2RVAA

Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from paenibacillus sp. ik-5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
131
structure length
131
Chain Sequence
NLALNKATATSSIETAGHEGDKAVDGNAATRWASAYGASPQWIYINLGSTQSISRVKLNWEDAYATAYSIQVSNDSGSTPTNWTTVYSTTTGDGAIDDITFAATNAKFVRVYATTRATAYGYSLWEFEVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucanase
publication title Mechanism of chitosan recognition by CBM32 carbohydrate-binding modules from a Paenibacillus sp. IK-5 chitosanase/glucanase
pubmed doi rcsb
source organism Paenibacillus fukuinensis
molecule tags Hydrolase
total genus 9
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2rvaA00
2J22A 2YFZA 3HPNA 3CQOA 1CZVA 4L0PA 4GWIA 4MO3M 3VD5A 2VZUA 3K77A 4UOJA 2XONA 1OF4A 3PUIA 4IUGA 4PQQA 2J1TA 4BJ0A 1W8NA 1UYXA 2YC4A 2VCBA 4W8JA 2XQXA 3K4ZA 1JYWA 2VMDA 3OBAA 1UYYA 3K4AA 3DYPA 3T0BA 2J1RA 2EICA 2LS6A 1OT5A 1JHJA 1GNYA 3LQCA 4CU8A 5IFPA 3LE0A 4GZ9A 3FHAA 2QQMA 3MO4A 2J1VA 4DUWA 4XUOA 3C7EA 2VMCA 2WN3A 1L7QA 4RYDA 3JXSA 3UETA 3HNMA 2Y6GA 1JZ4A 3D3AA 5JXHA 2WUHA 3HEIA 1UXXX 1MPXA 2YC2A 3T2PA 1JU3A 2C9KA 2DDUA 3VD7A 2QQIA 4D8MA 1W9TA 4CUBA 5LA0A 2J7MA 3WNMA 1W9SA 4QX0A 2WN2A 3CIHA 4ARYA 2W91A 2WBKA 3MUZ1 3NNGA 4QAWA 4XVHA 1JZ8A 2WZEA 3MUY1 1JZ7A 3J7HA 1SG3A 1F4HA 3I3BA 3OB8A 1UY1A 5DN2A 4MGQA 2VMFA 1W0NA 4XUTA 4LKSA 4A42A 1BHGA 4D0QA 2E32A 2R7EB 2VZQA 4M4PA 4ZY9A 4OZOA 1OF3A 3GDBA 1O8SA 2ZEYA 3BN6A 4MADA 3WF3A 1J83A 2B9VA 5IFTA 3OGVA 4BXSV 3FHQA 3WQBA 4A4AA 2BGPA 4XUPA 4ZXEA 3WNNA 1WKYA 5G05L 2V72A 5LA2A 2VQUA 4AAXA 4KWUA 1H6XA 5B4XA 3C7OA 1UXZA 3CZUA 4QB1A 2BZDA 2VQTA 1XNTA 1YQ2A 4FI9A 3P1IA 5B4NA 1TG7A 2WDBA 3I2HA 4A44A 2RJ2A 1W99A 4YPJA 1UWWA 3DYMA 1JZ3A 3CMGA 1JYXA 2HYXA 2W1UA 1GOFA 4W4ZA 1GOHA 1GUIA 1L7RA 1DP0A 1J84A 1RYYA 3K4DA 3EYPA 1D7PM 1UY3A 1F4AA 2VO5A 2QBXA 1CIYA 3LEKA 3MV11 1I5PA 3MV01 1W8OA 2ZEZA 1WCQA 3LEGA 4P08A 2ORZA 1O8PA 1K45A 4JKMA 3OGRA 3ACFA 1NKGA 1O59A 4BK5A 4XUNA 4JHZA 4OYUA 2QQKA 1TVGA 4LQRA 3HNYM 2J1UA 4KI5M 4RN5A 3IAPA 2W46A 3GXUA 4P00B 4UI9L 2VOTA 5IJRA 2V5DA 3ECQA 2XOMA 2X09A 4QX3A 1XPWA 4DEVA 3THDA 4E8DA 1JYNA 2VJXA 2W94A 4P02B 4QX1A 3CKHA 2QQJA 1JI6A 1K42A 3WF0A 4A45A 5CYYA 3U37A 2VTFA 2VR4A 4XZUG 3I2GA 1SHWB 4P5YA 1JYVA 4M4RA 3VDBA 3I2JA 2VZPA 2BGOA 2ZEXA 4TTGA 2J1EA 3HN3A 2VZ1A 1UY2A 3PUHA 3IDAA 4QDQA 4CU9A 4CUAA 4BK4A 3I2IA 5C70A 1ULPA 4QB6A 1W9WA 5JR2A 2C26A 1NUKA 2J1AA 1UY4A 1CZTA 5DMYA 2VZSA 5HXMA 2RVAA 2V4VA 5JXJA 1GU3A 1JZ2A 2DCKA 2WAOA 4DUXA 3OGSA 3FL7A 5DQ0A 4E8CA 4CU7A 3W5MA 3A7QA 3ZM8A 3K46A 5JMOA 4DXSA 3LPGA 2J1SA 3EB7A 1KGYA 2Y6HA 2KD7A 3T2OA 3C8XA 5J1XA 4TXWA 2EIEA 3T08A 3C7FA 3I3DA 2E33A 2YB7A 4LPLA 2QQNA 3T0AA 2HLEA 1UYZA 4DUVA 3A21A 3A23A 3NQHA 3K75B 4JKKA 2VZ3A 5LA1A 1ULOA 3T09A 3IIIA 2WAAA 2W95A 2W92A 2Y6JA 2PQSA 3VD9A 2B4KA 4JX0A 3VDCA 4W50A 2L9LA 2CDPA 2VM9A 3I2FA 1UX7A 3LEIA 2VZVA 5CZKA 3VD4A 5EIYB 4BDVB 2W1QA 4A3ZA 2VCAA 4A6OA 3IAQA 3UNPA 3HJRA 5JUVA 