2RVAA

Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
131
structure length
131
Chain Sequence
NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
molecule keywords Glucanase
total genus 9
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rvaA00
1LNSA 3C7EA 1PMJX 2Y6JA 2WQ8A 1GMMA 4DEVA 2QQNA 3LE0A 4MGSA 3CIHA 4TXWA 2DCJA 4XUQA 2RJ2A 3P6BA 3LPGA 3WNOA 4XVHA 3ACGA 4CUCA 1UX7A 5HXMA 1J83A 2B9VA 3WF0A 2YC2A 3C8XA 4W50A 1W9WA 4QB2A 3CZUA 5IFTA 1GU3A 3LEIA 2QQIA 2W9XA 4KI5M 3NRUA 2VMFA 3T0BA 4RN5A 2ZEYA 4W8JA 3HN3A 3LQCA 1EUTA 3WNLA 1OT5A 4GWJA 3MUY1 1OF3A 2J1UA 2VZVA 3C7GA 2C4XA 4KMQA 2YFZA 1CZTA 2EIEA 1RYYA 1UMIA 4P00B 2WN2A 3SEEA 3IAPA 2WZ8A 3P1IA 4ZZ8A 1L7QA 3IIIA 4XUTA 4QPWA 2W46A 3I2JA 3NNGA 1OH4A 3HOBA 2YB7A 4CVUA 5G05L 1UWWA 2WAAA 1DYOA 3IDAA 3HPNA 1PX3A 2WDBA 2ORZA 4DXSA 1US3A 2VR4A 4PQQA 4XUOA 3WEZA 3I3EA 2J7MA 2W5FA 3T2QA 2HYXA 3W5NA 5B4XA 4DEQA 2J1EA 2V72A 3THCA 2Y6LA 3E1F1 4DUWA 4D8MA 2JKXA 3I2IA 4QB6A 4GZ9A 4GWIA 3NQHA 4YPJA 3D3AA 4XUPA 4P5YA 1KGYA 2ZXQA 3CDZB 1JU4A 4A41A 4CUBA 3W5MA 2XOMA 2VZTA 3HJRA 1TG7A 2V5DA 2VZOA 1OD3A 4E8DA 3HNYM 3I2FA 3C7FA 2J1SA 3VD9A 3A7QA 3K4DA 3OGVA 4JKKA 3UETA 5IJRA 4P08A 3PUHA 5JXIA 2VL4A 2BERA 3VD3A 2BGOA 2J1TA 4P02B 4ZY9A 3WF1A 3C7OA 4QDRA 1JZ4A 1WKYA 5DMYA 3LPFA 1UY3A 3ACFA 3K4AA 1JU3A 2VZSA 5EIYB 1ULPA 3ECQA 4QX1A 2VCCA 3WNMA 4A4AA 4QB1A 3A21A 4QDSA 4Z2AA 2YG0A 3MV11 4DXTA 2HLEA 3THDA 3OG2A 4M4RA 5G04L 1US2A 3PUIA 1D7PM 2J1VA 3FL7A 3GDBA 2XQXA 1JYXA 3CZJA 3MV01 5LA2A 1JI6A 4DUVA 1GOGA 4ZXEA 3A22A 1W9SA 4ARYA 3K75B 1O59A 4JKLA 4DXRA 3WNPA 3C7HA 5LCWL 4CUAA 4CU6A 1W9TA 4RYDA 1UY4A 5JXGA 2WZEA 1IQDC 2OKXA 1XC6A 1P8JA 3A23A 3VDAA 1GUIA 2EICA 3CKHA 2X09A 1JZ6A 3UNPA 2J1RA 3NJVA 2X05A 4BDVB 1DP0A 2VQUA 5IFPA 1JYVA 1W8NA 2EIBA 3ZM8A 3BGAA 3I2HA 4JHZA 1JZ8A 1UY0A 3NJXA 2DCKA 5CYYA 3ABZA 3CQOA 1NAEA 2XHNA 4UOJA 5DQ0A 1SDDB 1PX4A 4PT6A 2QBXA 2Y64A 3OBAA 3T0DA 1JZ5A 3J7HA 2E33A 1R64A 1K3IA 2ZEWA 3WNKA 2VTFA 2W1WA 2ID4A 4UAPA 2WO3A 1UYXA 1K42A 3GGLA 1UMHA 4OMCA 4JX0A 4XZUG 2Y6KA 4UI9L 3WSOA 1I5PA 4AAXA 2QQLA 4KWUA 3VD5A 4DUXA 2VZRA 4TTGA 2E31A 1H6XA 1ULOA 1KEXA 5DN2A 2VZ3A 2CDOA 2C26A 5HPOA 3HNBM 2WBKA 2KD7A 5JR2A 1YQ2A 2VMCA 2W1SA 2C9KA 2RV9A 3FHAA 3HEIA 2J22A 2VO5A 1JZ3A 2VCBA 1NX9A 2WUHA 1UYZA 1W99A 2JD9A 4MGQA 2B4KA 3I97A 3IAQA 4L0PA 3ACHA 2CDPA 2WABA 1GOFA 2ZEXA 5J1XA 2QQOA 4QX3A 4MADA 4XURA 3ACIA 4AG4A 1F4HA 3T08A 3WF3A 1GOHA 2VMDA 3AC0A 3BN6A 4OUEA 5CZKA 3GXUA 1UY1A 2Z4FA 1F4AA 3MO4A 1JHJA 3T0AA 4JKMA 2Y6HA 5JXHA 2Y8KA 4BXSV 5IYYA 5EJ1B 3WF4A 1HN1A 2JE8A 2DDUA 2ORXA 1O8PA 3LEKA 1GNYA 2VQTA 1CZVA 2LW8A 2W87A 1UXXX 3CMGA 3JXSA 2PQSA 3VDBA 2WAOA 3FHQA 3WF2A 4QDQA 2ZEZA 4A45A 1UY2A 2W1QA 4A42A 4FI9A 4LPLA 4OMDA 1CIYA 5I0DA 5LA1A 3I2KA 1TVGA 2W94A 3T2PA 2J1AA 4E8CA 4A3ZA 2VZUA 1K45A 1W0NA 1MPXA 1UYYA 2BZDA 2WO1A 3I2GA 3MBWA 5JUVA 3T2OA 2XONA 4CU8A 2W92A 5C71A 5LA0A 3SEPA 4QX2A 3K77A 5F7UA 3OGRA 4BK5A 2W1UA 5C70A 3HNMA 3GM8A 3IB3A 4W4ZA 1SG3A 3DECA 1JZ7A 1JYNA 5JMOA 5C7GA 2WO2A 2VJXA 4XUNA 2W3JA 5JXJA 3MUZ1 2W91A 4MO3M 1JZ2A 1OF4A 2QQJA 3K4ZA 1JYWA 2YFUA 2RVAA 2W47A 4LHSA 2YC4A 5EJZB 2VMEA 1O8SA 3VDCA 2VOTA 2V4VA 3ETPA 2E26A 2WN3A 2L9LA 1UXZA 4ZZ5A 1XNTA 4LQRA 1XPWA 2E32A 1EUUA 3DYMA 2VZ1A 5FUIA 3I3BA 1UZ0A 4BJ0A 3T09A 3I3DA 4QAWA 1BHGA 4MOAA 4LKSA 2LS6A 2W95A 1CZSA 3UESA 2VM9A 2QQMA 3SKJE 4BK4A 1W8OA 1CX1A 1L7RA 1XNAA 3EYPA 3WNNA 4HG6B 5A1AA 2VCAA 1H6YA 3FN9A 1SHWB 2BBAA 4PF1A 2QQKA 2BGPA 3OB8A 2VC9A 3SKVA 4CU7A 1NUKA 4IUGA 1T2XA 4OZOA 4ET7A 1K12A 4D0QA 5DPNA 2JDAA 2X10A 5B4NA 5IHRA 4CU9A 3OEBA 3DYPA 1GQPA 4OYUA 4A44A 2WYSA 3WQBA 3DYOA 3U37A 3VD7A 4A6OA 3OEAA 2EIDA 3LEGA 3VD4A 1PMHX 3EB7A 3F2ZA 2R7EB 1J84A 3K46A 3OGSA 1NKGA 1WCQA 1DLCA 2VZQA 2VZPA 4M4PA 2Y6GA 4ARXA 4QX0A
chains in the Genus database with same CATH superfamily
2XLFA 1RHI3 4OI4A 2XL7A 4S2GA 5FZGA 2BPA2 1WLDA 4N43A 2HWD3 4X6QB 4XUQA 5EWSA 4P9IA 5LBBA 2XXZA 3GBGA 3WNOA 3P3PA 2XBO2 1RUF2 4ISQA 4PIXA 2R062 2A6WA 4YW2A 3RJ2X 4CUCA 3N9NA 1RUNA 3R6SA 2XKPA 3N9PA 4LOSA 3N36A 3ZSJA 2IXLA 3U14A 1UCXA 1DFQA 1SBDA 4BA6A 4XEZA 1GU3A 1PGL2 1N1SA 5A80A 1YQ6A 2HKXA 1OFSA 1LJ7A 2JDPA 2UWBA 3GALA 2CL2A 4KI5M 5FFOC 4FOYA 5BNNC 1CAWA 4CYDA 5KHJA 4XMIA 1LGCA 5FOBB 5DAQA 5LY2A 1YHFA 4IGPA 1QNWA 2Z2SB 2Q8DA 5LRRA 5AFEA 2UY9A 2TEPA 3IZOA 3DXUA 2WNVB 3NNJA 4DNYA 1N3OA 3WP6A 1ULFA 4XDPA 4XF4A 1FPN3 3AYAA 5JZGB 4NVPA 1NG0A 1UF2C 2YFZA 2NLRA 1CZTA 3AVSA 1RYYA 3AYDA 3SITA 3IAPA 2WZ8A 3KLSA 1VB4A 1H2LA 4K40A 4LLFA 2WQ4A 3NAPC 1TE1B 4NRQA 1DGLA 4EZHA 2NPIA 3THPA 4MYEA 2WSVA 5G05L 5T54A 5J37A 2IC1A 3I59A 1AX2A 4YNIA 1ASJ1 2WAAA 4FXGB 2I45A 1PX3A 3CJIB 3S0MA 2WDBA 2ORZA 3NWKA 4C8DA 1US3A 2HBTA 2OYZA 5KC5A 4G3YC 4CEYC 1RUC3 3ZXAC 3WEZA 2HWE2 1AHSA 1FNYA 3OJBA 1SACA 1S0CA 2RJLA 4NIGA 5B4XA 4O9GA 3E5XA 1WCUA 4IW3A 3THCA 3EO6A 2XLAA 4FPEA 5GLTA 3VBRC 4CCEA 5IT6A 4DUWA 3ZN6B 1MQTA 4FPYA 1QDOA 3AKPA 3KV5A 4RGAA 5FXVA 2GDFA 2JKXA 1ZZCA 5A3OA 3RMYA 3USUB 5C6CA 4LBQB 1GFF2 3CHXA 4GWIA 5FYTA 4AVBA 3QOPA 3D3AA 3LIHA 4EWDA 4GA9A 1KGYA 4UT5A 1G9CA 1AJKA 2OPWA 2XOMA 3HJRA 5ERLA 3ZN5A 2RDSA 3ALQA 1VBE1 5GALA 4AFDA 5C3QA 4AHXA 4XW3A 5ANNA 2VZOA 4WVVA 2J42A 4Z82A 1S2BA 3I2FA 4IE0A 3URFA 1JOBA 3VD9A 2YU2A 3RMXA 3JD73 3NJYA 1CAWB 4FOWA 4I0BA 2FCTA 1FOD3 2X5IC 2WJSA 3A7QA 4K3UA 3LZZA 2GU9A 4CP9A 4GIQA 4YFWA 2FZ2A 4JKKA 5FZ9A 4R4XA 1HJFA 4DB5A 4NMIA 5A3LA 2BWAA 4CEWC 5FTTC 3CL1A 2BERA 4M01A 1AR81 1ZRFA 2RE9A 1J1LA 1W2AX 2D7FA 2WNVA 2J1TA 5LEKA 4OLLA 3D0JA 4ZY9A 4ZU7A 2ZACA 4YM1A 4MXWA 2BP6A 3C7OA 3J8F3 1WW7A 2AYHA 4Q27A 4Q4V2 1RUJ1 1S0JA 1ND2A 3ACFA 4WV8A 3AL5A 2VZSA 5F1RA 3NV2A 2C5DA 1LULA 3CJXA 2XBO3 3BB6A 3U78A 2WZPP 1ZBA2 4N8MA 5C8CB 2GNDA 3E6BA 4HZFA 4TLGA 4YGDA 4BQXA 1ZRCA 2HLEA 3FLRA 3H8UA 1G9BA 1LRHA 3ORJA 3AYCA 1V6MA 2AGSA 1RHI2 3M3QA 1KDKA 1H9WA 2IZWA 1JOPA 4KWKA 1ZRIA 4E4SA 4I2OA 4Y4YA 2YDEA 2OX0A 1S2KA 5LBEA 2J1VA 4PLMA 1QHDA 1W6OB 2C6SA 1X33A 2ZS6B 4NUBA 5L7OA 3LDBA 3PMEA 4IE4A 1G9FA 4LO8A 1JYXA 3CZJA 4CP1A 4LITA 3MV01 5LA2A 4BQWA 2BTVC 4DUVA 4AI0A 2WA3A 4CCDA 3O1RA 1GSLA 3H7JA 5C8CC 4ZXEA 2UU8A 3AMPA 1IOAA 1FT9A 1NCQC 4Q4Y2 4XQ4A 3UJQA 4V1PA 1HRI3 4LIUA 4TLFA 3AP6A 1O59A 4LXLA 5FREA 4DXRA 3SC7X 3TN93 1OUXA 2BWCA 3VKFC 1FNZA 5LCWL 2A1XA 3QACA 4SBVA 2NQYA 3B9CA 4WZFA 2H6BA 3FHIB 3APBA 5L9RA 4CU6A 1W9TA 4I0AA 4FAHA 1UY4A 1RVF1 2MNGA 4AF9A 2OKXA 4LT5A 3J7MA 1XC6A 2OIIA 3ACLA 3BKZA 4UW4A 3WW2A 4NHXA 3MIBA 2XJUA 2ZGUA 3M1HA 5FP9A 4XJUA 4Q0SA 2RR12 2X09A 3VHPA 2Q4SA 4GMP0 5CKQA 2LTNA 5JSPA 3N3HA 2X05A 1W28A 1ST8A 4P9YA 5F5QA 1GP4A 1Q8VA 2Q1MA 1JYVA 4INDA 2DURA 2EIBA 1OPMA 4K9SA 3ZXJA 3ZM8A 5H9QA 1NE4A 4D6QA 1UY0A 3NJXA 5FZBA 3M70A 3ZSKA 4YW1A 4RHV1 3KVBA 3PTRB 1RL3A 1STMA 4WBBA 2XHNA 4OUMA 5FP4A 1SDDB 3JBG2 2ET1A 1CAVB 1GQHA 1PX4A 2BVVA 4PT6A 4Q8LA 5FPLA 4E4DX 3OBAA 2P3KA 1JZ5A 4XE9A 1R64A 1W8WA 1K3IA 1H2NA 5FPXA 3MF9A 4UAPA 2GP3A 4EJRA 2WO3A 3N7MA 4XXAA 2GC0A 4ASKA 1UMHA 5I0SA 2WYFA 2ZABA 5KBFA 1OURA 4XCAA 1DG6A 4UI9L 2VUJA 4OHWA 5FP3A 3WSOA 1T6GC 2D97A 4AAXA 4D6SA 3VD5A 1GZCA 1DQ2A 1S1AA 5F8PA 2VZRA 1ZA7A 2XJRA 3QCWA 5I91A 1ULOA 4Q4X1 1KITA 5DN2A 5IVYA 5FYZA 5LB6A 1RUF1 1EP0A 4XBNA 2WT0A 3KV4A 4UBGA 3OF1A 2CDOA 2C26A 2HWC2 1OD5A 3IIAA 1RUD3 3WG2A 1TME2 5JR2A 1DYKA 2OT7A 2RV9A 1QJU1 3OBZA 2D98A 3FHAA 3AKTA 2KXLA 3IPVB 5FLJA 4PIZA 1ACCA 4QXCA 2VCBA 4X6RB 4LJHA 4YW5A 5B2GB 4YVSB 4XZPA 4PI2A 5I0RA 5CVRA 3AKRA 2B4KA 4GJZA 1RUH1 4A2UA 4BQ5A 3IAQA 4YRDA 1G6NA 1V9U1 2W68A 2RJKA 1AR71 3BODA 3POJA 5ABJB 2CDPA 2WABA 5CKMA 4AQTA 1RUC2 1MZ6A 5J1XA 2QQOA 1QJX1 2IFWA 2PHDA 4LKEA 3T4VA 2C24A 3LCPA 5L36A 2Y38A 3H3LA 1O4YA 3D0SA 2NYYA 4J25A 4LA3A 2JDUA 2VMDA 2FDGA 3BN6A 5IVCA 4GKYA 5CZKA 1NZCA 4AL9A 2MHFA 1UY1A 2Z4FA 5IVJA 1F4AA 3WHTA 1UIKA 1PZ9A 4GD4A 1RUF3 3J7NA 5F6KA 3WDUA 3T0AA 1DGWA 2ATFA 3C2UA 4BMEA 4EN7B 3TBDA 4CE8A 2Y8KA 1RUJ3 3ZYGA 2ARXA 3M3EA 3WF4A 3SQOA 4DRVA 1TNRA 4B8EA 2XJTA 4BQ1A 5CFDB 2ZMLA 3N35A 2VQTA 2A6YA 2IVJA 3QLQA 4AVCA 2W87A 4IE7A 1V6LA 4R9CA 1N1TA 3JXSA 4LIVA 1MQTC 4KU8A 5DUWA 3EBRA 2QQUA 3VBFB 5KHIA 3BTZA 2WAOA 2D3RA 3KWVA 2HWE1 1O3RA 4QDQA 2R30A 4LE3A 2O8QA 1YQCA 2W1QA 4Y5TA 4YGEA 5FR3A 1V0AA 4TZDA 3N9LA 1CIYA 4NN0A 1B35C 1OQEA 4Q1RA 1KFUL 2R061 2G9ZA 4UW5A 1LGNA 1QEXA 4QQHA 2CWMA 3ILRA 3GCWA 4UW6A 2E7QA 4XBLA 1EV13 2IXHA 4OHZA 5AVPA 4AVSA 2HWF1 4B29A 1Q8SA 4Z8BA 2DU1A 4XCBA 3DPRA 3JB8A 2QKDA 2VBBA 4QKFA 2CGNA 4YARA 1QOOA 1EPZA 3N9QA 2WO1A 3MBWA 4XJAA 3RDIA 2ADEA 4XFIA 4IEXA 3OD4A 2W92A 3Q8BA 1CIWA 4HSLA 3KQRA 4HN0A 1IPKA 5GLVA 1AR62 5LA0A 1LHNA 3MPPG 4QX2A 3SEPA 4Y22B 5FBZA 3B7MA 1W8HA 1F8VA 4QU1A 1EAH1 3O0XA 5J98B 3OY8A 1YNAA 2B5HA 5C70A 2VCMA 3HNMA 3RI8A 3GM8A 4LBKA 4DIQA 3AMQA 3POIA 1JZ7A 2LALA 3UJOA 1XE0A 2G19A 3SMHA 4WVMB 1QGLA 1D2SA 3RZGA 1ND2C 4P9JA 2ZKNA 2VW1A 4KG8A 3W9AA 4AZZA 4QM8A 1SMVA 3TEYA 2WO2A 1QJY2 2WR9A 4HVRA 4NRMA 2VJXA 4RS5C 1COV3 1S0FA 5A3MA 3U75A 4CDQC 3VBOB 4XJ8A 1OA2A 4P9GA 1JZ2A 1CX4A 1KS5A 1Z7S1 3LEMA 4UFMA 2WWSA 5K4LA 1AXYA 1NCRC 3ZMOA 1CGPA 5F3CA 2WT2A 4GQ7A 2A5ZA 2A3XA 2YC4A 5EJZB 2JENA 5LBCA 1CAVA 1UQXA 3VDCA 2VMGA 4A7YA 4RR3C 1F9KA 3VBUB 3WDXA 5CFCB 1DZRA 3HBKA 3MW4A 1DQ6A 3ZKYA 4MGKE 4BMBA 1DF0A 4CP9B 4I30A 2NMOA 3TRSB 1GP6A 2P3IA 5KXDA 1EAH3 2RS12 4BCUA 1EYBA 5FWEA 4H2AA 1W6MA 4QGMA 4CCCA 4D7TA 1H8TC 1DHKB 2ETEA 4BJ0A 5LY1A 1POV1 1Q8OA 4JGYB 4Y1YA 4QAWA 3ETQA 4MOAA 4YG6A 2C1FA 1OVPA 2LROA 3LDRA 4Y1XA 3VBFA 1JUHA 4Y26A 5FZ4A 3UESA 1BBT2 3WR0A 2LM3A 2HJIA 3OPWA 1W06A 3POSA 4JGZB 1WW4A 2ZX1A 2QQMA 1W03A 3JD71 4CEYB 1GR3A 5BNNB 5CFDC 2UYBA 1UOJA 2DV9A 1CJPA 2YC0A 5A3TA 4Y5Z0 2ZGNA 5A3UA 1KRIA 2HYKA 2GALA 5E1RA 5A1AA 1R083 2BBAA 3HQXA 4XPVA 4LO6B 1VBB3 1V9U3 2JG8C 4F8AA 1V9U2 1X8MA 1OPOA 3L2YA 5FY4A 1HB2A 3E6CC 4FAGA 5FZ1A 4R8HA 3K48A 3FX3A 1QJX3 1GNHA 4FFGA 4FP2A 3VKOA 4M3CE 3WINE 4ET7A 4D0QA 1BYHA 5DPNA 3KF5A 5IHRA 1CQ9A 2NN8A 5FRAA 3K51A 1GLHA 3UK9A 4BQ3A 2GMPA 3DYPA 3DN7A 3MIHA 5C4WB 2ZAHA 2DWRA 2KM2A 5T3NA 3WQBA 4FTEA 1O5LA 1VALA 1O3SA 2EIDA 4CCJA 2UWCA 3IT8A 3F2ZA 3MHZA 1UZYA 1J84A 3K46A 1U5IA 1ZBE2 4F83A 3BIEA 3KHCA 4R9DA 2BJSA 2VOXA 4RFRB 2QZ2A 1E57A 3MLKA 4XQDA 2GC2A 1VRBA 1ALYA 3D4KA 5DDJ1 4E2QA 3KGZA 2QQWA 4IV1B 4RHV3 1WCQA 4KL1A 2RM22 2O14A 1QKQA 1VLNA 1LGBA 4QKNA 5CNAA 4CA9A 3IWZA 1F35A 2QDRA 4Q8KA 3NNMA 4YG3A 2PFWA 4I01A 3O1MA 4MGZE 2GMMA 4A7KA 2WNEA 4YW6A 2RDRA 4GJYA 1F5FA 1LNSA 2RDQA 1PMJX 1D0HA 3VBRB 5KHGA 2WQ8A 5A6ZA 5CU1A 4MGSA 4TXWA 3B93A 1BEV3 1F5JA 4LBMA 3T4HB 2RJ2A 5BNPB 5K7PA 3NV1A 3TB0A 