2RVAA

Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
131
structure length
131
Chain Sequence
b'NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 9
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rvaA00
3LQCA 4QDQA 4E8DA 2Y6KA 2ORXA 3I3BA 3D3AA 4JKLA 5JXJA 2LW8A 4PQQA 3NQHA 2KD7A 1UY3A 2JDAA 2VQTA 2Y8KA 1L7QA 2EIDA 3A23A 1WKYA 2VMCA 4GWIA 1ULOA 3LEKA 3WNLA 1SG3A 1KEXA 2VQUA 3ACHA 3SEEA 1W9TA 2VOTA 4ZZ5A 3VD7A 2QQLA 2E31A 3HN3A 3HNYM 1JYNA 1GQPA 4A41A 2WAOA 3WF3A 3HOBA 2Y6LA 5LA0A 2W92A 2EIBA 4GZ9A 3OEBA 2Y6HA 3CZUA 1TG7A 2VC9A 3NJVA 3WNPA 1W0NA 4A44A 2VZTA 3FHQA 1P8JA 2E26A 2ORZA 4LPLA 4CUCA 4P08A 3A21A 2VCCA 3PUIA 1JU4A 3LEGA 3C7EA 1CZSA 3MBWA 4W50A 2Y6GA 3VDBA 2VZPA 3T09A 3GDBA 3T0BA 4YPJA 4RN5A 2W9XA 4A6OA 1JZ7A 3T2PA 2VL4A 3PUHA 2J22A 1JYWA 5JUVA 3MUY1 3GM8A 2WYSA 3OB8A 4BK5A 5JXHA 3W5MA 5IHRA 2QQNA 1D7PM 4IUGA 1L7RA 4ARYA 2L9LA 2E33A 4XUOA 2W87A 1T2XA 2W3JA 1K45A 4HG6B 3A22A 1UX7A 3LEIA 4MO3M 2RJ2A 3T0DA 2VJXA 4CU9A 3AC0A 4XZUG 4JHZA 4D0QA 4ZY9A 4DUVA 4AG4A 4QB2A 2HYXA 4KI5M 2DCJA 4A4AA 1F4HA 3I2GA 2YFZA 1UY4A 1UYZA 3NNGA 3OEAA 2VZ3A 5LCWL 3SEPA 3WF4A 4CU8A 3C7GA 3C7FA 2WUHA 3CZJA 2W5FA 1EUUA 4M4RA 3JXSA 4QX3A 3P6BA 1JYVA 1XNTA 4KMQA 2J1VA 3K75B 1DLCA 3OGSA 3GGLA 1GOHA 4UOJA 4DEQA 1J83A 3WNOA 4XUNA 1MPXA 4ARXA 4M4PA 4ET7A 2RV9A 5IFPA 1JZ3A 4ZZ8A 1JZ2A 5JMOA 3MV01 4MGQA 3WF2A 5IYYA 5JXIA 2QQIA 3MO4A 3ACFA 5DPNA 2YB7A 2XONA 3OBAA 1JU3A 3DYPA 4ZXEA 3THDA 3VD5A 5J1XA 1CZTA 3DYMA 2Y64A 4OYUA 5DQ0A 3T2OA 4BXSV 3LPFA 5G04L 2V4VA 3WQBA 2XOMA 4A3ZA 2PQSA 4KWUA 3WEZA 1BHGA 1H6XA 1SDDB 1OD3A 4XUQA 5F7UA 4D8MA 2QQKA 3C7HA 1CIYA 1UYYA 5C7GA 2W47A 5CZKA 2VO5A 1PMJX 2BBAA 1CZVA 2ZXQA 4BDVB 5LA1A 1I5PA 2QQOA 1IQDC 4W4ZA 4JKMA 4QDSA 2XHNA 1PMHX 1LNSA 1EUTA 2C4XA 1R64A 2W46A 3VD3A 1O8SA 1JZ5A 3CKHA 1UWWA 2VMDA 3I2HA 2YG0A 3CQOA 1JZ6A 5JR2A 4OUEA 1US3A 4QB6A 4DUXA 2V72A 3C7OA 4PF1A 1JZ8A 1OT5A 1XNAA 4QX2A 1F4AA 1UMIA 1W9SA 3HNMA 3WSOA 2BERA 3IAPA 2C26A 3I2IA 2WABA 4MGSA 3J7HA 2BGPA 1K12A 4DEVA 5C70A 4XVHA 1UYXA 3VDCA 2VZ1A 3BN6A 2W91A 2BZDA 2Z4FA 3FN9A 3WNNA 1O8PA 1K42A 2VM9A 4QX1A 3I2KA 3WNMA 2W95A 1XC6A 2J1RA 5A1AA 4A45A 3UESA 3OGRA 2ZEXA 3T2QA 3VD9A 2X10A 3FHAA 2WO2A 3I3DA 3W5NA 2WZ8A 4MADA 2J1AA 4DXSA 4DXTA 4XUTA 3LPGA 4PT6A 1DYOA 2VCBA 4OMCA 3K77A 5HXMA 1OF3A 3WF0A 5DN2A 2YC4A 1US2A 1O59A 3CDZB 3DECA 2V5DA 3VD4A 3CIHA 1YQ2A 2B4KA 3MV11 1W8OA 4L0PA 1CX1A 2W94A 5B4NA 1HN1A 1WCQA 3HEIA 2WN2A 3T0AA 4P00B 1GUIA 2YFUA 4BK4A 3C8XA 1NKGA 2JKXA 1KGYA 5EJ1B 1K3IA 5CYYA 3FL7A 4DXRA 3I2JA 3I3EA 2BGOA 4AAXA 2EICA 3HPNA 3ETPA 4LHSA 4CVUA 4P5YA 1H6YA 1TVGA 4QX0A 2VZOA 3HNBM 4OMDA 1GOFA 4XUPA 2W1UA 5DMYA 1JI6A 1OH4A 2WZEA 2J7MA 2DCKA 5IJRA 2ZEWA 2E32A 2WO1A 3I2FA 1NUKA 2VZUA 1UY0A 5IFTA 2VR4A 4E8CA 4Z2AA 2J1TA 2LS6A 2WDBA 5B4XA 3HJRA 2B9VA 1UXXX 3NRUA 2WBKA 3EB7A 1GOGA 3OGVA 2YC2A 3ACIA 2WAAA 3OG2A 1RYYA 4CUAA 1OF4A 1DP0A 3MUZ1 2VTFA 4QB1A 1PX4A 3EYPA 2R7EB 2VMFA 3IAQA 3F2ZA 3GXUA 4LQRA 5JXGA 5G05L 2J1UA 1XPWA 4A42A 1JZ4A 2VZRA 1GMMA 4TTGA 5EIYB 4FI9A 2X09A 2VZVA 3ZM8A 1JHJA 2ZEYA 3ABZA 4XURA 4CUBA 2VZQA 2CDOA 3UNPA 1UZ0A 1SHWB 3CMGA 2W1SA 1JYXA 5C71A 5FUIA 4BJ0A 1PX3A 3K4ZA 2DDUA 5LA2A 4CU6A 1J84A 2WO3A 1W99A 4RYDA 3IIIA 3DYOA 5EJZB 3ACGA 4CU7A 4QAWA 2RVAA 3WNKA 3K46A 2QBXA 4JX0A 3BGAA 3SKJE 1UXZA 4OZOA 3WF1A 2ZEZA 2VCAA 3A7QA 1W8NA 3K4AA 2C9KA 1UMHA 4QDRA 2CDPA 2QQJA 2JD9A 3U37A 2J1EA 4W8JA 2XQXA 2W1WA 3E1F1 2JE8A 4MOAA 2W1QA 4TXWA 2WN3A 4DUWA 2HLEA 1NAEA 3IDAA 5HPOA 3I97A 1ULPA 4JKKA 2OKXA 3VDAA 1GU3A 2QQMA 3NJXA 3K4DA 5I0DA 3ECQA 1NX9A 4QPWA 3IB3A 4UAPA 4P02B 3UETA 4LKSA 2X05A 3LE0A 2J1SA 3T08A 2ID4A 1UY2A 1GNYA 2Y6JA 1UY1A 4UI9L 2VZSA 2VMEA 2EIEA 2WQ8A 3P1IA 3SKVA 3THCA 4GWJA 1W9WA
chains in the Genus database with same CATH superfamily
4A7ZA 1KRIA 4QDQA 4K6BA 2C6SA 2CNAA 2ORXA 3I3BA 5DZEA 3R6SA 3SMHA 3ZSLA 4AL9A 2WYFA 1HB4A 4JKLA 4FOYA 5JXJA 4K9SA 4BE3A 3WCSA 2ZMKA 5SV5A 1SZBA 4CTEA 3O1OA 1W90A 2XBO2 2DWRA 5A3NA 1PZ7A 3NQHA 1OVPA 2JD4A 2KD7A 4JGYA 3VBHA 1J3PA 1M06G 1G9AA 1CONA 2I45A 1DQ0A 1NQJA 1L7QA 2EIDA 2ZGTA 3ZOIA 4CYDA 3O1MA 3A23A 1WKYA 4OQ9A 1ZM1A 5K7PA 1LTEA 4FFFA 1G86A 3RDIA 4LBQB 4Q4V1 4GXLA 5K0UA 1MZEA 3LEKA 4MHRA 3MPBA 5FMOL 4JGZA 3FLPA 2BNMA 1VBA3 2CHHA 2Z69A 3GF6A 3SXWA 3AZYA 5IK8A 1L7LA 1JOJA 5LY2A 4XW3A 1VB4A 4Y1YA 4FXKB 4OI0A 4KGGA 3SEEA 3B01A 1NLQA 2AACA 2ZX3A 3SCGA 1JS9A 1LHUA 4ZZ5A 3MW3A 4DXZA 1AR62 4AAPA 4XQDA 4BWOA 3HN1A 4N90A 3HN3A 4Y20A 3RZKA 4CP0A 5LA9A 3AKRA 1S0JA 3AP7A 5CKQA 1VRH3 3WF3A 3HOBA 3WT3A 2ZGMA 2Y6LA 4GH4C 2FDIA 4NPMA 4CCJA 3TEZA 4XBLA 5FYMA 2R063 3J4UH 3KT1A 4LEJA 2Y6HA 2VC9A 1VR3A 2XUMA 3WNPA 4EN9B 1JODA 5M0TA 3S5AA 1XE7A 3FHQA 1V6OA 1PO12 4BQ2A 5ABJC 1W0OA 5KXBA 2ORZA 2E7QA 2VNOA 1PO21 3A21A 3WP6A 3ZXGA 4PLMA 2VCCA 5C33A 3S0MA 3H8OA 2QE3A 4YG6A 5HCFA 3C7EA 3LOBA 2RS53 1UU6A 4QXCA 2Y6FA 1R092 1ZBA3 3VDBA 1FMD1 5FCCA 2TBVA 4PCRA 4YPJA 2XKPA 4RN5A 3LKJA 4FSJA 4RFRB 1MQTC 4I3GA 4Q0QA 4GKYA 5KHJA 4QHOA 4A6OA 3O12A 4XCAA 1PGW1 2QCSB 1QY4A 1GFF2 4O9EA 1X33A 3AJZA 3PUHA 2H6BA 1LECA 5IVYA 1X8EA 3MUY1 4Q2FA 1JXNA 3ZFFC 3N7LA 3ON7A 1YQCA 1XNDA 3BU7A 5KC6A 4DZGA 5D8AC 2DUOA 5FMDA 3NKTA 2WS92 4CDWA 5IHRA 2QQNA 4IUGA 2EA7A 3I2OA 2PLV1 2E33A 4Y1ZA 3N9OA 3D5OA 2W3JA 2PAKA 4F83A 3LEIA 4V2VA 1SBEA 5F39A 5T3NA 1IHMA 2VJXA 2P3IA 3OPTA 1IOAA 1S0CA 3FZ3A 4LO4B 5T55A 4CU9A 2IVJA 1QXJA 4LBMA 3BIWE 5F9TA 1C4RA 3FUOA 3WQ0A 4XFCA 1W6NA 1D0HA 4ZY9A 2PN5A 4EYUA 4QB2A 3LGRA 1N3OA 1ZRIA 2YYOA 4D7YA 4A4AA 5SV8A 1Y3TA 1OA2A 4NPRA 2FDHA 2HWF2 4UBGA 5T50A 1D2SA 4GB33 5GLWA 5FQ0B 1B35C 4AGVA 1UY4A 2PELA 4LORA 2XH6A 3FLRA 1KFUL 3TAYA 5FZLA 1RUH1 4YW7A 1NT0A 2VZ3A 3JBG3 1HV0A 3TBDA 3WF4A 5EP9A 1OLRA 3IPVB 4HSLA 5C8CA 1DG6A 2BJSA 1TE1B 3AKQA 5FZDA 4PBOA 3ORJA 2WUHA 4FVVA 3CZJA 1VBD3 5LATA 4AFAA 4K1ZA 1QJY3 4Q4Y3 2RM23 5DDJ1 4NHKA 1MR5A 5FAXA 4M01A 3VHPA 1JYVA 1N3QA 2ZGPA 2VOXA 1WW4A 5DAQA 5A7WB 3K75B 3AMNA 3GGLA 4RS5C 4UOJA 3WNOA 1RUI2 1MPXA 4QPIB 5FYTA 4F7ZA 3PVNA 3AVRA 4JAAA 4L9BA 4XZPA 5CISA 4D6RA 5IFPA 3WDVA 1IZ3A 3Q9OA 2YHJA 1PZ8A 4JDMA 4ZZ8A 3H1WA 3LOIA 2WZPP 3Q8FA 4XAEA 2D44A 5DG2A 4JDNA 3WDUA 2MEV3 5FPXA 2VUCA 3NAPA 3WF2A 5IYYA 5JXIA 1IS5A 2Q4SA 3ACFA 4U2AA 1CAWA 5ACA1 2A3XA 1CAUA 2XONA 3OBAA 4Y5Z0 1JU3A 4RR3A 3BYWA 3SCFA 1V9U2 3Q8EA 2NN8A 3NL1A 3ZXKA 1HB1A 1I3HA 3ZXFA 4EWEA 4FPJA 3ZR6A 2W0XA 1NLSA 4FAGA 3RSJA 4Y24A 2NZ9A 2PAEA 4A3ZA 4PDWA 2E51A 5FY7A 2PQSA 4UBHA 2RS33 5H9RA 1BHGA 2WZR2 3J8F3 4WM8A 4L11A 4CDUC 1H6XA 2NLRA 4NHLA 3AL5A 1C8NA 4D8MA 5A1FA 1ZA4A 4I30A 1H30A 1S0IA 2BBAA 5LEJA 5K9YA 2ZXQA 3RJ2X 1U5YA 4WM7C 2EXHA 2D6KA 4NIHA 1LR5A 1HQLA 1TZOA 5T5JA 5JOZA 1RITA 5CADA 1IQDC 5JSOA 2ZBJA 2RR12 4NAMA 4JKMA 3IZOA 1PMHX 4FPYA 3N9PA 4R4XA 1AXKA 2XL9A 1KQRA 2VTXJ 2WFF2 3HIFA 5FUPA 1GSLA 3FMGA 2VNGA 3NNFA 2V09A 3RNSA 1RB8G 2O0OA 1RMU1 4XETA 5JR2A 4WV8A 3CJIC 3VDDB 4H14A 3RI8A 4EN0A 1QH6A 5BY5A 4OZXA 4I09A 4C0HA 4PF1A 3OY8A 1JZ8A 1HRI3 3BOWA 1BVVA 1OT5A 4IEOA 5GLTA 4LHNA 1NA1B 4FQ4A 2DCTA 3JUUA 4JDOA 2MHFA 4MGZE 3TNQA 1QXRA 4JTOA 1F4AA 1UMIA 2VY0A 3H3UA 1WD4A 5FPZA 1UW8A 4I2OA 3M3CA 3TYJA 2QDRA 5IAXA 4YNIA 4IE4A 1GP4A 3WSOA 1V6JA 2UWCA 1WCKA 1KD7A 4TZDA 3B93A 2BERA 2EIGA 3I2IA 2BPA2 4DS0A 4AR2A 1ZYBA 2WABA 1LGCA 4J1WA 3WHTA 3WQ7A 5CKNA 2FD8A 1K12A 4DEVA 3VBUB 3KB5A 4RQPA 4QXKA 2VZ1A 1ZVFA 4IV3C 3VUOA 4E4HA 3FN9A 3WNNA 1FV2A 1O8PA 3GNEA 5GZDA 1K42A 3I2KA 4OUMA 4ITCA 2JDNA 1XC6A 4C1XA 2WSVA 1OBNA 2IXHA 3N35A 1W04A 5BUVA 2XKOA 1CR7A 2HJIA 2VECA 4RGAA 2ZEXA 5JCTA 4CEWB 2IFRA 4UF0B 3D8CA 3I3DA 2WZ8A 1Q8VA 2XJVA 5FZ4A 5GALA 5FZFA 1RUF1 4CEYA 5FXVA 4DXSA 1X9TA 5FOJB 4XILA 1RUNA 1DYOA 3ZN5A 5GZCA 3WP3A 5HXMA 4IEZA 5BNNA 2ZKLA 3OUIA 3ILFA 4NPLA 4YVSC 5F2WA 3CDZB 4B8EA 5AC91 1R1A3 1ND2A 3H1YA 5F1RA 4IGPA 4LIVA 2ZGSA 3CIHA 5KHKA 2B4KA 3PURA 3SQOA 2XMLA 2ZPXA 5FP9A 3AX4A 2HKXA 4Q4X3 2OW4A 1AR91 2D3SA 3MV11 1ND3B 3V0AA 2QDNA 1SLLA 1NCQA 1QJU1 3ZYJB 1DQ5A 1JOBA 1VP6A 3O0WA 4P00B 1MACA 1VB2A 5KC5A 3ZPYA 2ZKNA 1VAKA 4FPCA 1RUH2 2YFUA 1RUD2 2QNKA 2W52A 5FXWA 4TWTA 1NY72 1O5LA 1RXGA 2UY9A 2JE9A 3AFKA 2CAVA 3USUA 1FV3A 1TNFA 1X7NA 1XU1A 5BV6A 5CFCC 1GQHA 2R043 3JBG2 5KBFA 1RHI1 4DXRA 1ZBE3 3MHZA 4GD4A 4HVQA 3M3OA 2EICA 1A6CA 1UU4A 4KGQA 1LOEA 4CVUA 4Y3OA 1F2NA 2PA7A 3DKQA 3GBFA 3LIHA 4P5YA 5L73A 1TVGA 1J3QA 3A0KA 1QJY2 3WP5A 1MS9A 4HXCA 2VZOA 3HNBM 1JUIA 4AQSA 2GNMA 2W1UA 3ATGA 2D40A 2H0BA 3ZMOA 1FX5A 1E5IA 1O4ZA 1GWLA 3RWNA 3VBRC 1VE0A 2WNUC 5CKMA 3AYCA 2XLAA 1WLCA 3CL1A 3HBZA 3UKTA 3VBHB 3ZDVA 4RHV2 4OHYA 1TMF3 3VKMA 1NUKA 3PDQA 5JZGC 3RQ0A 2DFBA 3FFZA 2DTYA 4E9KA 5HV4A 4M3CA 4Z2AA 4KU8A 4XFHA 1H8VA 1BBT3 2D6LX 2LS6A 4YVWB 2WDBA 3EJKA 1YEWA 3D4KA 3ZSEA 5JPMB 2Y0IA 1W9YA 3WG2A 2MEV2 5D21A 5AVPA 4JGZB 3RMXA 2VMIA 2WNVC 4BISA 1ULDA 2WBKA 2GMMA 1DQ4A 3EB7A 3ES1A 4XJ8A 1GOGA 1F5FA 1PIV1 5IK7A 3KMHA 3WOGA 4B1MA 1LB2A 2X53S 2HEVF 1OSGA 1RUJ3 4GAZA 2Q30A 3QD6A 5AFEA 3W59A 1POQA 2FDFA 2VTFA 4META 1TME3 2DTWA 4LNVA 4ZU7A 1FOD2 4WBBA 4GMP1 3BCWA 3F2ZA 3GXUA 5FY4A 3ZX7A 1AX2A 2GC2A 2I74A 4LQRA 2DVFA 3RFRA 4R4ZA 1YO8A 1PVC2 3H8RA 4Y5TA 4FI9A 4E4DX 1DZTA 5JI9A 1AR83 1BQPA 4OHZA 1H2KA 4CUBA 2CDOA 3WD5A 3UNPA 3DXUA 4IGQA 1ASJ3 1UZ0A 2FCVA 3LFMA 1C1FA 4KG0A 1SPPA 2CSGA 5L9BA 2VVDA 4AHYA 3PUQA 2HWE3 4FO9A 5C71A 3NKGA 5F37A 1CAVB 2ETEA 2ZA9A 2CV6A 3GZTB 1IS4A 5EQUA 5J98B 1RMU2 2IFWA 5E8AA 3VBSA 3K4ZA 1UPSA 4DPNA 1J84A 1IGOA 1REFA 2WO3A 1W99A 4GWNA 2A70A 5FFOC 5FXZA 4RD7A 5CFDA 5DAVA 1HIXA 2HWB3 3DYOA 3ACGA 1QF3A 2RS11 4GH4B 3RYPA 4C8DA 2RVAA 5EXOA 5C3QA 1MS1A 4GKXA 1D4M3 3K46A 5T5LA 4Y22A 1GICA 3WNXA 4N7UA 3PVBB 4AI2A 3WHUA 4N8MA 4CP9A 1H2LA 2OPWA 2NPIA 3LB9A 2JG9C 3WF1A 3S7IA 3TN93 1RJ7A 5ABJB 5CAZA 1VIWB 4H3WA 4AQTA 4BYYA 4NRQA 2VW0A 4AFMA 4CCCA 5I0RA 1LOAA 1AX0A 4YARA 4K8RB 2ZCWA 1QKQA 3B5LB 2GP3A 3VBOC 2CYFA 2C1FA 2XGXA 3HVDA 1ZA7A 4CDXC 3BALA 4IQPA 4JVAA 5FV3A 5HCAA 4XBNA 1MS4A 2EALA 1O91A 4KNCA 1DDLA 1MQTB 4ASMB 1KJLA 2JE8A 5HCHA 2VCMA 1V00A 1G8WA 4MHUA 4IE5A 5A70A 5BXXA 3ENRA 4TXWA 2HLEA 4AZZA 4LBQD 2IXJA 5H9PA 5L19A 3IDAA 2I07B 2WL1A 3ZFFB 2JDPA 4YZ2A 3I97A 1ULPA 5LK7B 4XJWA 1ACCA 4XPVA 3DEMA 2OKXA 4Y5SA 4BCUA 5D8AB 4YW2A 5J48A 3U78A 5FY1A 1VMJA 1PGL1 2WRAA 1UAIA 4HPKA 3H42B 4KU7A 2WT0A 4QU2A 4XFIA 4XHBA 4UAPA 4A2UA 1W6QA 2GDFA 4P02B 3UETA 4LKSA 2AGSA 4HSJA 4AVTA 4IEQA 3T1MA 3WZ1A 4Q4X2 4CDXA 3AYEA 1W2AX 4N43A 4RFT0 3LF7A 4KWKA 2X5IC 4L92A 3T2TA 2YGMA 4XFFA 2EIEA 2WQ8A 2IXIA 2XBO3 3B7MA 3FLTA 5F6KA 3ROUA 3NJZA 4GWJA 2CU5A 2Y38A 1WCSA 