3WNPA 5JXGA 3OG2A 2EIBA 2WQ8A 3NJVA 4DXTA 2LW8A 3MBWA 1DLCA 4OMCA 4ZZ5A 3F2ZA 1UMIA 4Z2AA 4ZZ8A 2ID4A 1XNAA 2JE8A 3I97A 2CDOA 4GWJA 5F7UA 4DEQA 1IQDC 3C7GA 1US3A 2JDAA 4ARXA 4PF1A 4CUCA 3GM8A 1NX9A 4QX2A 4MOAA 1PX3A 3THCA 2WO3A 3DECA 4LHSA 4OMDA 5DPNA 4AG4A 2WABA 2VZOA 4JKLA 4OUEA 3SKVA 3T2QA 5EJ1B 3SKJE 3CDZB 1LNSA 2ZXQA 4XUQA 1PMHX 2W47A 3WSOA 3HNBM 3IB3A 3SEEA 5HPOA 1CZSA 3BGAA 1OD3A 2E26A 3P6BA 1PX4A 3ACHA 3UESA 1NAEA 1DYOA 3VDAA 2ORXA 5A1AA 1HN1A 2VCCA 2EIDA 2OKXA 3ACGA 3VD3A 2W1SA 2RV9A 2DCJA 5C71A 3T0DA 3CZJA 2WO2A 5G04L 4CVUA 1JZ6A 3W5NA 3WF4A 4DXRA 2VL4A 2Y6LA 3WNLA 4CU6A 2X10A 3E1F1 2JD9A 3OEBA 5LCWL 5EJZB 1JU4A 4A41A 3I2KA 2WZ8A 2QQLA 1JZ5A 3OEAA 4QB2A 2BBAA 1EUUA 4HG6B 4PT6A 2WYSA 2W5FA 2VZRA 5FUIA 3I3EA 1CX1A 3FN9A 1OH4A 3WNOA 2W3JA 2Z4FA 4KMQA 1H6YA 2BERA 1T2XA 2W1WA 2VZTA 1US2A 2WO1A 4ET7A 2JKXA 2VMEA 3HOBA 4UAPA 1SDDB 2XHNA 1KEXA 3ABZA 1P8JA 3ACIA 2Y64A 5I0DA 3SEPA 2X05A 2ZEWA 1PMJX 1GMMA 3LPFA 4MGSA 1UZ0A 4QDRA 1EUTA 3ETPA 2QQOA 3WF2A 3GGLA 2Y6KA 2Y8KA 5IYYA 3WEZA 3NJXA 1UY0A 4QDSA 2YFUA 2E31A 5IHRA 3C7HA 4QPWA 1UMHA 5C7GA 3A22A 1K12A 5JXIA 2W9XA 3DYOA 2W87A 2VC9A 2YG0A 3WF1A 1GQPA 3WNKA 3AC0A 1K3IA 2C4XA 4XURA 1GOGA 1XC6A 3NRUA 1R64A
chains in the Genus database with same CATH superfamily
2J22A 1LOEA 2EA7A 4CTEA 5D8AC 1Q8SA 1ZX5A 1PVC3 2Y0IA 4GWIA 3RS6A 5HBAA 1NY72 5FZHA 2CGOA 2PTMA 2VUAA 3AVRA 4IE0A 3K2OA 1H2LA 2XONA 4QD2A 4HSLA 4PQQA 4BJ0A 4K9SA 2J1TA 3M3CA 4MGKE 3SC7X 1W8NA 2BTVC 1XOYA 2WT2A 5LY2A 2VCBA 3WW1A 2XQXA 4XXAA 5BNNB 1IS4A 1REEA 5J09A 1W2NA 3O0VA 3ON7A 2GZWA 1IS6A 2ZMKA 4RFT0 4JGYA 3WVJA 1RUD2 2P4EA 4LO5B 3K4AA 4IV3C 3ZYHA 3H3LA 3TEYA 1RINA 1R092 5HXVA 1YI7A 2R043 3M3IA 2OXBA 4CCJA 3LE0A 2G4IA 1FPN1 1NE4A 4Y24A 2ET1A 3R0RA 4EN7B 3AZWA 3WOGA 1SLCA 1UD1A 4E27A 2YU1A 3RI9A 4NHXA 1LU1A 2DVGA 2J1VA 3IIAA 3LFIA 4K21A 4DUWA 2R063 3C7EA 1GQGA 2PLV2 2WN3A 3MLLA 1L7QA 5GLUA 1EY2A 1RMU3 3HNMA 2Y6GA 3UETA 4MGZE 1F5FA 5JXHA 1JZ4A 4AGGA 3HEIA 5A33B 4FSJA 3ILRA 3SXWA 4M3CF 1CAXA 1H8TC 3E6BA 5FXXA 3TEWA 3WG4A 3T2PA 2C9KA 1NXMA 5EYYA 1AL21 5T55A 5FY5A 1U12A 1IPKA 4D3WA 4QPGB 1KFUL 2J7MA 3WNMA 3NKTA 3H3ZA 1W9SA 4FFGA 4A2UA 1V70A 2WN2A 3CIHA 2R30A 1VBD1 4YNIA 1TMF1 3ZKYA 4QAWA 1HV0A 3NNGA 4K20A 3IMNA 4Y22A 3S6PA 2WZEA 1ZZCA 1JZ7A 4COZA 4IE5A 3FBMA 1FT9A 4NIGA 3I3BA 3P5BA 3OB8A 3GHNA 4TN7A 1V6OA 2HBUA 1UY1A 2JDZA 3I59A 1QY4A 5FP7A 2WZR3 4E2GA 4YG6A 3EMRA 1AR92 2HJIA 1VJ2A 4BQ5A 4A42A 4JGZA 4D0QA 2VMHA 3NNLA 1MEC3 1AXZA 3MFCA 2VUDA 4COVA 2P37A 4LLFA 1O6UA 4FFIA 4UBHA 1OF3A 4Q4V3 1O8SA 2ILMA 2FCVA 2UY9A 3SNMA 2ZKLA 2B9VA 5IFTA 3J8F2 3PURA 2A75A 1QJFA 2A3XA 2D5HA 1RXGA 1X33A 4BXSV 1E57A 1KITA 1D4M2 2YBKA 3BYWA 1CAWB 1W90A 2BW8A 2YU2A 2XXZA 4MXWB 3UKVA 3WNNA 4CCDA 1WKYA 2V72A 4FPEA 2VQUA 2BYVE 3ZN4A 3IBMA 3CU7A 4KWUA 4ZU4A 1S0JA 1XXNA 1OURA 3VGIA 5L73A 4CXWA 1J3PA 4JGZC 1VRH2 1UXZA 2R072 3D6EA 4YVWC 1H1AA 1UU6A 3MEPA 5F5IA 3WZ1A 4D6SA 2LM3A 3CZUA 4LULA 4JAAA 1XNTA 