4AR2A 1ULDA 1PHMA 1S2EA 3ACGA 3B9IA 5I8TA 1MS1A 1PIV1 5EPAA 4YVSC 1WMXA 5HXMA 1QQP3 5F5CA 1VAVA 2PHWA 4S2DA 2BUKA 4W50A 1ZRDA 3H1MA 4LA2A 2P17A 2HWC3 2W39A 3OUHA 4FFFA 2HWB2 2FBEA 2WNUA 3CZUA 3JB4C 3BIWE 3F95A 3ZFEB 5EYXA 4AVAA 2W9XA 5EYYA 5FO9B 1KDMA 1H4HA 1SLAA 1JHNA 2CAUA 4HETA 4IEUA 4RN5A 3TNPB 3WDVA 4CCOA 1O4TA 3KF3A 1U5ZA 1TZOA 4UFHA 1MEC3 2WS93 1OA4A 5IUQA 1CESA 1V00A 2B42B 2AEYA 1POV3 2JDZA 1OF3A 4JGZC 1VB2A 1S0GA 3PU3A 4P9XA 3C7GA 1I5ZA 5ACA1 3R4UA 1DGRA 4KMQA 2D40A 1RXGA 3B69A 4P00B 3SEEA 3I7DA 3N7JA 2VU9A 4ZZ8A 1L7QA 3IIIA 3MF6A 5J96B 1S0IA 4QPWA 1HB1A 5IAXA 1XU2A 3I2JA 1W6QA 1OH4A 2ZX4A 3ZFFB 4DY3A 5T50A 5FZOB 1OSGA 3HOBA 4WZCA 5JIAA 1O91A 4CVUA 2OQ6A 4D7SA 1V6NA 1DCSA 3D8CA 3GHNA 4I3GA 4B4PA 4W6WA 5FY5A 4LKDA 5FUNA 4AXOA 2ZGKA 2B39A 2ZGTA 4XJ9A 1XNCA 2V5YA 3LFIA 4UFIA 3AMHA 5FJKA 3AZXA 2VR4A 3WV6A 5JZGA 4PQQA 4AW7A 5KXCA 4AEDA 4CTEA 2WS91 4MSVA 1MVEA 1CD3G 3C3VA 2GNBA 3CU7A 4KBBA 2UYAA 2EVXA 3BTXA 2HYXA 4QHZA 4DEQA 1Q3EA 2J1EA 4NO4A 4XJWA 2V72A 2VW0A 1KXGA 1W8TA 1UKGA 1WCKA 1YI7A 2D6MA 3MYXA 5EFUA 4AFBA 1AYN2 2Y6LA 5C5UA 2OQ7A 1BBT1 2XQRA 2LUWA 5C33A 2VXRA 3FLTA 3J8F2 1EV12 2UURA 3PVEA 3I8TA 2WFF3 3O12A 2ZXQA 3CDZB 2Y6FA 1JU4A 4WM7A 1REEA 3KCYA 5F3IA 5FXXA 4PLOA 4FPJA 2O0OA 2ERFA 1VBB1 4NWWA 1SCSA 2YPJA 1JUIA 4W65A 3LIGA 2DBIA 2FCUA 5FZHA 1IG3A 3VGIA 1ENRA 3V0AA 1W90A 3KS7A 3G7DA 1FOD2 4LBNA 4M3CB 5FZMA 3SCFA 1ENSA 3R0RA 2UY8A 1GBGA 5FPBA 5IWFA 3VKMA 4OFGA 3V64A 4F7ZA 1GANA 2JB4A 1LHWA 2X5IB 3VBUA 3MGUA 4FT8A 3PUHA 4UF0A 2VL4A 3H50A 3B00A 4QWNA 3WW1A 1H1AA 5JXIA 1C3HA 4PDWC 4MGIE 2WT1A 2CSGA 2FMYA 2SLIA 3WDYA 3ZFEA 3ZYFA 4CXWA 1SFNA 2Z5WA 4WM8A 4CDWA 1MS9A 2Q5TA 2YUEA 3CBNA 3SLIA 2XJSA 4QDRA 5M0TA 4RR3A 3TAYA 4P9WA 1UIJA 2VE1A 1UY3A 4XFBA 5FZ8A 1WW5A 1NYWA 3NKTA 3ZN4A 4GALA 2AH2A 3AK0A 1C28A 4XHBA 1KJRA 3S30A 5CFCC 2VCCA 4KGQA 1UYPA 3WNMA 4QB1A 3AKQA 4LK6A 3QD6A 2YG0A 1U5XA 5C3RA 3IDEA 5EQUA 5DDJ3 2QZ3A 4N43C 1SLLA 3M7AA 1MS5A 3UKTA 2BV4A 3ZYRA 3H8XA 3VLBB 3ELNA 3MZHA 1JMUB 1RINA 4M4RA 1US2A 2VXJA 1LKNA 1D7PM 2XG3A 1JBCA 3FL7A 3GDBA 2XQXA 3B02A 4XIKA 3T3YA 2E9QA 4TWTA 2XJQA 1RIRA 1JI6A 1HQLA 1NCRA 3ILFA 2VVDA 3MIEA 5FQ0B 2N7GA 4IEQA 4ZS2A 1W9SA 4Y1VA 5FYCA 2C0ZA 2R0HA 1NCQB 5A70A 3WUDA 3KVAA 1XYNA 3NNLA 4O65A 1SQ4A 1RUG1 2FD8A 4L99A 5JOYA 4OCTA 5FOJB 2ZA9A 1XYPA 3UKVA 4Y5SA 4Q4X3 1YO8A 5ACA3 5JXGA 1H9PA 5F32A 5FP7A 2WZEA 2R041 3O0WA 5CBLA 2E51A 5FYIA 1VRH2 3SCHA 3ZIXA 2CTVA 2W2IA 2CGPA 1H1MA 3KCCA 3V0AB 1SLTA 4UYBA 3OSDA 4Y22A 4AGGA 4L97A 3J4UH 3UL2A 1I6XA 1QJZA 1Y3TA 5LZ6A 3RZLA 4ZU4A 2XVKA 2RS53 3HQRA 2VOWA 4K21A 5F3EA 2ZGOA 1XU1A 4FFHA 3E5QA 1V70A 4QMAA 3NJVA 3LA3A 1DBNA 2JEMA 1DP0A 4N7IA 1H2MA 1SDWA 2VQUA 3FZ3A 4AGVA 4BISA 1RUI3 3M8LA 4XF1A 5KWRA 2BQPA 3I4IA 4QQPA 5F3GA 1IPSA 4CZSA 4Q0UA 2BU9A 5A33A 4JHZA 3VZNA 3ZFGC 1PZ8A 2HEWF 5GZDA 4CDXA 2DCKA 2V09A 5FO8B 2BEOA 5KC6A 1QXRA 3ABZA 4NIAA 1UZZA 2PLV1 3CQOA 4KH9A 2RR13 2YROA 4UOJA 5BNOB 2B8MA 3ZXFA 1JW6A 2OZJA 2Y64A 1BBT3 1EPWA 1JTZX 3FBYA 1W6NB 4COWA 3ZMNA 1PNGA 3VDDC 3BVCA 2JG8A 1XSQA 4YSFA 1WA6X 3N7KA 1UYXA 3GHMA 3LF7A 1GZWA 3GGLA 4J1WA 3DPRB 4XZUG 4JV4A 2Y6KA 2YU1A 4COZA 2G1MA 2QQLA 4V2WA 3H9AA 4K8RB 1YRZA 4G4FA 3RQ0A 1UU4A 2ARAA 1AX0A 1KEXA 4AHZA 1RUH2 2VZ3A 4Q4V3 4XILA 2ARCA 4YZ2A 1SFYA 2CYFA 5L9BA 4IEWA 1UZVA 2XUMA 2D6LX 2WBKA 1HRI2 2D6NA 2KD7A 3O5SA 5KXEA 5LRSA 3MW3A 1S4CA 2VD7A 1ZRRA 5FYSA 3UYJA 3PIGA 2J22A 2P4EA 4DY5A 3POGA 1WLTA 2FDFA 3K3NA 1DQ4A 1AR91 3VDDA 1Q56A 3PVBB 3I97A 1XBFA 4L0PA 3WHUA 1WMDA 2BGCA 2IXIA 1KFXL 1POQA 3SH3A 2ZEXA 3MFAA 4WVMA 4N43B 4XURA 4MADA 1ND2B 4HK8A 3TNQA 3MICA 4HLTA 1JOJA 1F4HA 3RSJA 1ZNPA 4XFCA 3DF0A 3WF3A 4B4RA 1RUG2 2WINB 1GZ9A 3AFGA 2VULA 4XTMA 3KD4A 1FAYA 5E8AA 3I59B 1PGW1 3MO4A 5JCTA 3ZLIA 4WM8B 4KWJA 4CDWB 4LBJA 5A7QA 2WRAA 2KA3A 2Y33A 4JKMA 1E5SA 4OVEA 4QXBA 4ZHNA 1HJGA 4NIIA 3P3NA 4BXSV 1NA1C 4GAZA 5IYYA 1JYTA 1HN1A 2JE8A 2JKBA 1MQTB 2ORXA 5FMDA 2A6ZA 2B9UA 5L7OB 2LW8A 4RD7A 4QXHA 5C4WA 1VBE3 1ODMA 1UNBA 3J7LA 4QPYA 5JVVA 4FTBA 2R49A 4KGGA 4BB3A 4QM9A 4ZPIA 2XJPA 4EROA 4H55A 1ZZ8A 3S5AA 2JD4A 5IVEA 3FHQA 4AHYA 2WS92 4WVWA 5BPXA 2ZEZA 3WD5A 2FCVA 4JGYC 1B35B 3LAGA 4A6SA 1VJ2A 1VMHA 4A42A 4LPLA 3IM0A 4OMDA 3WXPA 1HB3A 4YVWA 5I0DA 2ZGQA 2XPJA 1JYIA 1XE8A 4XYXA 1TVGA 1GP5A 2JDYA 2XJVA 1IKPA 3MI8A 3H3UA 1HRV2 2R0FA 2W94A 4C91A 4LNVA 3T2PA 4E8CA 1RITA 1PMIA 1BXHA 4IETA 2G4IA 3QH7A 4JDOA 1A3KA 1FYUA 2F6BA 2QVSB 1MZFA 1MPXA 4R52A 1M06G 2D6PA 2E7AA 4HKLA 1GNZA 2OA2A 2RS51 5C4WC 5BNOC 2D3SA 1SBFA 5JUVA 1ZA4A 3AP9A 5FZFA 1IS4A 1NA1A 1QOTA 1ULEA 1WD3A 3FBMA 4XACA 1CAUA 1YC61 2HWE3 3ZKUA 5T55A 1KD7A 2Y0OA 5J3UA 3SH4A 1IPJA 1Y9MA 3NKGA 2VMHA 2JJ6A 4MXWB 3K77A 4FPOB 4AGRA 2Q8EA 1HQNA 2X53S 4YVWB 2A6XA 3G6JB 2W1UA 3FFZA 4DFSA 3RRDA 2ZOEB 1QY4A 1CAXB 3RWKX 3DECA 4HN1A 1W6OA 3WG3A 4YZ5A 4HKWA 4EQVA 1TMF3 3AZYA 1JYNA 4MGTA 2CHHA 5DG2A 4JC1A 5FY7A 1RJ7A 3FMGA 5L19A 2GNTA 2PMWB 1XXNA 4WVZA 5L73A 5JXJA 4L92A 4YW7A 5FIXA 1RJ8A 2CV6A 1OF4A 2YBSA 3FFQA 4B1MA 3ROUA 1AXZA 5FO7B 1PIV2 3VBSA 2YFUA 2HBUA 2RVAA 3PIJA 4OQ9A 4BHPA 1NCRB 1Q8QA 4Q4V1 2X5IA 3WP3A 1WZXA 4LHLA 4UFLA 2XLGA 3H7YA 1N3QA 1RUD2 3OBRA 1TEIA 3RG0A 3R4DB 2VOTA 2V4VA 3ETPA 2WN3A 3POFA 4B1LA 4Y33A 3WZ1A 1N3PA 2RS13 2L9LA 1AYM2 1UU5A 2P34A 3BI3A 4N7UA 2EAKA 1V6OA 4PDWA 1IS3A 1I9RA 2R32A 3DYMA 5C3OA 3TEXA 4LR4A 4KG0A 3BOPA 3I3BA 4MVTA 4G9SB 1UZ0A 2WSUA 5FXWA 3VHRA 5FYMA 1CPMA 1NLSA 3I3DA 4R9BA 2R1BA 5ISLA 1BHGA 5GLWA 1Z7S3 1R082 1CPNA 1AYN3 2EAAA 3K2OA 5A6QA 2LS6A 2W95A 1CZSA 3DGTA 1BZWA 4SLIA 5JPNB 1O3TA 1GZTA 1LHVA 2WNVC 3KCXA 1W8OA 1XSRA 2VUDA 3W21A 1NOVA 1XNAA 4NPRA 1AXKA 1TME1 4HG6B 1W9YA 2A7AA 1AR93 4PF1A 4O9EA 1Q43A 1W3VA 4OZXA 1WCDJ 1J3PA 4Q0VA 4MV2A 1RUG3 3O1SA 1HIXA 4ATEA 1O7FA 3ZX7A 2WL1A 4AE2A 1AR92 1HRV3 2D44A 1T2XA 2R042 4ES9A 2H0BA 1AR63 1OQ1A 2JDKA 4M00A 2DTYA 5A3WA 1CWPA 4QHBA 4Q2FA 2DTWA 2ZJCA 4ISRA 1IS6A 2A75A 2YPDA 4AOCA 1HLCA 5FZLA 1H4GA 1GQPA 2FQPA 5C9AC 4CCLA 3ZXEA 2WYSA 4A3XA 1OI6A 3RVHA 3T1MA 3U37A 2DVGA 3ZYPA 3DUIA 3JBG1 4CDUA 3O1VA 4YWAA 3AJZA 4A6OA 3H42B 2GSYA 1MEC2 3A0NA 2VAUA 3NAPA 4FTSA 1A8DA 1PNFA 2NMNA 2BDRA 3CNAA 3BUCA 2NZ9A 1H0BA 1QJY3 3KSCA 5F2WA 4AEDB 4D94A 3GZAA 4ASLA 2XH6A 4CCKA 1NKGA 2DUQA 3RYKA 4FPKA 4JDNA 3BPZA 1NQJA 1Z78A 2YBKA 3A0KA 3D6EA 3KB5A 3S57A 2A73B 1A78A 1PGSA 3VDDB 1BMV1 1QF3A 3ME2A 1H1IA 1PZ7A 4D7YA 1J59A 2SBAA 3Q8CA 1YCIA 3UGHA 2XVGA 4U36A 1W39A 4I0WB 4PCRA 1GMMA 1QJU2 3PNAA 3LE0A 4GMP3 3CIHA 4CDQA 5C3PA 2EXHA 4Y20B 2A3YA 3OBTA 2YMZA 4MUVA 2GH2A 2R6QA 5JIUA 4RS5B 3RWNA 4AEJA 3T1LA 4HANA 1ND3B 5GZFA 4XDOA 1L7LA 2VTXA 3PL0A 5KHHA 1LOEA 1RGSA 2WFPA 4XF0A 1Y4WA 3VZOA 2YC2A 3K3OA 3N9OA 1GICA 2VQAA 3C8XA 1QNYA 5IW0A 4AI2A 1W9WA 4HL0A 3W58A 4NRPA 3ITQA 4JCKA 5IFTA 1HQWA 2XGXA 1PVXA 2IWGB 3LEIA 4QPIC 2QQIA 2WZR1 1XJAA 2AZ5A 2AACA 2DU0A 2G9GA 4PF5A 1UPIA 4GH4C 4D3WA 1N1YA 2VVFA 2D5FA 2P1BA 1KS4A 4NIHA 2FDJA 2ZZQA 2WLPA 5LATA 3W59A 3U4XA 2GMEA 3ZR5A 4FCAA 3ZFGA 3BCWA 1UN1A 4QQOA 1A34A 2AENA 3J9SA 3L2HA 3GZTB 3ZSLA 4Z1VA 4NHYA 4LO7A 5IK7A 3HIFA 5KXBA 2PHRA 2XUEA 1PIV3 2DVDA 5IK5A 4QPIB 1CN1A 4KU7A 1UZWA 1PVC2 3OUIA 2P2KA 4RA0A 1C8M3 5FZ3A 3SH5A 1E5HA 1I1EA 3P1IA 2YBPA 1HV1A 5FYHA 1R092 3ZYIB 4URTA 4JGYA 1TMF2 2BW8A 5LW9A 1QJX2 2O1QA 1DYOA 3IDAA 4U2AA 3H8RA 3ZXKA 5C9AA 3HPNA 4R9AA 4JHTA 3LOIA 4E2GA 2PAKA 4DXSA 2PQQA 1QJEA 1WA4A 3IMMA 1XNKA 3GYDA 5BYNA 4FPFA 4JTNA 4K1ZA 3B01A 5AC92 1RVF3 5F6LB 1XNDA 5E6HA 3WQ1A 2W5FA 1IGOA 2MEV2 1HB4A 2G9FA 3PLQA 4YLZA 1SCRA 4A7ZA 1LEDA 4IESA 5CG9A 2F4PA 4AYUA 1FMD2 5CAZA 1Y9GA 4YZ3A 3AMNA 4QB6A 2OUHA 4YPJA 1R093 2CGOA 2ZTNA 1ULCA 4XUPA 4P5YA 4A41A 1X50A 3W5MA 4CPBD 2QQVA 5GZCA 4K6BA 4IEZA 1FMD1 3ASIA 3JZVA 1TG7A 1HKDA 3M4FA 4E8DA 3B3QE 3WQ0A 1LEMA 3C7FA 5FBJA 4ITCA 5JWPA 1FX5A 5CFCA 1HRV1 1YFUA 4H7LA 4Z2WA 5IK8A 1Y9QA 5A1LA 5F37A 3K4DA 1G9AA 3OGVA 1MEC1 4S2FA 3UETA 1QU0A 3UGGA 5GM0A 4P08A 2WNUB 5ABJA 3PJYA 3ZVXA 5J7MA 4L11A 4L9BA 3Q8EA 4XJZA 1OLMA 4Y1ZA 5FV3A 2D6OX 3MDPA 4EV0A 1G9DA 2BGOA 1DQ1A 5D2AA 2R1DA 5FCCA 1ZZ9A 1COV2 2VW2A 4OUSA 2DFCA 5DZFA 4JGZA 4H14A 2ZMNA 4IV1C 4E4ZA 5DMYA 1JZ4A 3LPFA 4COUA 5K0UA 2CNAA 2VY0A 4OI2A 1JU3A 4HONA 5FLHA 5EIYB 3EJKA 5EV7A 4BH9A 1VBC1 1ULPA 4PJYA 2FMDA 1W2TA 2WWUA 4ATFA 4H7MA 4BQ2A 1LOAA 4A4AA 4IV1A 4IL7A 1RUE2 2DFBA 3A21A 4FBFA 3ZFFC 4FVVA 4Z2AA 1DYPA 2XL9A 4Q4Y1 2BVBA 5FPVA 1KJLA 4YZ1A 4BQ4A 1W8UA 2RM21 1QJU3 2VNOA 4J6GA 4KQ7A 3THDA 3ZYJB 4RL7A 4XBQA 2P6HA 4ORFA 4FPHA 2YGLA 3A4UA 5ABJC 1WBFA 3PUIA 2FZ1A 4FQ4A 4AEKA 4CXXA 2PLV2 4NROA 2DCYA 3Q8AA 4LUKA 3U07A 3WX5A 4FOVA 1SLIA 2PYTA 3MFCA 4N90A 3RZJA 5AFBA 2IXKA 1MZEA 2JX9A 2XKOA 1RUI2 4AI9A 3A22A 3H1YA 4NIDA 3INAA 4ARYA 1NY72 3BYWA 4COVA 1NQDA 2ZKLA 1PO22 3RZKA 4DPNA 1X36A 4LK7A 4QPGB 2RS52 1LENA 1Q5OA 4M3CF 1GWMA 1QOSA 2EIGA 2WC2A 2VTXJ 1WBLA 3DKWA 4KWLA 5D8AB 5I0TA 4DZGA 4DRRA 5AC91 2JB8A 3HMYA 1HRI1 1I3HA 2TUNA 4HK9A 4ONUA 5A6XA 5DAPA 4BZ4A 3ZXLA 5LASA 2W0XA 5BY5A 3RYRA 3IDBB 1NT0A 5GZEA 5LK7B 4RFT0 4QKBA 1ZBA1 2CY6A 1IHMA 5DUXA 3M2MA 4HXCA 4IDZA 4Y3OA 5I8SA 1LODA 5CFDA 1E5RA 4CEYA 2FDIA 5I93A 3UNPA 5FMOS 2J1RA 1IS5A 3POEA 4Y4RA 4I09A 1W8NA 4QPGC 5FLIA 1AR82 4AI8A 3U11A 2JE7A 3I2HA 4FPCA 4JQTA 1JZ8A 3BU7A 5FZDA 4JVAA 2AREA 2HWF3 1NAEA 4AEDC 3FLPA 4GH4A 2GC1A 1RXFA 2A70A 3KT1A 5AC93 3ES1A 1UKRA 1OH3A 2QBXA 4IEOA 4QGLA 1C5IA 2IVIB 1BLZA 1VR3A 2F17A 4EE2A 5BNPC 5F9TA 5FZ0A 3T0DA 1OKQA 2E33A 3ZXGA 5C9AB 2QQPA 2VTFA 2FHRA 1K5MC 1ZBE1 3B94A 1SFPA 3MIDA 4LKFA 3HVDA 5K0UB 3OGJA 4B4QA 4EWEA 5HXVA 4RHV2 1H8TA 3M3IA 4LLOA 2K0GA 4BM8A 5A33B 2I2SA 4DUXA 2E31A 2VNGA 3VUOA 1H6XA 1F15A 4UW3A 4YM0A 4TTGA 2WLQA 3DL3A 4C0BA 1UD1A 2XBO1 4AFMA 5J09A 3VZLA 1APNA 4HFSA 1C8M2 1LU2A 4XABA 1W8ZA 2PHUA 3U10A 4IERA 1GYKA 2BYVE 4PI0A 1ND3C 3HNBM 4Q1PA 5T5PA 5FAXA 2X29A 3HWJA 3V0BA 3SNMA 4FSJA 4ES8A 2W1SA 2C9KA 2PHTA 3AYEA 4AQSA 3HEIA 2VO5A 1MS8A 4GMP1 3CF6E 2VUCA 3E97A 1YIFA 3ZO0B 1VP6A 1NX9A 2CAVA 1W6PB 2DVAA 1YYNA 1UYZA 1W99A 2ILMA 4CPBA 2ZGRA 1EY2A 1FATA 3HQUA 1CAXA 2JWPA 1GOFA 2Y34A 3JBG3 4QX3A 1TMF1 4PHZA 1DQ0A 2DF7A 3DV8A 2YY1A 1QH7A 3T08A 1VBA1 1GOHA 4CDXC 4ZKTB 4FPGA 5SV8A 5A3PA 1HXS2 1VMFA 4XAAA 4YVSA 1SBEA 3GXUA 4XHXA 5A3NA 1LOGA 3SCGA 3KV6A 4LE4A 1X7NA 1JHJA 3I54A 1IQAA 1RUI1 2K9ZA 4AI1A 1NLQA 2HWD1 3AP7A 4JRLA 4E2SA 4DMIA 5FZ6A 2B46X 5EJ1B 2DBNA 2DDUA 1ZVFA 1FPN2 1U5YA 2PTMA 2AR6A 4S2HA 3SXWA 4URAA 2TBVA 5H9RA 1CZVA 5FDBA 2Q30A 4XXPA 1HW5A 5FKCA 3O0VA 3ZR6A 2PQSA 2WFF1 3AX4A 3M3OA 3D5OA 2GN3A 3Q8FA 1G86A 5CIRA 4IEYA 