1UZYA 4DOUA 1B35B 2WC2A 3NNLA 3PNAA 1E5HA 5EYYA 1W2TA 2Q1FA 1RINA 1ZBE2 1S0DA 3BTAA 3INAA 4UFJA 5L9RA 2GC0A 5LASA 1V6IA 3LD8A 2DURA 1RVF2 3VB9A 4YW3A 1EAH3 4A7YA 4YGDA 1GWMA 2GSYA 2WQ4A 2Z5WA 4JTNA 2VQTA 3O1VA 2JDAA 5DZFA 3B02A 4RR3B 1AR63 5AVAA 5FYZA 3ZYBA 1JTZX 1FI2A 1QNWA 4V2WA 5L7OA 1EV11 2VMCA 4HZFA 4EV0A 1D4VB 1X50A 4YRDA 4COYA 3KV5A 1IS6A 4Q29A 1ZZ8A 5IW0A 3POJA 3WNLA 3U4XA 4RS5B 5T5OA 5I8TA 4LO5B 5LEKA 1S0BA 3LCPA 1SG3A 1F35A 4ASKA 3ZKYA 1KEXA 2VQUA 3OF1A 3GBWA 3A4UA 3BOPA 3U14A 3AZXA 3VHNA 1OUSA 1W9TA 2HEYF 2VOTA 1PO13 3VD7A 1VBB2 2HH9A 4D6SA 4FOWA 2P1BA 2ERFA 2JEMA 1DHKB 2PHDA 1QJX1 1GQPA 1Y9MA 1IG3A 4XJZA 4A41A 1H8TC 2PHLA 1DGRN 2ARBA 2OA2A 2WAOA 4WVMA 3ZIXA 1RUC1 3FHIB 4HK8A 3ZYRA 4CDQA 3FBMA 4UW5A 2VMHA 1DYKA 2W92A 5LA0A 2QQUA 2H6CA 5IT6A 3M8LA 5J37A 3TRSB 4E4ZA 3DL3A 1W2NA 1BCXA 4R9DA 1BMV1 3KT7A 2VZTA 4HETA 4QU1A 1BK1A 4Q4W1 1OFSA 5EFUA 4B7KA 5IVFA 4LKFA 2ZAHA 4LPLA 2HBUA 4LLFA 4P08A 1AX1A 5FYIA 4CDUB 4B3NA 1AJKA 2VG9A 3PUIA 4QT6A 5F3CA 4W65A 2Q5TA 3LEGA 4GA9A 3ALQA 1CZSA 1ASJ2 4HVRA 1FNZA 4IEVA 4LJHA 2ZX4A 5CVRA 5DG1A 4AE2A 4EN6B 2VZPA 4SBVA 3S5QA 4WM7B 1VBC2 4UT5A 3ZYFA 1W6MB 1RTVA 3AM2A 1X8MA 1UF2C 4URAA 5F32A 2CGPA 1QNYA 3TEWA 4XF4A 1TEIA 4N9IA 1J58A 2V4AA 2AR6A 2JKBA 2TNFA 4OHVA 2JIJA 2LTNA 1MEC1 5A32B 1POV3 1W2UA 4A3XA 1QQP2 3R05A 2HWB2 2XVLA 5J7MA 1WZXA 2DVBA 3OYWB 2WWUA 1ENSA 1D7PM 3U07A 1N1TA 1L7RA 2XJPA 4ARYA 5LRRA 1UNBA 1H1IA 1T2XA 2HWF3 4AVBA 4QGMA 2BW8A 2VULA 2RJ2A 3JB8A 4QQPA 1AYN1 3TN92 5J96B 4AFBA 3T0DA 3MYXA 1UOGA 1ZZCA 3N7KA 3PHMA 4H7MA 5F5CA 5JAXA 1RUG2 3AC0A 4XZUG 2R071 3B69A 4BLJA 3UYJA 1NCRA 1W39A 3OD4A 4JHZA 5BNNB 4UXAA 3I3MA 2KA3A 5GLVA 3VKFC 2Y26A 4AG4A 1ND2B 5FZOA 3PMEA 2H0VA 1HB2A 4B4RA 3NW4A 2ZS6B 1F4HA 1FPN3 5E16A 5GLUA 1NOVA 4IV3B 3JQXA 1UYZA 3NNGA 3V0AB 3OEAA 1NCQB 4LO7A 4JGYC 3VBHC 2UYBA 1AL21 1HKDA 3MDPA 4LBLA 4BPZA 2BNNA 2Y0OA 1PGL2 1RUI3 3C7GA 3KGZA 3IDBB 3JU9A 3OPZA 5K0UC 3O1SA 3KWVA 1R082 3QH7A 5FJHA 1JUHA 1PNGA 3W9AA 4S2HA 3QOPA 1EUUA 4M4RA 4DY3A 4R9CA 1TQ5A 2VVFA 1AR71 4ISRA 4QX3A 3AXEA 4YVSB 2CGNA 1OLQA 2ZX0A 2R49A 4KMQA 1WA4A 2J1VA 3KCCA 4XFBA 1WBFA 5FZ6A 3U0ZA 1ZRDA 1HW5A 1GOHA 5LZ6A 4DEQA 2YGLA 1HB3A 1PM7A 4D94A 2JDZA 1HXS1 1V9U3 2RHPA 2JJ6A 4M4PA 4ET7A 3OUHA 5BYNA 1C8M1 4FFIA 4LBKA 1DGWX 1VBE2 3GJBA 1TNRA 2RG4A 4WZCA 2ZGRA 2PXJA 5ANQA 4YW4A 2YU1A 1C28A 4LKDA 2HWD2 3U10A 1PVXA 3GHMA 2WZR3 3H0OA 5JMOA 4M3CB 3M70A 3BPZA 4Q0SA 3KF5A 5CFCB 5DPNA 4LR4A 3K48A 4ZXEA 1HV1A 1WW7A 1YFUA 4PLNA 4LMFA 2FDKA 1EAH2 3I2DA 4YGBA 3DYMA 3POWA 1AF9A 4OYUA 3RZHA 4G3YC 1EV12 3MLJA 4LO6B 2ZOEB 5JOWA 2V4VA 2RR13 2XOMA 4HL0A 3ZYIB 3R4SA 3WEZA 4FTBA 3ZO0B 2XWJB 3VBRB 2WFF3 5FKBA 1SDDB 1OD3A 2WNUB 3AVSA 5F7UA 1Q8SA 1YJKA 2QQKA 3C7HA 4N53A 4J1XA 4WVWA 1UPIA 5GJ6A 2DVDA 3BVCA 1T6GC 1W0PA 4LIUA 1UCXA 3LSEA 2G19A 4GIQA 3KVBA 3VZNA 5JZGB 5LA1A 2RJLA 2QQOA 4LE4A 1QJZA 5DXDA 3RJRA 4W4ZA 5F8PA 3WQ1A 2DVAA 4QDSA 1PO23 1UIKA 1VBA1 2XHNA 4CDWC 2OT7A 2WNVB 2V73A 3LAGA 5FR3A 5C4WA 2C4XA 5J36A 3VD3A 4EQVA 4NOTA 3W58A 4IE0A 3I2HA 3PLQA 3KGLA 4CPBD 1H2MA 1RC6A 3CQOA 3WW3A 4HONA 1CGPA 4Z1VA 2TUNA 5C3SA 3UKNA 1IPSA 1SLIA 1US3A 2XVGA 1RUE1 4OUEA 3VBSB 5FYCA 3SNMA 1OLMA 3PJYA 1VRH1 1XNAA 5A3TA 3N9NA 1URXA 3AMQA 1LHOA 4MSVA 1XNKA 2IZWA 5CFDB 4QGLA 2NP0A 4NHXA 1DQ1A 3ILNA 1MVQA 4AF9A 3O1TA 5JSRA 1UX6A 4BB3A 1DBNA 4FT8A 5FRAA 3C3VA 3LIGA 3DCQA 1AZDA 2P3YA 2C26A 4FFHA 1OUXA 4EN7B 4NWVA 5EV7A 5BNQA 4UFMA 3MIEA 4XQWA 3N7JA 5IVJA 3J7HA 2BGPA 3TEXA 4XVHA 4X8PA 1EY2A 1O7FA 4Q4V2 5BNOA 4GJZA 4QGNA 3BN6A 5C8CC 3SH3A 2BZDA 4QD2A 5FZEA 4YW6A 4BQYA 2VM9A 1COV2 4PI0A 4ES8A 4HLTA 2W95A 5IVVA 2A1XA 2DUQA 1QOTA 2PQQA 3MW2A 5ERLA 4FPKA 4MH0E 4R9BA 5A3PA 2XJQA 3IKWA 5F3GA 1GP6A 5LBCA 1GZWA 3T2QA 5J09A 1LOFA 2VXRA 5FPBA 2GAUA 3I59B 3JD71 5IVEA 3PVOA 3W5NA 3CF6E 5JOYA 4FBFA 2PHWA 4H55A 3ZN6B 2KXLA 4XUTA 3LPGA 3JZVA 2QVSB 1CPMA 2IXKA 4IEUA 4IDZA 4LUKA 4QQOA 4UFIA 5IK4A 3GCWA 4LO8A 3TOJA 3KLSA 1SLBA 1RUH3 2R6QA 2DYCA 5DN2A 3WF0A 1RUD3 1US2A 2R0HA 2ZMLA 4N7IA 4WVVA 3AZVA 5GKAC 5LWBA 4FPHA 3HT1A 4XXAA 1ALYA 1LU2A 2VQAA 2JG9B 2AUYA 4RGGA 5L36A 1RIRA 5I0SA 1DZQA 2ZZQA 3NAPC 3CLPA 5DDJ3 1CX1A 2W94A 5B4NA 1WCQA 3AYAA 2WN2A 5DUVA 5A33B 3VBOB 1JMUB 2BVVA 3H7JA 4RR3C 4CDXB 1KS4A 1FPN2 3VBFA 2PYTA 4N43B 4YG3A 3ZFGC 1GUIA 2WWSA 3C8XA 4BZ4A 5FZ1A 4CE8A 4W6YA 1GBGA 1A8DA 2VQ0A 2JICA 4QPGA 2PTMA 3FL7A 4PHZA 4PDWC 1ENRA 3I2JA 4BQ1A 4RHV3 3WW2A 4AAXA 3X29B 3HPNA 4WM8C 3ETPA 5FZ3A 5BNPA 4GJYA 1ODNA 1XOYA 3ACLA 1YYNA 3HT2A 1AR72 3ZVXA 4UW6A 1X82A 4NHYA 4O9GA 5DMYA 1W28A 1V6MA 1VALA 5FREA 5I93A 4UFHA 3AMPA 1XSRA 4GALA 1OH4A 4UW4A 3V0BA 1LHVA 2D6OX 4Q4Y1 4AQ2A 1LGBA 2RM21 5IJRA 1U0AA 4BLIA 4IW3A 4Q1RA 3UV9A 4ZHNA 2Y33A 2E32A 2LROA 3VKOA 1WUVA 5I0UA 2VZUA 3ZFGA 5L7OB 3GCXA 2ZHNA 1UOJA 3J7LA 1UY0A 2VR4A 2VPVA 2JG8A 4C1WA 2E53A 1N3PA 4Z2WA 2X5IB 3AKTA 3NSTA 1O5UA 2FMDA 1FOD3 1IG0A 3LA3A 3JQWA 1ZZ9A 3EHKA 3KV9A 1YC61 4JV4A 1SEFA 2NMOA 2B9VA 1UXXX 2C24A 3ASIA 2HBTA 4IERA 1XYNA 4KQ7A 1PVC3 4MXVA 3OGVA 3VLBB 3N9LA 3ACIA 5ANNA 3L2HA 2PHFA 2VOWA 1KDKA 2YPDA 3OG2A 3O5SA 4QX5A 3THTA 3O1UA 2X29A 2QZ3A 2XPJA 4LITA 5F6LB 1QH7A 5CG8A 4BH9A 2K46A 3LEMA 5A3MA 3MUZ1 3VZOA 4QB1A 1PX4A 1ULCA 3CEWA 4NMIA 4CDQB 2VMFA 3IAQA 2VOVA 4DINB 4W6WA 3VZJA 2YUEA 1OD5A 1FAYA 1RMU3 1XPWA 1Z0HA 2B45X 3E97A 3MEPA 1WCUA 2XJRA 3B3QE 1GMMA 3D0SA 4RQPC 5EIYB 4QKDA 1DFQA 2PHRA 2XJUA 4TTGA 2X09A 1LRHA 2VZVA 3ZM8A 4XURA 4DMIA 2B42B 1DZRA 4F3JA 2RS31 1MS8A 2VZQA 3MLLA 3J8F1 2RMU1 2EAAA 4QHZA 2XJSA 1SHWB 2YY1A 4EE2A 2BOIA 1VAMA 4K21A 2VBPA 3WW1A 3PTRB 1PO22 4MXWB 4ZKTB 3S6PA 5CG9A 4CEYC 4BIFA 4ZS2A 5FYSA 5LK5A 1AUYA 5ISLA 1PX3A 1N47A 4NJ4A 4H7LA 5BNNC 4HK9A 3NJYA 4OI4A 4EWAA 1FMD2 4J6GA 4XXPA 1W9FA 1N1SA 1H8TB 1ND2C 2OPKA 3IIIA 5FPVA 3WY6A 1OC1A 1PGW2 1XJAA 2WNOA 4CU7A 3O1PA 4CCEA 2BYVE 4PQ9A 1HRV1 3BGAA 4LHKA 5A1LA 1STMA 1NCQC 2IUWA 1PMIA 3VKNA 1HRI1 2ZEZA 2VCAA 1YNAA 1VLNA 2JX9A 2B5HA 2BEOA 3B00A 3E5QA 3K4AA 2C9KA 4D69A 5C8WA 2PLV2 4QDRA 1H1AA 1W6PA 4HT1T 3GZAA 4LUMA 3VZMA 1UIJA 2QQJA 3AZZA 1ZZBA 2C9AA 4CZSA 2JD9A 1ZZ7A 2WWJA 3ETQA 2ARAA 1WLWA 2YBKA 1XNCA 4HKWA 2J1EA 2YMZA 4IEXA 1OQDA 4U36A 2XQXA 5FBJA 4AEDA 1JH5A 3E1F1 3N9MA 2VUJA 2W1QA 4S2GA 3JD72 4ASLA 3PMSA 1K5JA 2YROA 4LT5A 1NAEA 4ZS3A 1CAXA 1Y43B 2BUKA 1W6OB 2CL2A 3OPWA 4JC1A 5GZFA 3UK9A 5EZWA 3P3NA 1NXD1 2OQ7A 3HWJA 3ME2A 4JKKA 5FZCA 3RZLA 1SBFA 1YIFA 1GU3A 4AQ6A 4EWDA 1LU1A 3M7AA 3ZYGA 3RGBA 3ZSKA 5JIUA 4CCLA 3ZXJA 1RHI3 2JDKA 2DUPA 4P9IA 3HBKA 4QPWA 3ZSJA 4DNYA 5FXXA 4TSVA 4XIOA 1CWPA 3FBYA 3BTYA 4QKBA 3G7DA 2X05A 3MIFA 4QXBA 3T08A 4IV1A 4P9YA 5DDJ2 1AL0G 3KV4A 1RVF3 2UYAA 1IKQA 3NNMA 1QDOA 4WZFA 3THCA 3SKVA 1O6UA 5A6XA 1OKQA 4IL7A 5FZAA 1CX4A 3KM5A 4QXHA 5GZEA 2JIGA 4E27A 2OQ6A 2YC0A 2P6CA 4E8DA 3FFQA 3HR9A 1PGSA 4MV2A 4JGYB 4LLOA 1DQ2A 3ZKUA 3ZFEA 2A6WA 4P9XA 2FZ1A 4FFGA 5F5IA 2GMEA 4CCKA 3Q8BA 4COWA 3AP4A 3E5UA 5F2SA 5JLVA 4MLOA 4XOGA 2R041 2A6XA 1AYM1 2Q8OA 2BP6A 3JCIA 1GANA 5K0UB 3IWZA 1DIWA 2Y8KA 5LB6A 4YM2A 3EQEA 5IWFA 5ACA2 1PIV3 4XC9A 1VBB3 4ZU4A 2CAUA 1E5SA 2BBVA 5FZIA 1O3SA 4FP3A 4GWIA 4MG2A 4XMIA 2XLFA 1SQ4A 2CY6A 2GNBA 2VAUA 1ULOA 2QQPA 4QKNA 3RPQA 3VBSC 1OVSA 3POBA 2ZJCA 4QHBA 4KG8A 4GMP3 4XF1A 4Y20B 1NZCA 1S2KA 4UWDA 3ACHA 5CFDC 1RJ8A 4LBQA 2ENRA 4K20A 5FP8A 1NQDA 4BQ4A 4Q5OA 2G9FA 3JB4C 1JYNA 2A7AA 3AKSA 3MI8A 2OIIA 4MGYE 1IQAA 1LEDA 1YUDA 3AL6A 3ZYPA 3K2OA 3GJAA 2VVEA 1S4CA 4XCBA 2E9QA 1VAVA 3DXTA 1OMIA 1Q56A 4C90A 3CJXA 3CZUA 1VBC3 3NV3A 5E89A 3NJVA 3WG1A 2WLPA 1W0NA 1RUJ1 1GP5A 5FY9A 3AXDA 2VNRA 1P8JA 2BVBA 2WT1A 3KHCA 1W3XA 4OI2A 2XVKA 3WXPA 2NM1A 5IATA 1QQP3 3LSDA 3OBTA 5FP7A 1ZRRA 3BTXA 1JU4A 3MBWA 3H8UA 4ZU5A 4W50A 4YFZA 4DIQA 3N3HA 2Y6GA 3RG0A 3T09A 4YZ4A 1AR81 3T0BA 5KXEA 4OCTA 5FYVA 1LKNA 2W9XA 1CD3G 2DBIA 3RZMA 3NMBA 4AI8A 4L97A 1YFWA 1JZ7A 2Q1MA 4CDWB 3T2PA 5HCBA 2VL4A 1V70A 2AH2A 2RDRA 1JYWA 2HWE1 1RUG3 1YIPA 1RL3A 2P17A 4P9JA 1JBCA 1SLCA 2D97A 2JDYA 2WYSA 3GM8A 3OB8A 3BPSA 4D6QA 5JXHA 4LKEA 3M1HA 2GMPA 1JN2P 2JDUA 1O4YA 2HWC1 2QKDA 3SHRA 2L9LA 1LJ7A 4N43C 2W87A 2DU1A 1K45A 3B9CA 4HG6B 1UX7A 1W6NB 3H1MA 5JR7B 5JOXA 3QBQA 4CCDA 5CEHA 3KS7A 2D98A 1HJGA 1RUF2 2PHUA 1IKPA 2WT2A 3AMMA 1DF0A 2VXJA 4DFSA 4I0WB 2P37A 2K0GA 4MZUA 4D0QA 3PIJA 4QQ2A 1G9BA 2ARCA 2DF7A 1VMFA 3NO8A 2G4IA 1ZX5A 1R083 5AC92 1C3HA 2DCJA 1XYPA 2OXBA 3OBZA 4Y1XA 2JECA 1BJQA 1S55A 4GWMA 1YI9A 1DGRA 2R1DA 5C8CB 2YFZA 4RL7A 4EJRA 1DLLA 5EHDA 1AR92 2N7GA 5LRSA 4Y1UA 1QJU2 2IVIB 5LCWL 3SEPA 5L7OC 2HYKA 1DQ6A 3R4UA 1FNYA 4CU8A 5FQ0A 5EYXA 2G9ZA 5FLIA 2JDMA 4OVEA 4FTEA 3ZR5A 3NV1A 1V6LA 2GH8A 4E2SA 1VBE3 3N9QA 2DFCA 5K8SA 5FIXA 3OGJA 5KXCA 1RHI2 3TB0A 1YCIA 3JXSA 3IPVA 1CESA 2HWD3 4XF0A 5JPNB 4RSUA 4E4SA 4YWAA 1XNTA 4LHLA 3ZXAC 1O3TA 4LK7A 4X6QB 3OGSA 3FWEA 3WR0A 4XUNA 1IPJA 3S57A 2FZ2A 4ARXA 2E6VA 1WD3A 3NAPB 1AHSA 2P5BA 2RV9A 1Z78A 2JENA 4JRLA 5FLHA 3C2UA 4CDQC 1CAWB 5HV0A 1EV13 1CAUB 2ZGNA 1H0BA 2ET7A 4XIKA 4CCNA 1XNBA 2FBEA 1AJOA 3MW4A 3ZFGB 4FCAA 4QPIA 1DCSA 1NG0A 2XBO1 1ONAA 2QQIA 5JWPA 1UO9A 2WA4A 3MO4A 4XFGA 1LAJA 2YB7A 1AYM2 3IT8A 3U4SA 4PDWB 3DYPA 1O3RA 3THDA 4COUA 4WM8B 4OUSA 1POV0 5F5AA 5J1XA 2A75A 5FO9B 1CZTA 2RJKA 3I8TA 4HMZA 4ATFA 4XACA 4ISQA 5DQ0A 5F3EA 4Q0VA 5E1RA 1VRBA 5G04L 1PIV2 3WQBA 4B4PA 3CU7A 4FQZA 2XQRA 3WG4A 1Z7S1 4MUVA 3AP6A 4IEPA 1ZNPA 1R1ZA 3F95A 4YW1A 5LW9A 5FK7A 4XUQA 4M3CF 2EXIA 2Z2SB 4LA2A 2F4PA 3U1XA 1CIYA 1UYYA 4K7JA 2O8QA 5C7GA 2W47A 2B8MA 5I0TA 4UFLA 1PMJX 3ZN4A 4AFDA 5A3WA 4K1YA 1DYPA 1E57A 1CZVA 1W8FA 3H9AA 4S2DA 2BGCA 4A42A 1LHWA 4Q4W3 4Z8BA 5IUQA 1BEV1 4XDQA 4XF3A 2TEPA 1BLZA 4BQ5A 2P3JA 2P2KA 2D5HA 2WO7A 5FZ7A 1LNSA 1Q8PA 3OY8B 4AWDA 2G9GA 1R64A 4D3WA 3RZGA 3ZSMA 4GULA 1JZ5A 3CKHA 1UWWA 2R1BA 2VMDA 4AI1A 4INDA 1PO11 4TLFA 4AGRA 4I02A 5FZMA 2JDHA 2QJVA 1K5MA 1JZ6A 3UGGA 4QB6A 5HBAA 4DUXA 4EROA 1NCRC 1XSQA 1XBFA 2FHRA 4LOSA 4QX2A 5FYYA 3BI3A 5APAA 3UGHA 1UQXA 2QQVA 1R091 1COV3 3KQ4B 1BZWA 2WSUA 1I6XA 3VDDA 4IESA 2RS12 4RQPB 5FDBA 3J7NA 3S7EA 3DPRA 2B9UA 4JRAA 2ADEA 3ZDSA 3V65A 3IAPA 3IM0A 3MIDA 4I0BA 4HKOA 3VL8A 4XEZA 2ZMNA 1ULFA 2AC1A 1AYN3 3KV6A 1UYXA 3RVHA 5C70A 5DAXA 3VDCA 5D1IA 3VGIA 2W91A 3I7DA 1W6PB 4OFGA 5FPLA 5C3OA 2Z4FA 1JYTA 4IEYA 1Q8QA 2WS91 4QX1A 1G7YA 2P6HA 2WLQA 4LULA 4CEYB 3PU8A 5FY5A 5KHIA 1F15A 2E7AA 5A1AA 2GN7A 3VBUA 3UESA 2HWC2 3OGRA 4XHXA 5FPUA 4AVVA 2BRTA 3VD9A 3FHAA 3QACA 1T6BX 2F4LA 1SFYA 4XTMA 1NE6A 4YM3A 1W8TA 4MADA 2J1AA 4CUGA 1AXZA 5JSPA 2A6YA 4PT6A 4OMCA 1OF3A 1XQNA 