1W6QB 4BXFA 1GBGA 4LO4B 3LSEA 3RJRA 1D4VB 4URAA 2XLFA 5FZCA 4AI2A 3AP5A 5IVYA 2DCYA 4JHTA 4OHXA 4A44A 2H0VA 3KV5A 2RJ2A 4LO7A 1W99A 3DL3A 4YPJA 4AFMA 3WUDA 3U0ZA 1UWWA 4RHV2 5FWJA 3CMGA 3GNEA 4XJUA 1JZ3A 2V73A 3QACA 4DO0A 2HYXA 4ONUA 4BOWA 3W58A 3ZSEA 3D8CA 5LEKA 1V0AA 4I30A 4HKLA 1DP0A 1DU3D 2ZGMA 4ITCA 4W65A 2TUNA 4PDWA 5EYXA 1UO9A 4EZ4A 5JWPA 3OF1A 4X8PA 3FBYA 4EN0A 3NAPA 2XBO2 3EYPA 4Y1VA 4XYXA 3WW4A 4PCRA 1D7PM 4CEYB 5CAZA 4FQ4A 3VV1A 3WLUA 1AL23 4IEWA 5LK5A 3DPRA 3UGHA 3OD4A 4Q4X1 1H1MA 5JOYA 4MGIE 3I2DA 1CIYA 3LEKA 1I1EA 3NMBA 3ST7A 1I5PA 1QIQA 1VBD3 1TMF3 3OPZA 3W21A 5BUVA 1K5JA 2EXJA 3H8RA 3LEGA 4KQ7A 4P08A 1YC61 1K45A 2ZMLA 4LBQD 5DUXA 1SLLA 1ASJ2 1YFXA 5ANNA 4UFJA 4BK5A 2JG8A 2Q8OA 5GZCA 3INAA 4ASLA 3MGUA 5AVPA 3H7YA 4LLOA 3T1LA 5IK4A 1EAH1 2QQKA 1S2BA 4HK8A 2DU0A 4BQ3A 4LQRA 5AC91 3USSA 5E6HA 3CO2A 4QPIB 2WSUA 1W6PB 3LD8A 1POV1 3A4UA 2QQPA 3GXUA 3S7IA 1HXS2 4QT6A 2VOTA 1COV1 3NO8A 3AMMA 4OLLA 4BIOA 4CCMA 2V5DA 3WUCA 4NE9A 3QLQA 2D98A 4RGGA 1W6MB 1D2SA 3BOWA 5CBLA 1XU1A 2B39A 5KXDA 1UAIA 4NPRA 4LK7A 4NHYA 2DVAA 5T3NA 5FZBA 3S7EA 5FR3A 3M3OA 2FHRA 3ZIWA 5IAVA 1TE1B 3B5LB 3O7OA 4TSVA 5IK5A 4XZUG 4DY3A 2DWRA 1OOPC 1XJAA 2GH2A 1JYVA 4V2WA 1S0GA 4DY5A 1AJOA 4ASMB 5ACA1 5LW9A 3VBUB 1QNYA 2X5IB 2VZPA 3GZEA 5CADA 5GJ6A 5CG8A 1MQTC 4E2QA 5L7OA 3PL0A 3CJIB 4YARA 1AYM1 2IFWA 1O3RA 1Y9QA 2UWAA 1BBT1 2WNVA 1VLNA 2ZEXA 3DXTA 2WNOA 4UYBA 4XXPA 1S0EA 1IZ3A 1GZTA 1JYTA 1REDA 1SLIA 3PUHA 3JQXA 3IDAA 5JDBA 4PIYA 2FMDA 4BK4A 3OD0A 4QKNA 1AR71 2ZCWA 3I8TA 5JI7A 5A3NA 2WKKA 2B8MA 1HRV2 4L11A 4QX5A 3JBG2 2RVAA 5GLTA 4F3JA 4IEYA 4SBVA 2V4VA 5JXJA 3BTXA 1PO22 4CCEA 1GU3A 5L7OC 4YM2A 5AVAA 2DCKA 2KR2A 3FUQA 3I4IA 3VKFC 5B2GB 3HIFA 4ZU5A 5A3OA 2EIGA 4Q4X3 1PVC2 4IXLA 2WFPA 3M1HA 1A78A 1WD4A 2Y34A 1JYCA 4HANA 5DQ0A 3A7QA 1AX1A 5JR7B 1W8FA 1OLRA 2D5FA 4DXSA 2W68A 4KWLA 2JD4A 3EB7A 4FFHA 3OBTA 3Q8FA 4MXVA 4AEMA 3B93A 3GYDA 4B4QA 3KT1A 5J1XA 3TWIA 2TEPA 5JZGC 2IFRA 3GHMA 1QJZA 4UW6A 3I49A 1NCRB 4LKEA 1JMUB 1F5JA 5FZLA 3H50A 2VOWA 4R9BA 1EAH3 5AC93 2QQNA 4I3GA 3FLRA 5FMCA 3T0AA 2ZGSA 3V65A 4FCAA 1G9AA 1POV3 3DV8A 2A6XA 1RXFA 2R042 3AJYA 1CIWA 3Q9OA 1GZ9A 4QXKA 4QGLA 3ZO0B 1COV3 1O7FA 1OHFA 2A6ZA 1BYHA 1ULOA 3T09A 3L2HA 3HN1A 2JICA 1JOJA 1AF9A 2YZ4A 4YW4A 4IQPA 2NMNA 2PN5A 4NUBA 3RDIA 3VB9A 3OGJA 4LKFA 2IXHA 4Z8BA 2L9LA 3BKZA 2R062 2VM9A 1W2AX 1MS9A 1Z0HA 4ATFA 1WLTA 5KHIA 4LR4A 1RMU2 3GJAA 3HR9A 2JIGA 1MACA 2QNKA 5I0UA 4HN1A 4A6OA 5DABA 3VHRA 4IEXA 1RUD1 4B7EA 1YQ5A 2XGXA 3HJRA 3IPVA 1OFNA 2Q4SA 4N43B 5ACA3 3AP4A 4UW5A 4YVSA 1Y9GA 1R091 4YZ2A 2CNAA 4GAZA 3PUAA 2SLIA 3SH4A 3MBWA 2NQYA 1DLCA 4PI2A 3UT0A 5K9YA 3ZFGA 4ZZ5A 5L9BA 1AYM3 3F2ZA 1UMIA 1FAYA 1BBT3 3N7JA 4P9JA 5FMOS 4NRMA 1MR5A 2LRPA 1OBNA 4HOOA 2VTXJ 2WR9A 2JE8A 2PLV1 4RR3A 5GZFA 2WZR2 2AREA 2ZAHA 3PLQA 4WVWA 2DTYA 1US3A 2CAUA 2VNGA 3OJBA 1PO11 1ULGA 2UWCA 2VBDA 3RYPA 4CUCA 1PM7A 2GH8A 4YVSC 5FJKA 5A7PA 4Y33A 3IDCB 4Y20B 4CPBA 2GN7A 