K5M A;  5FZI A;  3PIJ A;  3PL0 A;  5A3U A;  1UX6 A;  5CFD B;  2DFB A;  3R4S A;  4RQP A;  5D8A A;  2Q1Z B;  4IGQ A;  2HEY F;  5FZO B;  3C2U A;  1BMV 2;  3FLP A;  1YYN A;  3B02 A;  2I45 A;  5EIY B;  3O1U A;  5GZF A;  2WLQ A;  4W65 A;  1KD7 A;  4KWK A;  5DUV A;  1OH3 A;  1QJU 1;  4WM7 B;  1NX9 A;  2RVA A;  4XHB A;  3T4V A;  4AGR A;  2JX9 A;  4GKY A;  3TNP B;  5E6H A;  4ATF A;  1W2O A;  3WDX A;  1XNT A;  4RA0 A;  2R49 A;  4YRD A;  4CZS A;  3IDC B;  3VKL A;  5M0T A;  3BTX A;  4BK4 A;  1RHI 3;  2QQW A;  2XB6 C;  3CMG A;  2YPD A;  3D8C A;  3U75 A;  1H6Y A;  5LK7 B;  4FPY A;  3VBR A;  5DUU A;  4CP2 A;  1H9P A;  2ATF A;  1GNH A;  5B4N A;  3PUI A;  5A1F A;  1VBB 2;  1WLT A;  1NA1 B;  4N53 A;  2XHK A;  4LBM A;  5BNP B;  5C4W C;  1LB2 A;  4YWA A;  5FQ0 A;  5T5J A;  3BTZ A;  4ZU4 A;  1LEN A;  5FYY A;  3SEP A;  2GP5 A;  1XOY A;  3ORJ A;  3B5L B;  4KU7 A;  4E9K A;  3ZXF A;  2XLA A;  1RTV A;  1BVP 1;  3GJA A;  1DU3 D;  2R1B A;  2VMH A;  3AP7 A;  4IEW A;  4CDU B;  3GBW A;  1F5J A;  1WME A;  1UYY A;  2VZR A;  4JQR A;  4OZO A;  3K3O A;  3THT A;  4ORF A;  3LEK A;  4LLO A;  3DKW A;  5H9S A;  4B4Q A;  4B29 A;  5BXX A;  1AX0 A;  4P14 A;  5JPN B;  1UL9 A;  2Z69 A;  4H2A A;  4WZF A;  2JIJ A;  4AQ6 A;  4CDW A;  1PMI A;  1R09 3;  5E88 A;  1QJX 1;  3LIG A;  5FMO L;  4BWO A;  2CU5 A;  4LBJ A;  4M3C A;  4XW3 A;  4YGE A;  2LRO A;  3M1H A;  4Y1Y A;  2WZE A;  1QXP A;  1W9Y A;  3WV6 A;  4N43 C;  4B8E A;  4LKE A;  1UW8 A;  4X8N A;  5EP9 A;  1H8T C;  3H3Z A;  3MUY 1;  4KG8 A;  5A3M A;  5AC9 2;  2B45 X;  4I0W B;  1OLQ A;  3O1S A;  1AR8 3;  4NHY A;  3U11 A;  4N9I A;  4URT A;  2EXH A;  5E89 A;  1K42 A;  3OTF A;  1B35 C;  1OLM A;  1PK6 C;  1YNA A;  4MHU A;  4FAH A;  4LQR A;  3V64 A;  4E27 A;  3RG0 A;  3JCI A;  4AFB A;  2WWJ A;  1PVX A;  4DZG A;  2D43 A;  3TB0 A;  4DUX A;  5CFD C;  2CGN A;  1CJP A;  3GHM A;  4NHL A;  3P3P A;  3PVO A;  4R4Z A;  1W90 A;  4BQX A;  3FBM A;  3BUC A;  3WG3 A;  2CSG A;  1L7L A;  2VBP A;  1W6O B;  2YHJ A;  4XUN A;  1H1M A;  1QJU 3;  4AZZ A;  1JYI A;  4WM7 C;  4XYX A;  2E33 A;  4LUK A;  5FPU A;  1I6X A;  3CEW A;  2X8K A;  3WDV A;  2YFZ A;  4COY A;  1GWM A;  2P6C A;  2RDS A;  3UJQ A;  3WOG A;  4NHM A;  2V4A A;  2IXI A;  1RMU 1;  4QQO A;  4MZU A;  1QJZ A;  4XOG A;  4Y20 A;  1CAU A;  5A33 A;  3MFA A;  1C28 A;  2XJP A;  1RUC 1;  