1OURA 2B46X 1KFXL 1C1LA 2YPJA 4CXWA 1O59A 1OOPC 4BIOA 4CEWA 3IIAA 4XABA 1N1YA 1SBDA 4UF0A 1ZRFA 2GU9A 2E7TA 3VD4A 4XDPA 2OS2A 2HWF1 3LDBA 1ENXA 2BFUS 1G6NA 1GNHA 1GQGA 1SCRA 2XHKA 3MIGA 4JZRA 3USUB 4AI3A 1HN1A 1GKBA 3HEIA 1AR73 4X8NA 1Q3EA 4FPGA 4O7XA 4CPBA 2EXJA 2WA3A 2A3YA 2C0ZA 4IV1B 4LOTA 2ZTNA 4BK4A 5C3PA 1AVBA 2JKXA 4NN0A 2MNGA 5LBEA 2XXZA 5DUUA 1K3IA 1ND3A 4YYOA 1QGLA 1XU2A 3N4MA 2ZABA 1C8M3 1PM4A 2BGOA 3M3EA 5A3OA 4R8HA 3MFCA 5F5QA 1QIQA 1PNFA 3LZZA 4BU2A 1QJFA 2QTWB 3D82A 1OOPA 2BU9A 3IDEA 4N53C 4QX0A 3VZKA 5A3LA 1MZ5A 5FWJA 3U11A 1GOFA 1WA6X 5LBBA 4CP2A 4Q4V3 2W68A 2WR9A 2WZEA 3WLUA 4EN8B 3GBGA 1UD1A 5C3RA 5LBFA 1MS5A 1SDWA 2ZEWA 5A7NA 1EP0A 4LXLA 1J1LA 3LA2A 3I2FA 5C4WC 4B1LA 2FDGA 2VGDA 3VKLA 4AEMA 3H3LA 5IFTA 5CB7A 2D6NA 3LDKA 2J1TA 4TLGA 5DUXA 3H50A 3KCXA 3LDRA 1V9U1 2GNDA 2LALA 3HJRA 5B4XA 5T5PA 1SCSA 2QUOA 1APNA 1A8MA 3NRUA 4FPFA 4MX3A 1KJRA 1OKOA 1QXPA 2YC2A 3EXUA 4G9SB 3GZEA 5TSWA 5A6ZA 1X36A 3NWKA 4TN7A 3M2MA 4YVWA 5A6QA 2WAAA 2WZR1 4NRPA 3TWIA 4FOVA 4HVOA 1OF4A 1Z7S2 2O14A 4QWNA 2ZHKA 5FO7B 2D3PA 3E6DA 1QJX2 3EYPA 3ZLIA 2R7EB 5IVBA 1XYOA 3WDYA 4NAOA 4XDOA 2BDRA 1RUC2 5G05L 1U12A 2J1UA 3CO2A 4NHMA 5GZGA 4K3UA 5BNOC 1SPPB 4NWWA 1WGPA 1RUE3 2RR11 2DVGA 1LEMA 2FMYA 2GP5A 4FP2A 2RDSA 1FMD3 3ABZA 1J3RA 1C5HA 1BMV2 1BEV2 2WFF1 2XL7A 4MGKE 1BYHA 4KH9A 4PBPA 4Q4W2 2ZGQA 4Q8LA 3CMGA 5GM0A 4L99A 3WX5A 3ZPOA 2W1SA 3MGUA 2UWAA 1LOFC 2O8OA 1JYXA 5E88A 5FUIA 2R061 4K8FA 2GALA 2WNEA 2ZACA 2UWBA 4FXGB 4BJ0A 3BUCA 5JIAA 3SH5A 2XB6C 3MPPG 4Y22B 4CU6A 4UFKA 2UY8A 4YZ5A 1S2EA 2PLV3 2ZZJA 3E5XA 4RYDA 4CP9B 1HX6A 3I4IA 4P9LA 2AREA 4L2NA 3M3QA 1CAVA 1OI6A 3OSDA 2GZWA 3MICA 4QAWA 3WNKA 4Z82A 4JX0A 2QBXA 4Q0PA 3H3ZA 2R32A 2V5YA 4NE9A 4HOOA 2RS51 1MEC2 3APBA 5FZ8A 3SKJE 3UKVA 3K3NA 4BM8A 1ZBA1 3OD0A 4IETA 4Y33A 1UXZA 1FT9A 3KQRA 5CU1A 5FP4A 2AZ5A 2RDQA 4LE3A 1F31A 4MVTA 3JD73 4OLLA 4GH4A 3VBFC 1U5XA 2BWAA 3A7QA 1W8NA 1S0GA 2AENA 3DN7A 2ILMA 1UMHA 2OVUA 4Z07A 4P9WA 5FMOS 3T30A 1F9KA 2PHTA 4Q26A 4QPGC 4NROA 5AFBA 4DRRA 3GZUC 5A7QA 1AYN2 3HQXA 1S1AA 4CCOA 2GC1A 4XQ4A 5ABJA 4A6SA 3DKWA 5BNPC 4W8JA 2R072 5HXVA 2VNVA 4UW3A 2XDVA 3TNPB 3AYDA 1XB9A 3ZXLA 1CN1A 1DGLA 4DUWA 4HPKB 4R52A 3ITQA 3PJQA 4XF9A 3D0JA 5DAPA 3V64A 4E2GA 3H7YA 4AEJA 5CA6A 3NVCA 1UU5A 2BOJA 5HPOA 1MQTA 1W6QB 1WMEA 3WDXA 2W39A 4BQWA 5C9AC 3U75A 5EWSA 3W21A 3VDAA 3PTYA 2AEZA 4BMEA 4QPYA 4Q27A 4JQRA 2R16A 2QQMA 1AL22 3IMMA 3K4DA 5KWRA 1UZVA 5JVVA 4AOCA 2JG8C 3E6CC 1DU3D 1NX9A 4XJUA 2JE7A 3ZFFA 1WW5A 1W3VA 4M3CE 2ZAAA 4DRVA 5D8AA 4GB31 2OUHA 4SLIA 1RUD1 3NNJA 1W8UA 1NY71 3RI9A 3RZJA 3V56A 1UY2A 3WDWA 1ENQA 2Y6JA 1MS0A 1UY1A 1H4GA 3JBG1 5CBLA 2VZSA 1YXWA 5HI0A 3OJBA 2Y60A 4K40A 4O65A 3TEYA 3AP5A 4XBQA 5ACA3 1QEXA 1BXHA 1W9WA 2EXKA 1VBD1 3LQCA 4C0BA 5JMCA 4CSWA 1QJY1 1HXS2 2Y6KA 5C9AA 5L9VA 3D3AA 1C8M2 4XMAA 4QM8A 1HQWA 1MZ6A 4JHTA 2OX0A 4P5HA 2JWPA 2CWSA 4D7SA 3G6JB 2BNOA 1B35A 2LW8A 2CGOA 5C6CA 3RRDA 3HQRA 4PQQA 1LOCA 4RHV1 3N7MA 5JI7A 3BIEA 5FP3A 4Q0UA 1UY3A 3BODA 1QOSA 2D7FA 2OZJA 4NVPA 1MS3A 4BA6A 1GZTA 3SITA 4MGTA 4N9HA 4Y4YA 2SLIA 4OHWA 1LULA 3LWCA 4IE6A 4I01A 1ULGA 3DV8A 3PU3A 2MEV1 1U5ZA 4OQ8A 4MGIE 4HN0A 1QOOA 3AK0A 4IGOA 5DZGA 1NE4A 1LODA 1UOBA 2RE9A 1FATA 1OPOA 2MPFA 3MF6A 4WVMB 5I8SA 3RZZA 1F5JA 4RS5A 2QQLA 2ZX2A 2OYZA 2E31A 2Q8CA 3HNYM 1PK6C 2CTVA 2RMU3 4YFWA 1BVP1 5FUNA 1FOD1 2GNTA 3ZXDA 2J42A 2C5DA 4YGEA 2YBSA 1PVC1 1VBA2 4XFAA 5FLJA 2EIBA 3OBRA 4GZ9A 3OEBA 2ES3A 3PVEA 3AP9A 1L3JA 2HEWF 1TG7A 3POSA 1LESA 4IXLA 3K3OA 1YWKA 4A44A 5B2GB 1OA3A 1ZRCA 1K5MB 1E5RA 1WLDA 3I54A 2IXCA 5FOBB 3RWKX 4AGGA 2FCTA 2E26A 4Q8KA 1RUE2 1HLCA 3VL9A 1KXGA 4CUCA 4J25A 4AEDC 2VU9A 4AXOA 1UOFA 1VRH2 3QLQA 2EF6A 1HRV3 1JYCA 5FWEA 2K2SA 4AHWA 4KBZA 2Z79A 1LHNA 1UMZA 2R062 4G4FA 2BWCA 1CQ9A 3VHRA 3GDBA 4YM1A 4AEKA 3VZLA 1PK6A 3DPRB 4CDUA 3UJQA 3J7MA 4QMAA 4FOQA 2EAKA 4CA9A 4AVAA 4KL1A 1EPZA 5FBZA 4ATEA 1VPHA 4OHXA 2J22A 3PUAA 2WQZC 4H2AA 4QM9A 5JUVA 1RUF3 2AYHA 4WM7A 4BOWA 1Y7BA 1IPKA 1W6MA 4COVA 3R4DB 5KHGA 3N36A 1GZCA 3SCHA 5KXDA 2RS52 4YG0A 1NYWA 1ULEA 4BK5A 1ZZ6A 3W5MA 1ZBA2 3POFA 4XTPA 4ZPIA 3J26N 3MIHA 3O0VA 5AC93 4RGKA 1NCRB 4IV1C 2ZGKA 4XUOA 2WINB 5A32A 3A22A 1Y9QA 5C5UA 2GH2A 4MO3M 2R0FA 2D5FA 5FZOB 3I49A 1GR3A 3MZHA 1AR93 2D3RA 4LBNA 1SLTA 2Q1ZB 3OYWA 4A7KA 2K9ZA 3CJIA 1EYBA 1YRZA 2YXSA 5EJ3A 1QJU3 4X6RB 1NLRA 1W2OA 5FZBA 1Y9GA 3SC7X 3GALA 1A3KA 1UYPA 1HJFA 4DUVA 3IBMA 4NIIA 1Q5OA 3FE5A 4QKFA 3ZFEC 1HQNA 1V0AA 2HYXA 4KI5M 1H2NA 4AI9A 4B4QA 3ELNA 4LBOA 3M3IA 4GMP0 3B9IA 3I2GA 4LTAA 3FUQA 5FPAA 2SBAA 3UGFA 1XE0A 2A3WA 1OFNA 2Q0AA 1YJLA 3FJSA 5CNAA 4M00A 1CVNA 4ZONA 5BPXA 1YI7A 1A78A 4D7TA 2O1QA 4ONUA 3SH4A 1R1A1 4CP1A 3H8XA 1GV9A 1OHFA 1WWYA 4IV3A 2UU8A 3LA7A 2JB8A 5H9SA 1OPMA 3C7FA 4R9AA 3QH6A 3O0XA 3OOXA 5FZHA 4Q4X1 2W5FA 5FYHA 2F17A 2JB4A 3Q8CA 4PIZA 4BMBA 4FPOB 4GB32 2DV9A 4BQXA 1LOBA 4Y4RA 5F3IA 3P6BA 1OOPB 2QZ2A 1LGNA 4EZ4A 5FZGA 5GLZA 2YZ4A 1MVEA 1H1MA 1DLCA 1AYM3 2LUWA 5CIRA 3EMRA 1J83A 1LOGA 3MFAA 1O4TA 4XJ9A 1V6NA 4L8QA 2F6BA 1S0FA 3AFGA 1SACA 3RYRA 1WMFA 4Y26A 1ZBE1 1VBD2 4YVSA 2E63A 3VN4A 1JZ3A 2W2IA 3PL0A 4Q4Y2 2RM22 1FXZA 4FPEA 1JZ2A 4P9GA 1RVF1 2VBBA 3BU0A 1W06A 3MV01 3O1RA 4MGQA 3P3PA 1JHNA 2VOKA 4LK6A 1GZ9A 1G9CA 5C5TA 2VH9A 3SISA 2A6ZA 4AVSA 2XR4A 3VD5A 1WW6A 4LBJA 4JCKA 3RMYA 3NV4A 1QWRA 2Y64A 1CJPA 4N53B 3DF0A 1TMF1 3DGTA 3IDCB 3LPFA 4TYSA 3T2OA 4BXSV 1W03A 5A6YA 5CFCA 2FDJA 4V1PA 1XE8A 3ZIWA 2DCZA 2XWBB 4KWUA 1BBT1 3FC0A 2LM3A 2XJTA 1UL9A 4HBNA 4HFSA 2WJSA 1YQ5A 2ARXA 1VBB1 2XG3A 3POIA 5CZKA 2VO5A 3QCWA 4KBBA 4EZHA 2ZHLA 2ZX1A 4JQTA 4BDVB 1H4HA 5C4WB 3I3QA 2OZ6A 1I5PA 3VBRA 4CRQA 3PIGA 2IWGB 1D0GA 2WNUA 2YU2A 1Q43A 4PIYA 3URFA 3VHOA 4B29A 1BK0A 2QQWA 2RDNA 1NXMA 4HKLA 2PFWA 2RS32 5JDBA 4AVCA 3ZYHA 3J8F2 4CXYA 1TME1 2RMU2 4QQLA 1EUTA 3AJYA 2W46A 5D2AA 5JZGA 1O8SA 2RS13 3RS6A 5T52A 3HAGA 5FK8A 2YG0A 2YBPA 2QFEA 2ZHMA 5FJKA 1CJDA 3MIBA 5EPAA 1OXCA 1SFPA 2V72A 3C7OA 1LCLA 2VE1A 2WNVA 1W05A 4IEWA 4NRMA 1D2QA 4W6XA 5IK5A 4IE7A 4OI1A 1EPWA 2A71A 1ASJ1 3B94A 5FKCA 2KR2A 5FTTC 3T4HB 2OUJA 3WINE 3KVAA 1W9SA 1VBC1 2KM2A 4BHPA 3A0NA 4XE9A 3WUCA 1YQ8A 3HNMA 3ZXEA 5BNOB 1I1EA 3BKZA 1OQEA 2HWC3 1HRV2 2GC3A 1SMVA 3D6EA 4PI2A 4ES9A 1ST8A 3KCYA 2DU0A 4MGSA 4PIXA 5H9QA 1G9DA 1HRI2 4MYEA 3KZ4C 1C57A 1QQP1 2XUEA 3DUIA 4AI0A 4CXXA 1DGWA 3L2YA 1GWKA 1GZWB 2BTVC 1JOPA 1U5IA 2DBNA 2HWB1 3R0RA 4LA3A 2G1MA 5K4LA 3WV6A 4FAHA 2IXLA 3THPA 1D4M1 2A73B 3OUJA 3WNMA 4DY5A 2J1RA 1KS5A 2D43A 2D6PA 4A45A 3POYA 3IMNA 4I0AA 4QX8A 3RYKA 3TN91 1UZWA 5A7OA 5LY1A 2X10A 2WO2A 2ET1A 1RUG1 3HQUA 4DXTA 1Q8OA 2VCBA 2A5ZA 1G9FA 2BV4A 3K77A 1QU0A 3OGGA 4P14A 5KHHA 2VW2A 3WW4A 4F8AA 2YC4A 3O14A 4C91A 2GN3A 5DABA 4AHXA 4E2QA 1MZFA 3I59A 2B39A 2P4EA 2V5DA 3DECA 3KSCA 3UL2A 1YQ2A 2B7YA 3ZN6A 3E6BA 3VBFB 1X9PA 4Z92B 4QPIC 3J9SA 2X8KA 1W8OA 3CNAA 4L0PA 1H9WA 4QQHA 3S30A 5DAWA 4QPGB 2R30A 3T0AA 2JG9A 2YDEA 4I3PA 1UN1A 1B09A 5BNPB 2ZGOA 2CWMA 2P34A 1NKGA 5FZ0A 1LENA 1KGYA 1R081 1R1A2 1WMDA 5EJ1B 5CYYA 1O3QA 5A80A 3ST7A 2I2SA 3OTFA 4B7EA 1OA4A 5A33A 1I5ZA 4YW5A 3VBOA 3I3EA 3KD4A 3V0BB 4LHSA 2ZGLA 3GHNA 5C9AB 2VD7A 1H6YA 2AEYA 4CCMA 1I9RA 5A7WA 4OMDA 4XUPA 1RGSA 1VJ2A 3ILRA 1JI6A 3T3YA 2VW1A 4S2FA 3AMHA 3PUSA 2EVXA 5FZKA 2JG8B 4YGCA 2J7MA 4PLOA 1HN0A 1VBE1 2DCKA 2R042 5FYBA 1S0EA 2NYYA 2VBDA 3WG3A 2HWD1 2WO1A 5T54A 5E6HA 2PAMA 4XYXA 3ES4A 3HMYA 2A6VA 4URTA 4E8CA 1Z7S3 1K5MC 4ORFA 3CHXA 1QJX3 1EAH1 4HANA 2ZGUA 1RUC3 5A7SA 2ATFA 2Z42A 3CBNA 2P3KA 1OLME 5DUWA 1AR61 4XAAA 3W20A 3P5BA 2X5IA 1F8VA 1RXFA 1TMF2 2VUDA 3VDDC 1BEV3 1ODMA 3K51A 1RYYA 3POGA 4BXFA 2LRPA 4CUAA 3OCPA 3DPRC 1DP0A 1BBT2 1N1VA 1QHDA 1NA1C 2VMGA 5KR7A 1WMXA 2Y34A 5I8YA 3VV1A 5JXGA 5FY0A 5FZ9A 1JZ4A 2VZRA 1AXYA 1QJEA 3WUDA 3T4VA 3KHBA 1JHJA 2ZEYA 2BFUL 3WVJA 1CIWA 5FMBA 4DB5A 1V6KA 1GYKA 1RUJ2 3USSA 1HDKA 4O61A 4NIAA 2IC1A 1BKZA 3VBUC 1R093 5J3UA 1TME2 4AHZA 1IS3A 1M4WA 1YQ6A 5A3UA 3POEA 2Q8EA 1MEC3 4GQ7A 3MLKA 3ZMNA 3UT0A 3T1LA 2DDUA 1OQ1A 5LA2A 3SLIA 4AW7A 2W08A 1PK6B 1QDCA 1AR82 3GYDA 4KWJA 4CEWC 1SFNA 1NA1A 3FX3A 3WP4A 5I91A 4MXWA 5IVCA 4YSFA 4AYUA 1J59A 4PF5A 4M0NA 3NV2A 5EJZB 1H9PA 5FYUA 1WCDJ 2WS93 4YLZA 1W8ZA 4FPLA 5IAVA 2D6MA 2HWE2 2WKKA 1UKRA 1JYIA 5FY8A 2R073 3KF3A 1H8TA 3EO6A 4OZOA 3AZWA 1ZREA 1FYUA 3HD8B 1YFYA 2PHXA 4AEDB 1COV1 2CDPA 1A34A 1ND3C 1REDA 3WDTA 3U37A 4HN1A 1RUOA 1SLAA 1POV1 3CJIB 4NUBA 4COZA 1CAXB 1D4M2 3O7OA 3UJOA 4PJYA 2VUAA 4M0HA 1AL23 3BB6A 4QX7A 3AKPA 1W8HA 2WIIB 3WCRA 2FCUA 2W1WA 1C5IA 4MOAA 1OH3A 1XXNA 2D93A 1GLHA 1XRUA 4AK3A 2WN3A 4YM0A 1PHMA 4YZ1A 3M4FA 2UURA 1J1TA 3AB0A 1KITA 1UZZA 1CPNA 2Q8DA 1UKGA 4NR1A 1W8WA 4NO4A 2NQYA 3MF9A 4FTSA 4RA0A 5A7PA 4BQ3A 3NJXA 4XJAA 1QMJA 1W6OA 3BTZA 1PZ9A 1NZIA 2WFPA 4WVZA 3ECQA 1GNZA 2NMNA 4YZ3A 5I0DA 1KDMA 4NIGA 1YHFA 3IB3A 3IN9A 3KT4A 4Q1PA 2YV8A 1HXS3 4DO0A 4AFCA 1FPN1 2JXAA 1REEA 2DCYA 2ADDA 2BQPA 1JW6A 1VMHA 2FQPA 2XLGA 2J1SA 3LE0A 4KWLA 4ZXKA 5FO8B 1S2BA 2ID4A 4OULA 1WBLA 4UYBA 4NIDA 5FMCA 1GNYA 1Y4WA 3LFIA 4UI9L 4YVWC 2PMWB 2VMEA 3L9JT 3Q8AA 3P1IA 3ZFEB 1RUI1 1WLTA 2VTXA 4DQAA 4Y1VA 3EBRA 4JGZC 1YFXA 1YLLA
chains in the Genus database with same CATH topology