5F3GA 1A34A 5KC6A 1OVSA 2WO3A 2NLRA 2P2KA 1S4CA 3NV1A 4OMDA 1XYOA 5FP8A 2I74A 2K46A 5F3IA 5JOZA 5FZDA 2KA3A 3ZFEA 2HEWF 4XTPA 1UOJA 3ZSMA 1GNZA 1NCQC 1ND3C 4PBPA 3O1TA 4JKLA 5FIXA 2VNVA 4OUEA 2FD8A 2F6BA 3O1PA 4OVEA 3AXEA 5IK7A 5FPAA 2HWB1 1OXCA 3LB9A 3PUQA 1OPOA 5FLJA 3R6SA 1LNSA 2BJSA 5D8AB 5FZFA 3WP5A 4DPNA 1EP0A 2HEYF 2BEOA 3PIGA 5FYHA 3RRDA 3SEEA 3R4DB 1AR91 3BGAA 4CEWC 2E26A 3UL2A 2Z69A 4QKDA 3ZDVA 4FVVA 3RJ2X 4TLFA 5EJ3A 5BNOB 3UESA 1DYOA 2EXHA 3ZFEC 4AW7A 1AVBA 4JQTA 1H4GA 4UW3A 4HBNA 1YHFA 3J8F1 3GZAA 3GZTB 1C8M3 1N47A 4OHWA 3VBRA 2A5ZA 1D4M1 4LKDA 2VOKA 4MYEA 4IV3B 1HQLA 2RV9A 5K0UA 3OUJA 4YLZA 1KRIA 3CZJA 2VD7A 2W52A 4RS5B 1AX2A 4BE3A 1RHI2 4XBNA 1TZOA 4DRRA 2PQQA 4K40A 3AP9A 3W5NA 3VBFA 5IWFA 2LUWA 2P3KA 4Q29A 3ZFFA 2IXKA 4AYUA 5KC5A 2XPJA 2JEMA 3KT7A 2B46X 4FT8A 4QHOA 4KG0A 4XIOA 3N9OA 3I2KA 2OQ7A 1R093 1BLZA 1GV9A 4OQ8A 5L9RA 2G9FA 3VBSA 1VBD2 2OPKA 1TMF2 2AGSA 5FUIA 3ZMOA 1CQ9A 4YWAA 4YYOA 1PZ8A 1Y3TA 2GMMA 1CX1A 1OH4A 4XABA 1R1A1 1WWYA 2Z4FA 2WNUB 1T2XA 2W1WA 4XETA 2B5HA 1RUC2 4CEYA 3ZFFC 2XWJB 2DTWA 1IPJA 1HV1A 5CFCB 1ENXA 3PJYA 2WRAA 4YW2A 1PK6C 4AVSA 1NA1B 4PLNA 4LOTA 4F7ZA 3ETQA 1PO13 4OHVA 2H0BA 1G86A 2OZ6A 1C1FA 1GP4A 1X9PA 1KS4A 3D82A 4RQPC 1LB2A 4IETA 5A3MA 2GMPA 5DAWA 1W6OA 4Y5Z0 3VBSC 1C8NA 1XRUA 2VG9A 2Y64A 3KHBA 2LROA 1UF2C 1DBNA 4KGGA 4WM8C 3JB4C 3WF2A 4Q0PA 5FQ0A 4X8NA 4QQ2A 2HWD1 2Y8KA 4WM7A 3PJQA 5IYYA 1LOBA 3WG3A 4QQLA 4K1YA 3WNXA 4X6RB 2HWB3 5A7WA 1DQ5A 1QH7A 2KM2A 2RDNA 4Y1YA 1OUSA 4QPWA 4BWOA 1YFYA 3A22A 3KF3A 2E51A 4LXLA 3RMYA 5JXIA 3FZ3A 1YLLA 3HBZA 1SQ4A 2E7AA 2CWSA 2ZHMA 2VC9A 1WW7A 1CAUA 3MW2A 3KVAA 3UV9A 3THTA 2HWF1 4Q5OA 3DN7A 4Q4W1 4GULA 5SV8A 4CP9B 5GM0A 2JDHA 1C4RA 1GOGA 4YVWB 5FPBA 5FY8A 1ZZ8A 4ES8A 4IL7A 4XCAA 1RVF2 3H8UA 4QX8A 5FPVA 4IV1C 4WM7C 3CF6E 4EROA 1R64A 3USUB 1D4M3 3PVOA 2AEYA 4QXHA 3U75A 3BTZA 2CL2A 3DKWA 1POQA 5F2SA 1V6NA 1B35C 1E5HA 5FZAA 4P9WA 4UOJA 2P3JA 2C6SA 4LORA 1QJU1 4BH9A 1W6NB 1AR61 3CJIA 3M4FA 3ZYPA 4OCTA 3WP4A 3ZX7A 4AI1A 2Q8DA 1UYXA 1ONAA 4BA6A 4W8JA 4ATEA 2PHWA 1AXYA 3KQRA 2O8OA 2NYYA 2ZACA 3KCYA 4GWNA 4DNYA 3K4ZA 4AOCA 2VMDA 4YGCA 4HL0A 5FLIA 4ZU7A 1OA2A 2DV9A 3AYDA 4B1LA 2LS6A 3KGZA 4AFAA 4W6YA 1QDOA 2B42B 4Q4X2 1M4WA 2VVDA 3VZMA 4GQ7A 1NYWA 4C91A 1GNYA 4QU2A 3LQCA 2ZHKA 3PNAA 1WCSA 3M8LA 1QOOA 1QH6A 1W9FA 1R1A3 2ENRA 2WS93 4M3CA 3U78A 3URFA 1K5MA 4RFRB 2IVJA 4Y3OA 3RZKA 3FHAA 3QCWA 4UFKA 1HB1A 2W08A 4GB31 3Q8AA 4CDQB 1Y43B 3OYWA 4XUOA 1OUXA 4KH9A 2IC1A 1X8EA 1HRV1 2GC0A 2VMCA 4L92A 5JCTA 1EAH2 1IG3A 1OQ1A 1W8HA 1AL0G 4RYDA 1ZYBA 5AC92 1O3TA 3JXSA 2XLGA 1O4TA 1ZA7A 5F1RA 4MG2A 4IEZA 1UXXX 2YC2A 2A1XA 5FYMA 4CDUB 4DS0A 1CPNA 4GALA 1S0CA 3KGLA 4MV2A 1COV2 1RUI1 4IEOA 3VBOA 5LBBA 2QQIA 3MIGA 3PUSA 4CDXC 4D8MA 5A6XA 4CUBA 3N4MA 2XKPA 1ULCA 3RZGA 4I01A 4JRAA 2ZPXA 1QKQA 4N8MA 4YFZA 2HWD3 4U36A 2DFBA 2VGDA 4XVHA 1JZ8A 2AACA 2YUEA 3MUY1 3J7HA 5K7PA 4FOQA 2TNFA 4NIAA 1OLME 4LITA 3MYXA 3J7MA 3VZKA 1OPMA 2X8KA 