4EJR A;  4A42 A;  3AZZ A;  2HWB 3;  3VBU B;  5F5I A;  5FUI A;  3B01 A;  1NA1 C;  3N7L A;  2JDN A;  5FK8 A;  1LGB A;  3ZSJ A;  5D1I A;  4GAL A;  3RZK A;  1PNG A;  1X9P A;  1BBT 2;  2A5Z A;  3H8R A;  1CAV B;  1QF3 A;  1VPH A;  2JD9 A;  5JSO A;  4BMB A;  5JZG A;  2ZKL A;  3MYX A;  1EP0 A;  1JTZ X;  3JU9 A;  3I2H A;  1FNZ A;  3MF9 A;  3SKV A;  2YMZ A;  4E8D A;  2IVJ A;  4PIY A;  5FLH A;  3RVH A;  5KHG A;  4CDU C;  1VP6 A;  2XL9 A;  4ZPI A;  2JB8 A;  4AHY A;  2YUE A;  4XZU G;  3KF3 A;  5FZ6 A;  5KHJ A;  5LRS A;  1JU3 A;  1JZ7 A;  1CR7 A;  3HNY M;  3KCC A;  4JGY B;  5FYI A;  3VBF B;  1O3R A;  1QJX 3;  5LW9 A;  1SHW B;  3IBM A;  4QXK A;  4CU6 A;  3KVA A;  2B42 B;  1ZRD A;  3MIE A;  2GZW A;  5JUV A;  1PMJ X;  3O5S A;  2FD8 A;  3AKT A;  3C3V A;  1OXC A;  3GM8 A;  4JDO A;  1DZR A;  1GMM A;  4AF9 A;  1N3P A;  3FFQ A;  1TNF A;  4AI1 A;  4D7S A;  4RFT 0;  2LRP A;  1DLL A;  3GF6 A;  1E5H A;  5KXC A;  4XET A;  2WBK A;  5F7U A;  3PNA A;  3RZG A;  4LT5 A;  1Y9G A;  4EE2 A;  3TEY A;  2RMU 3;  1KS5 A;  3AMP A;  1LOC A;  1UWW A;  2W5F A;  1UMI A;  1HB4 A;  5JXI A;  2P3J A;  1CGP A;  2C0Z A;  4AE2 A;  2HWD 1;  2MPF A;  5EPA A;  4P9L A;  1PGL 2;  1RUG 1;  4Q4W 3;  4XHX A;  1OFN A;  2E7T A;  3VKO A;  3WNP A;  1Q5O A;  3UKN A;  3M3Q A;  4K8R B;  1LTE A;  3RJR A;  1SDW A;  4YGB A;  2X5I B;  2X53 S;  4XQW A;  1W6P B;  5FY7 A;  2YU1 A;  5C7G A;  4P5H A;  1JOP A;  4AEM A;  1RUJ 1;  3SQO A;  1PIV 1;  4QQH A;  3N3H A;  4P00 B;  2DCJ A;  2C4X A;  1G7Y A;  2EID A;  3ASI A;  1W8Z A;  3MPP G;  1VLN A;  2IXK A;  5K8S A;  2RDN A;  3OBR A;  2PTM A;  4IV3 B;  3WY6 A;  3HAG A;  2H6C A;  2ZGK A;  2AYH A;  3RYP A;  3U78 A;  1IS6 A;  4JQT A;  1RMU 3;  2W1U A;  4Q4X 1;  3O0X A; 
#chains in the Genus database with same CATH homology
 2ZEW A;  2JDA A;  3UES A;  1OF3 A;  1RYY A;  5JMO A;  2J1R A;  4BDV B;  3NRU A;  4ZZ5 A;  3WQB A;  5IFP A;  3CZJ A;  3VD9 A;  2VZV A;  2VZQ A;  2W87 A;  3CIH A;  3HN3 A;  2WAO A;  5C70 A;  1JYX A;  3EB7 A;  1YQ2 A;  2EIB A;  4PQQ A;  4XUQ A;  4KI5 M;  3SEE A;  1PX4 A;  3MV0 1;  3DYO A;  1SDD B;  2W9X A;  4QDS A;  3C7E A;  5HXM A;  3HOB A;  5J1X A;  1JZ4 A;  3DYM A;  3VD7 A;  1W8O A;  3ABZ A;  1UXX X;  5G05 L;  2VZO A;  3LPG A;  3SKJ E;  3VD3 A;  1UXZ A;  4YPJ A;  3WF0 A;  2EIC A;  5LA2 A;  4DXT A;  5B4X A;  2PQS A;  2VZT A;  