3LQCA 4QDQA 4E8DA 2Y6KA 2ORXA 3I3BA 3D3AA 4JKLA 5JXJA 2LW8A 4PQQA 3NQHA 2KD7A 1UY3A 2JDAA 2VQTA 2Y8KA 1L7QA 2EIDA 3A23A 1WKYA 2VMCA 4GWIA 1ULOA 3LEKA 3WNLA 1SG3A 1KEXA 2VQUA 3ACHA 3SEEA 1W9TA 2VOTA 4ZZ5A 3VD7A 2QQLA 2E31A 3HN3A 3HNYM 1JYNA 1GQPA 4A41A 2WAOA 3WF3A 3HOBA 2Y6LA 5LA0A 2W92A 2EIBA 4GZ9A 3OEBA 2Y6HA 3CZUA 1TG7A 2VC9A 3NJVA 3WNPA 1W0NA 4A44A 2VZTA 3FHQA 1P8JA 2E26A 2ORZA 4LPLA 4CUCA 4P08A 3A21A 2VCCA 3PUIA 1JU4A 3LEGA 3C7EA 1CZSA 3MBWA 4W50A 2Y6GA 3VDBA 2VZPA 3T09A 3GDBA 3T0BA 4YPJA 4RN5A 2W9XA 4A6OA 1JZ7A 3T2PA 2VL4A 3PUHA 2J22A 1JYWA 5JUVA 3MUY1 3GM8A 2WYSA 3OB8A 4BK5A 5JXHA 3W5MA 5IHRA 2QQNA 1D7PM 4IUGA 1L7RA 4ARYA 2L9LA 2E33A 4XUOA 2W87A 1T2XA 2W3JA 1K45A 4HG6B 3A22A 1UX7A 3LEIA 4MO3M 2RJ2A 3T0DA 2VJXA 4CU9A 3AC0A 4XZUG 4JHZA 4D0QA 4ZY9A 4DUVA 4AG4A 4QB2A 2HYXA 4KI5M 2DCJA 4A4AA 1F4HA 3I2GA 2YFZA 1UY4A 1UYZA 3NNGA 3OEAA 2VZ3A 5LCWL 3SEPA 3WF4A 4CU8A 3C7GA 3C7FA 2WUHA 3CZJA 2W5FA 1EUUA 4M4RA 3JXSA 4QX3A 3P6BA 1JYVA 1XNTA 4KMQA 2J1VA 3K75B 1DLCA 3OGSA 3GGLA 1GOHA 4UOJA 4DEQA 1J83A 3WNOA 4XUNA 1MPXA 4ARXA 4M4PA 4ET7A 2RV9A 5IFPA 1JZ3A 4ZZ8A 1JZ2A 5JMOA 3MV01 4MGQA 3WF2A 5IYYA 5JXIA 2QQIA 3MO4A 3ACFA 5DPNA 2YB7A 2XONA 3OBAA 1JU3A 3DYPA 4ZXEA 3THDA 3VD5A 5J1XA 1CZTA 3DYMA 2Y64A 4OYUA 5DQ0A 3T2OA 4BXSV 3LPFA 5G04L 2V4VA 3WQBA 2XOMA 4A3ZA 2PQSA 4KWUA 3WEZA 1BHGA 1H6XA 1SDDB 1OD3A 4XUQA 5F7UA 4D8MA 2QQKA 3C7HA 1CIYA 1UYYA 5C7GA 2W47A 5CZKA 2VO5A 1PMJX 2BBAA 1CZVA 2ZXQA 4BDVB 5LA1A 1I5PA 2QQOA 1IQDC 4W4ZA 4JKMA 4QDSA 2XHNA 1PMHX 1LNSA 1EUTA 2C4XA 1R64A 2W46A 3VD3A 1O8SA 1JZ5A 3CKHA 1UWWA 2VMDA 3I2HA 2YG0A 3CQOA 1JZ6A 5JR2A 4OUEA 1US3A 4QB6A 4DUXA 2V72A 3C7OA 4PF1A 1JZ8A 1OT5A 1XNAA 4QX2A 1F4AA 1UMIA 1W9SA 3HNMA 3WSOA 2BERA 3IAPA 2C26A 3I2IA 2WABA 4MGSA 3J7HA 2BGPA 1K12A 4DEVA 5C70A 4XVHA 1UYXA 3VDCA 2VZ1A 3BN6A 2W91A 2BZDA 2Z4FA 3FN9A 3WNNA 1O8PA 1K42A 2VM9A 4QX1A 3I2KA 3WNMA 2W95A 1XC6A 2J1RA 5A1AA 4A45A 3UESA 3OGRA 2ZEXA 3T2QA 3VD9A 2X10A 3FHAA 2WO2A 3I3DA 3W5NA 2WZ8A 4MADA 2J1AA 4DXSA 4DXTA 4XUTA 3LPGA 4PT6A 1DYOA 2VCBA 4OMCA 3K77A 5HXMA 1OF3A 3WF0A 5DN2A 2YC4A 1US2A 1O59A 3CDZB 3DECA 2V5DA 3VD4A 3CIHA 1YQ2A 2B4KA 3MV11 1W8OA 4L0PA 1CX1A 2W94A 5B4NA 1HN1A 1WCQA 3HEIA 2WN2A 3T0AA 4P00B 1GUIA 2YFUA 4BK4A 3C8XA 1NKGA 2JKXA 1KGYA 5EJ1B 1K3IA 5CYYA 3FL7A 4DXRA 3I2JA 3I3EA 2BGOA 4AAXA 2EICA 3HPNA 3ETPA 4LHSA 4CVUA 4P5YA 1H6YA 1TVGA 4QX0A 2VZOA 3HNBM 4OMDA 1GOFA 4XUPA 2W1UA 5DMYA 1JI6A 1OH4A 2WZEA 2J7MA 2DCKA 5IJRA 2ZEWA 2E32A 2WO1A 3I2FA 1NUKA 2VZUA 1UY0A 5IFTA 2VR4A 4E8CA 4Z2AA 2J1TA 2LS6A 2WDBA 5B4XA 3HJRA 2B9VA 1UXXX 3NRUA 2WBKA 3EB7A 1GOGA 3OGVA 2YC2A 3ACIA 2WAAA 3OG2A 1RYYA 4CUAA 1OF4A 1DP0A 3MUZ1 2VTFA 4QB1A 1PX4A 3EYPA 2R7EB 2VMFA 3IAQA 3F2ZA 3GXUA 4LQRA 5JXGA 5G05L 2J1UA 1XPWA 4A42A 1JZ4A 2VZRA 1GMMA 4TTGA 5EIYB 4FI9A 2X09A 2VZVA 3ZM8A 1JHJA 2ZEYA 3ABZA 4XURA 4CUBA 2VZQA 2CDOA 3UNPA 1UZ0A 1SHWB 3CMGA 2W1SA 1JYXA 5C71A 5FUIA 4BJ0A 1PX3A 3K4ZA 2DDUA 5LA2A 4CU6A 1J84A 2WO3A 1W99A 4RYDA 3IIIA 3DYOA 5EJZB 3ACGA 4CU7A 4QAWA 2RVAA 3WNKA 3K46A 2QBXA 4JX0A 3BGAA 3SKJE 1UXZA 4OZOA 3WF1A 2ZEZA 2VCAA 3A7QA 1W8NA 3K4AA 2C9KA 1UMHA 4QDRA 2CDPA 2QQJA 2JD9A 3U37A 2J1EA 4W8JA 2XQXA 2W1WA 3E1F1 2JE8A 4MOAA 2W1QA 4TXWA 2WN3A 4DUWA 2HLEA 1NAEA 3IDAA 5HPOA 3I97A 1ULPA 4JKKA 2OKXA 3VDAA 1GU3A 2QQMA 3NJXA 3K4DA 5I0DA 3ECQA 1NX9A 4QPWA 3IB3A 4UAPA 4P02B 3UETA 4LKSA 2X05A 3LE0A 2J1SA 3T08A 2ID4A 1UY2A 1GNYA 2Y6JA 1UY1A 4UI9L 2VZSA 2VMEA 2EIEA 2WQ8A 3P1IA 3SKVA 3THCA 4GWJA 1W9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQC A;  4QDQ A;  4E8D A;  2Y6K A;  2ORX A;  3I3B A;  3D3A A;  4JKL A;  5JXJ A;  2LW8 A;  4PQQ A;  3NQH A;  2KD7 A;  1UY3 A;  2JDA A;  2VQT A;  2Y8K A;  1L7Q A;  2EID A;  3A23 A;  1WKY A;  2VMC A;  4GWI A;  1ULO A;  3LEK A;  3WNL A;  1SG3 A;  1KEX A;  2VQU A;  3ACH A;  3SEE A;  1W9T A;  2VOT A;  4ZZ5 A;  3VD7 A;  2QQL A;  2E31 A;  3HN3 A;  3HNY M;  1JYN A;  1GQP A;  4A41 A;  2WAO A;  3WF3 A;  3HOB A;  2Y6L A;  5LA0 A;  2W92 A;  2EIB A;  4GZ9 A;  3OEB A;  2Y6H A;  3CZU A;  1TG7 A;  2VC9 A;  3NJV A;  3WNP A;  1W0N A;  4A44 A;  2VZT A;  3FHQ A;  1P8J A;  2E26 A;  2ORZ A;  4LPL A;  4CUC A;  4P08 A;  3A21 A;  2VCC A;  3PUI A;  1JU4 A;  3LEG A;  3C7E A;  1CZS A;  3MBW A;  4W50 A;  2Y6G A;  3VDB A;  2VZP A;  3T09 A;  3GDB A;  3T0B A;  4YPJ A;  4RN5 A;  2W9X A;  4A6O A;  1JZ7 A;  3T2P A;  2VL4 A;  3PUH A;  2J22 A;  1JYW A;  5JUV A;  3MUY 1;  3GM8 A;  2WYS A;  3OB8 A;  4BK5 A;  5JXH A;  3W5M A;  5IHR A;  2QQN A;  1D7P M;  4IUG A;  1L7R A;  4ARY A;  2L9L A;  2E33 A;  4XUO A;  2W87 A;  1T2X A;  2W3J A;  1K45 A;  4HG6 B;  3A22 A;  1UX7 A;  3LEI A;  4MO3 M;  2RJ2 A;  3T0D A;  2VJX A;  4CU9 A;  3AC0 A;  4XZU G;  4JHZ A;  4D0Q A;  4ZY9 A;  4DUV A;  4AG4 A;  4QB2 A;  2HYX A;  4KI5 M;  2DCJ A;  4A4A A;  1F4H A;  3I2G A;  2YFZ A;  1UY4 A;  1UYZ A;  3NNG A;  3OEA A;  2VZ3 A;  5LCW L;  3SEP A;  3WF4 A;  4CU8 A;  3C7G A;  3C7F A;  2WUH A;  3CZJ A;  2W5F A;  1EUU A;  4M4R A;  3JXS A;  4QX3 A;  3P6B A;  1JYV A;  1XNT A;  4KMQ A;  2J1V A;  3K75 B;  1DLC A;  3OGS A;  3GGL A;  1GOH A;  4UOJ A;  4DEQ A;  1J83 A;  3WNO A;  4XUN A;  1MPX A;  4ARX A;  4M4P A;  4ET7 A;  2RV9 A;  5IFP A;  1JZ3 A;  4ZZ8 A;  1JZ2 A;  5JMO A;  3MV0 1;  4MGQ A;  3WF2 A;  5IYY A;  5JXI A;  2QQI A;  3MO4 A;  3ACF A;  5DPN A;  2YB7 A;  2XON A;  3OBA A;  1JU3 A;  3DYP A;  4ZXE A;  3THD A;  3VD5 A;  5J1X A;  1CZT A;  3DYM A;  2Y64 A;  4OYU A;  5DQ0 A;  3T2O A;  4BXS V;  3LPF A;  5G04 L;  2V4V A;  3WQB A;  2XOM A;  4A3Z A;  2PQS A;  4KWU A;  3WEZ A;  1BHG A;  1H6X A;  1SDD B;  1OD3 A;  4XUQ A;  5F7U A;  4D8M A;  2QQK A;  3C7H A;  1CIY A;  1UYY A;  5C7G A;  2W47 A;  5CZK A;  2VO5 A;  1PMJ X;  2BBA A;  1CZV A;  2ZXQ A;  4BDV B;  5LA1 A;  1I5P A;  2QQO A;  1IQD C;  4W4Z A;  4JKM A;  4QDS A;  2XHN A;  1PMH X;  1LNS A;  1EUT A;  2C4X A;  1R64 A;  2W46 A;  3VD3 A;  1O8S A;  1JZ5 A;  3CKH A;  1UWW A;  2VMD A;  3I2H A;  2YG0 A;  3CQO A;  1JZ6 A;  5JR2 A;  4OUE A;  1US3 A;  4QB6 A;  4DUX A;  2V72 A;  3C7O A;  4PF1 A;  1JZ8 A;  1OT5 A;  1XNA A;  4QX2 A;  1F4A A;  1UMI A;  1W9S A;  3HNM A;  3WSO A;  2BER A;  3IAP A;  2C26 A;  3I2I A;  2WAB A;  4MGS A;  3J7H A;  2BGP A;  1K12 A;  4DEV A;  5C70 A;  4XVH A;  1UYX A;  3VDC A;  2VZ1 A;  3BN6 A;  2W91 A;  2BZD A;  2Z4F A;  3FN9 A;  3WNN A;  1O8P A;  1K42 A;  2VM9 A;  4QX1 A;  3I2K A;  3WNM A;  2W95 A;  1XC6 A;  2J1R A;  5A1A A;  4A45 A;  3UES A;  3OGR A;  2ZEX A;  3T2Q A;  3VD9 A;  2X10 A;  3FHA A;  2WO2 A;  3I3D A;  3W5N A;  2WZ8 A;  4MAD A;  2J1A A;  4DXS A;  4DXT A;  4XUT A;  3LPG A;  4PT6 A;  1DYO A;  2VCB A;  4OMC A;  3K77 A;  5HXM A;  1OF3 A;  3WF0 A;  5DN2 A;  2YC4 A;  1US2 A;  1O59 A;  3CDZ B;  3DEC A;  2V5D A;  3VD4 A;  3CIH A;  1YQ2 A;  2B4K A;  3MV1 1;  1W8O A;  4L0P A;  1CX1 A;  2W94 A;  5B4N A;  1HN1 A;  1WCQ A;  3HEI A;  2WN2 A;  3T0A A;  4P00 B;  1GUI A;  2YFU A;  4BK4 A;  3C8X A;  1NKG A;  2JKX A;  1KGY A;  5EJ1 B;  1K3I A;  5CYY A;  3FL7 A;  4DXR A;  3I2J A;  3I3E A;  2BGO A;  4AAX A;  2EIC A;  3HPN A;  3ETP A;  4LHS A;  4CVU A;  4P5Y A;  1H6Y A;  1TVG A;  4QX0 A;  2VZO A;  3HNB M;  4OMD A;  1GOF A;  4XUP A;  2W1U A;  5DMY A;  1JI6 A;  1OH4 A;  2WZE A;  2J7M A;  2DCK A;  5IJR A;  2ZEW A;  2E32 A;  2WO1 A;  3I2F A;  1NUK A;  2VZU A;  1UY0 A;  5IFT A;  2VR4 A;  4E8C A;  4Z2A A;  2J1T A;  2LS6 A;  2WDB A;  5B4X A;  3HJR A;  2B9V A;  1UXX X;  3NRU A;  2WBK A;  3EB7 A;  1GOG A;  3OGV A;  2YC2 A;  3ACI A;  2WAA A;  3OG2 A;  1RYY A;  4CUA A;  1OF4 A;  1DP0 A;  3MUZ 1;  2VTF A;  4QB1 A;  1PX4 A;  3EYP A;  2R7E B;  2VMF A;  3IAQ A;  3F2Z A;  3GXU A;  4LQR A;  5JXG A;  5G05 L;  2J1U A;  1XPW A;  4A42 A;  1JZ4 A;  2VZR A;  1GMM A;  4TTG A;  5EIY B;  4FI9 A;  2X09 A;  2VZV A;  3ZM8 A;  1JHJ A;  2ZEY A;  3ABZ A;  4XUR A;  4CUB A;  2VZQ A;  2CDO A;  3UNP A;  1UZ0 A;  1SHW B;  3CMG A;  2W1S A;  1JYX A;  5C71 A;  5FUI A;  4BJ0 A;  1PX3 A;  3K4Z A;  2DDU A;  5LA2 A;  4CU6 A;  1J84 A;  2WO3 A;  1W99 A;  4RYD A;  3III A;  3DYO A;  5EJZ B;  3ACG A;  4CU7 A;  4QAW A;  2RVA A;  3WNK A;  3K46 A;  2QBX A;  4JX0 A;  3BGA A;  3SKJ E;  1UXZ A;  4OZO A;  3WF1 A;  2ZEZ A;  2VCA A;  3A7Q A;  1W8N A;  3K4A A;  2C9K A;  1UMH A;  4QDR A;  2CDP A;  2QQJ A;  2JD9 A;  3U37 A;  2J1E A;  4W8J A;  2XQX A;  2W1W A;  3E1F 1;  2JE8 A;  4MOA A;  2W1Q A;  4TXW A;  2WN3 A;  4DUW A;  2HLE A;  1NAE A;  3IDA A;  5HPO A;  3I97 A;  1ULP A;  4JKK A;  2OKX A;  3VDA A;  1GU3 A;  2QQM A;  3NJX A;  3K4D A;  5I0D A;  3ECQ A;  1NX9 A;  4QPW A;  3IB3 A;  4UAP A;  4P02 B;  3UET A;  4LKS A;  2X05 A;  3LE0 A;  2J1S A;  3T08 A;  2ID4 A;  1UY2 A;  1GNY A;  2Y6J A;  1UY1 A;  4UI9 L;  2VZS A;  2VME A;  2EIE A;  2WQ8 A;  3P1I A;  3SKV A;  3THC A;  4GWJ A;  1W9W A; 
#chains in the Genus database with same CATH topology
 4A7Z A;  1KRI A;  4QDQ A;  4K6B A;  2C6S A;  2CNA A;  2ORX A;  3I3B A;  5DZE A;  3R6S A;  3SMH A;  3ZSL A;  4AL9 A;  2WYF A;  1HB4 A;  4JKL A;  4FOY A;  5JXJ A;  4K9S A;  4BE3 A;  3WCS A;  2ZMK A;  5SV5 A;  1SZB A;  4CTE A;  3O1O A;  1W90 A;  2XBO 2;  2DWR A;  5A3N A;  1PZ7 A;  3NQH A;  1OVP A;  2JD4 A;  2KD7 A;  4JGY A;  3VBH A;  1J3P A;  1M06 G;  1G9A A;  1CON A;  2I45 A;  1DQ0 A;  1NQJ A;  1L7Q A;  2EID A;  2ZGT A;  3ZOI A;  4CYD A;  3O1M A;  3A23 A;  1WKY A;  4OQ9 A;  1ZM1 A;  5K7P A;  1LTE A;  4FFF A;  1G86 A;  3RDI A;  4LBQ B;  4Q4V 1;  4GXL A;  5K0U A;  1MZE A;  3LEK A;  4MHR A;  3MPB A;  5FMO L;  4JGZ A;  3FLP A;  2BNM A;  1VBA 3;  2CHH A;  2Z69 A;  3GF6 A;  3SXW A;  3AZY A;  5IK8 A;  1L7L A;  1JOJ A;  5LY2 A;  4XW3 A;  1VB4 A;  4Y1Y A;  4FXK B;  4OI0 A;  4KGG A;  3SEE A;  3B01 A;  1NLQ A;  2AAC A;  2ZX3 A;  3SCG A;  1JS9 A;  1LHU A;  4ZZ5 A;  3MW3 A;  4DXZ A;  1AR6 2;  4AAP A;  4XQD A;  4BWO A;  3HN1 A;  4N90 A;  3HN3 A;  4Y20 A;  3RZK A;  4CP0 A;  5LA9 A;  3AKR A;  1S0J A;  3AP7 A;  5CKQ A;  1VRH 3;  3WF3 A;  3HOB A;  3WT3 A;  2ZGM A;  2Y6L A;  4GH4 C;  2FDI A;  4NPM A;  4CCJ A;  3TEZ A;  4XBL A;  5FYM A;  2R06 3;  3J4U H;  3KT1 A;  4LEJ A;  2Y6H A;  2VC9 A;  1VR3 A;  2XUM A;  3WNP A;  4EN9 B;  1JOD A;  5M0T A;  3S5A A;  1XE7 A;  3FHQ A;  1V6O A;  1PO1 2;  4BQ2 A;  5ABJ C;  1W0O A;  5KXB A;  2ORZ A;  2E7Q A;  2VNO A;  1PO2 1;  3A21 A;  3WP6 A;  3ZXG A;  4PLM A;  2VCC A;  5C33 A;  3S0M A;  3H8O A;  2QE3 A;  4YG6 A;  5HCF A;  3C7E A;  3LOB A;  2RS5 3;  1UU6 A;  4QXC A;  2Y6F A;  1R09 2;  1ZBA 3;  3VDB A;  1FMD 1;  5FCC A;  2TBV A;  4PCR A;  4YPJ A;  2XKP A;  4RN5 A;  3LKJ A;  4FSJ A;  4RFR B;  1MQT C;  4I3G A;  4Q0Q A;  4GKY A;  5KHJ A;  4QHO A;  4A6O A;  3O12 A;  4XCA A;  1PGW 1;  2QCS B;  1QY4 A;  1GFF 2;  4O9E A;  1X33 A;  3AJZ A;  3PUH A;  2H6B A;  1LEC A;  5IVY A;  1X8E A;  3MUY 1;  4Q2F A;  1JXN A;  3ZFF C;  3N7L A;  3ON7 A;  1YQC A;  1XND A;  3BU7 A;  5KC6 A;  4DZG A;  5D8A C;  2DUO A;  5FMD A;  3NKT A;  2WS9 2;  4CDW A;  5IHR A;  2QQN A;  4IUG A;  2EA7 A;  3I2O A;  2PLV 1;  2E33 A;  4Y1Z A;  3N9O A;  3D5O A;  2W3J A;  2PAK A;  4F83 A;  3LEI A;  4V2V A;  1SBE A;  5F39 A;  5T3N A;  1IHM A;  2VJX A;  2P3I A;  3OPT A;  1IOA A;  1S0C A;  3FZ3 A;  4LO4 B;  5T55 A;  4CU9 A;  2IVJ A;  1QXJ A;  4LBM A;  3BIW E;  5F9T A;  1C4R A;  3FUO A;  3WQ0 A;  4XFC A;  1W6N A;  1D0H A;  4ZY9 A;  2PN5 A;  4EYU A;  4QB2 A;  3LGR A;  1N3O A;  1ZRI A;  2YYO A;  4D7Y A;  4A4A A;  5SV8 A;  1Y3T A;  1OA2 A;  4NPR A;  2FDH A;  2HWF 2;  4UBG A;  5T50 A;  1D2S A;  4GB3 3;  5GLW A;  5FQ0 B;  1B35 C;  4AGV A;  1UY4 A;  2PEL A;  4LOR A;  2XH6 A;  3FLR A;  1KFU L;  3TAY A;  5FZL A;  1RUH 1;  4YW7 A;  1NT0 A;  2VZ3 A;  3JBG 3;  1HV0 A;  3TBD A;  3WF4 A;  5EP9 A;  1OLR A;  3IPV B;  4HSL