1W8FA 2ZHLA 1YIPA 2QJVA 2GZWA 1XOYA 4A45A 3U4SA 3O1PA 4LEJA 3ENRA 1LCLA 5HPOA 2RG4A 5LA1A 5FK8A 3IBMA 3S7EA 4W6YA 4D6RA 3PUSA 3ES4A 1ENQA 1PO23 2DCTA 1NXD1 2XWJB 4ZS3A 2J1AA 2Y26A 4JZRA 1ONAA 2IXCA 5EZWA 5LA9A 2WNUC 4A3ZA 1NCQA 5KHKA 3FE5A 4ASMB 1K45A 1W0NA 3MIGA 5APAA 1UYYA 4UBHA 4BPZA 1CONA 2BZDA 1CR7A 2R063 4I3PA 3OPZA 2JG9B 1PVC1 2AEZA 1MS4A 1ASJ3 4Q4W3 3EHKA 3Q9OA 2RMU1 1LOBA 2MPFA 2PELA 5C71A 3ZXDA 3RZMA 3GBWA 4XOGA 4GXLA 1J58A 1NXMA 1R1ZA 1UU6A 3OGRA 2AC1A 3HD8B 1ZBA3 2R071 3CLPA 4PBOA 3WY6A 4AHWA 2WO7A 4IEPA 4NJ4A 3IB3A 3RZZA 2YZ4A 3IPVA 3WW3A 1ENXA 1RUC1 4YG0A 2Z79A 3O7OA 2DUOA 4RSUA 1M4WA 3I3QA 5JMOA 1UOBA 2DVBA 5C7GA 4XFGA 2E6VA 2JICA 4ZXKA 1SZBA 2JIGA 4K1YA 4XUNA 3V65A 2PAMA 2W3JA 4PDWB 3BTAA 4Q0PA 3ZIWA 4V2VA 2W91A 4MO3M 2E63A 5JOXA 4C90A 5A6YA 5JOZA 1WCSA 3LSEA 1WMEA 2Y60A 3BOWA 3NL1A 3ST7A 1SLCA 1GZWB 2QQJA 3K4ZA 4L8QA 1Z7S2 3FJSA 2W47A 2ZGMA 4P9LA 1VAMA 2VBPA 4GB33 4N53C 4RQPC 1NA1B 4IXLA 2PHLA 1O8SA 4OULA 3FUOA 4UWDA 3ZYHA 2UWAA 4YW3A 5EXOA 3WG1A 2E26A 2VOKA 1W2NA 3VKNA 3MIFA 1UXZA 1BK0A 3ZFEC 1XNTA 4LQRA 2YV8A 3FWEA 3POYA 1BMV2 1LTEA 2E32A 5A7WA 1W6QB 3ZFFA 1EUUA 1FV2A 1X82A 2EALA 1ZZ6A 3KGLA 2VZ1A 3O1TA 3AVRA 3DXTA 3WUCA 1LECA 5JLVA 1R091 4QQLA 1YXWA 4E4HA 1S0DA 1RHI1 3J8F1 4QXKA 1FMD3 4OQ8A 1SEFA 4LKSA 1BKZA 3S6PA 2EF6A 2VMIA 1XNBA 5DUVA 5FWJA 1R081 1PO12 2VM9A 1S0EA 2ZPXA 2QFEA 4HMZA 4QX5A 5FZCA 5BUVA 1PK6B 3TN92 5D21A 4JTOA 1BEV2 3KV9A 1CX1A 1L7RA 1VBA2 1DLLA 3WG4A 3RGBA 4NE9A 3HT1A 3VL9A 1BVP1 3ZDVA 4LMFA 4MH0E 3GJBA 2CU5A 3FN9A 4LBOA 2WKKA 5E16A 3CJIC 2QQKA 4CDUB 5SV5A 1REDA 1V6KA 4UFKA 1HXS3 2Q1FA 3SKVA 4CSWA 3E6DA 4CU7A 1DZTA 2GN7A 1NUKA 5IK4A 1C1LA 1H8VA 1UOFA 2JDNA 5LBFA 5FY9A 4EZ4A 3M3CA 5FMOL 1H30A 1CAUB 3N7LA 2PA7A 1K12A 1RMU1 2WNOA 4YVWC 3L9JT 4F3JA 5JAXA 5FYYA 2EXJA 3OGGA 5DABA 3LWCA 4LO4B 3JCIA 4NHKA 1J3QA 1QDCA 5BXXA 3LKJA 4CU9A 3H0OA 4OYUA 1VE0A 4J1XA 1OUSA 1XQNA 3VBRA 2BNNA 1VPHA 3DYOA 3DPRC 4IGOA 5ACA2 1ZREA 3LSDA 4Q4X2 3NJZA 5D8AA 4NPLA 1UO9A 1HV0A 3LEGA 3FC0A 1PMHX 1REFA 1ZX5A 3AB0A 3R4SA 5I0UA 1D4M2 3AXDA 4BIOA 5DUUA 2QDNA 5A32A 1OOPC 4CCMA 1OHFA 3MPBA 3NW4A 2Z69A 4QHOA 4RS5A 3PDQA 2OZ6A 3ZSEA 2DYCA 4PIYA 1UL9A 2XWBB 5C8CA 1U0AA 5EP9A 2VZQA 1OVSA 4IE5A 1K5JA 4AFAA 2XMLA 3VN4A 2HWB1 2ZX3A 5FYVA 3S5QA 3DCQA 4C1XA 4AWDA 4DS0A 3PMSA 3RPQA 3ZN6A 5FJHA 2Y6GA 5IVVA 4ARXA 1UOGA 1UPSA 2BNMA 1K5MB 3NNFA 1MR5A 1WUVA 1QIQA 4QX0A 3BTYA 3C7EA 2Y6JA 4JQRA 2HEYF 2QQNA 1RUE1 4NHMA 4DEVA 4P14A 5FQ0A 4MG2A 2DCJA 4YGCA 2RS31 4BYYA 4D69A 3P6BA 3LPGA 1WLCA 1LR5A 3VHNA 3E5UA 1S0BA 2OVUA 3LFMA 4XVHA 1J1TA 2JG9A 2XHKA 5FY0A 5K8SA 1UX7A 1J83A 5F5IA 2VPVA 2B9VA 1BEV1 1IKQA 1XRUA 3WF0A 3TWIA 2VECA 3ZPYA 1TME3 5E88A 4XMAA 4CUGA 3AP5A 4AQ6A 4QD2A 4QB2A 5C5TA 5JDBA 1ULGA 4PQ9A 5FZOA 2RHPA 1HN0A 4CRQA 3PJQA 1EAH2 4M0NA 1S55A 3NRUA 2VMFA 3T0BA 3WW4A 4M3CA 3VBHA 2XR4A 2ZEYA 1BK1A 3ILNA 3AKSA 4XAEA 4Y20A 1MS3A 4W8JA 4LULA 3HN3A 3LQCA 1XE7A 5T5JA 1O6UA 1EUTA 3DEMA 1D4M1 3GJAA 3WNLA 1RC6A 3X29B 1OT5A 2P37A 4GWJA 1WMFA 1YJLA 3MUY1 2ZCWA 3NV3A 1ZYBA 4XDQA 1PK6C 2VZVA 2J1UA 2XVLA 4TYSA 1PGL1 2C4XA 3KQ4B 1OLRA 2H6CA 2XDVA 4XF9A 3TOJA 1O3QA 3LD8A 2EIEA 3USUA 1UMIA 2ET7A 2WN2A 4NAMA 5GLUA 1B35A 1YFWA 2HWF2 4WM7C 5A7NA 4XUTA 3I2DA 3BU0A 1MACA 1RUH3 2DUPA 5FZEA 2W46A 3NNGA 4Q4Y3 2YB7A 1POV0 3I3MA 3VBFC 4B7KA 3AZZA 3NAPB 3PVOA 1UWWA 3WCSA 1O4ZA 2K2SA 4YM3A 3POBA 4EWAA 4IEVA 1VBC3 4XUOA 3NMBA 1VBC2 3PUQA 3I3EA 3VBHC 4QU2A 2DCZA 2J7MA 4KBZA 2ZHMA 1RUJ2 3T2QA 3W5NA 4IQPA 1YWKA 5IATA 5FZIA 4ZONA 1R1A1 1OC1A 1VAKA 1YQ5A 5E89A 3E1F1 4N53A 3IDCB 2ZX2A 4RQPA 4D8MA 2YXSA 3QBQA 3I2IA 4Z07A 1WLWA 3VBHB 1Y7BA 4GZ9A 3HT2A 3NQHA 2ZHKA 1RUOA 2VH9A 4UXAA 1PO11 3AFKA 2B45X 4CUBA 3FUQA 3KMHA 3VBSB 2VZTA 1BJQA 1SPPB 2ZGPA 5F39A 1DIWA 5I8YA 2V5DA 3POWA 1OFNA 3PTYA 1OD3A 2RS11 2EXKA 1OOPB 1LU1A 3HNYM 3OOXA 4O61A 3VV1A 5JPMB 2ZHNA 3MLLA 5FZ7A 1PM7A 4RR3B 2J1SA 3UT0A 3O1UA 1VRH3 2JIJA 3SHRA 3BALA 1W0PA 5A7OA 4B7EA 2OUJA 1AL23 2PLV3 3OYWA 4CEWB 5F5AA 3PHMA 3T30A 4X8PA 2GP5A 1DGWX 2JG9C 3OCPA 5FKBA 5IJRA 1H2KA 4OHYA 1N1VA 1NZIA 3VBOC 3RI9A 1QQP1 4I02A 3VD3A 4GKXA 4HVQA 4LHKA 5HCAA 4P02B 5FMCA 3WDTA 3RS6A 4GH4B 1W6MB 2HWB3 2QUOA 1TQ5A 2HWC1 1RUE3 4KNCA 3WF1A 4DXZA 1T6BX 2YYOA 1WKYA 2ZGLA 1AJOA 3D82A 1D2QA 3K4AA 1DU3D 1V6IA 2O8OA 4CDXB 1QQP2 5CISA 3LA2A 2Q8OA 3ECQA 4QX1A 3IMNA 4IV3C 3HN1A 1J3RA 1URXA 3PURA 4QX8A 2WZR3 4QDSA 4UFJA 3RJRA 4XFFA 3OY8B 4QX7A 3MV11 4DXTA 4OI1A 1AUYA 1Z0HA 2WA4A 3AL6A 4BE3A 3VZKA 2P5BA 3PUAA 3OG2A 4FO9A 4GB31 5G04L 4AFCA 5DAXA 3TEZA 5H9SA 2JECA 2IXJA 5T52A 3TYJA 4QQ2A 3LA7A 1D4VB 4MZUA 1YUDA 3CEWA 5FP8A 2YGMA 3PU8A 5JI7A 3JD72 3OTFA 2RMU3 3IKWA 4BOWA 5ANQA 2Q8CA 1AR72 1GOGA 4OHXA 5HCFA 4MHRA 2NM1A 3ZYBA 4WM8C 3K75B 5EJ3A 4CDWC 1RUD1 1ZBE3 4JKLA 4OHVA 2R073 5DAVA 1QMJA 1UX6A 1YQ8A 1D4M3 5AVAA 2WWJA 3WNPA 3C7HA 4AVTA 5JZGC 2A71A 4HVOA 5D1IA 4WM7B 4CUAA 1B09A 4JRAA 1W9FA 5DZGA 4RYDA 3MEPA 2PAEA 4NR1A 2JDMA 1IQDC 1ZZBA 1JODA 4CCNA 3KM5A 2QTWB 5DZEA 2OW4A 1P8JA 1VBD2 3A23A 3VDAA 3TEWA 2MEV3 5FXZA 1LOFC 1Y43B 2VNVA 3LDKA 4LO5B 5CB7A 3WVJA 1GUIA 1RVF2 4NPMA 3UV9A 5JSOA 3GCXA 2EICA 4HPKB 4BWOA 3AJYA 5FZAA 1N47A 3CKHA 1FOD1 1JZ6A 3GZUC 1SPPA 2WFF2 4R4ZA 4QPIA 5F2SA 2D5HA 4BDVB 4K7JA 3O1OA 5HCHA 1QXPA 5IFPA 2Y0IA 5LEJA 4LTAA 1VBB2 5FYUA 3WP4A 3ATGA 5FUPA 1OMIA 1AR83 3EXUA 2CWSA 5A1FA 3AP4A 5FPZA 3EQEA 3KHBA 4FFIA 5JR7B 3BGAA 4CP0A 1XYOA 4RGGA 4IGQA 1SLBA 4NWVA 5IVFA 5CYYA 1VBA3 3P5BA 3T2TA 4N9IA 3OPTA 2HWD2 1ND3A 5CADA 5DQ0A 5IAVA 1VIWB 4NAOA 1RTVA 4YZ4A 1PO13 3WCRA 5IVBA 1LOFA 1QJFA 2LRPA 4K20A 3J7HA 5A7SA 1X8EA 3U1XA 5FK7A 2BNOA 2ENRA 2ZEWA 3WNKA 2W1WA 1AYM1 2ID4A 3S7IA 1JS9A 1K42A 3ON7A 3HR9A 4OMCA 1AZDA 1WWYA 4JX0A 4EN0A 5J48A 1OBNA 3GNEA 1DDLA 1GV9A 1I5PA 4JAAA 1AL21 4KWUA 1A6CA 5A7WB 1F31A 1IG0A 4GWNA 2PHXA 3EMRA 4EYUA 4MXVA 1JN2P 5BNQA 4LUMA 3RZHA 1R1A3 3NO8A 4AQ2A 1R1A2 2VOVA 5CA6A 4LBQA 1W6NA 2VGDA 1YFYA 1COV1 2VNRA 4BLIA 2EXIA 1YQ2A 2VMCA 5A7PA 4FPLA 5BNOA 5GKAC 1GWLA 3SISA 3WP5A 1G7YA 3RYPA 1JZ3A 3W20A 1K5MA 2WUHA 3GBFA 2V73A 1C8M1 2IUWA 3AZWA 2XB6C 1W2UA 5LK5A 2BFUL 2JD9A 3HBZA 2OXBA 4MGQA 1LHUA 2VQ0A 3B5LB 5J36A 1OLME 2DVFA 3ACHA 1KQRA 1OKOA 5HV4A 1OQDA 4HSJA 4AG4A 2K46A 3ACIA 3UKNA 4CEWA 2E7TA 2GAUA 4XFAA 4META 2Z42A 1FPN1 2QCSB 5FPUA 3AXEA 1GQGA 1QWRA 4HOOA 2OS2A 5FYBA 4EN9B 3AC0A 4FP3A 1U12A 4OUEA 1W3XA 1YEWA 4JDMA 5JOWA 3R05A 3GF6A 3LOBA 1OA3A 4OI0A 2V4AA 3ZDSA 3JQWA 1OLQA 1LAJA 2Y6HA 5BNPA 2ZGSA 5JXHA 2C9AA 1EV11 2PXJA 1FI2A 1UMZA 5JSRA 4Q4W2 5C8WA 1E5IA 4GULA 4QKDA 3HAGA 4Q26A 1O8PA 4MLOA 3LEKA 1AYN1 1GNYA 4GWMA 1W6PA 3VBUC 3ZSMA 4LHNA 4BXFA 2FDKA 1UXXX 3CMGA 4QGNA 1QXJA 1VBD3 4XC9A 5DG1A 3O14A 1MVQA 1WW6A 5T5LA 3VDBA 4CXYA 1IZ3A 2NP0A 3WF2A 5L9VA 4LBLA 4AVVA 2HEVF 4DQAA 2KR2A 5C3SA 1UY2A 4FI9A 3USSA 4MHUA 4X8NA 2Q0AA 4YFZA 3I2KA 1YLLA 1AX1A 1V6JA 4Q0QA 4QT6A 5BNNA 4K8FA 2R072 5A32B 5T5OA 2ZAAA 4MGYE 2JXAA 2RS32 3AZVA 5CKNA 4CDUC 2VZUA 5HI0A 1AR73 2D3PA 4Q29A 1NY71 4QPGA 4E27A 5GZGA 2JG8B 2RMU2 3PVNA 4UF0B 5K9YA 5L7OC 1PGW2 1CVNA 3I2GA 3V0BB 3J26N 1HX6A 3T2OA 4DOUA 1F2NA 2XONA 4CU8A 5FY1A 4LOTA 2H0VA 2ZX0A 2BRTA 1XB9A 4B3NA 3V56A 5DXDA 2TNFA 2JE9A 4BLJA 4COYA 4CP2A 4HPKA 2X8KA 4E9KA 5JMCA 1X9TA 5DDJ2 4XIOA 3WQ7A 4MX3A 3LB9A 4PBPA 5LWBA 5F7UA 2WZR2 2D6KA 4BK5A 2MEV1 3TN91 4P5HA 1BCXA 4IV3A 1WD4A 3ZPOA 3NV4A 4W4ZA 1SG3A 2BOIA 1C57A 4BIFA 2RM23 4AI3A 5HBAA 2ZBJA 2PN5A 1JXNA 2VG9A 4BQYA 2R16A 1YJKA 1VRH1 2D93A 1AYM3 1W05A 3N9MA 4AAPA 1ZZ7A 4FQZA 3MUZ1 1ZM1A 1PVC3 2ZZJA 5FMBA 1C4RA 1C1FA 1FXZA 1AL0G 1WGPA 4EN6B 5BV6A 1PK6A 3KZ4C 5HV0A 1UAIA 3BPSA 1LESA 1NE6A 1X9PA 2RR11 3KT7A 1JYWA 3I2OA 4HT1T 1RMU3 2BFUS 1RMU2 2EA7A 4LHSA 1AF9A 4YGBA 2ZMKA 2WQZC 2P3JA 2I07B 1OXCA 4ZU5A 1AL22 1GKBA 2VMEA 4XQWA 5GLZA 1VMJA 4FOQA 4XTPA 4Y1UA 5DAWA 3RNSA 1FV3A 1C8NA 5FZKA 4IV3B 4M0HA 5CEHA 3I49A 2I74A 1DQ5A 3QH6A 4ZZ5A 1BVVA 4H3WA 2W08A 1XPWA 1H8TB 2QE3A 3VBOA 1DZQA 2E53A 4PLNA 1NLRA 5FUIA 2ES3A 2D43A 4AEMA 3WOGA 3U0ZA 3OD0A 2Q1ZB 1D0GA 3T09A 2GH8A 4TN7A 5KR7A 3N4MA 3WNXA 1ODNA 4GB32 1PO21 3GZEA 2FDHA 2A6VA 1AVBA 5CG8A 4N9HA 1C5HA 1VBE2 1UW8A 1LB2A 5FY8A 4LBQD 4C0HA 4NOTA 3VL8A 2ADDA 3SKJE 4BK4A 2AUYA 2F4LA 2GNMA 5JI9A 2W52A 4Y24A 5EHDA 5GJ6A 3EYPA 3THTA 4DINB 4TSVA 3WNNA 3ZFGB 4EN8B 1Q8PA 1HDKA 2OPKA 2VCAA 1H6YA 2WIIB 4RGKA 1SHWB 5D8AC 5HCBA 3KT4A 2BGPA 1L3JA 4O7XA 3OB8A 2VC9A 2RS33 2BBVA 2B7YA 3NVCA 4IUGA 4LORA 1MS0A 4W6XA 3VHOA 3OUJA 3IN9A 1TNFA 4DO0A 3ZOIA 3UGFA 3WDWA 4XFHA 1OOPA 4OZOA 5H9PA 4Q5OA 3LGRA 2QNKA 1G8WA 4YW4A 4L2NA 1VBD1 2JDAA 2X10A 3NSTA 4YYOA 1W2OA 3JU9A 3H8OA 2JDHA 1ASJ2 5B4NA 1CJDA 1W04A 1YFXA 3OEBA 1PM4A 4HKOA 2PHFA 1O5UA 4YM2A 2VBDA 2P3YA 1RB8G 4AK3A 2BOJA 3JUUA 4A44A 1AR61 5FPAA 2VVEA 3AMMA 3WLUA 4BU2A 1QJY1 1DGRN 3CJIA 3WT3A 2IFRA 4CDQB 3VD7A 3OYWB 1JYCA 3RFRA 3OEAA 3H3ZA 4Q4W1 1JH5A 1LOCA 3VBSC 4C1WA 3VD4A 4Z92B 3EB7A 4NHLA 3VKLA 3MLJA 1QH6A 1HXS1 2VUAA 2R7EB 3VZMA 1LHOA 3OGSA 5TSWA 4FXKB 1A8MA 2RDNA 3DKQA 2ARBA 4HBNA 2R043 2A3WA 3VZJA 1DLCA 1W0OA 3JQXA 1BQPA 1MZ5A 3CO2A 3VB9A 3AM2A 3H1WA 2VZPA 2YHJA 4XETA 2P6CA 1GWKA 3MW2A 4IE6A 2HH9A 4M4PA 4N53B 4RQPB 5K0UC 1YI9A 2GC3A 4XF3A
chains in the Genus database with same CATH topology
1LNSA 3C7EA 1PMJX 2Y6JA 2WQ8A 1GMMA 4DEVA 2QQNA 3LE0A 4MGSA 3CIHA 4TXWA 2DCJA 4XUQA 2RJ2A 3P6BA 3LPGA 3WNOA 4XVHA 3ACGA 4CUCA 1UX7A 5HXMA 1J83A 2B9VA 3WF0A 2YC2A 3C8XA 4W50A 1W9WA 4QB2A 3CZUA 5IFTA 1GU3A 3LEIA 2QQIA 2W9XA 4KI5M 3NRUA 2VMFA 3T0BA 4RN5A 2ZEYA 4W8JA 3HN3A 3LQCA 1EUTA 3WNLA 1OT5A 4GWJA 3MUY1 1OF3A 2J1UA 2VZVA 3C7GA 2C4XA 4KMQA 2YFZA 1CZTA 2EIEA 1RYYA 1UMIA 4P00B 2WN2A 3SEEA 3IAPA 2WZ8A 3P1IA 4ZZ8A 1L7QA 3IIIA 4XUTA 4QPWA 2W46A 3I2JA 3NNGA 1OH4A 3HOBA 2YB7A 4CVUA 5G05L 1UWWA 2WAAA 1DYOA 3IDAA 3HPNA 1PX3A 2WDBA 2ORZA 4DXSA 1US3A 2VR4A 4PQQA 4XUOA 3WEZA 3I3EA 2J7MA 2W5FA 3T2QA 2HYXA 3W5NA 5B4XA 4DEQA 2J1EA 2V72A 3THCA 2Y6LA 3E1F1 4DUWA 4D8MA 2JKXA 3I2IA 4QB6A 4GZ9A 4GWIA 3NQHA 4YPJA 3D3AA 4XUPA 4P5YA 1KGYA 2ZXQA 3CDZB 1JU4A 4A41A 4CUBA 3W5MA 2XOMA 2VZTA 3HJRA 1TG7A 2V5DA 2VZOA 1OD3A 4E8DA 3HNYM 3I2FA 3C7FA 2J1SA 3VD9A 3A7QA 3K4DA 3OGVA 4JKKA 3UETA 5IJRA 4P08A 3PUHA 5JXIA 2VL4A 2BERA 3VD3A 2BGOA 2J1TA 4P02B 4ZY9A 3WF1A 3C7OA 4QDRA 1JZ4A 1WKYA 5DMYA 3LPFA 1UY3A 3ACFA 3K4AA 1JU3A 2VZSA 5EIYB 1ULPA 3ECQA 4QX1A 2VCCA 3WNMA 4A4AA 4QB1A 3A21A 4QDSA 4Z2AA 2YG0A 3MV11 4DXTA 2HLEA 3THDA 3OG2A 4M4RA 5G04L 1US2A 3PUIA 1D7PM 2J1VA 3FL7A 3GDBA 2XQXA 1JYXA 3CZJA 3MV01 5LA2A 1JI6A 4DUVA 1GOGA 4ZXEA 3A22A 1W9SA 4ARYA 3K75B 1O59A 4JKLA 4DXRA 3WNPA 3C7HA 5LCWL 4CUAA 4CU6A 1W9TA 4RYDA 1UY4A 5JXGA 2WZEA 1IQDC 2OKXA 1XC6A 1P8JA 3A23A 3VDAA 1GUIA 2EICA 3CKHA 2X09A 1JZ6A 3UNPA 2J1RA 3NJVA 2X05A 4BDVB 1DP0A 2VQUA 5IFPA 1JYVA 1W8NA 2EIBA 3ZM8A 3BGAA 3I2HA 4JHZA 1JZ8A 1UY0A 3NJXA 2DCKA 5CYYA 3ABZA 3CQOA 1NAEA 2XHNA 4UOJA 5DQ0A 1SDDB 1PX4A 4PT6A 2QBXA 2Y64A 3OBAA 3T0DA 1JZ5A 3J7HA 2E33A 1R64A 1K3IA 2ZEWA 3WNKA 2VTFA 2W1WA 2ID4A 4UAPA 2WO3A 1UYXA 1K42A 3GGLA 1UMHA 4OMCA 4JX0A 4XZUG 2Y6KA 4UI9L 3WSOA 1I5PA 4AAXA 2QQLA 4KWUA 3VD5A 4DUXA 2VZRA 4TTGA 2E31A 1H6XA 1ULOA 1KEXA 5DN2A 2VZ3A 2CDOA 2C26A 5HPOA 3HNBM 2WBKA 2KD7A 5JR2A 1YQ2A 2VMCA 2W1SA 2C9KA 2RV9A 3FHAA 3HEIA 2J22A 2VO5A 1JZ3A 2VCBA 1NX9A 2WUHA 1UYZA 1W99A 2JD9A 4MGQA 2B4KA 3I97A 3IAQA 4L0PA 3ACHA 2CDPA 2WABA 1GOFA 2ZEXA 5J1XA 2QQOA 4QX3A 4MADA 4XURA 3ACIA 4AG4A 1F4HA 3T08A 3WF3A 1GOHA 2VMDA 3AC0A 3BN6A 4OUEA 5CZKA 3GXUA 1UY1A 2Z4FA 1F4AA 3MO4A 1JHJA 3T0AA 4JKMA 2Y6HA 5JXHA 2Y8KA 4BXSV 5IYYA 5EJ1B 3WF4A 1HN1A 2JE8A 2DDUA 2ORXA 1O8PA 3LEKA 1GNYA 2VQTA 1CZVA 2LW8A 2W87A 1UXXX 3CMGA 3JXSA 2PQSA 3VDBA 2WAOA 3FHQA 3WF2A 4QDQA 2ZEZA 4A45A 1UY2A 2W1QA 4A42A 4FI9A 4LPLA 4OMDA 1CIYA 5I0DA 5LA1A 3I2KA 1TVGA 2W94A 3T2PA 2J1AA 4E8CA 4A3ZA 2VZUA 1K45A 1W0NA 1MPXA 1UYYA 2BZDA 2WO1A 3I2GA 3MBWA 5JUVA 3T2OA 2XONA 4CU8A 2W92A 5C71A 5LA0A 3SEPA 4QX2A 3K77A 5F7UA 3OGRA 4BK5A 2W1UA 5C70A 3HNMA 3GM8A 3IB3A 4W4ZA 1SG3A 3DECA 1JZ7A 1JYNA 5JMOA 5C7GA 2WO2A 2VJXA 4XUNA 2W3JA 5JXJA 3MUZ1 2W91A 4MO3M 1JZ2A 1OF4A 2QQJA 3K4ZA 1JYWA 2YFUA 2RVAA 2W47A 4LHSA 2YC4A 5EJZB 2VMEA 1O8SA 3VDCA 2VOTA 2V4VA 3ETPA 2E26A 2WN3A 2L9LA 1UXZA 4ZZ5A 1XNTA 4LQRA 1XPWA 2E32A 1EUUA 3DYMA 2VZ1A 5FUIA 3I3BA 1UZ0A 4BJ0A 3T09A 3I3DA 4QAWA 1BHGA 4MOAA 4LKSA 2LS6A 2W95A 1CZSA 3UESA 2VM9A 2QQMA 3SKJE 4BK4A 1W8OA 1CX1A 1L7RA 1XNAA 3EYPA 3WNNA 4HG6B 5A1AA 2VCAA 1H6YA 3FN9A 1SHWB 2BBAA 4PF1A 2QQKA 2BGPA 3OB8A 2VC9A 3SKVA 4CU7A 1NUKA 4IUGA 1T2XA 4OZOA 4ET7A 1K12A 4D0QA 5DPNA 2JDAA 2X10A 5B4NA 5IHRA 4CU9A 3OEBA 3DYPA 1GQPA 4OYUA 4A44A 2WYSA 3WQBA 3DYOA 3U37A 3VD7A 4A6OA 3OEAA 2EIDA 3LEGA 3VD4A 1PMHX 3EB7A 3F2ZA 2R7EB 1J84A 3K46A 3OGSA 1NKGA 1WCQA 1DLCA 2VZQA 2VZPA 4M4PA 2Y6GA 4ARXA 4QX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNS A;  3C7E A;  1PMJ X;  2Y6J A;  2WQ8 A;  1GMM A;  4DEV A;  2QQN A;  3LE0 A;  4MGS A;  3CIH A;  4TXW A;  2DCJ A;  4XUQ A;  2RJ2 A;  3P6B A;  3LPG A;  3WNO A;  4XVH A;  3ACG A;  4CUC A;  1UX7 A;  5HXM A;  1J83 A;  2B9V A;  3WF0 A;  2YC2 A;  3C8X A;  4W50 A;  1W9W A;  4QB2 A;  3CZU A;  5IFT A;  1GU3 A;  3LEI A;  2QQI A;  2W9X A;  4KI5 M;  3NRU A;  2VMF A;  3T0B A;  4RN5 A;  2ZEY A;  4W8J A;  3HN3 A;  3LQC A;  1EUT A;  3WNL A;  1OT5 A;  4GWJ A;  3MUY 1;  1OF3 A;  2J1U A;  2VZV A;  3C7G A;  2C4X A;  4KMQ A;  2YFZ A;  1CZT A;  2EIE A;  1RYY A;  1UMI A;  4P00 B;  2WN2 A;  3SEE A;  3IAP A;  2WZ8 A;  3P1I A;  4ZZ8 A;  1L7Q A;  3III A;  4XUT A;  4QPW A;  2W46 A;  3I2J A;  3NNG A;  1OH4 A;  3HOB A;  2YB7 A;  4CVU A;  5G05 L;  1UWW A;  2WAA A;  1DYO A;  3IDA A;  3HPN A;  1PX3 A;  2WDB A;  2ORZ A;  4DXS A;  1US3 A;  2VR4 A;  4PQQ A;  4XUO A;  3WEZ A;  3I3E A;  2J7M A;  2W5F A;  3T2Q A;  2HYX A;  3W5N A;  5B4X A;  4DEQ A;  2J1E A;  2V72 A;  3THC A;  2Y6L A;  3E1F 1;  4DUW A;  4D8M A;  2JKX A;  3I2I A;  4QB6 A;  4GZ9 A;  4GWI A;  3NQH A;  4YPJ A;  3D3A A;  4XUP A;  4P5Y A;  1KGY A;  2ZXQ A;  3CDZ B;  1JU4 A;  4A41 A;  4CUB A;  3W5M A;  2XOM A;  2VZT A;  3HJR A;  1TG7 A;  2V5D A;  2VZO A;  1OD3 A;  4E8D A;  3HNY M;  3I2F A;  3C7F A;  2J1S A;  3VD9 A;  3A7Q A;  3K4D A;  3OGV A;  4JKK A;  3UET A;  5IJR A;  4P08 A;  3PUH A;  5JXI A;  2VL4 A;  2BER A;  3VD3 A;  2BGO A;  2J1T A;  4P02 B;  4ZY9 A;  3WF1 A;  3C7O A;  4QDR A;  1JZ4 A;  1WKY A;  5DMY A;  3LPF A;  1UY3 A;  3ACF A;  3K4A A;  1JU3 A;  2VZS A;  5EIY B;  1ULP A;  3ECQ A;  4QX1 A;  2VCC A;  3WNM A;  4A4A A;  4QB1 A;  3A21 A;  4QDS A;  4Z2A A;  2YG0 A;  3MV1 1;  4DXT A;  2HLE A;  3THD A;  3OG2 A;  4M4R A;  5G04 L;  1US2 A;  3PUI A;  1D7P M;  2J1V A;  3FL7 A;  3GDB A;  2XQX A;  1JYX A;  3CZJ A;  3MV0 1;  5LA2 A;  1JI6 A;  4DUV A;  1GOG A;  4ZXE A;  3A22 A;  1W9S A;  4ARY A;  3K75 B;  1O59 A;  4JKL A;  4DXR A;  3WNP A;  3C7H A;  5LCW L;  4CUA A;  4CU6 A;  1W9T A;  4RYD A;  1UY4 A;  5JXG A;  2WZE A;  1IQD C;  2OKX A;  1XC6 A;  1P8J A;  3A23 A;  3VDA A;  1GUI A;  2EIC A;  3CKH A;  2X09 A;  1JZ6 A;  3UNP A;  2J1R A;  3NJV A;  2X05 A;  4BDV B;  1DP0 A;  2VQU A;  5IFP A;  1JYV A;  1W8N A;  2EIB A;  3ZM8 A;  3BGA A;  3I2H A;  4JHZ A;  1JZ8 A;  1UY0 A;  3NJX A;  2DCK A;  5CYY A;  3ABZ A;  3CQO A;  1NAE A;  2XHN A;  4UOJ A;  5DQ0 A;  1SDD B;  1PX4 A;  4PT6 A;  2QBX A;  2Y64 A;  3OBA A;  3T0D A;  1JZ5 A;  3J7H A;  2E33 A;  1R64 A;  1K3I A;  2ZEW A;  3WNK A;  2VTF A;  2W1W A;  2ID4 A;  4UAP A;  2WO3 A;  1UYX A;  1K42 A;  3GGL A;  1UMH A;  4OMC A;  4JX0 A;  4XZU G;  2Y6K A;  4UI9 L;  3WSO A;  1I5P A;  4AAX A;  2QQL A;  4KWU A;  3VD5 A;  4DUX A;  2VZR A;  4TTG A;  2E31 A;  1H6X A;  1ULO A;  1KEX A;  5DN2 A;  2VZ3 A;  2CDO A;  2C26 A;  5HPO A;  3HNB M;  2WBK A;  2KD7 A;  5JR2 A;  1YQ2 A;  2VMC A;  2W1S A;  2C9K A;  2RV9 A;  3FHA A;  3HEI A;  2J22 A;  2VO5 A;  1JZ3 A;  2VCB A;  1NX9 A;  2WUH A;  1UYZ A;  1W99 A;  2JD9 A;  4MGQ A;  2B4K A;  3I97 A;  3IAQ A;  4L0P A;  3ACH A;  2CDP A;  2WAB A;  1GOF A;  2ZEX A;  5J1X A;  2QQO A;  4QX3 A;  4MAD A;  4XUR A;  3ACI A;  4AG4 A;  1F4H A;  3T08 A;  3WF3 A;  1GOH A;  2VMD A;  3AC0 A;  3BN6 A;  4OUE A;  5CZK A;  3GXU A;  1UY1 A;  2Z4F A;  1F4A A;  3MO4 A;  1JHJ A;  3T0A A;  4JKM A;  2Y6H A;  5JXH A;  2Y8K A;  4BXS V;  5IYY A;  5EJ1 B;  3WF4 A;  1HN1 A;  2JE8 A;  2DDU A;  2ORX A;  1O8P A;  3LEK A;  1GNY A;  2VQT A;  1CZV A;  2LW8 A;  2W87 A;  1UXX X;  3CMG A;  3JXS A;  2PQS A;  3VDB A;  2WAO A;  3FHQ A;  3WF2 A;  4QDQ A;  2ZEZ A;  4A45 A;  1UY2 A;  2W1Q A;  4A42 A;  4FI9 A;  4LPL A;  4OMD A;  1CIY A;  5I0D A;  5LA1 A;  3I2K A;  1TVG A;  2W94 A;  3T2P A;  2J1A A;  4E8C A;  4A3Z A;  2VZU A;  1K45 A;  1W0N A;  1MPX A;  1UYY A;  2BZD A;  2WO1 A;  3I2G A;  3MBW A;  5JUV A;  3T2O A;  2XON A;  4CU8 A;  2W92 A;  5C71 A;  5LA0 A;  3SEP A;  4QX2 A;  3K77 A;  5F7U A;  3OGR A;  4BK5 A;  2W1U A;  5C70 A;  3HNM A;  3GM8 A;  3IB3 A;  4W4Z A;  1SG3 A;  3DEC A;  1JZ7 A;  1JYN A;  5JMO A;  5C7G A;  2WO2 A;  2VJX A;  4XUN A;  2W3J A;  5JXJ A;  3MUZ 1;  2W91 A;  4MO3 M;  1JZ2 A;  1OF4 A;  2QQJ A;  3K4Z A;  1JYW A;  2YFU A;  2RVA A;  2W47 A;  4LHS A;  2YC4 A;  5EJZ B;  2VME A;  1O8S A;  3VDC A;  2VOT A;  2V4V A;  3ETP A;  2E26 A;  2WN3 A;  2L9L A;  1UXZ A;  4ZZ5 A;  1XNT A;  4LQR A;  1XPW A;  2E32 A;  1EUU A;  3DYM A;  2VZ1 A;  5FUI A;  3I3B A;  1UZ0 A;  4BJ0 A;  3T09 A;  3I3D A;  4QAW A;  1BHG A;  4MOA A;  4LKS A;  2LS6 A;  2W95 A;  1CZS A;  3UES A;  2VM9 A;  2QQM A;  3SKJ E;  4BK4 A;  1W8O A;  1CX1 A;  1L7R A;  1XNA A;  3EYP A;  3WNN A;  4HG6 B;  5A1A A;  2VCA A;  1H6Y A;  3FN9 A;  1SHW B;  2BBA A;  4PF1 A;  2QQK A;  2BGP A;  3OB8 A;  2VC9 A;  3SKV A;  4CU7 A;  1NUK A;  4IUG A;  1T2X A;  4OZO A;  4ET7 A;  1K12 A;  4D0Q A;  5DPN A;  2JDA A;  2X10 A;  5B4N A;  5IHR A;  4CU9 A;  3OEB A;  3DYP A;  1GQP A;  4OYU A;  4A44 A;  2WYS A;  3WQB A;  3DYO A;  3U37 A;  3VD7 A;  4A6O A;  3OEA A;  2EID A;  3LEG A;  3VD4 A;  1PMH X;  3EB7 A;  3F2Z A;  2R7E B;  1J84 A;  3K46 A;  3OGS A;  1NKG A;  1WCQ A;  1DLC A;  2VZQ A;  2VZP A;  4M4P A;  2Y6G A;  4ARX A;  4QX0 A; 
#chains in the Genus database with same CATH topology
 2XLF A;  1RHI 3;  4OI4 A;  2XL7 A;  4S2G A;  5FZG A;  2BPA 2;  1WLD A;  4N43 A;  2HWD 3;  4X6Q B;  4XUQ A;  5EWS A;  4P9I A;  5LBB A;  2XXZ A;  3GBG A;  3WNO A;  3P3P A;  2XBO 2;  1RUF 2;  4ISQ A;  4PIX A;  2R06 2;  2A6W A;  4YW2 A;  3RJ2 X;  4CUC A;  3N9N A;  1RUN A;  3R6S A;  2XKP A;  3N9P A;  4LOS A;  3N36 A;  3ZSJ A;  2IXL A;  3U14 A;  1UCX A;  1DFQ A;  1SBD A;  4BA6 A;  4XEZ A;  1GU3 A;  1PGL 2;  1N1S A;  5A80 A;  1YQ6 A;  2HKX A;  1OFS A;  1LJ7 A;  2JDP A;  2UWB A;  3GAL A;  2CL2 A;  4KI5 M;  5FFO C;  4FOY A;  5BNN C;  1CAW A;  4CYD A;  5KHJ A;  4XMI A;  1LGC A;  5FOB B;  5DAQ A;  5LY2 A;  1YHF A;  4IGP A;  1QNW A;  2Z2S B;  2Q8D A;  5LRR A;  5AFE A;  2UY9 A;  2TEP A;  3IZO A;  3DXU A;  2WNV B;  3NNJ A;  4DNY A;  1N3O A;  3WP6 A;  1ULF A;  4XDP A;  4XF4 A;  1FPN 3;  3AYA A;  5JZG B;  4NVP A;  1NG0 A;  1UF2 C;  2YFZ A;  2NLR A;  1CZT A;  3AVS A;  1RYY A;  3AYD A;  3SIT A;  3IAP A;  2WZ8 A;  3KLS A;  1VB4 A;  1H2L A;  4K40 A;  4LLF A;  2WQ4 A;  3NAP C;  1TE1 B;  4NRQ A;  1DGL A;  4EZH A;  2NPI A;  3THP A;  4MYE A;  2WSV A;  5G05 L;  5T54 A;  5J37 A;  2IC1 A;  3I59 A;  1AX2 A;  4YNI A;  1ASJ 1;  2WAA A;  4FXG B;  2I45 A;  1PX3 A;  3CJI B;  3S0M A;  2WDB A;  2ORZ A;  3NWK A;  4C8D A;  1US3 A;  2HBT A;  2OYZ A;  5KC5 A;  4G3Y C;  4CEY C;  1RUC 3;  3ZXA C;  3WEZ A;  2HWE 2;  1AHS A;  1FNY A;  3OJB A;  1SAC A;  1S0C A;  2RJL A;  4NIG A;  5B4X A;  4O9G A;  3E5X A;  1WCU A;  4IW3 A;  3THC A;  3EO6 A;  2XLA A;  4FPE A;  5GLT A;  3VBR C;  4CCE A;  5IT6 A;  4DUW A;  3ZN6 B;  1MQT A;  4FPY A;  1QDO A;  3AKP A;  3KV5 A;  4RGA A;  5FXV A;  2GDF A;  2JKX A;  1ZZC A;  5A3O A;  3RMY A;  3USU B;  5C6C A;  4LBQ B;  1GFF 2;  3CHX A;  4GWI A;  5FYT A;  4AVB A;  3QOP A;  3D3A A;  3LIH A;  4EWD A;  4GA9 A;  1KGY A;  4UT5 A;  1G9C A;  1AJK A;  2OPW A;  2XOM A;  3HJR A;  5ERL A;  3ZN5 A;  2RDS A;  3ALQ A;  1VBE 1;  5GAL A;  4AFD A;  5C3Q A;  4AHX A;  4XW3 A;  5ANN A;  2VZO A;  4WVV A;  2J42 A;  4Z82 A;  1S2B A;  3I2F A;  4IE0 A;  3URF A;  1JOB A;  3VD9 A;  2YU2 A;  3RMX A;  3JD7 3;  3NJY A;  1CAW B;  4FOW A;  4I0B A;  2FCT A;  1FOD 3;  2X5I C;  2WJS A;  3A7Q A;  4K3U A;  3LZZ A;  2GU9 A;  4CP9 A;  4GIQ A;  4YFW A;  2FZ2 A;  4JKK A;  5FZ9 A;  4R4X A;  1HJF A;  4DB5 A;  4NMI A;  5A3L A;  2BWA A;  4CEW C;  5FTT C;  3CL1 A;  2BER A;  4M01 A;  1AR8 1;  1ZRF A;  2RE9 A;  1J1L A;  1W2A X;  2D7F A;  2WNV A;  2J1T A;  5LEK A;  4OLL A;  3D0J A;  4ZY9 A;  4ZU7 A;  2ZAC A;  4YM1 A;  4MXW A;  2BP6 A;  3C7O A;  3J8F 3;  1WW7 A;  2AYH A;  4Q27 A;  4Q4V 2;  1RUJ 1;  1S0J A;  1ND2 A;  3ACF A;  4WV8 A;  3AL5 A;  2VZS A;  5F1R A;  3NV2 A;  2C5D A;  1LUL A;  3CJX A;  2XBO 3;  3BB6 A;  3U78 A;  2WZP P;  1ZBA 2;  4N8M A;  5C8C B;  2GND A;  3E6B A;  4HZF A;  4TLG A;  4YGD A;  4BQX A;  1ZRC