2J1E A;  2OKX A;  2J1A A;  3NJV A;  2B4K A;  1T2X A;  4LHS A;  4CU7 A;  3ZM8 A;  4Z2A A;  2VO5 A;  4AG4 A;  1W8N A;  2ORZ A;  4CUA A;  1XNA A;  1US2 A;  2YB7 A;  3T0D A;  1XPW A;  4DUW A;  1OD3 A;  2VME A;  3WNO A;  4ARX A;  4BJ0 A;  2QBX A;  1UY3 A;  3WF3 A;  3F2Z A;  4M4R A;  4ZXE A;  4DEQ A;  4JHZ A;  2ZEZ A;  3K4Z A;  4ET7 A;  1I5P A;  4MOA A;  4CUC A;  3U37 A;  1JYN A;  1O8S A;  3DEC A;  2YG0 A;  2Y6K A;  4OUE A;  1UMH A;  3K77 A;  2ORX A;  5JXJ A;  2J1V A;  5JXG A;  3NNG A;  4M4P A;  2YC2 A;  2VZP A;  4W50 A;  3ECQ A;  4RN5 A;  3HNM A;  3UNP A;  2VCA A;  3WSO A;  2Z4F A;  3K4A A;  5LA0 A;  4XVH A;  5IHR A;  4UOJ A;  1GNY A;  3IAP A;  1H6X A;  2YC4 A;  2X09 A;  3GXU A;  4RYD A;  2VZS A;  4A6O A;  4TTG A;  4MGQ A;  2VC9 A;  1TVG A;  2J1T A;  3OGS A;  3OEB A;  4KWU A;  3T09 A;  3A22 A;  1CZV A;  3WF2 A;  3FN9 A;  3T2O A;  2VJX A;  1SG3 A;  2W1S A;  3ACG A;  1W9S A;  4ZY9 A;  4CU9 A;  4E8C A;  1W99 A;  5G04 L;  2QQO A;  4JKK A;  4QX1 A;  3BN6 A;  2WDB A;  3GDB A;  2W46 A;  4QX3 A;  4P02 B;  3K4D A;  4KMQ A;  3C7F A;  3W5M A;  1JU4 A;  4DXS A;  3LQC A;  2BBA A;  2J1U A;  4GZ9 A;  2E31 A;  1UY2 A;  1JYW A;  2V72 A;  4PT6 A;  5C71 A;  2Y6G A;  3FHA A;  1OT5 A;  2WN2 A;  2DCK A;  3LPF A;  1JZ2 A;  2W1Q A;  2Y8K A;  2XQX A;  2VL4 A;  4JX0 A;  3CQO A;  2DDU A;  3NQH A;  3JXS A;  2VM9 A;  4DUV A;  3OB8 A;  1HN1 A;  4HG6 B;  3I3D A;  3FL7 A;  4D0Q A;  1US3 A;  2WYS A;  2Y64 A;  3CKH A;  3T2P A;  4LPL A;  1K3I A;  3VDA A;  3J7H A;  2VTF A;  2ZEX A;  2W94 A;  4P5Y A;  4QX0 A;  3HEI A;  2J1S A;  1GOF A;  4LKS A;  2VR4 A;  4JKL A;  1W9W A;  4BXS V;  2JKX A;  2VQT A;  3MBW A;  3I2F A;  1GUI A;  2X05 A;  4XUP A;  2QQN A;  1WCQ A;  2VQU A;  3I3E A;  5LCW L;  1UYX A;  3K46 A;  4L0P A;  1DLC A;  1DYO A;  3OGV A;  3MUZ 1;  3A23 A;  1DP0 A;  3GGL A;  1TG7 A;  3WF4 A;  4OYU A;  3ACF A;  2Y6L A;  3IB3 A;  5HPO A;  3C8X A;  2ZXQ A;  1F4A A;  1UZ0 A;  4ZZ8 A;  4MGS A;  2WN3 A;  1JZ5 A;  3HPN A;  3DYP A;  2JE8 A;  3ACI A;  5IYY A;  1CZT A;  4MAD A;  1CZS A;  3C7G A;  2C26 A;  2XON A;  3ACH A;  3AC0 A;  1NUK A;  2R7E B;  2WAB A;  1J84 A;  3HJR A;  3W5N A;  1JZ8 A;  3THC A;  3T0A A;  2VZ1 A;  2Y6J A;  4ARY A;  1O59 A;  2ID4 A;  1OF4 A;  2VCB A;  4A45 A;  4P08 A;  2W91 A;  2WO3 A;  2VCC A;  2LS6 A;  4FI9 A;  2VMC A;  1K45 A;  2VZ3 A;  1GQP