A;  5C8C A;  1DG6 A;  2BJS A;  1TE1 B;  3AKQ A;  5FZD A;  4PBO A;  3ORJ A;  2WUH A;  4FVV A;  3CZJ A;  1VBD 3;  5LAT A;  4AFA A;  4K1Z A;  1QJY 3;  4Q4Y 3;  2RM2 3;  5DDJ 1;  4NHK A;  1MR5 A;  5FAX A;  4M01 A;  3VHP A;  1JYV A;  1N3Q A;  2ZGP A;  2VOX A;  1WW4 A;  5DAQ A;  5A7W B;  3K75 B;  3AMN A;  3GGL A;  4RS5 C;  4UOJ A;  3WNO A;  1RUI 2;  1MPX A;  4QPI B;  5FYT A;  4F7Z A;  3PVN A;  3AVR A;  4JAA A;  4L9B A;  4XZP A;  5CIS A;  4D6R A;  5IFP A;  3WDV A;  1IZ3 A;  3Q9O A;  2YHJ A;  1PZ8 A;  4JDM A;  4ZZ8 A;  3H1W A;  3LOI A;  2WZP P;  3Q8F A;  4XAE A;  2D44 A;  5DG2 A;  4JDN A;  3WDU A;  2MEV 3;  5FPX A;  2VUC A;  3NAP A;  3WF2 A;  5IYY A;  5JXI A;  1IS5 A;  2Q4S A;  3ACF A;  4U2A A;  1CAW A;  5ACA 1;  2A3X A;  1CAU A;  2XON A;  3OBA A;  4Y5Z 0;  1JU3 A;  4RR3 A;  3BYW A;  3SCF A;  1V9U 2;  3Q8E A;  2NN8 A;  3NL1 A;  3ZXK A;  1HB1 A;  1I3H A;  3ZXF A;  4EWE A;  4FPJ A;  3ZR6 A;  2W0X A;  1NLS A;  4FAG A;  3RSJ A;  4Y24 A;  2NZ9 A;  2PAE A;  4A3Z A;  4PDW A;  2E51 A;  5FY7 A;  2PQS A;  4UBH A;  2RS3 3;  5H9R A;  1BHG A;  2WZR 2;  3J8F 3;  4WM8 A;  4L11 A;  4CDU C;  1H6X A;  2NLR A;  4NHL A;  3AL5 A;  1C8N A;  4D8M A;  5A1F A;  1ZA4 A;  4I30 A;  1H30 A;  1S0I A;  2BBA A;  5LEJ A;  5K9Y A;  2ZXQ A;  3RJ2 X;  1U5Y A;  4WM7 C;  2EXH A;  2D6K A;  4NIH A;  1LR5 A;  1HQL A;  1TZO A;  5T5J A;  5JOZ A;  1RIT A;  5CAD A;  1IQD C;  5JSO A;  2ZBJ A;  2RR1 2;  4NAM A;  4JKM A;  3IZO A;  1PMH X;  4FPY A;  3N9P A;  4R4X A;  1AXK A;  2XL9 A;  1KQR A;  2VTX J;  2WFF 2;  3HIF A;  5FUP A;  1GSL A;  3FMG A;  2VNG A;  3NNF A;  2V09 A;  3RNS A;  1RB8 G;  2O0O A;  1RMU 1;  4XET A;  5JR2 A;  4WV8 A;  3CJI C;  3VDD B;  4H14 A;  3RI8 A;  4EN0 A;  1QH6 A;  5BY5 A;  4OZX A;  4I09 A;  4C0H A;  4PF1 A;  3OY8 A;  1JZ8 A;  1HRI 3;  3BOW A;  1BVV A;  1OT5 A;  4IEO A;  5GLT A;  4LHN A;  1NA1 B;  4FQ4 A;  2DCT A;  3JUU A;  4JDO A;  2MHF A;  4MGZ E;  3TNQ A;  1QXR A;  4JTO A;  1F4A A;  1UMI A;  2VY0 A;  3H3U A;  1WD4 A;  5FPZ A;  1UW8 A;  4I2O A;  3M3C A;  3TYJ A;  2QDR A;  5IAX A;  4YNI A;  4IE4 A;  1GP4 A;  3WSO A;  1V6J A;  2UWC A;  1WCK A;  1KD7 A;  4TZD A;  3B93 A;  2BER A;  2EIG A;  3I2I A;  2BPA 2;  4DS0 A;  4AR2 A;  1ZYB A;  2WAB A;  1LGC A;  4J1W A;  3WHT A;  3WQ7 A;  5CKN A;  2FD8 A;  1K12 A;  4DEV A;  3VBU B;  3KB5 A;  4RQP A;  4QXK A;  2VZ1 A;  1ZVF A;  4IV3 C;  3VUO A;  4E4H A;  3FN9 A;  3WNN A;  1FV2 A;  1O8P A;  3GNE A;  5GZD A;  1K42 A;  3I2K A;  4OUM A;  4ITC A;  2JDN A;  1XC6 A;  4C1X A;  2WSV A;  1OBN A;  2IXH A;  3N35 A;  1W04 A;  5BUV A;  2XKO A;  1CR7 A;  2HJI A;  2VEC A;  4RGA A;  2ZEX A;  5JCT A;  4CEW B;  2IFR A;  4UF0 B;  3D8C A;  3I3D A;  2WZ8 A;  1Q8V A;  2XJV A;  5FZ4 A;  5GAL A;  5FZF A;  1RUF 1;  4CEY A;  5FXV A;  4DXS A;  1X9T A;  5FOJ B;  4XIL A;  1RUN A;  1DYO A;  3ZN5 A;  5GZC A;  3WP3 A;  5HXM A;  4IEZ A;  5BNN A;  2ZKL A;  3OUI A;  3ILF A;  4NPL A;  4YVS C;  5F2W A;  3CDZ B;  4B8E A;  5AC9 1;  1R1A 3;  1ND2 A;  3H1Y A;  5F1R A;  4IGP A;  4LIV A;  2ZGS A;  3CIH A;  5KHK A;  2B4K A;  3PUR A;  3SQO A;  2XML A;  2ZPX A;  5FP9 A;  3AX4 A;  2HKX A;  4Q4X 3;  2OW4 A;  1AR9 1;  2D3S A;  3MV1 1;  1ND3 B;  3V0A A;  2QDN A;  1SLL A;  1NCQ A;  1QJU 1;  3ZYJ B;  1DQ5 A;  1JOB A;  1VP6 A;  3O0W A;  4P00 B;  1MAC A;  1VB2 A;  5KC5 A;  3ZPY A;  2ZKN A;  1VAK A;  4FPC A;  1RUH 2;  2YFU A;  1RUD 2;  2QNK A;  2W52 A;  5FXW A;  4TWT A;  1NY7 2;  1O5L A;  1RXG A;  2UY9 A;  2JE9 A;  3AFK A;  2CAV A;  3USU A;  1FV3 A;  1TNF A;  1X7N A;  1XU1 A;  5BV6 A;  5CFC C;  1GQH A;  2R04 3;  3JBG 2;  5KBF A;  1RHI 1;  4DXR A;  1ZBE 3;  3MHZ A;  4GD4 A;  4HVQ A;  3M3O A;  2EIC A;  1A6C A;  1UU4 A;  4KGQ A;  1LOE A;  4CVU A;  4Y3O A;  1F2N A;  2PA7 A;  3DKQ A;  3GBF A;  3LIH A;  4P5Y A;  5L73 A;  1TVG A;  1J3Q A;  3A0K A;  1QJY 2;  3WP5 A;  1MS9 A;  4HXC A;  2VZO A;  3HNB M;  1JUI A;  4AQS A;  2GNM A;  2W1U A;  3ATG A;  2D40 A;  2H0B A;  3ZMO A;  1FX5 A;  1E5I A;  1O4Z A;  1GWL A;  3RWN A;  3VBR C;  1VE0 A;  2WNU C;  5CKM A;  3AYC A;  2XLA A;  1WLC A;  3CL1 A;  3HBZ A;  3UKT A;  3VBH B;  3ZDV A;  4RHV 2;  4OHY A;  1TMF 3;  3VKM A;  1NUK A;  3PDQ A;  5JZG C;  3RQ0 A;  2DFB A;  3FFZ A;  2DTY A;  4E9K A;  5HV4 A;  4M3C A;  4Z2A A;  4KU8 A;  4XFH A;  1H8V A;  1BBT 3;  2D6L X;  2LS6 A;  4YVW B;  2WDB A;  3EJK A;  1YEW A;  3D4K A;  3ZSE A;  5JPM B;  2Y0I A;  1W9Y A;  3WG2 A;  2MEV 2;  5D21 A;  5AVP A;  4JGZ B;  3RMX A;  2VMI A;  2WNV C;  4BIS A;  1ULD A;  2WBK A;  2GMM A;  1DQ4 A;  3EB7 A;  3ES1 A;  4XJ8 A;  1GOG A;  1F5F A;  1PIV 1;  5IK7 A;  3KMH A;  3WOG A;  4B1M A;  1LB2 A;  2X53 S;  2HEV F;  1OSG A;  1RUJ 3;  4GAZ A;  2Q30 A;  3QD6 A;  5AFE A;  3W59 A;  1POQ A;  2FDF A;  2VTF A;  4MET A;  1TME 3;  2DTW A;  4LNV A;  4ZU7 A;  1FOD 2;  4WBB A;  4GMP 1;  3BCW A;  3F2Z A;  3GXU A;  5FY4 A;  3ZX7 A;  1AX2 A;  2GC2 A;  2I74 A;  4LQR A;  2DVF A;  3RFR A;  4R4Z A;  1YO8 A;  1PVC 2;  3H8R A;  4Y5T A;  4FI9 A;  4E4D X;  1DZT A;  5JI9 A;  1AR8 3;  1BQP A;  4OHZ A;  1H2K A;  4CUB A;  2CDO A;  3WD5 A;  3UNP A;  3DXU A;  4IGQ A;  1ASJ 3;  1UZ0 A;  2FCV A;  3LFM A;  1C1F A;  4KG0 A;  1SPP A;  2CSG A;  5L9B A;  2VVD A;  4AHY A;  3PUQ A;  2HWE 3;  4FO9 A;  5C71 A;  3NKG A;  5F37 A;  1CAV B;  2ETE A;  2ZA9 A;  2CV6 A;  3GZT B;  1IS4 A;  5EQU A;  5J98 B;  1RMU 2;  2IFW A;  5E8A A;  3VBS A;  3K4Z A;  1UPS A;  4DPN A;  1J84 A;  1IGO A;  1REF A;  2WO3 A;  1W99 A;  4GWN A;  2A70 A;  5FFO C;  5FXZ A;  4RD7 A;  5CFD A;  5DAV A;  1HIX A;  2HWB 3;  3DYO A;  3ACG A;  1QF3 A;  2RS1 1;  4GH4 B;  3RYP A;  4C8D A;  2RVA A;  5EXO A;  5C3Q A;  1MS1 A;  4GKX A;  1D4M 3;  3K46 A;  5T5L A;  4Y22 A;  1GIC A;  3WNX A;  4N7U A;  3PVB B;  4AI2 A;  3WHU A;  4N8M A;  4CP9 A;  1H2L A;  2OPW A;  2NPI A;  3LB9 A;  2JG9 C;  3WF1 A;  3S7I A;  3TN9 3;  1RJ7 A;  5ABJ B;  5CAZ A;  1VIW B;  4H3W A;  4AQT A;  4BYY A;  4NRQ A;  2VW0 A;  4AFM A;  4CCC A;  5I0R A;  1LOA A;  1AX0 A;  4YAR A;  4K8R B;  2ZCW A;  1QKQ A;  3B5L B;  2GP3 A;  3VBO C;  2CYF A;  2C1F A;  2XGX A;  3HVD A;  1ZA7 A;  4CDX C;  3BAL A;  4IQP A;  4JVA A;  5FV3 A;  5HCA A;  4XBN A;  1MS4 A;  2EAL A;  1O91 A;  4KNC A;  1DDL A;  1MQT B;  4ASM B;  1KJL A;  2JE8 A;  5HCH A;  2VCM A;  1V00 A;  1G8W A;  4MHU A;  4IE5 A;  5A70 A;  5BXX A;  3ENR A;  4TXW A;  2HLE A;  4AZZ A;  4LBQ D;  2IXJ A;  5H9P A;  5L19 A;  3IDA A;  2I07 B;  2WL1 A;  3ZFF B;  2JDP A;  4YZ2 A;  3I97 A;  1ULP A;  5LK7 B;  4XJW A;  1ACC A;  4XPV A;  3DEM A;  2OKX A;  4Y5S A;  4BCU A;  5D8A B;  4YW2 A;  5J48 A;  3U78 A;  5FY1 A;  1VMJ A;  1PGL 1;  2WRA A;  1UAI A;  4HPK A;  3H42 B;  4KU7 A;  2WT0 A;  4QU2 A;  4XFI A;  4XHB A;  4UAP A;  4A2U A;  1W6Q A;  2GDF A;  4P02 B;  3UET A;  4LKS A;  2AGS A;  4HSJ A;  4AVT A;  4IEQ A;  3T1M A;  3WZ1 A;  4Q4X 2;  4CDX A;  3AYE A;  1W2A X;  4N43 A;  4RFT 0;  3LF7 A;  4KWK A;  2X5I C;  4L92 A;  3T2T A;  2YGM A;  4XFF A;  2EIE A;  2WQ8 A;  2IXI A;  2XBO 3;  3B7M A;  3FLT A;  5F6K A;  3ROU A;  3NJZ A;  4GWJ A;  2CU5 A;  2Y38 A;  1WCS A;  1UZY A;  4DOU A;  1B35 B;  2WC2 A;  3NNL A;  3PNA A;  1E5H A;  5EYY A;  1W2T A;  2Q1F A;  1RIN A;  1ZBE 2;  1S0D A;  3BTA A;  3INA A;  4UFJ A;  5L9R A;  2GC0 A;  5LAS A;  1V6I A;  3LD8 A;  2DUR A;  1RVF 2;  3VB9 A;  4YW3 A;  1EAH 3;  4A7Y A;  4YGD A;  1GWM A;  2GSY A;  2WQ4 A;  2Z5W A;  4JTN A;  2VQT A;  3O1V A;  2JDA A;  5DZF A;  3B02 A;  4RR3 B;  1AR6 3;  5AVA A;  5FYZ A;  3ZYB A;  1JTZ X;  1FI2 A;  1QNW A;  4V2W A;  5L7O A;  1EV1 1;  2VMC A;  4HZF A;  4EV0 A;  1D4V B;  1X50 A;  4YRD A;  4COY A;  3KV5 A;  1IS6 A;  4Q29 A;  1ZZ8 A;  5IW0 A;  3POJ A;  3WNL A;  3U4X A;  4RS5 B;  5T5O A;  5I8T A;  4LO5 B;  5LEK A;  1S0B A;  3LCP A;  1SG3 A;  1F35 A;  4ASK A;  3ZKY A;  1KEX A;  2VQU A;  3OF1 A;  3GBW A;  3A4U A;  3BOP A;  3U14 A;  3AZX A;  3VHN A;  1OUS A;  1W9T A;  2HEY F;  2VOT A;  1PO1 3;  3VD7 A;  1VBB 2;  2HH9 A;  4D6S A;  4FOW A;  2P1B A;  2ERF A;  2JEM A;  1DHK B;  2PHD A;  1QJX 1;  1GQP A;  1Y9M A;  1IG3 A;  4XJZ A;  4A41 A;  1H8T C;  2PHL A;  1DGR N;  2ARB A;  2OA2 A;  2WAO A;  4WVM A;  3ZIX A;  1RUC 1;  3FHI B;  4HK8 A;  3ZYR A;  4CDQ A;  3FBM A;  4UW5 A;  2VMH A;  1DYK A;  2W92 A;  5LA0 A;  2QQU A;  2H6C A;  5IT6 A;  3M8L A;  5J37 A;  3TRS B;  4E4Z A;  3DL3 A;  1W2N A;  1BCX A;  4R9D A;  1BMV 1;  3KT7 A;  2VZT A;  4HET A;  4QU1 A;  1BK1 A;  4Q4W 1;  1OFS A;  5EFU A;  4B7K A;  5IVF A;  4LKF A;  2ZAH A;  4LPL A;  2HBU A;  4LLF A;  4P08 A;  1AX1 A;  5FYI A;  4CDU B;  4B3N A;  1AJK A;  2VG9 A;  3PUI A;  4QT6 A;  5F3C A;  4W65 A;  2Q5T A;  3LEG A;  4GA9 A;  3ALQ A;  1CZS A;  1ASJ 2;  4HVR A;  1FNZ A;  4IEV A;  4LJH A;  2ZX4 A;  5CVR A;  5DG1 A;  4AE2 A;  4EN6 B;  2VZP A;  4SBV A;  3S5Q A;  4WM7 B;  1VBC 2;  4UT5 A;  3ZYF A;  1W6M B;  1RTV A;  3AM2 A;  1X8M A;  1UF2 C;  4URA A;  5F32 A;  2CGP A;  1QNY A;  3TEW A;  4XF4 A;  1TEI A;  4N9I A;  1J58 A;  2V4A A;  2AR6 A;  2JKB A;  2TNF A;  4OHV A;  2JIJ A;  2LTN A;  1MEC 1;  5A32 B;  1POV 3;  1W2U A;  4A3X A;  1QQP 2;  3R05 A;  2HWB 2;  2XVL A;  5J7M A;  1WZX A;  2DVB A;  3OYW B;  2WWU A;  1ENS A;  1D7P M;  3U07 A;  1N1T A;  1L7R A;  2XJP A;  4ARY A;  5LRR A;  1UNB A;  1H1I A;  1T2X A;  2HWF 3;  4AVB A;  4QGM A;  2BW8 A;  2VUL A;  2RJ2 A;  3JB8 A;  4QQP A;  1AYN 1;  3TN9 2;  5J96 B;  4AFB A;  3T0D A;  3MYX A;  1UOG A;  1ZZC A;  3N7K A;  3PHM A;  4H7M A;  5F5C A;  5JAX A;  1RUG 2;  3AC0 A;  4XZU G;  2R07 1;  3B69 A;  4BLJ A;  3UYJ A;  1NCR A;  1W39 A;  3OD4 A;  4JHZ A;  5BNN B;  4UXA A;  3I3M A;  2KA3 A;  5GLV A;  3VKF C;  2Y26 A;  4AG4 A;  1ND2 B;  5FZO A;  3PME A;  2H0V A;  1HB2 A;  4B4R A;  3NW4 A;  2ZS6 B;  1F4H A;  1FPN 3;  5E16 A;  5GLU A;  1NOV A;  4IV3 B;  3JQX A;  1UYZ A;  3NNG A;  3V0A B;  3OEA A;  1NCQ B;  4LO7 A;  4JGY C;  3VBH C;  2UYB A;  1AL2 1;  1HKD A;  3MDP A;  4LBL A;  4BPZ A;  2BNN A;  2Y0O A;  1PGL 2;  1RUI 3;  3C7G A;  3KGZ A;  3IDB B;  3JU9 A;  3OPZ A;  5K0U C;  3O1S A;  3KWV A;  1R08 2;  3QH7 A;  5FJH A;  1JUH A;  1PNG A;  3W9A A;  4S2H A;  3QOP A;  1EUU A;  4M4R A;  4DY3 A;  4R9C A;  1TQ5 A;  2VVF A;  1AR7 1;  4ISR A;  4QX3 A;  3AXE A;  4YVS B;  2CGN A;  1OLQ A;  2ZX0 A;  2R49 A;  4KMQ A;  1WA4 A;  2J1V A;  3KCC A;  4XFB A;  1WBF A;  5FZ6 A;  3U0Z A;  1ZRD A;  1HW5 A;  1GOH A;  5LZ6 A;  4DEQ A;  2YGL A;  1HB3 A;  1PM7 A;  4D94 A;  2JDZ A;  1HXS 1;  1V9U 3;  2RHP A;  2JJ6 A;  4M4P A;  4ET7 A;  3OUH A;  5BYN A;  1C8M 1;  4FFI A;  4LBK A;  1DGW X;  1VBE 2;  3GJB A;  1TNR A;  2RG4 A;  4WZC A;  2ZGR A;  2PXJ A;  5ANQ A;  4YW4 A;  2YU1 A;  1C28 A;  4LKD A;  2HWD 2;  3U10 A;  1PVX A;  3GHM A;  2WZR 3;  3H0O A;  5JMO A;  4M3C B;  3M70 A;  3BPZ A;  4Q0S A;  3KF5 A;  5CFC B;  5DPN A;  4LR4 A;  3K48 A;  4ZXE A;  1HV1 A;  1WW7 A;  1YFU A;  4PLN A;  4LMF A;  2FDK A;  1EAH 2;  3I2D A;  4YGB A;  3DYM A;  3POW A;  1AF9 A;  4OYU A;  3RZH A;  4G3Y C;  1EV1 2;  3MLJ A;  4LO6 B;  2ZOE B;  5JOW A;  2V4V A;  2RR1 3;  2XOM A;  4HL0 A;  3ZYI B;  3R4S A;  3WEZ A;  4FTB A;  3ZO0 B;  2XWJ B;  3VBR B;  2WFF 3;  5FKB A;  1SDD B;  1OD3 A;  2WNU B;  3AVS A;  5F7U A;  1Q8S A;  1YJK A;  2QQK A;  3C7H A;  4N53 A;  4J1X A;  4WVW A;  1UPI A;  5GJ6 A;  2DVD A;  3BVC A;  1T6G C;  1W0P A;  4LIU A;  1UCX A;  3LSE A;  2G19 A;  4GIQ A;  3KVB A;  3VZN A;  5JZG B;  5LA1 A;  2RJL A;  2QQO A;  4LE4 A;  1QJZ A;  5DXD A;  3RJR A;  4W4Z A;  5F8P A;  3WQ1 A;  2DVA A;  4QDS A;  1PO2 3;  1UIK A;  1VBA 1;  2XHN A;  4CDW C;  2OT7 A;  2WNV B;  2V73 A;  3LAG A;  5FR3 A;  5C4W A;  2C4X A;  5J36 A;  3VD3 A;  4EQV A;  4NOT A;  3W58 A;  4IE0 A;  3I2H A;  3PLQ A;  3KGL A;  4CPB D;  1H2M A;  1RC6 A;  3CQO A;  3WW3 A;  4HON A;  1CGP A;  4Z1V A;  2TUN A;  5C3S A;  3UKN A;  1IPS A;  1SLI A;  1US3 A;  2XVG A;  1RUE 1;  4OUE A;  3VBS B;  5FYC A;  3SNM A;  1OLM A;  3PJY A;  1VRH 1;  1XNA A;  5A3T A;  3N9N A;  1URX A;  3AMQ A;  1LHO A;  4MSV A;  1XNK A;  2IZW A;  5CFD B;  4QGL A;  2NP0 A;  4NHX A;  1DQ1 A;  3ILN A;  1MVQ A;  4AF9 A;  3O1T A;  5JSR A;  1UX6 A;  4BB3 A;  1DBN A;  4FT8 A;  5FRA A;  3C3V A;  3LIG A;  3DCQ A;  1AZD A;  2P3Y A;  2C26 A;  4FFH A;  1OUX A;  4EN7 B;  4NWV A;  5EV7 A;  5BNQ A;  4UFM A;  3MIE A;  4XQW A;  3N7J A;  5IVJ A;  3J7H A;  2BGP A;  3TEX A;  4XVH A;  4X8P A;  1EY2 A;  1O7F A;  4Q4V 2;  5BNO A;  4GJZ A;  4QGN A;  3BN6 A;  5C8C C;  3SH3 A;  2BZD A;  4QD2 A;  5FZE A;  4YW6 A;  4BQY A;  2VM9 A;  1COV 2;  4PI0 A;  4ES8 A;  4HLT A;  2W95 A;  5IVV A;  2A1X A;  2DUQ A;  1QOT A;  2PQQ A;  3MW2 A;  5ERL A;  4FPK A;  4MH0 E;  4R9B A;  5A3P A;  2XJQ A;  3IKW A;  5F3G A;  1GP6 A;  5LBC A;  1GZW A;  3T2Q A;  5J09 A;  1LOF A;  2VXR A;  5FPB A;  2GAU A;  3I59 B;  3JD7 1;  5IVE A;  3PVO A;  3W5N A;  3CF6 E;  5JOY A;  4FBF A;  2PHW A;  4H55 A;  3ZN6 B;  2KXL A;  4XUT A;  3LPG A;  3JZV A;  2QVS B;  1CPM A;  2IXK A;  4IEU A;  4IDZ A;  4LUK A;  4QQO A;  4UFI A;  5IK4 A;  3GCW A;  4LO8 A;  3TOJ A;  3KLS A;  1SLB A;  1RUH 3;  2R6Q A;  2DYC A;  5DN2 A;  3WF0 A;  1RUD 3;  1US2 A;  2R0H A;  2ZML A;  4N7I A;  4WVV A;  3AZV A;  5GKA C;  5LWB A;  4FPH A;  3HT1 A;  4XXA A;  1ALY A;  1LU2 A;  2VQA A;  2JG9 B;  2AUY A;  4RGG A;  5L36 A;  1RIR A;  5I0S A;  1DZQ A;  2ZZQ A;  3NAP C;  3CLP A;  5DDJ 3;  1CX1 A;  2W94 A;  5B4N A;  1WCQ A;  3AYA A;  2WN2 A;  5DUV A;  5A33 B;  3VBO B;  1JMU B;  2BVV A;  3H7J A;  4RR3 C;  4CDX B;  1KS4 A;  1FPN 2;  3VBF A;  2PYT A;  4N43 B;  4YG3 A;  3ZFG C;  1GUI A;  2WWS A;  3C8X A;  4BZ4 A;  5FZ1 A;  4CE8 A;  4W6Y A;  1GBG A;  1A8D A;  2VQ0 A;  2JIC A;  4QPG A;  2PTM A;  3FL7 A;  4PHZ A;  4PDW C;  1ENR A;  3I2J A;  4BQ1 A;  4RHV 3;  3WW2 A;  4AAX A;  3X29 B;  3HPN A;  4WM8 C;  3ETP A;  5FZ3 A;  5BNP A;  4GJY A;  1ODN A;  1XOY A;  3ACL A;  1YYN A;  3HT2 A;  1AR7 2;  3ZVX A;  4UW6 A;  1X82 A;  4NHY A;  4O9G A;  5DMY A;  1W28 A;  1V6M A;  1VAL A;  5FRE A;  5I93 A;  4UFH A;  3AMP A;  1XSR A;  4GAL A;  1OH4 A;  4UW4 A;  3V0B A;  1LHV A;  2D6O X;  4Q4Y 1;  4AQ2 A;  1LGB A;  2RM2 1;  5IJR A;  1U0A A;  4BLI A;  4IW3 A;  4Q1R A;  3UV9 A;  4ZHN A;  2Y33 A;  2E32 A;  2LRO A;  3VKO A;  1WUV A;  5I0U A;  2VZU A;  3ZFG A;  5L7O B;  3GCX A;  2ZHN A;  1UOJ A;  3J7L A;  1UY0 A;  2VR4 A;  2VPV A;  2JG8 A;  4C1W A;  2E53 A;  1N3P A;  4Z2W A;  2X5I B;  3AKT A;  3NST A;  1O5U A;  2FMD A;  1FOD 3;  1IG0 A;  3LA3 A;  3JQW A;  1ZZ9 A;  3EHK A;  3KV9 A;  1YC6 1;  4JV4 A;  1SEF A;  2NMO A;  2B9V A;  1UXX X;  2C24 A;  3ASI A;  2HBT A;  4IER A;  1XYN A;  4KQ7 A;  1PVC 3;  4MXV A;  3OGV A;  3VLB B;  3N9L A;  3ACI A;  5ANN A;  3L2H A;  2PHF A;  2VOW A;  1KDK A;  2YPD A;  3OG2 A;  3O5S A;  4QX5 A;  3THT A;  3O1U A;  2X29 A;  2QZ3 A;  2XPJ A;  4LIT A;  5F6L B;  1QH7 A;  5CG8 A;  4BH9 A;  2K46 A;  3LEM A;  5A3M A;  3MUZ 1;  3VZO A;  4QB1 A;  1PX4 A;  1ULC A;  3CEW A;  4NMI A;  4CDQ B;  2VMF A;  3IAQ A;  2VOV A;  4DIN B;  4W6W A;  3VZJ A;  2YUE A;  1OD5 A;  1FAY A;  1RMU 3;  1XPW A;  1Z0H A;  2B45 X;  3E97 A;  3MEP A;  1WCU A;  2XJR A;  3B3Q E;  1GMM A;  3D0S A;  4RQP C;  5EIY B;  4QKD A;  1DFQ A;  2PHR A;  2XJU A;  4TTG A;  2X09 A;  1LRH A;  2VZV A;  3ZM8 A;  4XUR A;  4DMI A;  2B42 B;  1DZR A;  4F3J A;  2RS3 1;  1MS8 A;  2VZQ A;  3MLL A;  3J8F 1;  2RMU 1;  2EAA A;  4QHZ A;  2XJS A;  1SHW B;  2YY1 A;  4EE2 A;  2BOI A;  1VAM A;  4K21 A;  2VBP A;  3WW1 A;  3PTR B;  1PO2 2;  4MXW B;  4ZKT B;  3S6P A;  5CG9 A;  4CEY C;  4BIF A;  4ZS2 A;  5FYS A;  5LK5 A;  1AUY A;  5ISL A;  1PX3 A;  1N47 A;  4NJ4 A;  4H7L A;  5BNN C;  4HK9 A;  3NJY A;  4OI4 A;  4EWA A;  1FMD 2;  4J6G A;  4XXP A;  1W9F A;  1N1S A;  1H8T B;  1ND2 C;  2OPK A;  3III A;  5FPV A;  3WY6 A;  1OC1 A;  1PGW 2;  1XJA A;  2WNO A;  4CU7 A;  3O1P A;  4CCE A;  2BYV E;  4PQ9 A;  1HRV 1;  3BGA A;  4LHK A;  5A1L A;  1STM A;  1NCQ C;  2IUW A;  1PMI A;  3VKN A;  1HRI 1;  2ZEZ A;  2VCA A;  1YNA A;  1VLN A;  2JX9 A;  2B5H A;  2BEO A;  3B00 A;  3E5Q A;  3K4A A;  2C9K A;  4D69 A;  5C8W A;  2PLV 2;  4QDR A;  1H1A A;  1W6P A;  4HT1 T;  3GZA A;  4LUM A;  3VZM A;  1UIJ A;  2QQJ A;  3AZZ A;  1ZZB A;  2C9A A;  4CZS A;  2JD9 A;  1ZZ7 A;  2WWJ A;  3ETQ A;  2ARA A;  1WLW A;  2YBK A;  1XNC A;  4HKW A;  2J1E A;  2YMZ A;  4IEX A;  1OQD A;  4U36 A;  2XQX A;  5FBJ A;  4AED A;  1JH5 A;  3E1F 1;  3N9M A;  2VUJ A;  2W1Q A;  4S2G A;  3JD7 2;  4ASL A;  3PMS A;  1K5J A;  2YRO A;  4LT5 A;  1NAE A;  4ZS3 A;  1CAX A;  1Y43 B;  2BUK A;  1W6O B;  2CL2 A;  3OPW A;  4JC1 A;  5GZF A;  3UK9 A;  5EZW A;  3P3N A;  1NXD 1;  2OQ7 A;  3HWJ A;  3ME2 A;  4JKK A;  5FZC A;  3RZL A;  1SBF A;  1YIF A;  1GU3 A;  4AQ6 A;  4EWD A;  1LU1 A;  3M7A A;  3ZYG A;  3RGB A;  3ZSK A;  5JIU A;  4CCL A;  3ZXJ A;  1RHI 3;  2JDK A;  2DUP A;  4P9I A;  3HBK A;  4QPW A;  3ZSJ A;  4DNY A;  5FXX A;  4TSV A;  4XIO A;  1CWP A;  3FBY A;  3BTY A;  4QKB A;  3G7D A;  2X05 A;  3MIF A;  4QXB A;  3T08 A;  4IV1 A;  4P9Y A;  5DDJ 2;  1AL0 G;  3KV4 A;  1RVF 3;  2UYA A;  1IKQ A;  3NNM A;  1QDO A;  4WZF A;  3THC A;  3SKV A;  1O6U A;  5A6X A;  1OKQ A;  4IL7 A;  5FZA A;  1CX4 A;  3KM5 A;  4QXH A;  5GZE A;  2JIG A;  4E27 A;  2OQ6 A;  2YC0 A;  2P6C A;  4E8D A;  3FFQ A;  3HR9 A;  1PGS A;  4MV2 A;  4JGY B;  4LLO A;  1DQ2 A;  3ZKU A;  3ZFE A;  2A6W A;  4P9X A;  2FZ1 A;  4FFG A;  5F5I A;  2GME A;  4CCK A;  3Q8B A;  4COW A;  3AP4 A;  3E5U A;  5F2S A;  5JLV A;  4MLO A;  4XOG A;  2R04 1;  2A6X A;  1AYM 1;  2Q8O A;  2BP6 A;  3JCI A;  1GAN A;  5K0U B;  3IWZ A;  1DIW A;  2Y8K A;  5LB6 A;  4YM2 A;  3EQE A;  5IWF A;  5ACA 2;  1PIV 3;  4XC9 A;  1VBB 3;  4ZU4 A;  2CAU A;  1E5S A;  2BBV A;  5FZI A;  1O3S A;  4FP3 A;  4GWI A;  4MG2 A;  4XMI A;  2XLF A;  1SQ4 A;  2CY6 A;  2GNB A;  2VAU A;  1ULO A;  2QQP A;  4QKN A;  3RPQ A;  3VBS C;  1OVS A;  3POB A;  2ZJC A;  4QHB A;  4KG8 A;  4GMP 3;  4XF1 A;  4Y20 B;  1NZC A;  1S2K A;  4UWD A;  3ACH A;  5CFD C;  1RJ8 A;  4LBQ A;  2ENR A;  4K20 A;  5FP8 A;  1NQD A;  4BQ4 A;  4Q5O A;  2G9F A;  3JB4 C;  1JYN A;  2A7A A;  3AKS A;  3MI8 A;  2OII A;  4MGY E;  1IQA A;  1LED A;  1YUD A;  3AL6 A;  3ZYP A;  3K2O A;  3GJA A;  2VVE A;  1S4C A;  4XCB A;  2E9Q A;  1VAV A;  3DXT A;  1OMI A;  1Q56 A;  4C90 A;  3CJX A;  3CZU A;  1VBC 3;  3NV3 A;  5E89 A;  3NJV A;  3WG1 A;  2WLP A;  1W0N A;  1RUJ 1;  1GP5 A;  5FY9 A;  3AXD A;  2VNR A;  1P8J A;  2BVB A;  2WT1 A;  3KHC A;  1W3X A;  4OI2 A;  2XVK A;  3WXP A;  2NM1 A;  5IAT A;  1QQP 3;  3LSD A;  3OBT A;  5FP7 A;  1ZRR A;  3BTX A;  1JU4 A;  3MBW A;  3H8U A;  4ZU5 A;  4W50 A;  4YFZ A;  4DIQ A;  3N3H A;  2Y6G A;  3RG0 A;  3T09 A;  4YZ4 A;  1AR8 1;  3T0B A;  5KXE A;  4OCT A;  5FYV A;  1LKN A;  2W9X A;  1CD3 G;  2DBI A;  3RZM A;  3NMB A;  4AI8 A;  4L97 A;  1YFW A;  1JZ7 A;  2Q1M A;  4CDW B;  3T2P A;  5HCB A;  2VL4 A;  1V70 A;  2AH2 A;  2RDR A;  1JYW A;  2HWE 1;  1RUG 3;  1YIP A;  1RL3 A;  2P17 A;  4P9J A;  1JBC A;  1SLC A;  2D97 A;  2JDY A;  2WYS A;  3GM8 A;  3OB8 A;  3BPS A;  4D6Q A;  5JXH A;  4LKE A;  3M1H A;  2GMP A;  1JN2 P;  2JDU A;  1O4Y A;  2HWC 1;  2QKD A;  3SHR A;  2L9L A;  1LJ7 A;  4N43 C;  2W87 A;  2DU1 A;  1K45 A;  3B9C A;  4HG6 B;  1UX7 A;  1W6N B;  3H1M A;  5JR7 B;  5JOX A;  3QBQ A;  4CCD A;  5CEH A;  3KS7 A;  2D98 A;  1HJG A;  1RUF 2;  2PHU A;  1IKP A;  2WT2 A;  3AMM A;  1DF0 A;  2VXJ A;  4DFS A;  4I0W B;  2P37 A;  2K0G A;  4MZU A;  4D0Q A;  3PIJ A;  4QQ2 A;  1G9B A;  2ARC A;  2DF7 A;  1VMF A;  3NO8 A;  2G4I A;  1ZX5 A;  1R08 3;  5AC9 2;  1C3H A;  2DCJ A;  1XYP A;  2OXB A;  3OBZ A;  4Y1X A;  2JEC A;  1BJQ A;  1S55 A;  4GWM A;  1YI9 A;  1DGR A;  2R1D A;  5C8C B;  2YFZ A;  4RL7 A;  4EJR A;  1DLL A;  5EHD A;  1AR9 2;  2N7G A;  5LRS A;  4Y1U A;  1QJU 2;  2IVI B;  5LCW L;  3SEP A;  5L7O C;  2HYK A;  1DQ6 A;  3R4U A;  1FNY A;  4CU8 A;  5FQ0 A;  5EYX A;  2G9Z A;  5FLI A;  2JDM A;  4OVE A;  4FTE A;  3ZR5 A;  3NV1 A;  1V6L A;  2GH8 A;  4E2S A;  1VBE 3;  3N9Q A;  2DFC A;  5K8S A;  5FIX A;  3OGJ A;  5KXC A;  1RHI 2;  3TB0 A;  1YCI A;  3JXS A;  3IPV A;  1CES A;  2HWD 3;  4XF0 A;  5JPN B;  4RSU A;  4E4S A;  4YWA A;  1XNT A;  4LHL A;  3ZXA C;  1O3T A;  4LK7 A;  4X6Q B;  3OGS A;  3FWE A;  3WR0 A;  4XUN A;  1IPJ A;  3S57 A;  2FZ2 A;  4ARX A;  2E6V A;  1WD3 A;  3NAP B;  1AHS A;  2P5B A;  2RV9 A;  1Z78 A;  2JEN A;  4JRL A;  5FLH A;  3C2U A;  4CDQ C;  1CAW B;  5HV0 A;  1EV1 3;  1CAU B;  2ZGN A;  1H0B A;  2ET7 A;  4XIK A;  4CCN A;  1XNB A;  2FBE A;  1AJO A;  3MW4 A;  3ZFG B;  4FCA A;  4QPI A;  1DCS A;  1NG0 A;  2XBO 1;  1ONA A;  2QQI A;  5JWP A;  1UO9 A;  2WA4 A;  3MO4 A;  4XFG A;  1LAJ A;  2YB7 A;  1AYM 2;  3IT8 A;  3U4S A;  4PDW B;  3DYP A;  1O3R A;  3THD A;  4COU A;  4WM8 B;  4OUS A;  1POV 0;  5F5A A;  5J1X A;  2A75 A;  5FO9 B;  1CZT A;  2RJK A;  3I8T A;  4HMZ A;  4ATF A;  4XAC A;  4ISQ A;  5DQ0 A;  5F3E A;  