A;  2HLE A;  3FLR A;  3H8U A;  1G9B A;  1LRH A;  3ORJ A;  3AYC A;  1V6M A;  2AGS A;  1RHI 2;  3M3Q A;  1KDK A;  1H9W A;  2IZW A;  1JOP A;  4KWK A;  1ZRI A;  4E4S A;  4I2O A;  4Y4Y A;  2YDE A;  2OX0 A;  1S2K A;  5LBE A;  2J1V A;  4PLM A;  1QHD A;  1W6O B;  2C6S A;  1X33 A;  2ZS6 B;  4NUB A;  5L7O A;  3LDB A;  3PME A;  4IE4 A;  1G9F A;  4LO8 A;  1JYX A;  3CZJ A;  4CP1 A;  4LIT A;  3MV0 1;  5LA2 A;  4BQW A;  2BTV C;  4DUV A;  4AI0 A;  2WA3 A;  4CCD A;  3O1R A;  1GSL A;  3H7J A;  5C8C C;  4ZXE A;  2UU8 A;  3AMP A;  1IOA A;  1FT9 A;  1NCQ C;  4Q4Y 2;  4XQ4 A;  3UJQ A;  4V1P A;  1HRI 3;  4LIU A;  4TLF A;  3AP6 A;  1O59 A;  4LXL A;  5FRE A;  4DXR A;  3SC7 X;  3TN9 3;  1OUX A;  2BWC A;  3VKF C;  1FNZ A;  5LCW L;  2A1X A;  3QAC A;  4SBV A;  2NQY A;  3B9C A;  4WZF A;  2H6B A;  3FHI B;  3APB A;  5L9R A;  4CU6 A;  1W9T A;  4I0A A;  4FAH A;  1UY4 A;  1RVF 1;  2MNG A;  4AF9 A;  2OKX A;  4LT5 A;  3J7M A;  1XC6 A;  2OII A;  3ACL A;  3BKZ A;  4UW4 A;  3WW2 A;  4NHX A;  3MIB A;  2XJU A;  2ZGU A;  3M1H A;  5FP9 A;  4XJU A;  4Q0S A;  2RR1 2;  2X09 A;  3VHP A;  2Q4S A;  4GMP 0;  5CKQ A;  2LTN A;  5JSP A;  3N3H A;  2X05 A;  1W28 A;  1ST8 A;  4P9Y A;  5F5Q A;  1GP4 A;  1Q8V A;  2Q1M A;  1JYV A;  4IND A;  2DUR A;  2EIB A;  1OPM A;  4K9S A;  3ZXJ A;  3ZM8 A;  5H9Q A;  1NE4 A;  4D6Q A;  1UY0 A;  3NJX A;  5FZB A;  3M70 A;  3ZSK A;  4YW1 A;  4RHV 1;  3KVB A;  3PTR B;  1RL3 A;  1STM A;  4WBB A;  2XHN A;  4OUM A;  5FP4 A;  1SDD B;  3JBG 2;  2ET1 A;  1CAV B;  1GQH A;  1PX4 A;  2BVV A;  4PT6 A;  4Q8L A;  5FPL A;  4E4D X;  3OBA A;  2P3K A;  1JZ5 A;  4XE9 A;  1R64 A;  1W8W A;  1K3I A;  1H2N A;  5FPX A;  3MF9 A;  4UAP A;  2GP3 A;  4EJR A;  2WO3 A;  3N7M A;  4XXA A;  2GC0 A;  4ASK A;  1UMH A;  5I0S A;  2WYF A;  2ZAB A;  5KBF A;  1OUR A;  4XCA A;  1DG6 A;  4UI9 L;  2VUJ A;  4OHW A;  5FP3 A;  3WSO A;  1T6G C;  2D97 A;  4AAX A;  4D6S A;  3VD5 A;  1GZC A;  1DQ2 A;  1S1A A;  5F8P A;  2VZR A;  1ZA7 A;  2XJR A;  3QCW A;  5I91 A;  1ULO A;  4Q4X 1;  1KIT A;  5DN2 A;  5IVY A;  5FYZ A;  5LB6 A;  1RUF 1;  1EP0 A;  4XBN A;  2WT0 A;  3KV4 A;  4UBG A;  3OF1 A;  2CDO A;  2C26 A;  2HWC 2;  1OD5 A;  3IIA A;  1RUD 3;  3WG2 A;  1TME 2;  5JR2 A;  1DYK A;  2OT7 A;  2RV9 A;  1QJU 1;  3OBZ A;  2D98 A;  3FHA A;  3AKT A;  2KXL A;  3IPV B;  5FLJ A;  4PIZ A;  1ACC A;  4QXC A;  2VCB A;  4X6R B;  4LJH A;  4YW5 A;  5B2G B;  4YVS B;  4XZP A;  4PI2 A;  5I0R A;  5CVR A;  3AKR A;  2B4K A;  4GJZ A;  1RUH 1;  4A2U A;  4BQ5 A;  3IAQ A;  4YRD A;  1G6N A;  1V9U 1;  2W68 A;  2RJK A;  1AR7 1;  3BOD A;  3POJ A;  5ABJ B;  2CDP A;  2WAB A;  5CKM A;  4AQT A;  1RUC 2;  1MZ6 A;  5J1X A;  2QQO A;  1QJX 1;  2IFW A;  2PHD A;  4LKE A;  3T4V A;  2C24 A;  3LCP A;  5L36 A;  2Y38 A;  3H3L A;  1O4Y A;  3D0S A;  2NYY A;  4J25 A;  4LA3 A;  2JDU A;  2VMD A;  2FDG A;  3BN6 A;  5IVC A;  4GKY A;  5CZK A;  1NZC A;  4AL9 A;  2MHF A;  1UY1 A;  2Z4F A;  5IVJ A;  1F4A A;  3WHT A;  1UIK A;  1PZ9 A;  4GD4 A;  1RUF 3;  3J7N A;  5F6K A;  3WDU A;  3T0A A;  1DGW A;  2ATF A;  3C2U A;  4BME A;  4EN7 B;  3TBD A;  4CE8 A;  2Y8K A;  1RUJ 3;  3ZYG A;  2ARX A;  3M3E A;  3WF4 A;  3SQO A;  4DRV A;  1TNR A;  4B8E A;  2XJT A;  4BQ1 A;  5CFD B;  2ZML A;  3N35 A;  2VQT A;  2A6Y A;  2IVJ A;  3QLQ A;  4AVC A;  2W87 A;  4IE7 A;  1V6L A;  4R9C A;  1N1T A;  3JXS A;  4LIV A;  1MQT C;  4KU8 A;  5DUW A;  3EBR A;  2QQU A;  3VBF B;  5KHI A;  3BTZ A;  2WAO A;  2D3R A;  3KWV A;  2HWE 1;  1O3R A;  4QDQ A;  2R30 A;  4LE3 A;  2O8Q A;  1YQC A;  2W1Q A;  4Y5T A;  4YGE A;  5FR3 A;  1V0A A;  4TZD A;  3N9L A;  1CIY A;  4NN0 A;  1B35 C;  1OQE A;  4Q1R A;  1KFU L;  2R06 1;  2G9Z A;  4UW5 A;  1LGN A;  1QEX A;  4QQH A;  2CWM A;  3ILR A;  3GCW A;  4UW6 A;  2E7Q A;  4XBL A;  1EV1 3;  2IXH A;  4OHZ A;  5AVP A;  4AVS A;  2HWF 1;  4B29 A;  1Q8S A;  4Z8B A;  2DU1 A;  4XCB A;  3DPR A;  3JB8 A;  2QKD A;  2VBB A;  4QKF A;  2CGN A;  4YAR A;  1QOO A;  1EPZ A;  3N9Q A;  2WO1 A;  3MBW A;  4XJA A;  3RDI A;  2ADE A;  4XFI A;  4IEX A;  3OD4 A;  2W92 A;  3Q8B A;  1CIW A;  4HSL A;  3KQR A;  4HN0 A;  1IPK A;  5GLV A;  1AR6 2;  5LA0 A;  1LHN A;  3MPP G;  4QX2 A;  3SEP A;  4Y22 B;  5FBZ A;  3B7M A;  1W8H A;  1F8V A;  4QU1 A;  1EAH 1;  3O0X A;  5J98 B;  3OY8 A;  1YNA A;  2B5H A;  5C70 A;  2VCM A;  3HNM A;  3RI8 A;  3GM8 A;  4LBK A;  4DIQ A;  3AMQ A;  3POI A;  1JZ7 A;  2LAL A;  3UJO A;  1XE0 A;  2G19 A;  3SMH A;  4WVM B;  1QGL A;  1D2S A;  3RZG A;  1ND2 C;  4P9J A;  2ZKN A;  2VW1 A;  4KG8 A;  3W9A A;  4AZZ A;  4QM8 A;  1SMV A;  3TEY A;  2WO2 A;  1QJY 2;  2WR9 A;  4HVR A;  4NRM A;  2VJX A;  4RS5 C;  1COV 3;  1S0F A;  5A3M A;  3U75 A;  4CDQ C;  3VBO B;  4XJ8 A;  1OA2 A;  4P9G A;  1JZ2 A;  1CX4 A;  1KS5 A;  1Z7S 1;  3LEM A;  4UFM A;  2WWS A;  5K4L A;  1AXY A;  1NCR C;  3ZMO A;  1CGP A;  5F3C A;  2WT2 A;  4GQ7 A;  2A5Z A;  2A3X A;  2YC4 A;  5EJZ B;  2JEN A;  5LBC A;  1CAV A;  1UQX A;  3VDC A;  2VMG A;  4A7Y A;  4RR3 C;  1F9K A;  3VBU B;  3WDX A;  5CFC B;  1DZR A;  3HBK A;  3MW4 A;  1DQ6 A;  3ZKY A;  4MGK E;  4BMB A;  1DF0 A;  4CP9 B;  4I30 A;  2NMO A;  3TRS B;  1GP6 A;  2P3I A;  5KXD A;  1EAH 3;  2RS1 2;  4BCU A;  1EYB A;  5FWE A;  4H2A A;  1W6M A;  4QGM A;  4CCC A;  4D7T A;  1H8T C;  1DHK B;  2ETE A;  4BJ0 A;  5LY1 A;  1POV 1;  1Q8O A;  4JGY B;  4Y1Y A;  4QAW A;  3ETQ A;  4MOA A;  4YG6 A;  2C1F A;  1OVP A;  2LRO A;  3LDR A;  4Y1X A;  3VBF A;  1JUH A;  4Y26 A;  5FZ4 A;  3UES A;  1BBT 2;  3WR0 A;  2LM3 A;  2HJI A;  3OPW A;  1W06 A;  3POS A;  4JGZ B;  1WW4 A;  2ZX1 A;  2QQM A;  1W03 A;  3JD7 1;  4CEY B;  1GR3 A;  5BNN B;  5CFD C;  2UYB A;  1UOJ A;  2DV9 A;  1CJP A;  2YC0 A;  5A3T A;  4Y5Z 0;  2ZGN A;  5A3U A;  1KRI A;  2HYK A;  2GAL A;  5E1R A;  5A1A A;  1R08 3;  2BBA A;  3HQX A;  4XPV A;  4LO6 B;  1VBB 3;  1V9U 3;  2JG8 C;  4F8A A;  1V9U 2;  1X8M A;  1OPO A;  3L2Y A;  5FY4 A;  1HB2 A;  3E6C C;  4FAG A;  5FZ1 A;  4R8H A;  3K48 A;  3FX3 A;  1QJX 3;  1GNH A;  4FFG A;  4FP2 A;  3VKO A;  4M3C E;  3WIN E;  4ET7 A;  4D0Q A;  1BYH A;  5DPN A;  3KF5 A;  5IHR A;  1CQ9 A;  2NN8 A;  5FRA A;  3K51 A;  1GLH A;  3UK9 A;  4BQ3 A;  2GMP A;  3DYP A;  3DN7 A;  3MIH A;  5C4W B;  2ZAH A;  2DWR A;  2KM2 A;  5T3N A;  3WQB A;  4FTE A;  1O5L A;  1VAL A;  1O3S A;  2EID A;  4CCJ A;  2UWC A;  3IT8 A;  3F2Z A;  3MHZ A;  1UZY A;  1J84 A;  3K46 A;  1U5I A;  1ZBE 2;  4F83 A;  3BIE A;  3KHC A;  4R9D A;  2BJS A;  2VOX A;  4RFR B;  2QZ2 A;  1E57 A;  3MLK A;  4XQD A;  2GC2 A;  1VRB A;  1ALY A;  3D4K A;  5DDJ 1;  4E2Q A;  3KGZ A;  2QQW A;  4IV1 B;  4RHV 3;  1WCQ A;  4KL1 A;  2RM2 2;  2O14 A;  1QKQ A;  1VLN A;  1LGB A;  4QKN A;  5CNA A;  4CA9 A;  3IWZ A;  1F35 A;  2QDR A;  4Q8K A;  3NNM A;  4YG3 A;  2PFW A;  4I01 A;  3O1M A;  4MGZ E;  2GMM A;  4A7K A;  2WNE A;  4YW6 A;  2RDR A;  4GJY A;  1F5F A;  1LNS A;  2RDQ A;  1PMJ X;  1D0H A;  3VBR B;  5KHG A;  2WQ8 A;  5A6Z A;  5CU1 A;  4MGS A;  4TXW A;  3B93 A;  1BEV 3;  1F5J A;  4LBM A;  3T4H B;  2RJ2 A;  5BNP B;  5K7P A;  3NV1 A;  3TB0 A;  4AR2 A;  1ULD A;  1PHM A;  1S2E A;  3ACG A;  3B9I A;  5I8T A;  1MS1 A;  1PIV 1;  5EPA A;  4YVS C;  1WMX A;  5HXM A;  1QQP 3;  5F5C A;  1VAV A;  2PHW A;  4S2D A;  2BUK A;  4W50 A;  1ZRD A;  3H1M A;  4LA2 A;  2P17 A;  2HWC 3;  2W39 A;  3OUH A;  4FFF A;  2HWB 2;  2FBE A;  2WNU A;  3CZU A;  3JB4 C;  3BIW E;  3F95 A;  3ZFE B;  5EYX A;  4AVA A;  2W9X A;  5EYY A;  5FO9 B;  1KDM A;  1H4H A;  1SLA A;  1JHN A;  2CAU A;  4HET A;  4IEU A;  4RN5 A;  3TNP B;  3WDV A;  4CCO A;  1O4T A;  3KF3 A;  1U5Z A;  1TZO A;  4UFH A;  1MEC 3;  2WS9 3;  1OA4 A;  5IUQ A;  1CES A;  1V00 A;  2B42 B;  2AEY A;  1POV 3;  2JDZ A;  1OF3 A;  4JGZ C;  1VB2 A;  1S0G A;  3PU3 A;  4P9X A;  3C7G A;  1I5Z A;  5ACA 1;  3R4U A;  1DGR A;  4KMQ A;  2D40 A;  1RXG A;  3B69 A;  4P00 B;  3SEE A;  3I7D A;  3N7J A;  2VU9 A;  4ZZ8 A;  1L7Q A;  3III A;  3MF6 A;  5J96 B;  1S0I A;  4QPW A;  1HB1 A;  5IAX A;  1XU2 A;  3I2J A;  1W6Q A;  1OH4 A;  2ZX4 A;  3ZFF B;  4DY3 A;  5T50 A;  5FZO B;  1OSG A;  3HOB A;  4WZC A;  5JIA A;  1O91 A;  4CVU A;  2OQ6 A;  4D7S A;  1V6N A;  1DCS A;  3D8C A;  3GHN A;  4I3G A;  4B4P A;  4W6W A;  5FY5 A;  4LKD A;  5FUN A;  4AXO A;  2ZGK A;  2B39 A;  2ZGT A;  4XJ9 A;  1XNC A;  2V5Y A;  3LFI A;  4UFI A;  3AMH A;  5FJK A;  3AZX A;  2VR4 A;  3WV6 A;  5JZG A;  4PQQ A;  4AW7 A;  5KXC A;  4AED A;  4CTE A;  2WS9 1;  4MSV A;  1MVE A;  1CD3 G;  3C3V A;  2GNB A;  3CU7 A;  4KBB A;  2UYA A;  2EVX A;  3BTX A;  2HYX A;  4QHZ A;  4DEQ A;  1Q3E A;  2J1E A;  4NO4 A;  4XJW A;  2V72 A;  2VW0 A;  1KXG A;  1W8T A;  1UKG A;  1WCK A;  1YI7 A;  2D6M A;  3MYX A;  5EFU A;  4AFB A;  1AYN 2;  2Y6L A;  5C5U A;  2OQ7 A;  1BBT 1;  2XQR A;  2LUW A;  5C33 A;  2VXR A;  3FLT A;  3J8F 2;  1EV1 2;  2UUR A;  3PVE A;  3I8T A;  2WFF 3;  3O12 A;  2ZXQ A;  3CDZ B;  2Y6F A;  1JU4 A;  4WM7 A;  1REE A;  3KCY A;  5F3I A;  5FXX A;  4PLO A;  4FPJ A;  2O0O A;  2ERF A;  1VBB 1;  4NWW A;  1SCS A;  2YPJ A;  1JUI A;  4W65 A;  3LIG A;  2DBI A;  2FCU A;  5FZH A;  1IG3 A;  3VGI A;  1ENR A;  3V0A A;  1W90 A;  3KS7 A;  3G7D A;  1FOD 2;  4LBN A;  4M3C B;  5FZM A;  3SCF A;  1ENS A;  3R0R A;  2UY8 A;  1GBG A;  5FPB A;  5IWF A;  3VKM A;  4OFG A;  3V64 A;  4F7Z A;  1GAN A;  2JB4 A;  1LHW A;  2X5I B;  3VBU A;  3MGU A;  4FT8 A;  3PUH A;  4UF0 A;  2VL4 A;  3H50 A;  3B00 A;  4QWN A;  3WW1 A;  1H1A A;  5JXI A;  1C3H A;  4PDW C;  4MGI E;  2WT1 A;  2CSG A;  2FMY A;  2SLI A;  3WDY A;  3ZFE A;  3ZYF A;  4CXW A;  1SFN A;  2Z5W A;  4WM8 A;  4CDW A;  1MS9 A;  2Q5T A;  2YUE A;  3CBN A;  3SLI A;  2XJS A;  4QDR A;  5M0T A;  4RR3 A;  3TAY A;  4P9W A;  1UIJ A;  2VE1 A;  1UY3 A;  4XFB A;  5FZ8 A;  1WW5 A;  1NYW A;  3NKT A;  3ZN4 A;  4GAL A;  2AH2 A;  3AK0 A;  1C28 A;  4XHB A;  1KJR A;  3S30 A;  5CFC C;  2VCC A;  4KGQ A;  1UYP A;  3WNM A;  4QB1 A;  3AKQ A;  4LK6 A;  3QD6 A;  2YG0 A;  1U5X A;  5C3R A;  3IDE A;  5EQU A;  5DDJ 3;  2QZ3 A;  4N43 C;  1SLL A;  3M7A A;  1MS5 A;  3UKT A;  2BV4 A;  3ZYR A;  3H8X A;  3VLB B;  3ELN A;  3MZH A;  1JMU B;  1RIN A;  4M4R A;  1US2 A;  2VXJ A;  1LKN A;  1D7P M;  2XG3 A;  1JBC A;  3FL7 A;  3GDB A;  2XQX A;  3B02 A;  4XIK A;  3T3Y A;  2E9Q A;  4TWT A;  2XJQ A;  1RIR A;  1JI6 A;  1HQL A;  1NCR A;  3ILF A;  2VVD A;  3MIE A;  5FQ0 B;  2N7G A;  4IEQ A;  4ZS2 A;  1W9S A;  4Y1V A;  5FYC A;  2C0Z A;  2R0H A;  1NCQ B;  5A70 A;  3WUD A;  