1LHWA 4META 4XDPA 5C4WC 4MGQA 3VHOA 5E8AA 4ZXKA 1YJKA 3R05A 3WG2A 4EV0A 1W0NA 3JZVA 4XUTA 5ACA2 4CCKA 1TME1 4YGEA 1QEXA 2ZGRA 2IXCA 1BHGA 2HWF3 3U1XA 2R041 5I8TA 4Q4W3 4FQZA 1GZWA 4Y26A 4ZY9A 5FV3A 5A70A 1AYM2 4NPLA 4FAGA 1Y9MA 4AQTA 1BBT2 4EWAA 1LAJA 1J83A 3JU9A 3SCFA 2FCTA 5J98B 4DRVA 3CL1A 3BUCA 1NZIA 2VW0A 5FYUA 5KXCA 5EZWA 2IXIA 2R061 2VBPA 4A4AA 1MQTB 4AVVA 4XUPA 4QM9A 4ZXEA 4Q0SA 5F2WA 1LJ7A 3BTAA 2GMEA 3RZJA 4N9IA 5G05L 1QJU3 1AR63 2XKOA 4LBQB 1H6XA 1PNGA 4IEQA 1V6JA 3J7NA 4UXAA 1PGL2 3BPSA 4QMAA 1G9CA 4LA2A 3VZOA 5DG1A 4PIZA 1JW6A 1CESA 3POIA 1YQ2A 3LSDA 2GNTA 4PBOA 3KF5A 2GN3A 1X50A 4C0BA 4Y5TA 3ZXKA 5KHGA 4N53A 3D0JA 1WMEA 1TG7A 1YFWA 2WDBA 2OW4A 3VDDC 2VY0A 3N9MA 4ORFA 1W39A 2WC2A 1ZBA3 4AHXA 1W2OA 5F9TA 4GKXA 1CJPA 2RDQA 4DMIA 1VMFA 5FZOA 3UK9A 3T30A 4GB33 3R4SA 2W1UA 3NSTA 5FKCA 3WT3A 3AMNA 1OLQA 1QJX1 2XJPA 5I8YA 4GJYA 1BMV2 5LWBA 4ZPIA 4EJRA 4XF1A 5BNPB 2FDGA 5FZ9A 1FXZA 3K4DA 2VW2A 1C8M2 1RUI3 3CLPA 2Q0AA 1QU0A 3RYRA 1LRHA 5FY9A 1ZBE1 2QBXA 2W0XA 3TNPB 5FMBA 2YY1A 5JPNB 3Q8CA 3N35A 3NV4A 3QH7A 3O1RA 1O5LA 1W8OA 2JDPA 5DUWA 4AVCA 4H14A 4QQOA 4OI0A 2ZEZA 1PNFA 4FPYA 1DLLA 2D6LX 4AF9A 3MPBA 4ZHNA 1WA6X 4JHZA 2FMYA 5FFOC 4OYUA 1SEFA 1CPMA 4Y4YA 4GH4B 3ZYBA 3TN91 3WCSA 5FMOL 3Q8BA 1TME3 4RS5A 1TVGA 5A1FA 1WMXA 3HNYM 1IKPA 3UGFA 3ZYRA 1MVQA 1RGSA 5C3OA 3IAPA 2W46A 4P00B 2FCUA 4PLOA 2UU8A 5H9PA 5KR7A 3AKTA 4NRPA 4AZZA 2MNGA 5FZEA 1MS8A 5LRRA 4XFIA 1GP5A 2XOMA 3ECQA 4QX3A 4U2AA 4WVZA 4CCOA 2WLQA 3K3NA 1RHI1 2BNOA 1JYNA 2W94A 2QQJA 1JI6A 5FUPA 1C28A 4JGYC 3POFA 3ROUA 5A3TA 2BVBA 1PO12 1SFPA 1HW5A 3T1MA 1OA3A 1TNRA 2Q1MA 3WF0A 1ND2A 5L9VA 4NIDA 4A45A 1K42A 5C9AB 1A8DA 5CYYA 1YIFA 3SH5A 2VTFA 3RVHA 1UPSA 4UFMA 2WNUA 3D4KA 4FPHA 4CDWA 5APAA 1Q8OA 3ZYFA 2PAEA 3NV2A 3J9SA 1UU4A 2VECA 4M4RA 2I07B 5CFCA 3I2JA 1PGW1 4JQRA 1NA1A 2D3SA 4EWEA 3V0BA 3M2MA 4OUMA 2ERFA 5FKBA 2B7YA 2ZX0A 3PIJA 4DINB 1RUC1 2BWCA 2HWB2 2Y33A 4FPJA 3GCXA 3RPQA 4KGQA 4RGAA 2WA4A 1VAVA 4QDQA 2R1DA 5FBZA 1DQ1A 2UYAA 1ZVFA 3AX4A 4WVMA 3I2IA 2XH6A 2OQ6A 4QB6A 4CUAA 1QJX3 1NUKA 4CDWC 3O12A 2BUKA 3X29B 3H8OA 5C8CB 5DMYA 3RYKA 2MHFA 2VZSA 5CB7A 4XACA 2JJ6A 3PHMA 5FYTA 5C3PA 1QMJA 2JX9A 4XJ9A 4CEWB 1JZ2A 2WAOA 5F3EA 1VPHA 1Y7BA 3MPPG 4Q2FA 5FOJB 3OGSA 1LR5A 4L99A 2YPDA 4DXZA 3TEZA 1O4YA 1ZBE3 4E8CA 3AVSA 4I02A 4CU7A 2QDNA 3W5MA 4S2GA 3ZM8A 1UKRA 1ULDA 1UOBA 5JMOA 3KWVA 3N9NA 2BFUS 2J1SA 1HQWA 2Y6HA 2D44A 2C9AA 2RDSA 3AKPA 2P1BA 2QDRA 1UPIA 2XHKA 1CD3G 2DCTA 2D43A 4IW3A 3O0WA 3TN93 1LHUA 3LGRA 4BMBA 4LPLA 2IXJA 3GF6A 2XUMA 3MHZA 2VVFA 5LY1A 1RVF1 1F35A 2XJRA 5M0TA 2JB8A 2FDIA 3NQHA 4XJWA 3E5QA 2RG4A 4KL1A 4DOUA 4F8AA 1XB9A 1V00A 4F83A 1R1A2 5LA1A 2WS92 4XFGA 3IIIA 3UGGA 4DB5A 3NL1A 3MIFA 3O1VA 4HPKB 4PI0A 2Y6JA 1RHI3 5F5CA 1KQRA 2ETEA 3AKSA 5BV6A 4JX0A 5BYNA 3VD9A 4W50A 1AYN2 3HMYA 1LENA 4RD7A 3I3MA 2RJLA 3I2FA 1Y4WA 2XL9A 4HMZA 4WZCA 2VZVA 4FPKA 5EIYB 2C0ZA 3PTYA 1WW5A 2VCAA 5HI0A 1ODNA 3BIWE 2AR6A 3BPZA 