4Q0V A;  5E1R A;  1VRB A;  5G04 L;  1PIV 2;  3WQB A;  4B4P A;  3CU7 A;  4FQZ A;  2XQR A;  3WG4 A;  1Z7S 1;  4MUV A;  3AP6 A;  4IEP A;  1ZNP A;  1R1Z A;  3F95 A;  4YW1 A;  5LW9 A;  5FK7 A;  4XUQ A;  4M3C F;  2EXI A;  2Z2S B;  4LA2 A;  2F4P A;  3U1X A;  1CIY A;  1UYY A;  4K7J A;  2O8Q A;  5C7G A;  2W47 A;  2B8M A;  5I0T A;  4UFL A;  1PMJ X;  3ZN4 A;  4AFD A;  5A3W A;  4K1Y A;  1DYP A;  1E57 A;  1CZV A;  1W8F A;  3H9A A;  4S2D A;  2BGC A;  4A42 A;  1LHW A;  4Q4W 3;  4Z8B A;  5IUQ A;  1BEV 1;  4XDQ A;  4XF3 A;  2TEP A;  1BLZ A;  4BQ5 A;  2P3J A;  2P2K A;  2D5H A;  2WO7 A;  5FZ7 A;  1LNS A;  1Q8P A;  3OY8 B;  4AWD A;  2G9G A;  1R64 A;  4D3W A;  3RZG A;  3ZSM A;  4GUL A;  1JZ5 A;  3CKH A;  1UWW A;  2R1B A;  2VMD A;  4AI1 A;  4IND A;  1PO1 1;  4TLF A;  4AGR A;  4I02 A;  5FZM A;  2JDH A;  2QJV A;  1K5M A;  1JZ6 A;  3UGG A;  4QB6 A;  5HBA A;  4DUX A;  4ERO A;  1NCR C;  1XSQ A;  1XBF A;  2FHR A;  4LOS A;  4QX2 A;  5FYY A;  3BI3 A;  5APA A;  3UGH A;  1UQX A;  2QQV A;  1R09 1;  1COV 3;  3KQ4 B;  1BZW A;  2WSU A;  1I6X A;  3VDD A;  4IES A;  2RS1 2;  4RQP B;  5FDB A;  3J7N A;  3S7E A;  3DPR A;  2B9U A;  4JRA A;  2ADE A;  3ZDS A;  3V65 A;  3IAP A;  3IM0 A;  3MID A;  4I0B A;  4HKO A;  3VL8 A;  4XEZ A;  2ZMN A;  1ULF A;  2AC1 A;  1AYN 3;  3KV6 A;  1UYX A;  3RVH A;  5C70 A;  5DAX A;  3VDC A;  5D1I A;  3VGI A;  2W91 A;  3I7D A;  1W6P B;  4OFG A;  5FPL A;  5C3O A;  2Z4F A;  1JYT A;  4IEY A;  1Q8Q A;  2WS9 1;  4QX1 A;  1G7Y A;  2P6H A;  2WLQ A;  4LUL A;  4CEY B;  3PU8 A;  5FY5 A;  5KHI A;  1F15 A;  2E7A A;  5A1A A;  2GN7 A;  3VBU A;  3UES A;  2HWC 2;  3OGR A;  4XHX A;  5FPU A;  4AVV A;  2BRT A;  3VD9 A;  3FHA A;  3QAC A;  1T6B X;  2F4L A;  1SFY A;  4XTM A;  1NE6 A;  4YM3 A;  1W8T A;  4MAD A;  2J1A A;  4CUG A;  1AXZ A;  5JSP A;  2A6Y A;  4PT6 A;  4OMC A;  1OF3 A;  1XQN A;  1OUR A;  2B46 X;  1KFX L;  1C1L A;  2YPJ A;  4CXW A;  1O59 A;  1OOP C;  4BIO A;  4CEW A;  3IIA A;  4XAB A;  1N1Y A;  1SBD A;  4UF0 A;  1ZRF A;  2GU9 A;  2E7T A;  3VD4 A;  4XDP A;  2OS2 A;  2HWF 1;  3LDB A;  1ENX A;  2BFU S;  1G6N A;  1GNH A;  1GQG A;  1SCR A;  2XHK A;  3MIG A;  4JZR A;  3USU B;  4AI3 A;  1HN1 A;  1GKB A;  3HEI A;  1AR7 3;  4X8N A;  1Q3E A;  4FPG A;  4O7X A;  4CPB A;  2EXJ A;  2WA3 A;  2A3Y A;  2C0Z A;  4IV1 B;  4LOT A;  2ZTN A;  4BK4 A;  5C3P A;  1AVB A;  2JKX A;  4NN0 A;  2MNG A;  5LBE A;  2XXZ A;  5DUU A;  1K3I A;  1ND3 A;  4YYO A;  1QGL A;  1XU2 A;  3N4M A;  2ZAB A;  1C8M 3;  1PM4 A;  2BGO A;  3M3E A;  5A3O A;  4R8H A;  3MFC A;  5F5Q A;  1QIQ A;  1PNF A;  3LZZ A;  4BU2 A;  1QJF A;  2QTW B;  3D82 A;  1OOP A;  2BU9 A;  3IDE A;  4N53 C;  4QX0 A;  3VZK A;  5A3L A;  1MZ5 A;  5FWJ A;  3U11 A;  1GOF A;  1WA6 X;  5LBB A;  4CP2 A;  4Q4V 3;  2W68 A;  2WR9 A;  2WZE A;  3WLU A;  4EN8 B;  3GBG A;  1UD1 A;  5C3R A;  5LBF A;  1MS5 A;  1SDW A;  2ZEW A;  5A7N A;  1EP0 A;  4LXL A;  1J1L A;  3LA2 A;  3I2F A;  5C4W C;  4B1L A;  2FDG A;  2VGD A;  3VKL A;  4AEM A;  3H3L A;  5IFT A;  5CB7 A;  2D6N A;  3LDK A;  2J1T A;  4TLG A;  5DUX A;  3H50 A;  3KCX A;  3LDR A;  1V9U 1;  2GND A;  2LAL A;  3HJR A;  5B4X A;  5T5P A;  1SCS A;  2QUO A;  1APN A;  1A8M A;  3NRU A;  4FPF A;  4MX3 A;  1KJR A;  1OKO A;  1QXP A;  2YC2 A;  3EXU A;  4G9S B;  3GZE A;  5TSW A;  5A6Z A;  1X36 A;  3NWK A;  4TN7 A;  3M2M A;  4YVW A;  5A6Q A;  2WAA A;  2WZR 1;  4NRP A;  3TWI A;  4FOV A;  4HVO A;  1OF4 A;  1Z7S 2;  2O14 A;  4QWN A;  2ZHK A;  5FO7 B;  2D3P A;  3E6D A;  1QJX 2;  3EYP A;  3ZLI A;  2R7E B;  5IVB A;  1XYO A;  3WDY A;  4NAO A;  4XDO A;  2BDR A;  1RUC 2;  5G05 L;  1U12 A;  2J1U A;  3CO2 A;  4NHM A;  5GZG A;  4K3U A;  5BNO C;  1SPP B;  4NWW A;  1WGP A;  1RUE 3;  2RR1 1;  2DVG A;  1LEM A;  2FMY A;  2GP5 A;  4FP2 A;  2RDS A;  1FMD 3;  3ABZ A;  1J3R A;  1C5H A;  1BMV 2;  1BEV 2;  2WFF 1;  2XL7 A;  4MGK E;  1BYH A;  4KH9 A;  4PBP A;  4Q4W 2;  2ZGQ A;  4Q8L A;  3CMG A;  5GM0 A;  4L99 A;  3WX5 A;  3ZPO A;  2W1S A;  3MGU A;  2UWA A;  1LOF C;  2O8O A;  1JYX A;  5E88 A;  5FUI A;  2R06 1;  4K8F A;  2GAL A;  2WNE A;  2ZAC A;  2UWB A;  4FXG B;  4BJ0 A;  3BUC A;  5JIA A;  3SH5 A;  2XB6 C;  3MPP G;  4Y22 B;  4CU6 A;  4UFK A;  2UY8 A;  4YZ5 A;  1S2E A;  2PLV 3;  2ZZJ A;  3E5X A;  4RYD A;  4CP9 B;  1HX6 A;  3I4I A;  4P9L A;  2ARE A;  4L2N A;  3M3Q A;  1CAV A;  1OI6 A;  3OSD A;  2GZW A;  3MIC A;  4QAW A;  3WNK A;  4Z82 A;  4JX0 A;  2QBX A;  4Q0P A;  3H3Z A;  2R32 A;  2V5Y A;  4NE9 A;  4HOO A;  2RS5 1;  1MEC 2;  3APB A;  5FZ8 A;  3SKJ E;  3UKV A;  3K3N A;  4BM8 A;  1ZBA 1;  3OD0 A;  4IET A;  4Y33 A;  1UXZ A;  1FT9 A;  3KQR A;  5CU1 A;  5FP4 A;  2AZ5 A;  2RDQ A;  4LE3 A;  1F31 A;  4MVT A;  3JD7 3;  4OLL A;  4GH4 A;  3VBF C;  1U5X A;  2BWA A;  3A7Q A;  1W8N A;  1S0G A;  2AEN A;  3DN7 A;  2ILM A;  1UMH A;  2OVU A;  4Z07 A;  4P9W A;  5FMO S;  3T30 A;  1F9K A;  2PHT A;  4Q26 A;  4QPG C;  4NRO A;  5AFB A;  4DRR A;  3GZU C;  5A7Q A;  1AYN 2;  3HQX A;  1S1A A;  4CCO A;  2GC1 A;  4XQ4 A;  5ABJ A;  4A6S A;  3DKW A;  5BNP C;  4W8J A;  2R07 2;  5HXV A;  2VNV A;  4UW3 A;  2XDV A;  3TNP B;  3AYD A;  1XB9 A;  3ZXL A;  1CN1 A;  1DGL A;  4DUW A;  4HPK B;  4R52 A;  3ITQ A;  3PJQ A;  4XF9 A;  3D0J A;  5DAP A;  3V64 A;  4E2G A;  3H7Y A;  4AEJ A;  5CA6 A;  3NVC A;  1UU5 A;  2BOJ A;  5HPO A;  1MQT A;  1W6Q B;  1WME A;  3WDX A;  2W39 A;  4BQW A;  5C9A C;  3U75 A;  5EWS A;  3W21 A;  3VDA A;  3PTY A;  2AEZ A;  4BME A;  4QPY A;  4Q27 A;  4JQR A;  2R16 A;  2QQM A;  1AL2 2;  3IMM A;  3K4D A;  5KWR A;  1UZV A;  5JVV A;  4AOC A;  2JG8 C;  3E6C C;  1DU3 D;  1NX9 A;  4XJU A;  2JE7 A;  3ZFF A;  1WW5 A;  1W3V A;  4M3C E;  2ZAA A;  4DRV A;  5D8A A;  4GB3 1;  2OUH A;  4SLI A;  1RUD 1;  3NNJ A;  1W8U A;  1NY7 1;  3RI9 A;  3RZJ A;  3V56 A;  1UY2 A;  3WDW A;  1ENQ A;  2Y6J A;  1MS0 A;  1UY1 A;  1H4G A;  3JBG 1;  5CBL A;  2VZS A;  1YXW A;  5HI0 A;  3OJB A;  2Y60 A;  4K40 A;  4O65 A;  3TEY A;  3AP5 A;  4XBQ A;  5ACA 3;  1QEX A;  1BXH A;  1W9W A;  2EXK A;  1VBD 1;  3LQC A;  4C0B A;  5JMC A;  4CSW A;  1QJY 1;  1HXS 2;  2Y6K A;  5C9A A;  5L9V A;  3D3A A;  1C8M 2;  4XMA A;  4QM8 A;  1HQW A;  1MZ6 A;  4JHT A;  2OX0 A;  4P5H A;  2JWP A;  2CWS A;  4D7S A;  3G6J B;  2BNO A;  1B35 A;  2LW8 A;  2CGO A;  5C6C A;  3RRD A;  3HQR A;  4PQQ A;  1LOC A;  4RHV 1;  3N7M A;  5JI7 A;  3BIE A;  5FP3 A;  4Q0U A;  1UY3 A;  3BOD A;  1QOS A;  2D7F A;  2OZJ A;  4NVP A;  1MS3 A;  4BA6 A;  1GZT A;  3SIT A;  4MGT A;  4N9H A;  4Y4Y A;  2SLI A;  4OHW A;  1LUL A;  3LWC A;  4IE6 A;  4I01 A;  1ULG A;  3DV8 A;  3PU3 A;  2MEV 1;  1U5Z A;  4OQ8 A;  4MGI E;  4HN0 A;  1QOO A;  3AK0 A;  4IGO A;  5DZG A;  1NE4 A;  1LOD A;  1UOB A;  2RE9 A;  1FAT A;  1OPO A;  2MPF A;  3MF6 A;  4WVM B;  5I8S A;  3RZZ A;  1F5J A;  4RS5 A;  2QQL A;  2ZX2 A;  2OYZ A;  2E31 A;  2Q8C A;  3HNY M;  1PK6 C;  2CTV A;  2RMU 3;  4YFW A;  1BVP 1;  5FUN A;  1FOD 1;  2GNT A;  3ZXD A;  2J42 A;  2C5D A;  4YGE A;  2YBS A;  1PVC 1;  1VBA 2;  4XFA A;  5FLJ A;  2EIB A;  3OBR A;  4GZ9 A;  3OEB A;  2ES3 A;  3PVE A;  3AP9 A;  1L3J A;  2HEW F;  1TG7 A;  3POS A;  1LES A;  4IXL A;  3K3O A;  1YWK A;  4A44 A;  5B2G B;  1OA3 A;  1ZRC A;  1K5M B;  1E5R A;  1WLD A;  3I54 A;  2IXC A;  5FOB B;  3RWK X;  4AGG A;  2FCT A;  2E26 A;  4Q8K A;  1RUE 2;  1HLC A;  3VL9 A;  1KXG A;  4CUC A;  4J25 A;  4AED C;  2VU9 A;  4AXO A;  1UOF A;  1VRH 2;  3QLQ A;  2EF6 A;  1HRV 3;  1JYC A;  5FWE A;  2K2S A;  4AHW A;  4KBZ A;  2Z79 A;  1LHN A;  1UMZ A;  2R06 2;  4G4F A;  2BWC A;  1CQ9 A;  3VHR A;  3GDB A;  4YM1 A;  4AEK A;  3VZL A;  1PK6 A;  3DPR B;  4CDU A;  3UJQ A;  3J7M A;  4QMA A;  4FOQ A;  2EAK A;  4CA9 A;  4AVA A;  4KL1 A;  1EPZ A;  5FBZ A;  4ATE A;  1VPH A;  4OHX A;  2J22 A;  3PUA A;  2WQZ C;  4H2A A;  4QM9 A;  5JUV A;  1RUF 3;  2AYH A;  4WM7 A;  4BOW A;  1Y7B A;  1IPK A;  1W6M A;  4COV A;  3R4D B;  5KHG A;  3N36 A;  1GZC A;  3SCH A;  5KXD A;  2RS5 2;  4YG0 A;  1NYW A;  1ULE A;  4BK5 A;  1ZZ6 A;  3W5M A;  1ZBA 2;  3POF A;  4XTP A;  4ZPI A;  3J26 N;  3MIH A;  3O0V A;  5AC9 3;  4RGK A;  1NCR B;  4IV1 C;  2ZGK A;  4XUO A;  2WIN B;  5A32 A;  3A22 A;  1Y9Q A;  5C5U A;  2GH2 A;  4MO3 M;  2R0F A;  2D5F A;  5FZO B;  3I49 A;  1GR3 A;  3MZH A;  1AR9 3;  2D3R A;  4LBN A;  1SLT A;  2Q1Z B;  3OYW A;  4A7K A;  2K9Z A;  3CJI A;  1EYB A;  1YRZ A;  2YXS A;  5EJ3 A;  1QJU 3;  4X6R B;  1NLR A;  1W2O A;  5FZB A;  1Y9G A;  3SC7 X;  3GAL A;  1A3K A;  1UYP A;  1HJF A;  4DUV A;  3IBM A;  4NII A;  1Q5O A;  3FE5 A;  4QKF A;  3ZFE C;  1HQN A;  1V0A A;  2HYX A;  4KI5 M;  1H2N A;  4AI9 A;  4B4Q A;  3ELN A;  4LBO A;  3M3I A;  4GMP 0;  3B9I A;  3I2G A;  4LTA A;  3FUQ A;  5FPA A;  2SBA A;  3UGF A;  1XE0 A;  2A3W A;  1OFN A;  2Q0A A;  1YJL A;  3FJS A;  5CNA A;  4M00 A;  1CVN A;  4ZON A;  5BPX A;  1YI7 A;  1A78 A;  4D7T A;  2O1Q A;  4ONU A;  3SH4 A;  1R1A 1;  4CP1 A;  3H8X A;  1GV9 A;  1OHF A;  1WWY A;  4IV3 A;  2UU8 A;  3LA7 A;  2JB8 A;  5H9S A;  1OPM A;  3C7F A;  4R9A A;  3QH6 A;  3O0X A;  3OOX A;  5FZH A;  4Q4X 1;  2W5F A;  5FYH A;  2F17 A;  2JB4 A;  3Q8C A;  4PIZ A;  4BMB A;  4FPO B;  4GB3 2;  2DV9 A;  4BQX A;  1LOB A;  4Y4R A;  5F3I A;  3P6B A;  1OOP B;  2QZ2 A;  1LGN A;  4EZ4 A;  5FZG A;  5GLZ A;  2YZ4 A;  1MVE A;  1H1M A;  1DLC A;  1AYM 3;  2LUW A;  5CIR A;  3EMR A;  1J83 A;  1LOG A;  3MFA A;  1O4T A;  4XJ9 A;  1V6N A;  4L8Q A;  2F6B A;  1S0F A;  3AFG A;  1SAC A;  3RYR A;  1WMF A;  4Y26 A;  1ZBE 1;  1VBD 2;  4YVS A;  2E63 A;  3VN4 A;  1JZ3 A;  2W2I A;  3PL0 A;  4Q4Y 2;  2RM2 2;  1FXZ A;  4FPE A;  1JZ2 A;  4P9G A;  1RVF 1;  2VBB A;  3BU0 A;  1W06 A;  3MV0 1;  3O1R A;  4MGQ A;  3P3P A;  1JHN A;  2VOK A;  4LK6 A;  1GZ9 A;  1G9C A;  5C5T A;  2VH9 A;  3SIS A;  2A6Z A;  4AVS A;  2XR4 A;  3VD5 A;  1WW6 A;  4LBJ A;  4JCK A;  3RMY A;  3NV4 A;  1QWR A;  2Y64 A;  1CJP A;  4N53 B;  3DF0 A;  1TMF 1;  3DGT A;  3IDC B;  3LPF A;  4TYS A;  3T2O A;  4BXS V;  1W03 A;  5A6Y A;  5CFC A;  2FDJ A;  4V1P A;  1XE8 A;  3ZIW A;  2DCZ A;  2XWB B;  4KWU A;  1BBT 1;  3FC0 A;  2LM3 A;  2XJT A;  1UL9 A;  4HBN A;  4HFS A;  2WJS A;  1YQ5 A;  2ARX A;  1VBB 1;  2XG3 A;  3POI A;  5CZK A;  2VO5 A;  3QCW A;  4KBB A;  4EZH A;  2ZHL A;  2ZX1 A;  4JQT A;  4BDV B;  1H4H A;  5C4W B;  3I3Q A;  2OZ6 A;  1I5P A;  3VBR A;  4CRQ A;  3PIG A;  2IWG B;  1D0G A;  2WNU A;  2YU2 A;  1Q43 A;  4PIY A;  3URF A;  3VHO A;  4B29 A;  1BK0 A;  