3KVA A;  1XYN A;  3NNL A;  4O65 A;  1SQ4 A;  1RUG 1;  2FD8 A;  4L99 A;  5JOY A;  4OCT A;  5FOJ B;  2ZA9 A;  1XYP A;  3UKV A;  4Y5S A;  4Q4X 3;  1YO8 A;  5ACA 3;  5JXG A;  1H9P A;  5F32 A;  5FP7 A;  2WZE A;  2R04 1;  3O0W A;  5CBL A;  2E51 A;  5FYI A;  1VRH 2;  3SCH A;  3ZIX A;  2CTV A;  2W2I A;  2CGP A;  1H1M A;  3KCC A;  3V0A B;  1SLT A;  4UYB A;  3OSD A;  4Y22 A;  4AGG A;  4L97 A;  3J4U H;  3UL2 A;  1I6X A;  1QJZ A;  1Y3T A;  5LZ6 A;  3RZL A;  4ZU4 A;  2XVK A;  2RS5 3;  3HQR A;  2VOW A;  4K21 A;  5F3E A;  2ZGO A;  1XU1 A;  4FFH A;  3E5Q A;  1V70 A;  4QMA A;  3NJV A;  3LA3 A;  1DBN A;  2JEM A;  1DP0 A;  4N7I A;  1H2M A;  1SDW A;  2VQU A;  3FZ3 A;  4AGV A;  4BIS A;  1RUI 3;  3M8L A;  4XF1 A;  5KWR A;  2BQP A;  3I4I A;  4QQP A;  5F3G A;  1IPS A;  4CZS A;  4Q0U A;  2BU9 A;  5A33 A;  4JHZ A;  3VZN A;  3ZFG C;  1PZ8 A;  2HEW F;  5GZD A;  4CDX A;  2DCK A;  2V09 A;  5FO8 B;  2BEO A;  5KC6 A;  1QXR A;  3ABZ A;  4NIA A;  1UZZ A;  2PLV 1;  3CQO A;  4KH9 A;  2RR1 3;  2YRO A;  4UOJ A;  5BNO B;  2B8M A;  3ZXF A;  1JW6 A;  2OZJ A;  2Y64 A;  1BBT 3;  1EPW A;  1JTZ X;  3FBY A;  1W6N B;  4COW A;  3ZMN A;  1PNG A;  3VDD C;  3BVC A;  2JG8 A;  1XSQ A;  4YSF A;  1WA6 X;  3N7K A;  1UYX A;  3GHM A;  3LF7 A;  1GZW A;  3GGL A;  4J1W A;  3DPR B;  4XZU G;  4JV4 A;  2Y6K A;  2YU1 A;  4COZ A;  2G1M A;  2QQL A;  4V2W A;  3H9A A;  4K8R B;  1YRZ A;  4G4F A;  3RQ0 A;  1UU4 A;  2ARA A;  1AX0 A;  1KEX A;  4AHZ A;  1RUH 2;  2VZ3 A;  4Q4V 3;  4XIL A;  2ARC A;  4YZ2 A;  1SFY A;  2CYF A;  5L9B A;  4IEW A;  1UZV A;  2XUM A;  2D6L X;  2WBK A;  1HRI 2;  2D6N A;  2KD7 A;  3O5S A;  5KXE A;  5LRS A;  3MW3 A;  1S4C A;  2VD7 A;  1ZRR A;  5FYS A;  3UYJ A;  3PIG A;  2J22 A;  2P4E A;  4DY5 A;  3POG A;  1WLT A;  2FDF A;  3K3N A;  1DQ4 A;  1AR9 1;  3VDD A;  1Q56 A;  3PVB B;  3I97 A;  1XBF A;  4L0P A;  3WHU A;  1WMD A;  2BGC A;  2IXI A;  1KFX L;  1POQ A;  3SH3 A;  2ZEX A;  3MFA A;  4WVM A;  4N43 B;  4XUR A;  4MAD A;  1ND2 B;  4HK8 A;  3TNQ A;  3MIC A;  4HLT A;  1JOJ A;  1F4H A;  3RSJ A;  1ZNP A;  4XFC A;  3DF0 A;  3WF3 A;  4B4R A;  1RUG 2;  2WIN B;  1GZ9 A;  3AFG A;  2VUL A;  4XTM A;  3KD4 A;  1FAY A;  5E8A A;  3I59 B;  1PGW 1;  3MO4 A;  5JCT A;  3ZLI A;  4WM8 B;  4KWJ A;  4CDW B;  4LBJ A;  5A7Q A;  2WRA A;  2KA3 A;  2Y33 A;  4JKM A;  1E5S A;  4OVE A;  4QXB A;  4ZHN A;  1HJG A;  4NII A;  3P3N A;  4BXS V;  1NA1 C;  4GAZ A;  5IYY A;  1JYT A;  1HN1 A;  2JE8 A;  2JKB A;  1MQT B;  2ORX A;  5FMD A;  2A6Z A;  2B9U A;  5L7O B;  2LW8 A;  4RD7 A;  4QXH A;  5C4W A;  1VBE 3;  1ODM A;  1UNB A;  3J7L A;  4QPY A;  5JVV A;  4FTB A;  2R49 A;  4KGG A;  4BB3 A;  4QM9 A;  4ZPI A;  2XJP A;  4ERO A;  4H55 A;  1ZZ8 A;  3S5A A;  2JD4 A;  5IVE A;  3FHQ A;  4AHY A;  2WS9 2;  4WVW A;  5BPX A;  2ZEZ A;  3WD5 A;  2FCV A;  4JGY C;  1B35 B;  3LAG A;  4A6S A;  1VJ2 A;  1VMH A;  4A42 A;  4LPL A;  3IM0 A;  4OMD A;  3WXP A;  1HB3 A;  4YVW A;  5I0D A;  2ZGQ A;  2XPJ A;  1JYI A;  1XE8 A;  4XYX A;  1TVG A;  1GP5 A;  2JDY A;  2XJV A;  1IKP A;  3MI8 A;  3H3U A;  1HRV 2;  2R0F A;  2W94 A;  4C91 A;  4LNV A;  3T2P A;  4E8C A;  1RIT A;  1PMI A;  1BXH A;  4IET A;  2G4I A;  3QH7 A;  4JDO A;  1A3K A;  1FYU A;  2F6B A;  2QVS B;  1MZF A;  1MPX A;  4R52 A;  1M06 G;  2D6P A;  2E7A A;  4HKL A;  1GNZ A;  2OA2 A;  2RS5 1;  5C4W C;  5BNO C;  2D3S A;  1SBF A;  5JUV A;  1ZA4 A;  3AP9 A;  5FZF A;  1IS4 A;  1NA1 A;  1QOT A;  1ULE A;  1WD3 A;  3FBM A;  4XAC A;  1CAU A;  1YC6 1;  2HWE 3;  3ZKU A;  5T55 A;  1KD7 A;  2Y0O A;  5J3U A;  3SH4 A;  1IPJ A;  1Y9M A;  3NKG A;  2VMH A;  2JJ6 A;  4MXW B;  3K77 A;  4FPO B;  4AGR A;  2Q8E A;  1HQN A;  2X53 S;  4YVW B;  2A6X A;  3G6J B;  2W1U A;  3FFZ A;  4DFS A;  3RRD A;  2ZOE B;  1QY4 A;  1CAX B;  3RWK X;  3DEC A;  4HN1 A;  1W6O A;  3WG3 A;  4YZ5 A;  4HKW A;  4EQV A;  1TMF 3;  3AZY A;  1JYN A;  4MGT A;  2CHH A;  5DG2 A;  4JC1 A;  5FY7 A;  1RJ7 A;  3FMG A;  5L19 A;  2GNT A;  2PMW B;  1XXN A;  4WVZ A;  5L73 A;  5JXJ A;  4L92 A;  4YW7 A;  5FIX A;  1RJ8 A;  2CV6 A;  1OF4 A;  2YBS A;  3FFQ A;  4B1M A;  3ROU A;  1AXZ A;  5FO7 B;  1PIV 2;  3VBS A;  2YFU A;  2HBU A;  2RVA A;  3PIJ A;  4OQ9 A;  4BHP A;  1NCR B;  1Q8Q A;  4Q4V 1;  2X5I A;  3WP3 A;  1WZX A;  4LHL A;  4UFL A;  2XLG A;  3H7Y A;  1N3Q A;  1RUD 2;  3OBR A;  1TEI A;  3RG0 A;  3R4D B;  2VOT A;  2V4V A;  3ETP A;  2WN3 A;  3POF A;  4B1L A;  4Y33 A;  3WZ1 A;  1N3P A;  2RS1 3;  2L9L A;  1AYM 2;  1UU5 A;  2P34 A;  3BI3 A;  4N7U A;  2EAK A;  1V6O A;  4PDW A;  1IS3 A;  1I9R A;  2R32 A;  3DYM A;  5C3O A;  3TEX A;  4LR4 A;  4KG0 A;  3BOP A;  3I3B A;  4MVT A;  4G9S B;  1UZ0 A;  2WSU A;  5FXW A;  3VHR A;  5FYM A;  1CPM A;  1NLS A;  3I3D A;  4R9B A;  2R1B A;  5ISL A;  1BHG A;  5GLW A;  1Z7S 3;  1R08 2;  1CPN A;  1AYN 3;  2EAA A;  3K2O A;  5A6Q A;  2LS6 A;  2W95 A;  1CZS A;  3DGT A;  1BZW A;  4SLI A;  5JPN B;  1O3T A;  1GZT A;  1LHV A;  2WNV C;  3KCX A;  1W8O A;  1XSR A;  2VUD A;  3W21 A;  1NOV A;  1XNA A;  4NPR A;  1AXK A;  1TME 1;  4HG6 B;  1W9Y A;  2A7A A;  1AR9 3;  4PF1 A;  4O9E A;  1Q43 A;  1W3V A;  4OZX A;  1WCD J;  1J3P A;  4Q0V A;  4MV2 A;  1RUG 3;  3O1S A;  1HIX A;  4ATE A;  1O7F A;  3ZX7 A;  2WL1 A;  4AE2 A;  1AR9 2;  1HRV 3;  2D44 A;  1T2X A;  2R04 2;  4ES9 A;  2H0B A;  1AR6 3;  1OQ1 A;  2JDK A;  4M00 A;  2DTY A;  5A3W A;  1CWP A;  4QHB A;  4Q2F A;  2DTW A;  2ZJC A;  4ISR A;  1IS6 A;  2A75 A;  2YPD A;  4AOC A;  1HLC A;  5FZL A;  1H4G A;  1GQP A;  2FQP A;  5C9A C;  4CCL A;  3ZXE A;  2WYS A;  4A3X A;  1OI6 A;  3RVH A;  3T1M A;  3U37 A;  2DVG A;  3ZYP A;  3DUI A;  3JBG 1;  4CDU A;  3O1V A;  4YWA A;  3AJZ A;  4A6O A;  3H42 B;  2GSY A;  1MEC 2;  3A0N A;  2VAU A;  3NAP A;  4FTS A;  1A8D A;  1PNF A;  2NMN A;  2BDR A;  3CNA A;  3BUC A;  2NZ9 A;  1H0B A;  1QJY 3;  3KSC A;  5F2W A;  4AED B;  4D94 A;  3GZA A;  4ASL A;  2XH6 A;  4CCK A;  1NKG A;  2DUQ A;  3RYK A;  4FPK A;  4JDN A;  3BPZ A;  1NQJ A;  1Z78 A;  2YBK A;  3A0K A;  3D6E A;  3KB5 A;  3S57 A;  2A73 B;  1A78 A;  1PGS A;  3VDD B;  1BMV 1;  1QF3 A;  3ME2 A;  1H1I A;  1PZ7 A;  4D7Y A;  1J59 A;  2SBA A;  3Q8C A;  1YCI A;  3UGH A;  2XVG A;  4U36 A;  1W39 A;  4I0W B;  4PCR A;  1GMM A;  1QJU 2;  3PNA A;  3LE0 A;  4GMP 3;  3CIH A;  4CDQ A;  5C3P A;  2EXH A;  4Y20 B;  2A3Y A;  3OBT A;  2YMZ A;  4MUV A;  2GH2 A;  2R6Q A;  5JIU A;  4RS5 B;  3RWN A;  4AEJ A;  3T1L A;  4HAN A;  1ND3 B;  5GZF A;  4XDO A;  1L7L A;  2VTX A;  3PL0 A;  5KHH A;  1LOE A;  1RGS A;  2WFP A;  4XF0 A;  1Y4W A;  3VZO A;  2YC2 A;  3K3O A;  3N9O A;  1GIC A;  2VQA A;  3C8X A;  1QNY A;  5IW0 A;  4AI2 A;  1W9W A;  4HL0 A;  3W58 A;  4NRP A;  3ITQ A;  4JCK A;  5IFT A;  1HQW A;  2XGX A;  1PVX A;  2IWG B;  3LEI A;  4QPI C;  2QQI A;  2WZR 1;  1XJA A;  2AZ5 A;  2AAC A;  2DU0 A;  2G9G A;  4PF5 A;  1UPI A;  4GH4 C;  4D3W A;  1N1Y A;  2VVF A;  2D5F A;  2P1B A;  1KS4 A;  4NIH A;  2FDJ A;  2ZZQ A;  2WLP A;  5LAT A;  3W59 A;  3U4X A;  2GME A;  3ZR5 A;  4FCA A;  3ZFG A;  3BCW A;  1UN1 A;  4QQO A;  1A34 A;  2AEN A;  3J9S A;  3L2H A;  3GZT B;  3ZSL A;  4Z1V A;  4NHY A;  4LO7 A;  5IK7 A;  3HIF A;  5KXB A;  2PHR A;  2XUE A;  1PIV 3;  2DVD A;  5IK5 A;  4QPI B;  1CN1 A;  4KU7 A;  1UZW A;  1PVC 2;  3OUI A;  2P2K A;  4RA0 A;  1C8M 3;  5FZ3 A;  3SH5 A;  1E5H A;  1I1E A;  3P1I A;  2YBP A;  1HV1 A;  5FYH A;  1R09 2;  3ZYI B;  4URT A;  4JGY A;  1TMF 2;  2BW8 A;  5LW9 A;  1QJX 2;  2O1Q A;  1DYO A;  3IDA A;  4U2A A;  3H8R A;  3ZXK A;  5C9A A;  3HPN A;  4R9A A;  4JHT A;  3LOI A;  4E2G A;  2PAK A;  4DXS A;  2PQQ A;  1QJE A;  1WA4 A;  3IMM A;  1XNK A;  3GYD A;  5BYN A;  4FPF A;  4JTN A;  4K1Z A;  3B01 A;  5AC9 2;  1RVF 3;  5F6L B;  1XND A;  5E6H A;  3WQ1 A;  2W5F A;  1IGO A;  2MEV 2;  1HB4 A;  2G9F A;  3PLQ A;  4YLZ A;  1SCR A;  4A7Z A;  1LED A;  4IES A;  5CG9 A;  2F4P A;  4AYU A;  1FMD 2;  5CAZ A;  1Y9G A;  4YZ3 A;  3AMN A;  4QB6 A;  2OUH A;  4YPJ A;  1R09 3;  2CGO A;  2ZTN A;  1ULC A;  4XUP A;  4P5Y A;  4A41 A;  1X50 A;  3W5M A;  4CPB D;  2QQV A;  5GZC A;  4K6B A;  4IEZ A;  1FMD 1;  3ASI A;  3JZV A;  1TG7 A;  1HKD A;  3M4F A;  4E8D A;  3B3Q E;  3WQ0 A;  1LEM A;  3C7F A;  5FBJ A;  4ITC A;  5JWP A;  1FX5 A;  5CFC A;  1HRV 1;  1YFU A;  4H7L A;  4Z2W A;  5IK8 A;  1Y9Q A;  5A1L A;  5F37 A;  3K4D A;  1G9A A;  3OGV A;  1MEC 1;  4S2F A;  3UET A;  1QU0 A;  3UGG A;  5GM0 A;  4P08 A;  2WNU B;  5ABJ A;  3PJY A;  3ZVX A;  5J7M A;  4L11 A;  4L9B A;  3Q8E A;  4XJZ A;  1OLM A;  4Y1Z A;  5FV3 A;  2D6O X;  3MDP A;  4EV0 A;  1G9D A;  2BGO A;  1DQ1 A;  5D2A A;  2R1D A;  5FCC A;  1ZZ9 A;  1COV 2;  2VW2 A;  4OUS A;  2DFC A;  5DZF A;  4JGZ A;  4H14 A;  2ZMN A;  4IV1 C;  4E4Z A;  5DMY A;  1JZ4 A;  3LPF A;  4COU A;  5K0U A;  2CNA A;  2VY0 A;  4OI2 A;  1JU3 A;  4HON A;  5FLH A;  5EIY B;  3EJK A;  5EV7 A;  4BH9 A;  1VBC 1;  1ULP A;  4PJY A;  2FMD A;  1W2T A;  2WWU A;  4ATF A;  4H7M A;  4BQ2 A;  1LOA A;  4A4A A;  4IV1 A;  4IL7 A;  1RUE 2;  2DFB A;  3A21 A;  4FBF A;  3ZFF C;  4FVV A;  4Z2A A;  1DYP A;  2XL9 A;  4Q4Y 1;  2BVB A;  5FPV A;  1KJL A;  4YZ1 A;  4BQ4 A;  1W8U A;  2RM2 1;  1QJU 3;  2VNO A;  4J6G A;  4KQ7 A;  3THD A;  3ZYJ B;  4RL7 A;  4XBQ A;  2P6H A;  4ORF A;  4FPH A;  2YGL A;  3A4U A;  5ABJ C;  1WBF A;  3PUI A;  2FZ1 A;  4FQ4 A;  4AEK A;  4CXX A;  2PLV 2;  4NRO A;  2DCY A;  3Q8A A;  4LUK A;  3U07 A;  3WX5 A;  4FOV A;  1SLI A;  2PYT A;  3MFC A;  4N90 A;  3RZJ A;  5AFB A;  2IXK A;  1MZE A;  2JX9 A;  2XKO A;  1RUI 2;  4AI9 A;  3A22 A;  3H1Y A;  4NID A;  3INA A;  4ARY A;  1NY7 2;  3BYW A;  4COV A;  1NQD A;  2ZKL A;  1PO2 2;  3RZK A;  4DPN A;  1X36 A;  4LK7 A;  4QPG B;  2RS5 2;  1LEN A;  1Q5O A;  4M3C F;  1GWM A;  1QOS A;  2EIG A;  2WC2 A;  2VTX J;  1WBL A;  3DKW A;  4KWL A;  5D8A B;  5I0T A;  4DZG A;  4DRR A;  5AC9 1;  2JB8 A;  3HMY A;  1HRI 1;  1I3H A;  2TUN A;  4HK9 A;  4ONU A;  5A6X A;  5DAP A;  4BZ4 A;  3ZXL A;  5LAS A;  2W0X A;  5BY5 A;  3RYR A;  3IDB B;  1NT0 A;  5GZE A;  5LK7 B;  4RFT 0;  4QKB A;  1ZBA 1;  2CY6 A;  1IHM A;  5DUX A;  3M2M A;  4HXC A;  4IDZ A;  4Y3O A;  5I8S A;  1LOD A;  5CFD A;  1E5R A;  4CEY A;  2FDI A;  5I93 A;  3UNP A;  5FMO S;  2J1R A;  1IS5 A;  3POE A;  4Y4R A;  4I09 A;  1W8N A;  4QPG C;  5FLI A;  1AR8 2;  4AI8 A;  3U11 A;  2JE7 A;  3I2H A;  4FPC A;  4JQT A;  1JZ8 A;  3BU7 A;  5FZD A;  4JVA A;  2ARE A;  2HWF 3;  1NAE A;  4AED C;  3FLP A;  4GH4 A;  2GC1 A;  