A;  3THD A;  3LEI A;  5EIY B;  2RV9 A;  4XUR A;  2CDO A;  3OEA A;  4MO3 M;  4UI9 L;  1WKY A;  1UX7 A;  1NX9 A;  4W8J A;  2RVA A;  1D7P M;  3K75 B;  1XNT A;  5DN2 A;  1KEX A;  1W0N A;  4QB1 A;  4BK4 A;  3FHQ A;  3CMG A;  2V4V A;  1H6Y A;  2E32 A;  3C7H A;  3I3B A;  3E1F 1;  3A7Q A;  2QQM A;  3EYP A;  4CVU A;  2E26 A;  5B4N A;  3PUI A;  1P8J A;  2Y6H A;  2WAA A;  2VOT A;  4A44 A;  5DPN A;  3SEP A;  1OH4 A;  4CU8 A;  2B9V A;  2QQL A;  3CZU A;  2WQ8 A;  3III A;  5JR2 A;  2WUH A;  2W92 A;  5IJR A;  2BER A;  1UYY A;  2VZR A;  4IUG A;  4OZO A;  3LEK A;  4XUT A;  1F4H A;  1J83 A;  3LEG A;  2YFU A;  1CIY A;  3NJX A;  4QB6 A;  3OBA A;  2WO1 A;  1JI6 A;  3ETP A;  3WF1 A;  2WZE A;  3D3A A;  5LA1 A;  5EJ1 B;  3PUH A;  2X10 A;  3MUY 1;  2W1W A;  1XC6 A;  1K12 A;  4XUO A;  4D8M A;  1GOH A;  2VMD A;  1UY0 A;  2BGO A;  4W4Z A;  1K42 A;  1UY4 A;  2BGP A;  3T2Q A;  3P1I A;  4LQR A;  4QB2 A;  1LNS A;  4DUX A;  1UY1 A;  2ZEY A;  3C7O A;  3T0B A;  1GU3 A;  3P6B A;  1PMH X;  3IAQ A;  3OG2 A;  4XUN A;  3LE0 A;  3VD5 A;  2QQJ A;  2XOM A;  3BGA A;  1R64 A;  2E33 A;  2WZ8 A;  3HNB M;  2YFZ A;  3MO4 A;  4QDR A;  2XHN A;  4CUB A;  4A4A A;  3I2K A;  3WNM A;  2QQI A;  1IQD C;  3I2I A;  5DQ0 A;  3WNN A;  3CDZ B;  4A42 A;  2VMF A;  3I2J A;  4JKM A;  1O8P A;  1JZ3 A;  5FUI A;  3VDC A;  1MPX A;  3MV1 1;  4UAP A;  1NKG A;  4A3Z A;  1JHJ A;  1GOG A;  5CYY A;  2HYX A;  1L7R A;  2JD9 A;  1PX3 A;  4GWI A;  2VZU A;  1W9T A;  4DXR A;  3I2H A;  4TXW A;  3SKV A;  2BZD A;  2RJ2 A;  4QPW A;  1EUT A;  4E8D A;  2C9K A;  5I0D A;  5DMY A;  4QDQ A;  1NAE A;  4XZU G;  3UET A;  1JU3 A;  1L7Q A;  2W47 A;  1JZ7 A;  5CZK A;  4OMC A;  1ULP A;  3HNY M;  2W95 A;  3WNK A;  1SHW B;  2J22 A;  4CU6 A;  5JUV A;  1UYZ A;  2CDP A;  1PMJ X;  1KGY A;  2V5D A;  3GM8 A;  1EUU A;  1GMM A;  2W3J A;  5IFT A;  3WNL A;  4BK5 A;  3I97 A;  4DEV A;  2J7M A;  2WBK A;  5F7U A;  4QAW A;  3WEZ A;  1UWW A;  1ULO A;  1UMI A;  2W5F A;  5JXI A;  1JYV A;  4OMD A;  2WO2 A;  5JXH A;  2L9L A;  5EJZ B;  2KD7 A;  3A21 A;  5A1A A;  3WNP A;  4GWJ A;  2QQK A;  3T08 A;  1JZ6 A;  5C7G A;  1BHG A;  3VDB A;  3VD4 A;  2HLE A;  4AAX A;  4QX2 A;  4P00 B;  2DCJ A;  2C4X A;  2EID A;  2EIE A;  3OGR A;  3I2G A;  3IDA A;  4A41 A;  2LW8 A;  1CX1 A;  2W1U A;  4PF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...