3NNMA 3AP6A 3O1MA 3BODA 1PK6B 2K0GA 3MICA 3ZYJB 1XU2A 1LODA 5JUVA 3I7DA 2CY6A 1DDLA 2JG9B 3AYAA 5J48A 3OG2A 2WQ8A 3AB0A 1ZA4A 2PAMA 1LESA 1LOFA 1UL9A 2CWMA 2R32A 4RQPB 5E1RA 2GDFA 4I0AA 2HWD2 2VXRA 1QJY3 4K7JA 2VBBA 4QXCA 1RUC3 2OUJA 4PDWC 1IG0A 2JE9A 1EPZA 1HJFA 1W8UA 5A32A 1JYIA 4WM8B 3NAPC 1E5SA 5FZ1A 2WO7A 1CAVB 1SMVA 1VALA 2CDOA 2Q8EA 4DEQA 1ULFA 2JDAA 1N1SA 4JCKA 4MGYE 3DCQA 3JCIA 3DPRC 3TOJA 4A3XA 2ZGLA 4E4HA 2CU5A 2HWF2 4XAEA 4ZS2A 1NX9A 4Q4W2 4QX2A 4K6BA 4MOAA 1W8WA 4W6XA 2RS31 4I09A 4LUMA 1WGPA 3IT8A 1V6KA 1G6NA 1G9FA 3IWZA 1ENSA 4YZ3A 3N7LA 4BMEA 3APBA 4IDZA 5DPNA 5LBEA 1VAMA 2JG8C 2WABA 3N9PA 4E2SA 5CA6A 3POGA 3BIEA 3AZZA 1FX5A 4NHKA 3VL8A 1QJU2 4A7YA 1L7LA 4GWMA 1AR62 1ZZ9A 4YRDA 4A7KA 4BZ4A 1VE0A 2ZXQA 1PMHX 2W47A 3PMSA 4MSVA 1B35B 1CZSA 2PHRA 3DF0A 1OD3A 2YMZA 2A71A 4TYSA 4Z2WA 5FXWA 1GANA 2CHHA 3DKQA 3VBHB 2ZKNA 1APNA 2VUCA 4XIKA 2Q1FA 4Q1PA 1KFXL 3WQ7A 5FXVA 3VDAA 1RVF3 2ORXA 5LATA 3KCCA 3RZZA 5GZDA 3NV3A 2YROA 1MZ5A 5SV5A 2CYFA 2VCCA 3IZOA 4AE2A 4NMIA 3HBKA 3S30A 4QQHA 2V4AA 1ZBA2 1VBB1 4CP0A 3ACGA 1WBFA 3HD8B 1UW8A 3K3OA 4AGRA 5DZEA 2DCJA 1TQ5A 5FY1A 3O1UA 5EPAA 2WO2A 4GB32 1DGLA 2QCSB 4CVUA 1JZ6A 4MGTA 1JHNA 5ISLA 4J1WA 1VB4A 2A6YA 1H4HA 3I54A 5DUVA 4D69A 3H7JA 1PGL1 1QHDA 3K51A 2VL4A 1ZZBA 3WNLA 4B8EA 4CU6A 2X10A 1AHSA 1OQDA 2Q30A 4EWDA 4FAHA 3RMXA 5EJZB 4OHZA 5ANQA 3FC0A 3WDXA 2WNVC 3POJA 1RUI2 2DU1A 1LOAA 1O5UA 2XG3A 3HQXA 4B4PA 2QQLA 2ADEA 3OEAA 4PIXA 1FNZA 3H9AA 4I0BA 1RUOA 1WW6A 2H6BA 3G6JB 1VP6A 2R1BA 2Q1ZB 3BB6A 3HT2A 4FP2A 4LTAA 5LK7B 5FZMA 3DUIA 5CKMA 4AEDB 2QKDA 1KJRA 2H6CA 2W3JA 3MIEA 4CDXB 1KD7A 2RE9A 1LEDA 5JLVA 4MLOA 4CA9A 3NJZA 5FBJA 2ZBJA 5FZGA 3PVBB 3KZ4C 1RUNA 1S2EA 4ET7A 1BMV1 2JKXA 4B4RA 3HAGA 5ERLA 4XE9A 1W8TA 1B09A 2W2IA 4UAPA 1TME2 5DAQA 1OI6A 5GLWA 4JTOA 3ILNA 4CCNA 4L97A 5CFDB 4HZFA 1XBFA 1C8M1 2PHTA 2RS33 2ZTNA 3MFAA 4AL9A 2JDYA 5FYSA 5BNNA 5C4WB 4S2HA 2D6PA 1YI9A 3JQWA 4Y1ZA 5I0DA 2DVFA 1H2KA 4EQVA 1O4ZA 4FTSA 2EVXA 3E5UA 3MW3A 5FZ8A 1PMJX 2YPJA 1UZ0A 3ETPA 1W3XA 1Q56A 3BU7A 3AL6A 3IMMA 2XUEA 1MZ6A 1H2NA 3POBA 4YGDA 1RUE1 1V6MA 1BEV3 4FTEA 3PVNA 2YFUA 2E31A 4NIIA 5J37A 4CPBD 4XBQA 5FJHA 4AXOA 4JRLA 1K12A 2ZGQA 3UKNA 2VMGA 3FLPA 3W9AA 3ZN6B 2QQVA 2W87A 3LA3A 5FYCA 3TAYA 4O9GA 2WNEA 4IE4A 4QPYA 4I3PA 5FO7B 1BK1A 3VLBB 4NROA 3ATGA 1GQPA 3FHIB 3WNKA 2XMLA 3AC0A 4GMP0 2A6VA 2C4XA 2NN8A 3HT1A 4NHLA 5DDJ1 4AVBA 5A33A 3L9JT 4M01A 4CUGA 1RUJ3 2XDVA 1X9TA 2VPVA 3NRUA 1VBB3 2OUHA 5ABJB 5HV4A 1V9U2 3HWJA 5JPMB 4P14A 1CX4A 4QPGA 3CQOA 1J3QA 1CZVA 3FWEA 4L0PA 1OQEA 1X36A 2DUQA 3OOXA 2DBNA 2PHLA 3VDDB 3K77A 1QJX2 3MDPA 5CKQA 1OF4A 4XQDA 4H2AA 4L8QA 4IUGA 2Q5TA 5F8PA 3TRSB 4OZXA 2FQPA 3OBRA 2YC4A 2DBIA 3ZFGC 1ZM1A 5IVJA 1OSGA 3H1MA 3TB0A 1OMIA 1CN1A 1JYWA 5DAPA 3M3EA 4Z82A 5IW0A 1BK0A 5I91A 2YV8A 1IS3A 2RS11 1OVPA 1H2MA 2EICA 3O0XA 1GYKA 1ZNPA 4RR3C 1ZBE2 3S57A 4OI2A 2EXIA 4CU8A 5IFPA 4CRQA 3FE5A 2ES3A 2MPFA 3SH3A 1F9KA 1WD3A 3N3HA 2FDFA 