1RXF A;  2A70 A;  3KT1 A;  5AC9 3;  3ES1 A;  1UKR A;  1OH3 A;  2QBX A;  4IEO A;  4QGL A;  1C5I A;  2IVI B;  1BLZ A;  1VR3 A;  2F17 A;  4EE2 A;  5BNP C;  5F9T A;  5FZ0 A;  3T0D A;  1OKQ A;  2E33 A;  3ZXG A;  5C9A B;  2QQP A;  2VTF A;  2FHR A;  1K5M C;  1ZBE 1;  3B94 A;  1SFP A;  3MID A;  4LKF A;  3HVD A;  5K0U B;  3OGJ A;  4B4Q A;  4EWE A;  5HXV A;  4RHV 2;  1H8T A;  3M3I A;  4LLO A;  2K0G A;  4BM8 A;  5A33 B;  2I2S A;  4DUX A;  2E31 A;  2VNG A;  3VUO A;  1H6X A;  1F15 A;  4UW3 A;  4YM0 A;  4TTG A;  2WLQ A;  3DL3 A;  4C0B A;  1UD1 A;  2XBO 1;  4AFM A;  5J09 A;  3VZL A;  1APN A;  4HFS A;  1C8M 2;  1LU2 A;  4XAB A;  1W8Z A;  2PHU A;  3U10 A;  4IER A;  1GYK A;  2BYV E;  4PI0 A;  1ND3 C;  3HNB M;  4Q1P A;  5T5P A;  5FAX A;  2X29 A;  3HWJ A;  3V0B A;  3SNM A;  4FSJ A;  4ES8 A;  2W1S A;  2C9K A;  2PHT A;  3AYE A;  4AQS A;  3HEI A;  2VO5 A;  1MS8 A;  4GMP 1;  3CF6 E;  2VUC A;  3E97 A;  1YIF A;  3ZO0 B;  1VP6 A;  1NX9 A;  2CAV A;  1W6P B;  2DVA A;  1YYN A;  1UYZ A;  1W99 A;  2ILM A;  4CPB A;  2ZGR A;  1EY2 A;  1FAT A;  3HQU A;  1CAX A;  2JWP A;  1GOF A;  2Y34 A;  3JBG 3;  4QX3 A;  1TMF 1;  4PHZ A;  1DQ0 A;  2DF7 A;  3DV8 A;  2YY1 A;  1QH7 A;  3T08 A;  1VBA 1;  1GOH A;  4CDX C;  4ZKT B;  4FPG A;  5SV8 A;  5A3P A;  1HXS 2;  1VMF A;  4XAA A;  4YVS A;  1SBE A;  3GXU A;  4XHX A;  5A3N A;  1LOG A;  3SCG A;  3KV6 A;  4LE4 A;  1X7N A;  1JHJ A;  3I54 A;  1IQA A;  1RUI 1;  2K9Z A;  4AI1 A;  1NLQ A;  2HWD 1;  3AP7 A;  4JRL A;  4E2S A;  4DMI A;  5FZ6 A;  2B46 X;  5EJ1 B;  2DBN A;  2DDU A;  1ZVF A;  1FPN 2;  1U5Y A;  2PTM A;  2AR6 A;  4S2H A;  3SXW A;  4URA A;  2TBV A;  5H9R A;  1CZV A;  5FDB A;  2Q30 A;  4XXP A;  1HW5 A;  5FKC A;  3O0V A;  3ZR6 A;  2PQS A;  2WFF 1;  3AX4 A;  3M3O A;  3D5O A;  2GN3 A;  3Q8F A;  1G86 A;  5CIR A;  4IEY A;  1W8F A;  2ZHL A;  1YIP A;  2QJV A;  2GZW A;  1XOY A;  4A45 A;  3U4S A;  3O1P A;  4LEJ A;  3ENR A;  1LCL A;  5HPO A;  2RG4 A;  5LA1 A;  5FK8 A;  3IBM A;  3S7E A;  4W6Y A;  4D6R A;  3PUS A;  3ES4 A;  1ENQ A;  1PO2 3;  2DCT A;  1NXD 1;  2XWJ B;  4ZS3 A;  2J1A A;  2Y26 A;  4JZR A;  1ONA A;  2IXC A;  5EZW A;  5LA9 A;  2WNU C;  4A3Z A;  1NCQ A;  5KHK A;  3FE5 A;  4ASM B;  1K45 A;  1W0N A;  3MIG A;  5APA A;  1UYY A;  4UBH A;  4BPZ A;  1CON A;  2BZD A;  1CR7 A;  2R06 3;  4I3P A;  3OPZ A;  2JG9 B;  1PVC 1;  2AEZ A;  1MS4 A;  1ASJ 3;  4Q4W 3;  3EHK A;  3Q9O A;  2RMU 1;  1LOB A;  2MPF A;  2PEL A;  5C71 A;  3ZXD A;  3RZM A;  3GBW A;  4XOG A;  4GXL A;  1J58 A;  1NXM A;  1R1Z A;  1UU6 A;  3OGR A;  2AC1 A;  3HD8 B;  1ZBA 3;  2R07 1;  3CLP A;  4PBO A;  3WY6 A;  4AHW A;  2WO7 A;  4IEP A;  4NJ4 A;  3IB3 A;  3RZZ A;  2YZ4 A;  3IPV A;  3WW3 A;  1ENX A;  1RUC 1;  4YG0 A;  2Z79 A;  3O7O A;  2DUO A;  4RSU A;  1M4W A;  3I3Q A;  5JMO A;  1UOB A;  2DVB A;  5C7G A;  4XFG A;  2E6V A;  2JIC A;  4ZXK A;  1SZB A;  2JIG A;  4K1Y A;  4XUN A;  3V65 A;  2PAM A;  2W3J A;  4PDW B;  3BTA A;  4Q0P A;  3ZIW A;  4V2V A;  2W91 A;  4MO3 M;  2E63 A;  5JOX A;  4C90 A;  5A6Y A;  5JOZ A;  1WCS A;  3LSE A;  1WME A;  2Y60 A;  3BOW A;  3NL1 A;  3ST7 A;  1SLC A;  1GZW B;  2QQJ A;  3K4Z A;  4L8Q A;  1Z7S 2;  3FJS A;  2W47 A;  2ZGM A;  4P9L A;  1VAM A;  2VBP A;  4GB3 3;  4N53 C;  4RQP C;  1NA1 B;  4IXL A;  2PHL A;  1O8S A;  4OUL A;  3FUO A;  4UWD A;  3ZYH A;  2UWA A;  4YW3 A;  5EXO A;  3WG1 A;  2E26 A;  2VOK A;  1W2N A;  3VKN A;  3MIF A;  1UXZ A;  1BK0 A;  3ZFE C;  1XNT A;  4LQR A;  2YV8 A;  3FWE A;  3POY A;  1BMV 2;  1LTE A;  2E32 A;  5A7W A;  1W6Q B;  3ZFF A;  1EUU A;  1FV2 A;  1X82 A;  2EAL A;  1ZZ6 A;  3KGL A;  2VZ1 A;  3O1T A;  3AVR A;  3DXT A;  3WUC A;  1LEC A;  5JLV A;  1R09 1;  4QQL A;  1YXW A;  4E4H A;  1S0D A;  1RHI 1;  3J8F 1;  4QXK A;  1FMD 3;  4OQ8 A;  1SEF A;  4LKS A;  1BKZ A;  3S6P A;  2EF6 A;  2VMI A;  1XNB A;  5DUV A;  5FWJ A;  1R08 1;  1PO1 2;  2VM9 A;  1S0E A;  2ZPX A;  2QFE A;  4HMZ A;  4QX5 A;  5FZC A;  5BUV A;  1PK6 B;  3TN9 2;  5D21 A;  4JTO A;  1BEV 2;  3KV9 A;  1CX1 A;  1L7R A;  1VBA 2;  1DLL A;  3WG4 A;  3RGB A;  4NE9 A;  3HT1 A;  3VL9 A;  1BVP 1;  3ZDV A;  4LMF A;  4MH0 E;  3GJB A;  2CU5 A;  3FN9 A;  4LBO A;  2WKK A;  5E16 A;  3CJI C;  2QQK A;  4CDU B;  5SV5 A;  1RED A;  1V6K A;  4UFK A;  1HXS 3;  2Q1F A;  3SKV A;  4CSW A;  3E6D A;  4CU7 A;  1DZT A;  2GN7 A;  1NUK A;  5IK4 A;  1C1L A;  1H8V A;  1UOF A;  2JDN A;  5LBF A;  5FY9 A;  4EZ4 A;  3M3C A;  5FMO L;  1H30 A;  1CAU B;  3N7L A;  2PA7 A;  1K12 A;  1RMU 1;  2WNO A;  4YVW C;  3L9J T;  4F3J A;  5JAX A;  5FYY A;  2EXJ A;  3OGG A;  5DAB A;  3LWC A;  4LO4 B;  3JCI A;  4NHK A;  1J3Q A;  1QDC A;  5BXX A;  3LKJ A;  4CU9 A;  3H0O A;  4OYU A;  1VE0 A;  4J1X A;  1OUS A;  1XQN A;  3VBR A;  2BNN A;  1VPH A;  3DYO A;  3DPR C;  4IGO A;  5ACA 2;  1ZRE A;  3LSD A;  4Q4X 2;  3NJZ A;  5D8A A;  4NPL A;  1UO9 A;  1HV0 A;  3LEG A;  3FC0 A;  1PMH X;  1REF A;  1ZX5 A;  3AB0 A;  3R4S A;  5I0U A;  1D4M 2;  3AXD A;  4BIO A;  5DUU A;  2QDN A;  5A32 A;  1OOP C;  4CCM A;  1OHF A;  3MPB A;  3NW4 A;  2Z69 A;  4QHO A;  4RS5 A;  3PDQ A;  2OZ6 A;  3ZSE A;  2DYC A;  4PIY A;  1UL9 A;  2XWB B;  5C8C A;  1U0A A;  5EP9 A;  2VZQ A;  1OVS A;  4IE5 A;  1K5J A;  4AFA A;  2XML A;  3VN4 A;  2HWB 1;  2ZX3 A;  5FYV A;  3S5Q A;  3DCQ A;  4C1X A;  4AWD A;  4DS0 A;  3PMS A;  3RPQ A;  3ZN6 A;  5FJH A;  2Y6G A;  5IVV A;  4ARX A;  1UOG A;  1UPS A;  2BNM A;  1K5M B;  3NNF A;  1MR5 A;  1WUV A;  1QIQ A;  4QX0 A;  3BTY A;  3C7E A;  2Y6J A;  4JQR A;  2HEY F;  2QQN A;  1RUE 1;  4NHM A;  4DEV A;  4P14 A;  5FQ0 A;  4MG2 A;  2DCJ A;  4YGC A;  2RS3 1;  4BYY A;  4D69 A;  3P6B A;  3LPG A;  1WLC A;  1LR5 A;  3VHN A;  3E5U A;  1S0B A;  2OVU A;  3LFM A;  4XVH A;  1J1T A;  2JG9 A;  2XHK A;  5FY0 A;  5K8S A;  1UX7 A;  1J83 A;  5F5I A;  2VPV A;  2B9V A;  1BEV 1;  1IKQ A;  1XRU A;  3WF0 A;  3TWI A;  2VEC A;  3ZPY A;  1TME 3;  5E88 A;  4XMA A;  4CUG A;  3AP5 A;  4AQ6 A;  4QD2 A;  4QB2 A;  5C5T A;  5JDB A;  1ULG A;  4PQ9 A;  5FZO A;  2RHP A;  1HN0 A;  4CRQ A;  3PJQ A;  1EAH 2;  4M0N A;  1S55 A;  3NRU A;  2VMF A;  3T0B A;  3WW4 A;  4M3C A;  3VBH A;  2XR4 A;  2ZEY A;  1BK1 A;  3ILN A;  3AKS A;  4XAE A;  4Y20 A;  1MS3 A;  4W8J A;  4LUL A;  3HN3 A;  3LQC A;  1XE7 A;  5T5J A;  1O6U A;  1EUT A;  3DEM A;  1D4M 1;  3GJA A;  3WNL A;  1RC6 A;  3X29 B;  1OT5 A;  2P37 A;  4GWJ A;  1WMF A;  1YJL A;  3MUY 1;  2ZCW A;  3NV3 A;  1ZYB A;  4XDQ A;  1PK6 C;  2VZV A;  2J1U A;  2XVL A;  4TYS A;  1PGL 1;  2C4X A;  3KQ4 B;  1OLR A;  2H6C A;  2XDV A;  4XF9 A;  3TOJ A;  1O3Q A;  3LD8 A;  2EIE A;  3USU A;  1UMI A;  2ET7 A;  2WN2 A;  4NAM A;  5GLU A;  1B35 A;  1YFW A;  2HWF 2;  4WM7 C;  5A7N A;  4XUT A;  3I2D A;  3BU0 A;  1MAC A;  1RUH 3;  2DUP A;  5FZE A;  2W46 A;  3NNG A;  4Q4Y 3;  2YB7 A;  1POV 0;  3I3M A;  3VBF C;  4B7K A;  3AZZ A;  3NAP B;  3PVO A;  1UWW A;  3WCS A;  1O4Z A;  2K2S A;  4YM3 A;  3POB A;  4EWA A;  4IEV A;  1VBC 3;  4XUO A;  3NMB A;  1VBC 2;  3PUQ A;  3I3E A;  3VBH C;  4QU2 A;  2DCZ A;  2J7M A;  4KBZ A;  2ZHM A;  1RUJ 2;  3T2Q A;  3W5N A;  4IQP A;  1YWK A;  5IAT A;  5FZI A;  4ZON A;  1R1A 1;  1OC1 A;  1VAK A;  1YQ5 A;  5E89 A;  3E1F 1;  4N53 A;  3IDC B;  2ZX2 A;  4RQP A;  4D8M A;  2YXS A;  3QBQ A;  3I2I A;  4Z07 A;  1WLW A;  3VBH B;  1Y7B A;  4GZ9 A;  3HT2 A;  3NQH A;  2ZHK A;  1RUO A;  2VH9 A;  4UXA A;  1PO1 1;  3AFK A;  2B45 X;  4CUB A;  3FUQ A;  3KMH A;  3VBS B;  2VZT A;  1BJQ A;  1SPP B;  2ZGP A;  5F39 A;  1DIW A;  5I8Y A;  2V5D A;  3POW A;  1OFN A;  3PTY A;  1OD3 A;  2RS1 1;  2EXK A;  1OOP B;  1LU1 A;  3HNY M;  3OOX A;  4O61 A;  3VV1 A;  5JPM B;  2ZHN A;  3MLL A;  5FZ7 A;  1PM7 A;  4RR3 B;  2J1S A;  3UT0 A;  3O1U A;  1VRH 3;  2JIJ A;  3SHR A;  3BAL A;  1W0P A;  5A7O A;  4B7E A;  2OUJ A;  1AL2 3;  2PLV 3;  3OYW A;  4CEW B;  5F5A A;  3PHM A;  3T30 A;  4X8P A;  2GP5 A;  1DGW X;  2JG9 C;  3OCP A;  5FKB A;  5IJR A;  1H2K A;  4OHY A;  1N1V A;  1NZI A;  3VBO C;  3RI9 A;  1QQP 1;  4I02 A;  3VD3 A;  4GKX A;  4HVQ A;  4LHK A;  5HCA A;  4P02 B;  5FMC A;  3WDT A;  3RS6 A;  4GH4 B;  1W6M B;  2HWB 3;  2QUO A;  1TQ5 A;  2HWC 1;  1RUE 3;  4KNC A;  3WF1 A;  4DXZ A;  1T6B X;  2YYO A;  1WKY A;  2ZGL A;  1AJO A;  3D82 A;  1D2Q A;  3K4A A;  1DU3 D;  1V6I A;  2O8O A;  4CDX B;  1QQP 2;  5CIS A;  3LA2 A;  2Q8O A;  3ECQ A;  4QX1 A;  3IMN A;  4IV3 C;  3HN1 A;  1J3R A;  1URX A;  3PUR A;  4QX8 A;  2WZR 3;  4QDS A;  4UFJ A;  3RJR A;  4XFF A;  3OY8 B;  4QX7 A;  3MV1 1;  4DXT A;  4OI1 A;  1AUY A;  1Z0H A;  2WA4 A;  3AL6 A;  4BE3 A;  3VZK A;  2P5B A;  3PUA A;  3OG2 A;  4FO9 A;  4GB3 1;  5G04 L;  4AFC A;  5DAX A;  3TEZ A;  5H9S A;  2JEC A;  2IXJ A;  5T52 A;  3TYJ A;  4QQ2 A;  3LA7 A;  1D4V B;  4MZU A;  1YUD A;  3CEW A;  5FP8 A;  2YGM A;  3PU8 A;  5JI7 A;  3JD7 2;  3OTF A;  2RMU 3;  3IKW A;  4BOW A;  5ANQ A;  2Q8C A;  1AR7 2;  1GOG A;  4OHX A;  5HCF A;  4MHR A;  2NM1 A;  3ZYB A;  4WM8 C;  3K75 B;  5EJ3 A;  4CDW C;  1RUD 1;  1ZBE 3;  4JKL A;  4OHV A;  2R07 3;  5DAV A;  1QMJ A;  1UX6 A;  1YQ8 A;  1D4M 3;  5AVA A;  2WWJ A;  3WNP A;  3C7H A;  4AVT A;  5JZG C;  2A71 A;  4HVO A;  5D1I A;  4WM7 B;  4CUA A;  1B09 A;  4JRA A;  1W9F A;  5DZG A;  4RYD A;  3MEP A;  2PAE A;  4NR1 A;  2JDM A;  1IQD C;  1ZZB A;  1JOD A;  4CCN A;  3KM5 A;  2QTW B;  5DZE A;  2OW4 A;  1P8J A;  1VBD 2;  3A23 A;  3VDA A;  3TEW A;  2MEV 3;  5FXZ A;  1LOF C;  1Y43 B;  2VNV A;  3LDK A;  4LO5 B;  5CB7 A;  3WVJ A;  1GUI A;  1RVF 2;  4NPM A;  3UV9 A;  5JSO A;  3GCX A;  2EIC A;  4HPK B;  4BWO A;  3AJY A;  5FZA A;  1N47 A;  3CKH A;  1FOD 1;  1JZ6 A;  3GZU C;  1SPP A;  2WFF 2;  4R4Z A;  4QPI A;  5F2S A;  2D5H A;  4BDV B;  4K7J A;  3O1O A;  5HCH A;  1QXP A;  5IFP A;  2Y0I A;  5LEJ A;  4LTA A;  1VBB 2;  5FYU A;  3WP4 A;  3ATG A;  5FUP A;  1OMI A;  1AR8 3;  3EXU A;  2CWS A;  5A1F A;  3AP4 A;  5FPZ A;  3EQE A;  3KHB A;  4FFI A;  5JR7 B;  3BGA A;  4CP0 A;  1XYO A;  4RGG A;  4IGQ A;  1SLB A;  4NWV A;  5IVF A;  5CYY A;  1VBA 3;  3P5B A;  3T2T A;  4N9I A;  3OPT A;  2HWD 2;  1ND3 A;  5CAD A;  5DQ0 A;  5IAV A;  1VIW B;  4NAO A;  1RTV A;  4YZ4 A;  1PO1 3;  3WCR A;  5IVB A;  1LOF A;  1QJF A;  2LRP A;  4K20 A;  3J7H A;  5A7S A;  1X8E A;  3U1X A;  5FK7 A;  2BNO A;  2ENR A;  2ZEW A;  3WNK A;  2W1W A;  1AYM 1;  2ID4 A;  3S7I A;  1JS9 A;  1K42 A;  3ON7 A;  3HR9 A;  4OMC A;  1AZD A;  1WWY A;  4JX0 A;  4EN0 A;  5J48 A;  1OBN A;  3GNE A;  1DDL A;  1GV9 