2QQW A;  2RDN A;  1NXM A;  4HKL A;  2PFW A;  2RS3 2;  5JDB A;  4AVC A;  3ZYH A;  3J8F 2;  4CXY A;  1TME 1;  2RMU 2;  4QQL A;  1EUT A;  3AJY A;  2W46 A;  5D2A A;  5JZG A;  1O8S A;  2RS1 3;  3RS6 A;  5T52 A;  3HAG A;  5FK8 A;  2YG0 A;  2YBP A;  2QFE A;  2ZHM A;  5FJK A;  1CJD A;  3MIB A;  5EPA A;  1OXC A;  1SFP A;  2V72 A;  3C7O A;  1LCL A;  2VE1 A;  2WNV A;  1W05 A;  4IEW A;  4NRM A;  1D2Q A;  4W6X A;  5IK5 A;  4IE7 A;  4OI1 A;  1EPW A;  2A71 A;  1ASJ 1;  3B94 A;  5FKC A;  2KR2 A;  5FTT C;  3T4H B;  2OUJ A;  3WIN E;  3KVA A;  1W9S A;  1VBC 1;  2KM2 A;  4BHP A;  3A0N A;  4XE9 A;  3WUC A;  1YQ8 A;  3HNM A;  3ZXE A;  5BNO B;  1I1E A;  3BKZ A;  1OQE A;  2HWC 3;  1HRV 2;  2GC3 A;  1SMV A;  3D6E A;  4PI2 A;  4ES9 A;  1ST8 A;  3KCY A;  2DU0 A;  4MGS A;  4PIX A;  5H9Q A;  1G9D A;  1HRI 2;  4MYE A;  3KZ4 C;  1C57 A;  1QQP 1;  2XUE A;  3DUI A;  4AI0 A;  4CXX A;  1DGW A;  3L2Y A;  1GWK A;  1GZW B;  2BTV C;  1JOP A;  1U5I A;  2DBN A;  2HWB 1;  3R0R A;  4LA3 A;  2G1M A;  5K4L A;  3WV6 A;  4FAH A;  2IXL A;  3THP A;  1D4M 1;  2A73 B;  3OUJ A;  3WNM A;  4DY5 A;  2J1R A;  1KS5 A;  2D43 A;  2D6P A;  4A45 A;  3POY A;  3IMN A;  4I0A A;  4QX8 A;  3RYK A;  3TN9 1;  1UZW A;  5A7O A;  5LY1 A;  2X10 A;  2WO2 A;  2ET1 A;  1RUG 1;  3HQU A;  4DXT A;  1Q8O A;  2VCB A;  2A5Z A;  1G9F A;  2BV4 A;  3K77 A;  1QU0 A;  3OGG A;  4P14 A;  5KHH A;  2VW2 A;  3WW4 A;  4F8A A;  2YC4 A;  3O14 A;  4C91 A;  2GN3 A;  5DAB A;  4AHX A;  4E2Q A;  1MZF A;  3I59 A;  2B39 A;  2P4E A;  2V5D A;  3DEC A;  3KSC A;  3UL2 A;  1YQ2 A;  2B7Y A;  3ZN6 A;  3E6B A;  3VBF B;  1X9P A;  4Z92 B;  4QPI C;  3J9S A;  2X8K A;  1W8O A;  3CNA A;  4L0P A;  1H9W A;  4QQH A;  3S30 A;  5DAW A;  4QPG B;  2R30 A;  3T0A A;  2JG9 A;  2YDE A;  4I3P A;  1UN1 A;  1B09 A;  5BNP B;  2ZGO A;  2CWM A;  2P34 A;  1NKG A;  5FZ0 A;  1LEN A;  1KGY A;  1R08 1;  1R1A 2;  1WMD A;  5EJ1 B;  5CYY A;  1O3Q A;  5A80 A;  3ST7 A;  2I2S A;  3OTF A;  4B7E A;  1OA4 A;  5A33 A;  1I5Z A;  4YW5 A;  3VBO A;  3I3E A;  3KD4 A;  3V0B B;  4LHS A;  2ZGL A;  3GHN A;  5C9A B;  2VD7 A;  1H6Y A;  2AEY A;  4CCM A;  1I9R A;  5A7W A;  4OMD A;  4XUP A;  1RGS A;  1VJ2 A;  3ILR A;  1JI6 A;  3T3Y A;  2VW1 A;  4S2F A;  3AMH A;  3PUS A;  2EVX A;  5FZK A;  2JG8 B;  4YGC A;  2J7M A;  4PLO A;  1HN0 A;  1VBE 1;  2DCK A;  2R04 2;  5FYB A;  1S0E A;  2NYY A;  2VBD A;  3WG3 A;  2HWD 1;  2WO1 A;  5T54 A;  5E6H A;  2PAM A;  4XYX A;  3ES4 A;  3HMY A;  2A6V A;  4URT A;  4E8C A;  1Z7S 3;  1K5M C;  4ORF A;  3CHX A;  1QJX 3;  1EAH 1;  4HAN A;  2ZGU A;  1RUC 3;  5A7S A;  2ATF A;  2Z42 A;  3CBN A;  2P3K A;  1OLM E;  5DUW A;  1AR6 1;  4XAA A;  3W20 A;  3P5B A;  2X5I A;  1F8V A;  1RXF A;  1TMF 2;  2VUD A;  3VDD C;  1BEV 3;  1ODM A;  3K51 A;  1RYY A;  3POG A;  4BXF A;  2LRP A;  4CUA A;  3OCP A;  3DPR C;  1DP0 A;  1BBT 2;  1N1V A;  1QHD A;  1NA1 C;  2VMG A;  5KR7 A;  1WMX A;  2Y34 A;  5I8Y A;  3VV1 A;  5JXG A;  5FY0 A;  5FZ9 A;  1JZ4 A;  2VZR A;  1AXY A;  1QJE A;  3WUD A;  3T4V A;  3KHB A;  1JHJ A;  2ZEY A;  2BFU L;  3WVJ A;  1CIW A;  5FMB A;  4DB5 A;  1V6K A;  1GYK A;  1RUJ 2;  3USS A;  1HDK A;  4O61 A;  4NIA A;  2IC1 A;  1BKZ A;  3VBU C;  1R09 3;  5J3U A;  1TME 2;  4AHZ A;  1IS3 A;  1M4W A;  1YQ6 A;  5A3U A;  3POE A;  2Q8E A;  1MEC 3;  4GQ7 A;  3MLK A;  3ZMN A;  3UT0 A;  3T1L A;  2DDU A;  1OQ1 A;  5LA2 A;  3SLI A;  4AW7 A;  2W08 A;  1PK6 B;  1QDC A;  1AR8 2;  3GYD A;  4KWJ A;  4CEW C;  1SFN A;  1NA1 A;  3FX3 A;  3WP4 A;  5I91 A;  4MXW A;  5IVC A;  4YSF A;  4AYU A;  1J59 A;  4PF5 A;  4M0N A;  3NV2 A;  5EJZ B;  1H9P A;  5FYU A;  1WCD J;  2WS9 3;  4YLZ A;  1W8Z A;  4FPL A;  5IAV A;  2D6M A;  2HWE 2;  2WKK A;  1UKR A;  1JYI A;  5FY8 A;  2R07 3;  3KF3 A;  1H8T A;  3EO6 A;  4OZO A;  3AZW A;  1ZRE A;  1FYU A;  3HD8 B;  1YFY A;  2PHX A;  4AED B;  1COV 1;  2CDP A;  1A34 A;  1ND3 C;  1RED A;  3WDT A;  3U37 A;  4HN1 A;  1RUO A;  1SLA A;  1POV 1;  3CJI B;  4NUB A;  4COZ A;  1CAX B;  1D4M 2;  3O7O A;  3UJO A;  4PJY A;  2VUA A;  4M0H A;  1AL2 3;  3BB6 A;  4QX7 A;  3AKP A;  1W8H A;  2WII B;  3WCR A;  2FCU A;  2W1W A;  1C5I A;  4MOA A;  1OH3 A;  1XXN A;  2D93 A;  1GLH A;  1XRU A;  4AK3 A;  2WN3 A;  4YM0 A;  1PHM A;  4YZ1 A;  3M4F A;  2UUR A;  1J1T A;  3AB0 A;  1KIT A;  1UZZ A;  1CPN A;  2Q8D A;  1UKG A;  4NR1 A;  1W8W A;  4NO4 A;  2NQY A;  3MF9 A;  4FTS A;  4RA0 A;  5A7P A;  4BQ3 A;  3NJX A;  4XJA A;  1QMJ A;  1W6O A;  3BTZ A;  1PZ9 A;  1NZI A;  2WFP A;  4WVZ A;  3ECQ A;  1GNZ A;  2NMN A;  4YZ3 A;  5I0D A;  1KDM A;  4NIG A;  1YHF A;  3IB3 A;  3IN9 A;  3KT4 A;  4Q1P A;  2YV8 A;  1HXS 3;  4DO0 A;  4AFC A;  1FPN 1;  2JXA A;  1REE A;  2DCY A;  2ADD A;  2BQP A;  1JW6 A;  1VMH A;  2FQP A;  2XLG A;  2J1S A;  3LE0 A;  4KWL A;  4ZXK A;  5FO8 B;  1S2B A;  2ID4 A;  4OUL A;  1WBL A;  4UYB A;  4NID A;  5FMC A;  1GNY A;  1Y4W A;  3LFI A;  4UI9 L;  4YVW C;  2PMW B;  2VME A;  3L9J T;  3Q8A A;  3P1I A;  3ZFE B;  1RUI 1;  1WLT A;  2VTX A;  4DQA A;  4Y1V A;  3EBR A;  4JGZ C;  1YFX A;  1YLL A; 
#chains in the Genus database with same CATH homology
 3LQC A;  4QDQ A;  4E8D A;  2Y6K A;  2ORX A;  3I3B A;  3D3A A;  4JKL A;  5JXJ A;  2LW8 A;  4PQQ A;  3NQH A;  2KD7 A;  1UY3 A;  2JDA A;  2VQT A;  2Y8K A;  1L7Q A;  2EID A;  3A23 A;  1WKY A;  2VMC A;  4GWI A;  1ULO A;  3LEK A;  3WNL A;  1SG3 A;  1KEX A;  2VQU A;  3ACH A;  3SEE A;  1W9T A;  2VOT A;  4ZZ5 A;  3VD7 A;  2QQL A;  2E31 A;  3HN3 A;  3HNY M;  1JYN A;  1GQP A;  4A41 A;  2WAO A;  3WF3 A;  3HOB A;  2Y6L A;  5LA0 A;  2W92 A;  2EIB A;  4GZ9 A;  3OEB A;  2Y6H A;  3CZU A;  1TG7 A;  2VC9 A;  3NJV A;  3WNP A;  1W0N A;  4A44 A;  2VZT A;  3FHQ A;  1P8J A;  2E26 A;  2ORZ A;  4LPL A;  4CUC A;  4P08 A;  3A21 A;  2VCC A;  3PUI A;  1JU4 A;  3LEG A;  3C7E A;  1CZS A;  3MBW A;  4W50 A;  2Y6G A;  3VDB A;  2VZP A;  3T09 A;  3GDB A;  3T0B A;  4YPJ A;  4RN5 A;  2W9X A;  4A6O A;  1JZ7 A;  3T2P A;  2VL4 A;  3PUH A;  2J22 A;  1JYW A;  5JUV A;  3MUY 1;  3GM8 A;  2WYS A;  3OB8 A;  4BK5 A;  5JXH A;  3W5M A;  5IHR A;  2QQN A;  1D7P M;  4IUG A;  1L7R A;  4ARY A;  2L9L A;  2E33 A;  4XUO A;  2W87 A;  1T2X A;  2W3J A;  1K45 A;  4HG6 B;  3A22 A;  1UX7 A;  3LEI A;  4MO3 M;  2RJ2 A;  3T0D A;  2VJX A;  4CU9 A;  3AC0 A;  4XZU G;  4JHZ A;  4D0Q A;  4ZY9 A;  4DUV A;  4AG4 A;  4QB2 A;  2HYX A;  4KI5 M;  2DCJ A;  4A4A A;  1F4H A;  3I2G A;  2YFZ A;  1UY4 A;  1UYZ A;  3NNG A;  3OEA A;  2VZ3 A;  5LCW L;  3SEP A;  3WF4 A;  4CU8 A;  3C7G A;  3C7F A;  2WUH A;  3CZJ A;  2W5F A;  1EUU A;  4M4R A;  3JXS A;  4QX3 A;  3P6B A;  1JYV A;  1XNT A;  4KMQ A;  2J1V A;  3K75 B;  1DLC A;  3OGS A;  3GGL A;  1GOH A;  4UOJ A;  4DEQ A;  1J83 A;  3WNO A;  4XUN A;  1MPX A;  4ARX A;  4M4P A;  4ET7 A;  2RV9 A;  5IFP A;  1JZ3 A;  4ZZ8 A;  1JZ2 A;  5JMO A;  3MV0 1;  4MGQ A;  3WF2 A;  5IYY A;  5JXI A;  2QQI A;  3MO4 A;  3ACF A;  5DPN A;  2YB7 A;  2XON A;  3OBA A;  1JU3 A;  3DYP A;  4ZXE A;  3THD A;  3VD5 A;  5J1X A;  1CZT A;  3DYM A;  2Y64 A;  4OYU A;  5DQ0 A;  3T2O A;  4BXS V;  3LPF A;  5G04 L;  2V4V A;  3WQB A;  2XOM A;  4A3Z A;  2PQS A;  4KWU A;  3WEZ A;  1BHG A;  1H6X A;  1SDD B;  1OD3 A;  4XUQ A;  5F7U A;  4D8M A;  2QQK A;  3C7H A;  1CIY A;  1UYY A;  5C7G A;  2W47 A;  5CZK A;  2VO5 A;  1PMJ X;  2BBA A;  1CZV A;  2ZXQ A;  4BDV B;  5LA1 A;  1I5P A;  2QQO A;  1IQD C;  4W4Z A;  4JKM A;  4QDS A;  2XHN A;  1PMH X;  1LNS A;  1EUT A;  2C4X A;  1R64 A;  2W46 A;  3VD3 A;  1O8S A;  1JZ5 A;  3CKH A;  1UWW A;  2VMD A;  3I2H A;  2YG0 A;  3CQO A;  1JZ6 A;  5JR2 A;  4OUE A;  1US3 A;  4QB6 A;  4DUX A;  2V72 A;  3C7O A;  4PF1 A;  1JZ8 A;  1OT5 A;  1XNA A;  4QX2 A;  1F4A A;  1UMI A;  1W9S A;  3HNM A;  3WSO A;  2BER A;  3IAP A;  2C26 A;  3I2I A;  2WAB A;  4MGS A;  3J7H A;  2BGP A;  1K12 A;  4DEV A;  5C70 A;  4XVH A;  1UYX A;  3VDC A;  2VZ1 A;  3BN6 A;  2W91 A;  2BZD A;  2Z4F A;  3FN9 A;  3WNN A;  1O8P A;  1K42 A;  2VM9 A;  4QX1 A;  3I2K A;  3WNM A;  2W95 A;  1XC6 A;  2J1R A;  5A1A A;  4A45 A;  3UES A;  3OGR A;  2ZEX A;  3T2Q A;  3VD9 A;  2X10 A;  3FHA A;  2WO2 A;  3I3D A;  3W5N A;  2WZ8 A;  4MAD A;  2J1A A;  4DXS A;  4DXT A;  4XUT A;  3LPG A;  4PT6 A;  1DYO A;  2VCB A;  4OMC A;  3K77 A;  5HXM A;  1OF3 A;  3WF0 A;  5DN2 A;  2YC4 A;  1US2 A;  1O59 A;  3CDZ B;  3DEC A;  2V5D A;  3VD4 A;  3CIH A;  1YQ2 A;  2B4K A;  3MV1 1;  1W8O A;  4L0P A;  1CX1 A;  2W94 A;  5B4N A;  1HN1 A;  1WCQ A;  3HEI A;  2WN2 A;  3T0A A;  4P00 B;  1GUI A;  2YFU A;  4BK4 A;  3C8X A;  1NKG A;  2JKX A;  1KGY A;  5EJ1 B;  1K3I A;  5CYY A;  3FL7 A;  4DXR A;  3I2J A;  3I3E A;  2BGO A;  4AAX A;  2EIC A;  3HPN A;  3ETP A;  4LHS A;  4CVU A;  4P5Y A;  1H6Y A;  1TVG A;  4QX0 A;  2VZO A;  3HNB M;  4OMD A;  1GOF A;  4XUP A;  2W1U A;  5DMY A;  1JI6 A;  1OH4 A;  2WZE A;  2J7M A;  2DCK A;  5IJR A;  2ZEW A;  2E32 A;  2WO1 A;  3I2F A;  1NUK A;  2VZU A;  1UY0 A;  5IFT A;  2VR4 A;  4E8C A;  4Z2A A;  2J1T A;  2LS6 A;  2WDB A;  5B4X A;  3HJR A;  2B9V A;  1UXX X;  3NRU A;  2WBK A;  3EB7 A;  1GOG A;  3OGV A;  2YC2 A;  3ACI A;  2WAA A;  3OG2 A;  1RYY A;  4CUA A;  1OF4 A;  1DP0 A;  3MUZ 1;  2VTF A;  4QB1 A;  1PX4 A;  3EYP A;  2R7E B;  2VMF A;  3IAQ A;  3F2Z A;  3GXU A;  4LQR A;  5JXG A;  5G05 L;  2J1U A;  1XPW A;  4A42 A;  1JZ4 A;  2VZR A;  1GMM A;  4TTG A;  5EIY B;  4FI9 A;  2X09 A;  2VZV A;  3ZM8 A;  1JHJ A;  2ZEY A;  3ABZ A;  4XUR A;  4CUB A;  2VZQ A;  2CDO A;  3UNP A;  1UZ0 A;  1SHW B;  3CMG A;  2W1S A;  1JYX A;  5C71 A;  5FUI A;  4BJ0 A;  1PX3 A;  3K4Z A;  2DDU A;  5LA2 A;  4CU6 A;  1J84 A;  2WO3 A;  1W99 A;  4RYD A;  3III A;  3DYO A;  5EJZ B;  3ACG A;  4CU7 A;  4QAW A;  2RVA A;  3WNK A;  3K46 A;  2QBX A;  4JX0 A;  3BGA A;  3SKJ E;  1UXZ A;  4OZO A;  3WF1 A;  2ZEZ A;  2VCA A;  3A7Q A;  1W8N A;  3K4A A;  2C9K A;  1UMH A;  4QDR A;  2CDP A;  2QQJ A;  2JD9 A;  3U37 A;  2J1E A;  4W8J A;  2XQX A;  2W1W A;  3E1F 1;  2JE8 A;  4MOA A;  2W1Q A;  4TXW A;  2WN3 A;  4DUW A;  2HLE A;  1NAE A;  3IDA A;  5HPO A;  3I97 A;  1ULP A;  4JKK A;  2OKX A;  3VDA A;  1GU3 A;  2QQM A;  3NJX A;  3K4D A;  5I0D A;  3ECQ A;  1NX9 A;  4QPW A;  3IB3 A;  4UAP A;  4P02 B;  3UET A;  4LKS A;  2X05 A;  3LE0 A;  2J1S A;  3T08 A;  2ID4 A;  1UY2 A;  1GNY A;  2Y6J A;  1UY1 A;  4UI9 L;  2VZS A;  2VME A;  2EIE A;  2WQ8 A;  3P1I A;  3SKV A;  3THC A;  4GWJ A;  1W9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...