1H1IA 2EALA 2JECA 4GZ9A 4UF0B 5KHJA 1G8WA 5KHKA 3MO4A 3PU8A 2B9UA 2QE3A 5CISA 1I5ZA 2Y26A 1CAWA 1JS9A 4MXWA 2EAKA 3TN92 3S0MA 2WFF1 4FPGA 1N3PA 1QJEA 2K9ZA 4QM8A 1VMHA 2V5YA 3ILFA 5A6ZA 1GWLA 2BP6A 4LBKA 5A32B 3MIHA 1MPXA 4YW7A 5LRSA 1OFSA 2O8QA 1JU3A 2GNBA 5H9RA 2DDUA 3VD7A 4M0HA 1W6QA 1OD5A 5GLZA 2UY8A 2VAUA 4COWA 5IK8A 3WHTA 4QX0A 4GA9A 4Y5SA 1N1VA 2LALA 2W91A 3WDTA 1RTVA 1LEMA 1KJLA 1SCSA 1BCXA 1D2QA 1RUE3 3VZJA 1GZCA 1F4HA 3WDVA 2JDUA 1U0AA 4P9LA 1NXD1 1BVVA 3RG0A 2P3IA 3SISA 3H1YA 2WQZC 1GKBA 3WW3A 3ZDSA 4E4SA 4QKFA 4XILA 4JGYB 3VBRC 4JDNA 3ZSLA 2G9ZA 2HBTA 3OY8B 4LKSA 4J6GA 4EE2A 3V56A 4IGQA 4D7SA 5K0UC 1PGW2 1H8TB 2O14A 5DAVA 1MZFA 1W0OA 1HDKA 2E32A 3B02A 2CGNA 5DDJ3 3MZHA 2A3YA 2WS91 2HKXA 3VBFC 1QJY2 2HYKA 4MADA 2ZEYA 3BN6A 4IGPA 1O3SA 4S2DA 5GZEA 1X7NA 2A6WA 3KV9A 5I0SA 3OGVA 1AYN1 4XFFA 2GU9A 3FHQA 4EN8B 3H8XA 2JG9A 4FBFA 2BGPA 3SITA 2ZGNA 2HWC1 1XYNA 5LA2A 3LDKA 4OFGA 1VB2A 2WA3A 5B4XA 5CU1A 3ZXGA 3A0NA 4XJ8A 3B3QE 4QB1A 2VQTA 4XTMA 2RR11 5JIUA 3AMPA 4LBMA 1PZ7A 2RS13 4CEYC 2FDHA 4K8FA 2WINB 2OT7A 2P34A 1VRBA 2PMWB 2WJSA 1W6PA 4QPIA 3GZUC 3P1IA 5A3LA 5B4NA 4Y22B 3V0AB 2YGLA 2FZ1A 2P6CA 5CG9A 3J4UH 3VHNA 4W6WA 4JDMA 2R49A 5KXBA 2BU9A 5T54A 4BLJA 4AVTA 1JYXA 1W6MA 2VXJA 2OA2A 4FP3A 2VMIA 2XVLA 3B00A 4XF9A 2A73B 4QGNA 1FATA 1GOFA 4NR1A 4HFSA 4W4ZA 1GOHA 2F4LA 2WFF3 3E5XA 1GUIA 1VAKA 1L7RA 2YHJA 4JGZB 4FTBA 1J84A 2D93A 2XJVA 4C90A 4JZRA 2K2SA 1WLDA 2AENA 5EXOA 3B69A 2R16A 3P3NA 2VO5A 3VBUA 2X5IA 1YNAA 4P9YA 1LULA 1RUG1 4FPFA 3BALA 3MV01 1UCXA 4LMFA 2VCMA 4AGVA 4FPCA 2ORZA 2MEV3 4JKMA 3OGRA 1OKQA 4AHWA 5J7MA 1YUDA 1NKGA 1VMJA 4C1XA 5FK8A 3LIGA 3AM2A 3E97A 4WBBA 4CYDA 2D3PA 2ZGKA 3ZXDA 1UZWA 2J1UA 2PELA 3POEA 4NN0A 3WG1A 4LJHA 1UQXA 3NNFA 4RN5A 2X5IC 1YXWA 2EF6A 4LHNA 5FZKA 1ZBA1 4BU2A 3CJXA 2ZABA 1C5IA 3AZVA 3UJQA 1X82A 1IQAA 5IJRA 3WD5A 3CJIC 4CSWA 2FDJA 3UKTA 2X09A 5JSPA 4YG3A 1MS5A 3H3UA 2YGMA 1AYN3 2O1QA 3AFKA 2VJXA 4CE8A 4QX1A 5J96B 4HKWA 3RI8A 3OUHA 2HWC3 4COYA 3GCWA 3SCHA 1HRI1 2VVEA 3POYA 1BKZA 1HB3A 4IESA 4PDWB 5FDBA 3L2YA 4R9DA 3JD72 4AHYA 2RS32 2BOIA 3I2GA 2WIIB 4P9GA 5IATA 5JMCA 4INDA 5A80A 5FZ4A 2RR13 2WQ4A 1NCRA 3POSA 1K5MC 3DPRB 3ZPYA 2E63A 2JIJA 4NWVA 5FOBB 4XFCA 3KLSA 4IE7A 4AFCA 2BGOA 5FP3A 3KVBA 2XWBB 2Y38A 1GP6A 5FPUA 1BEV2 2J1EA 2JENA 5KXEA 2VUJA 2OPWA 2VZ1A 5FZ6A 1WCDJ 1UY2A 2JG8B 3AYEA 1T6GC 4PLMA 4CU9A 4RA0A 4H7LA 3VBOC 1SBEA 5EQUA 1MS1A 2ZGUA 5JR2A 1TEIA 2CAVA 1UY4A 2ET7A 1H9WA 1CZTA 1QOTA 3KV6A 4TLGA 4YW3A 4BCUA 1OOPB 3RWNA 5HXMA 2ZS6B 1EV11 1RUJ2 2VNOA 2XJSA 3FFZA 4HSJA 5LEJA 4BQWA 1AR83 1VBB2 2NM1A 4N43A 5A6YA 2E53A 2ZZQA 2UURA 1AX0A 2PHDA 1RUG3 5K4LA 1URXA 1QGLA 4JV4A 3QOPA 3K46A 2HH9A 5FYIA 3LPGA 1KGYA 2FBEA 4NO4A 3RZLA 2GAUA 3T2OA 5GALA 1YFUA 3C8XA 1ZRDA 2EIEA 4Q8LA 3ZYGA 4LOSA 1OKOA 5C3SA 4AAPA 1PIV1 5AFBA 3C7FA 5FREA 5KWRA 4A7ZA 4AEKA 4GJZA 4LNVA 2E33A 2YB7A 3AL5A 3WW2A 4ASKA 5CVRA 2HLEA 1UYZA 3SMHA 3U4SA 3TNQA 4YZ1A 5L7OB 3U07A 4Y20A 