A;  1I5P A;  4JAA A;  1AL2 1;  4KWU A;  1A6C A;  5A7W B;  1F31 A;  1IG0 A;  4GWN A;  2PHX A;  3EMR A;  4EYU A;  4MXV A;  1JN2 P;  5BNQ A;  4LUM A;  3RZH A;  1R1A 3;  3NO8 A;  4AQ2 A;  1R1A 2;  2VOV A;  5CA6 A;  4LBQ A;  1W6N A;  2VGD A;  1YFY A;  1COV 1;  2VNR A;  4BLI A;  2EXI A;  1YQ2 A;  2VMC A;  5A7P A;  4FPL A;  5BNO A;  5GKA C;  1GWL A;  3SIS A;  3WP5 A;  1G7Y A;  3RYP A;  1JZ3 A;  3W20 A;  1K5M A;  2WUH A;  3GBF A;  2V73 A;  1C8M 1;  2IUW A;  3AZW A;  2XB6 C;  1W2U A;  5LK5 A;  2BFU L;  2JD9 A;  3HBZ A;  2OXB A;  4MGQ A;  1LHU A;  2VQ0 A;  3B5L B;  5J36 A;  1OLM E;  2DVF A;  3ACH A;  1KQR A;  1OKO A;  5HV4 A;  1OQD A;  4HSJ A;  4AG4 A;  2K46 A;  3ACI A;  3UKN A;  4CEW A;  2E7T A;  2GAU A;  4XFA A;  4MET A;  2Z42 A;  1FPN 1;  2QCS B;  5FPU A;  3AXE A;  1GQG A;  1QWR A;  4HOO A;  2OS2 A;  5FYB A;  4EN9 B;  3AC0 A;  4FP3 A;  1U12 A;  4OUE A;  1W3X A;  1YEW A;  4JDM A;  5JOW A;  3R05 A;  3GF6 A;  3LOB A;  1OA3 A;  4OI0 A;  2V4A A;  3ZDS A;  3JQW A;  1OLQ A;  1LAJ A;  2Y6H A;  5BNP A;  2ZGS A;  5JXH A;  2C9A A;  1EV1 1;  2PXJ A;  1FI2 A;  1UMZ A;  5JSR A;  4Q4W 2;  5C8W A;  1E5I A;  4GUL A;  4QKD A;  3HAG A;  4Q26 A;  1O8P A;  4MLO A;  3LEK A;  1AYN 1;  1GNY A;  4GWM A;  1W6P A;  3VBU C;  3ZSM A;  4LHN A;  4BXF A;  2FDK A;  1UXX X;  3CMG A;  4QGN A;  1QXJ A;  1VBD 3;  4XC9 A;  5DG1 A;  3O14 A;  1MVQ A;  1WW6 A;  5T5L A;  3VDB A;  4CXY A;  1IZ3 A;  2NP0 A;  3WF2 A;  5L9V A;  4LBL A;  4AVV A;  2HEV F;  4DQA A;  2KR2 A;  5C3S A;  1UY2 A;  4FI9 A;  3USS A;  4MHU A;  4X8N A;  2Q0A A;  4YFZ A;  3I2K A;  1YLL A;  1AX1 A;  1V6J A;  4Q0Q A;  4QT6 A;  5BNN A;  4K8F A;  2R07 2;  5A32 B;  5T5O A;  2ZAA A;  4MGY E;  2JXA A;  2RS3 2;  3AZV A;  5CKN A;  4CDU C;  2VZU A;  5HI0 A;  1AR7 3;  2D3P A;  4Q29 A;  1NY7 1;  4QPG A;  4E27 A;  5GZG A;  2JG8 B;  2RMU 2;  3PVN A;  4UF0 B;  5K9Y A;  5L7O C;  1PGW 2;  1CVN A;  3I2G A;  3V0B B;  3J26 N;  1HX6 A;  3T2O A;  4DOU A;  1F2N A;  2XON A;  4CU8 A;  5FY1 A;  4LOT A;  2H0V A;  2ZX0 A;  2BRT A;  1XB9 A;  4B3N A;  3V56 A;  5DXD A;  2TNF A;  2JE9 A;  4BLJ A;  4COY A;  4CP2 A;  4HPK A;  2X8K A;  4E9K A;  5JMC A;  1X9T A;  5DDJ 2;  4XIO A;  3WQ7 A;  4MX3 A;  3LB9 A;  4PBP A;  5LWB A;  5F7U A;  2WZR 2;  2D6K A;  4BK5 A;  2MEV 1;  3TN9 1;  4P5H A;  1BCX A;  4IV3 A;  1WD4 A;  3ZPO A;  3NV4 A;  4W4Z A;  1SG3 A;  2BOI A;  1C57 A;  4BIF A;  2RM2 3;  4AI3 A;  5HBA A;  2ZBJ A;  2PN5 A;  1JXN A;  2VG9 A;  4BQY A;  2R16 A;  1YJK A;  1VRH 1;  2D93 A;  1AYM 3;  1W05 A;  3N9M A;  4AAP A;  1ZZ7 A;  4FQZ A;  3MUZ 1;  1ZM1 A;  1PVC 3;  2ZZJ A;  5FMB A;  1C4R A;  1C1F A;  1FXZ A;  1AL0 G;  1WGP A;  4EN6 B;  5BV6 A;  1PK6 A;  3KZ4 C;  5HV0 A;  1UAI A;  3BPS A;  1LES A;  1NE6 A;  1X9P A;  2RR1 1;  3KT7 A;  1JYW A;  3I2O A;  4HT1 T;  1RMU 3;  2BFU S;  1RMU 2;  2EA7 A;  4LHS A;  1AF9 A;  4YGB A;  2ZMK A;  2WQZ C;  2P3J A;  2I07 B;  1OXC A;  4ZU5 A;  1AL2 2;  1GKB A;  2VME A;  4XQW A;  5GLZ A;  1VMJ A;  4FOQ A;  4XTP A;  4Y1U A;  5DAW A;  3RNS A;  1FV3 A;  1C8N A;  5FZK A;  4IV3 B;  4M0H A;  5CEH A;  3I49 A;  2I74 A;  1DQ5 A;  3QH6 A;  4ZZ5 A;  1BVV A;  4H3W A;  2W08 A;  1XPW A;  1H8T B;  2QE3 A;  3VBO A;  1DZQ A;  2E53 A;  4PLN A;  1NLR A;  5FUI A;  2ES3 A;  2D43 A;  4AEM A;  3WOG A;  3U0Z A;  3OD0 A;  2Q1Z B;  1D0G A;  3T09 A;  2GH8 A;  4TN7 A;  5KR7 A;  3N4M A;  3WNX A;  1ODN A;  4GB3 2;  1PO2 1;  3GZE A;  2FDH A;  2A6V A;  1AVB A;  5CG8 A;  4N9H A;  1C5H A;  1VBE 2;  1UW8 A;  1LB2 A;  5FY8 A;  4LBQ D;  4C0H A;  4NOT A;  3VL8 A;  2ADD A;  3SKJ E;  4BK4 A;  2AUY A;  2F4L A;  2GNM A;  5JI9 A;  2W52 A;  4Y24 A;  5EHD A;  5GJ6 A;  3EYP A;  3THT A;  4DIN B;  4TSV A;  3WNN A;  3ZFG B;  4EN8 B;  1Q8P A;  1HDK A;  2OPK A;  2VCA A;  1H6Y A;  2WII B;  4RGK A;  1SHW B;  5D8A C;  5HCB A;  3KT4 A;  2BGP A;  1L3J A;  4O7X A;  3OB8 A;  2VC9 A;  2RS3 3;  2BBV A;  2B7Y A;  3NVC A;  4IUG A;  4LOR A;  1MS0 A;  4W6X A;  3VHO A;  3OUJ A;  3IN9 A;  1TNF A;  4DO0 A;  3ZOI A;  3UGF A;  3WDW A;  4XFH A;  1OOP A;  4OZO A;  5H9P A;  4Q5O A;  3LGR A;  2QNK A;  1G8W A;  4YW4 A;  4L2N A;  1VBD 1;  2JDA A;  2X10 A;  3NST A;  4YYO A;  1W2O A;  3JU9 A;  3H8O A;  2JDH A;  1ASJ 2;  5B4N A;  1CJD A;  1W04 A;  1YFX A;  3OEB A;  1PM4 A;  4HKO A;  2PHF A;  1O5U A;  4YM2 A;  2VBD A;  2P3Y A;  1RB8 G;  4AK3 A;  2BOJ A;  3JUU A;  4A44 A;  1AR6 1;  5FPA A;  2VVE A;  3AMM A;  3WLU A;  4BU2 A;  1QJY 1;  1DGR N;  3CJI A;  3WT3 A;  2IFR A;  4CDQ B;  3VD7 A;  3OYW B;  1JYC A;  3RFR A;  3OEA A;  3H3Z A;  4Q4W 1;  1JH5 A;  1LOC A;  3VBS C;  4C1W A;  3VD4 A;  4Z92 B;  3EB7 A;  4NHL A;  3VKL A;  3MLJ A;  1QH6 A;  1HXS 1;  2VUA A;  2R7E B;  3VZM A;  1LHO A;  3OGS A;  5TSW A;  4FXK B;  1A8M A;  2RDN A;  3DKQ A;  2ARB A;  4HBN A;  2R04 3;  2A3W A;  3VZJ A;  1DLC A;  1W0O A;  3JQX A;  1BQP A;  1MZ5 A;  3CO2 A;  3VB9 A;  3AM2 A;  3H1W A;  2VZP A;  2YHJ A;  4XET A;  2P6C A;  1GWK A;  3MW2 A;  4IE6 A;  2HH9 A;  4M4P A;  4N53 B;  4RQP B;  5K0U C;  1YI9 A;  2GC3 A;  4XF3 A; 
#chains in the Genus database with same CATH homology
 1LNS A;  3C7E A;  1PMJ X;  2Y6J A;  2WQ8 A;  1GMM A;  4DEV A;  2QQN A;  3LE0 A;  4MGS A;  3CIH A;  4TXW A;  2DCJ A;  4XUQ A;  2RJ2 A;  3P6B A;  3LPG A;  3WNO A;  4XVH A;  3ACG A;  4CUC A;  1UX7 A;  5HXM A;  1J83 A;  2B9V A;  3WF0 A;  2YC2 A;  3C8X A;  4W50 A;  1W9W A;  4QB2 A;  3CZU A;  5IFT A;  1GU3 A;  3LEI A;  2QQI A;  2W9X A;  4KI5 M;  3NRU A;  2VMF A;  3T0B A;  4RN5 A;  2ZEY A;  4W8J A;  3HN3 A;  3LQC A;  1EUT A;  3WNL A;  1OT5 A;  4GWJ A;  3MUY 1;  1OF3 A;  2J1U A;  2VZV A;  3C7G A;  2C4X A;  4KMQ A;  2YFZ A;  1CZT A;  2EIE A;  1RYY A;  1UMI A;  4P00 B;  2WN2 A;  3SEE A;  3IAP A;  2WZ8 A;  3P1I A;  4ZZ8 A;  1L7Q A;  3III A;  4XUT A;  4QPW A;  2W46 A;  3I2J A;  3NNG A;  1OH4 A;  3HOB A;  2YB7 A;  4CVU A;  5G05 L;  1UWW A;  2WAA A;  1DYO A;  3IDA A;  3HPN A;  1PX3 A;  2WDB A;  2ORZ A;  4DXS A;  1US3 A;  2VR4 A;  4PQQ A;  4XUO A;  3WEZ A;  3I3E A;  2J7M A;  2W5F A;  3T2Q A;  2HYX A;  3W5N A;  5B4X A;  4DEQ A;  2J1E A;  2V72 A;  3THC A;  2Y6L A;  3E1F 1;  4DUW A;  4D8M A;  2JKX A;  3I2I A;  4QB6 A;  4GZ9 A;  4GWI A;  3NQH A;  4YPJ A;  3D3A A;  4XUP A;  4P5Y A;  1KGY A;  2ZXQ A;  3CDZ B;  1JU4 A;  4A41 A;  4CUB A;  3W5M A;  2XOM A;  2VZT A;  3HJR A;  1TG7 A;  2V5D A;  2VZO A;  1OD3 A;  4E8D A;  3HNY M;  3I2F A;  3C7F A;  2J1S A;  3VD9 A;  3A7Q A;  3K4D A;  3OGV A;  4JKK A;  3UET A;  5IJR A;  4P08 A;  3PUH A;  5JXI A;  2VL4 A;  2BER A;  3VD3 A;  2BGO A;  2J1T A;  4P02 B;  4ZY9 A;  3WF1 A;  3C7O A;  4QDR A;  1JZ4 A;  1WKY A;  5DMY A;  3LPF A;  1UY3 A;  3ACF A;  3K4A A;  1JU3 A;  2VZS A;  5EIY B;  1ULP A;  3ECQ A;  4QX1 A;  2VCC A;  3WNM A;  4A4A A;  4QB1 A;  3A21 A;  4QDS A;  4Z2A A;  2YG0 A;  3MV1 1;  4DXT A;  2HLE A;  3THD A;  3OG2 A;  4M4R A;  5G04 L;  1US2 A;  3PUI A;  1D7P M;  2J1V A;  3FL7 A;  3GDB A;  2XQX A;  1JYX A;  3CZJ A;  3MV0 1;  5LA2 A;  1JI6 A;  4DUV A;  1GOG A;  4ZXE A;  3A22 A;  1W9S A;  4ARY A;  3K75 B;  1O59 A;  4JKL A;  4DXR A;  3WNP A;  3C7H A;  5LCW L;  4CUA A;  4CU6 A;  1W9T A;  4RYD A;  1UY4 A;  5JXG A;  2WZE A;  1IQD C;  2OKX A;  1XC6 A;  1P8J A;  3A23 A;  3VDA A;  1GUI A;  2EIC A;  3CKH A;  2X09 A;  1JZ6 A;  3UNP A;  2J1R A;  3NJV A;  2X05 A;  4BDV B;  1DP0 A;  2VQU A;  5IFP A;  1JYV A;  1W8N A;  2EIB A;  3ZM8 A;  3BGA A;  3I2H A;  4JHZ A;  1JZ8 A;  1UY0 A;  3NJX A;  2DCK A;  5CYY A;  3ABZ A;  3CQO A;  1NAE A;  2XHN A;  4UOJ A;  5DQ0 A;  1SDD B;  1PX4 A;  4PT6 A;  2QBX A;  2Y64 A;  3OBA A;  3T0D A;  1JZ5 A;  3J7H A;  2E33 A;  1R64 A;  1K3I A;  2ZEW A;  3WNK A;  2VTF A;  2W1W A;  2ID4 A;  4UAP A;  2WO3 A;  1UYX A;  1K42 A;  3GGL A;  1UMH A;  4OMC A;  4JX0 A;  4XZU G;  2Y6K A;  4UI9 L;  3WSO A;  1I5P A;  4AAX A;  2QQL A;  4KWU A;  3VD5 A;  4DUX A;  2VZR A;  4TTG A;  2E31 A;  1H6X A;  1ULO A;  1KEX A;  5DN2 A;  2VZ3 A;  2CDO A;  2C26 A;  5HPO A;  3HNB M;  2WBK A;  2KD7 A;  5JR2 A;  1YQ2 A;  2VMC A;  2W1S A;  2C9K A;  2RV9 A;  3FHA A;  3HEI A;  2J22 A;  2VO5 A;  1JZ3 A;  2VCB A;  1NX9 A;  2WUH A;  1UYZ A;  1W99 A;  2JD9 A;  4MGQ A;  2B4K A;  3I97 A;  3IAQ A;  4L0P A;  3ACH A;  2CDP A;  2WAB A;  1GOF A;  2ZEX A;  5J1X A;  2QQO A;  4QX3 A;  4MAD A;  4XUR A;  3ACI A;  4AG4 A;  1F4H A;  3T08 A;  3WF3 A;  1GOH A;  2VMD A;  3AC0 A;  3BN6 A;  4OUE A;  5CZK A;  3GXU A;  1UY1 A;  2Z4F A;  1F4A A;  3MO4 A;  1JHJ A;  3T0A A;  4JKM A;  2Y6H A;  5JXH A;  2Y8K A;  4BXS V;  5IYY A;  5EJ1 B;  3WF4 A;  1HN1 A;  2JE8 A;  2DDU A;  2ORX A;  1O8P A;  3LEK A;  1GNY A;  2VQT A;  1CZV A;  2LW8 A;  2W87 A;  1UXX X;  3CMG A;  3JXS A;  2PQS A;  3VDB A;  2WAO A;  3FHQ A;  3WF2 A;  4QDQ A;  2ZEZ A;  4A45 A;  1UY2 A;  2W1Q A;  4A42 A;  4FI9 A;  4LPL A;  4OMD A;  1CIY A;  5I0D A;  5LA1 A;  3I2K A;  1TVG A;  2W94 A;  3T2P A;  2J1A A;  4E8C A;  4A3Z A;  2VZU A;  1K45 A;  1W0N A;  1MPX A;  1UYY A;  2BZD A;  2WO1 A;  3I2G A;  3MBW A;  5JUV A;  3T2O A;  2XON A;  4CU8 A;  2W92 A;  5C71 A;  5LA0 A;  3SEP A;  4QX2 A;  3K77 A;  5F7U A;  3OGR A;  4BK5 A;  2W1U A;  5C70 A;  3HNM A;  3GM8 A;  3IB3 A;  4W4Z A;  1SG3 A;  3DEC A;  1JZ7 A;  1JYN A;  5JMO A;  5C7G A;  2WO2 A;  2VJX A;  4XUN A;  2W3J A;  5JXJ A;  3MUZ 1;  2W91 A;  4MO3 M;  1JZ2 A;  1OF4 A;  2QQJ A;  3K4Z A;  1JYW A;  2YFU A;  2RVA A;  2W47 A;  4LHS A;  2YC4 A;  5EJZ B;  2VME A;  1O8S A;  3VDC A;  2VOT A;  2V4V A;  3ETP A;  2E26 A;  2WN3 A;  2L9L A;  1UXZ A;  4ZZ5 A;  1XNT A;  4LQR A;  1XPW A;  2E32 A;  1EUU A;  3DYM A;  2VZ1 A;  5FUI A;  3I3B A;  1UZ0 A;  4BJ0 A;  3T09 A;  3I3D A;  4QAW A;  1BHG A;  4MOA A;  4LKS A;  2LS6 A;  2W95 A;  1CZS A;  3UES A;  2VM9 A;  2QQM A;  3SKJ E;  4BK4 A;  1W8O A;  1CX1 A;  1L7R A;  1XNA A;  3EYP A;  3WNN A;  4HG6 B;  5A1A A;  2VCA A;  1H6Y A;  3FN9 A;  1SHW B;  2BBA A;  4PF1 A;  2QQK A;  2BGP A;  3OB8 A;  2VC9 A;  3SKV A;  4CU7 A;  1NUK A;  4IUG A;  1T2X A;  4OZO A;  4ET7 A;  1K12 A;  4D0Q A;  5DPN A;  2JDA A;  2X10 A;  5B4N A;  5IHR A;  4CU9 A;  3OEB A;  3DYP A;  1GQP A;  4OYU A;  4A44 A;  2WYS A;  3WQB A;  3DYO A;  3U37 A;  3VD7 A;  4A6O A;  3OEA A;  2EID A;  3LEG A;  3VD4 A;  1PMH X;  3EB7 A;  3F2Z A;  2R7E B;  1J84 A;  3K46 A;  3OGS A;  1NKG A;  1WCQ A;  1DLC A;  2VZQ A;  2VZP A;  4M4P A;  2Y6G A;  4ARX A;  4QX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...