3JUUA 1RUH3 3A21A 4O65A 2OYZA 1V9U1 3K75B 1HKDA 3S5AA 2VZ3A 5DXDA 5HCFA 5F6LB 1RUF3 2WAAA 3C2UA 2ZHNA 3U14A 3LA2A 4AI8A 1ULEA 2PQSA 2Y6FA 2B4KA 3LFMA 1JODA 4HXCA 1DIWA 3B01A 3WQ0A 5L19A 3ZR6A 3EHKA 3ES1A 2JDKA 1NZCA 1HRI3 1OH3A 1UX7A 3LEIA 4D7YA 2BRTA 4Q27A 1DYKA 3VD4A 4BDVB 4CP1A 4XF4A 5JZGB 1VBA1 4N53C 4A3ZA 4MVTA 2JB4A 5D8AA 3VKMA 3E6DA 3IAQA 4B1MA 1XQNA 5C5UA 4XQWA 5FLHA 4EYUA 1W04A 3WNPA 4ISRA 2EIBA 3NJVA 2PYTA 3IN9A 5BNOA 1HB2A 2YXSA 2F17A 3CBNA 4R52A 5T5PA 1DQ6A 5FPZA 1MS3A 1QWRA 3P3PA 3ZXEA 3SCGA 4D7TA 2EXKA 1RUE2 4ZZ8A 3PU3A 3M7AA 3WHUA 4GXLA 1QXJA 5A3UA 1DCSA 3W59A 4IV3A 5E88A 3I97A 1H8VA 3AMQA 4KBZA 4UWDA 1DFQA 1IQDC 4LEJA 1OA4A 4G4FA 5FAXA 4ARXA 2PXJA 4D6QA 4PF1A 3VUOA 4Z1VA 1T6BX 4BLIA 5LA9A 4AWDA 1ZRFA 2ATFA 3U11A 3RZHA 5DDJ2 1J59A 5F5AA 4QKBA 1EYBA 3UJOA 3WDYA 1EV13 4B3NA 4BISA 4N90A 5BNOC 4XHXA 4LHSA 3EO6A 4A6SA 4BPZA 1CJDA 2ZOEB 4AHZA 4AI0A 1UOGA 5A7QA 5FWEA 3CEWA 1BVP1 1MS0A 2GALA 2RS51 3KV4A 3LF7A 3OY8A 4Y1UA 4LHLA 1SDWA 3OBZA 1H8TA 4Q1RA 3KS7A 2V09A 4H3WA 4RS5C 2DURA 4J1XA 3N7KA 3LEMA 3DXUA 4XUQA 4Q4Y1 3WSOA 4CCCA 1H9PA 1XE7A 1R081 2I45A 3IPVB 3LDBA 3ZXAC 3MI8A 1FYUA 1PIV3 4YVSB 2BGCA 3P6BA 4C8DA 4Z92B 1AZDA 3AK0A 3J26N 4RSUA 1A3KA 2RS12 3ACHA 4H55A 3ZXFA 3FMGA 1QJY1 4JTNA 3B9CA 1PMIA 3PDQA 3ZFGB 5A1AA 2HWE1 2C24A 1V9U3 2PAKA 4D94A 1ND2C 4JVAA 5FY4A 1Q3EA 1NCQB 1ND3B 1KXGA 3NNJA 1QF3A 2FZ2A 5C71A 4XQ4A 4L2NA 3T0DA 2WNUC 4RR3B 4AQ6A 4XFBA 3GBGA 1BZWA 4M3CE 2E7TA 1WLCA 1YJLA 4R9CA 5CFCC 2WFF2 2RDRA 3AFGA 5D1IA 2Y6LA 5EP9A 4C1WA 4P9XA 1JUHA 1NA1C 4DXRA 3AP7A 1SPPB 1VBA3 2JD9A 3KM5A 3OEBA 1YQ8A 3THPA 2ADDA 5LCWL 2CV6A 2CGPA 1VBE1 2WYFA 2WZ8A 3FUOA 1UNBA 1I6XA 1UYPA 3M70A 3ZFEB 1JZ5A 1QQP2 2BBAA 4IERA 4UFLA 3I2OA 3IDBB 2QZ2A 3M3QA 2OS2A 4CP9A 5C33A 4HONA 4YVWA 2VZRA 5FYZA 3I3EA 1LU2A 5FY7A 1CONA 3RNSA 3WNOA 3WDWA 1NT0A 1O3QA 2MEV2 1H6YA 1XE8A 1G7YA 4PJYA 4RL7A 3USUA 1V6LA 3PTRB 5EWSA 2PHUA 2TBVA 3BCWA 5FYYA 4YM3A 3GBWA 1LGNA 4E4DX 3WR0A 3LIHA 3RQ0A 2VMEA 3LAGA 5IVEA 1SLBA 1C3HA 2IUWA 2DYCA 1WA4A 1SDDB 2Z42A 4KWJA 1W6NA 1WMDA 2XQRA 4CXXA 1POV0 4NJ4A 4XJAA 3VKOA 1KEXA 5CKNA 5F32A 3E6CC 4AQ2A 5D21A 5EHDA 4KBBA 3VBRB 4P5HA 4C0HA 4LO8A 1ODMA 1YRZA 2WWJA 4Q0UA 2X05A 5K0UB 1PGSA 3SQOA 5FZ0A 3LPFA 4KU8A 1RB8G 2RS53 1EUTA 5T5LA 3GGLA 2VOXA 2GC1A 1UOFA 2HWC2 2Y6KA 4QGMA 3MIBA 5BXXA 3VBFB 4DFSA 1JOBA 3VZLA 1WW4A 3N7MA 4UBGA 3NJXA 4R8HA 3ZFFB 4R9AA 1DQ2A 1H30A 5LBFA 5T52A 3EBRA 1FPN3 1YQ6A 3WX5A 4Q4Y3 1UMHA 3D0SA 1F2NA 1R083 2W9XA 4IEVA 4MUVA 3N9LA 4M00A 2RR12 4ISQA 4CDQA 4QQPA 1FMD1 2YG0A 3MIDA 2D6KA 2X53S 2D6NA 1DHKB 4XBLA 1K3IA 4YGBA 5F3CA 2QFEA 5BY5A 3IM0A 3POWA 3VBSB 3ACLA 3ENRA 5GZGA 2HWE3 4CDUA 3BVCA 3HQRA 1C1LA 1KDMA 4FOYA 1GR3A 2RM21 3J7LA 4OI1A 2E9QA 2JKBA 2P6HA 2YFZA 3ORJA 1VBC1 4AVAA 3HPNA 2AZ5A 4MO3M 2UWBA 3VD5A 1WLWA 2VZUA 2ZGTA 2W39A 4YFWA 3ZOIA 3JD71 1IKQA 3KB5A 4CDQC 4O7XA 5BPXA 3PUIA 5FY0A 1LOFC 5C3RA 2PFWA 5A1LA 3FX3A 1H0BA 4L9BA 3RSJA 5FYBA 1W6OB 2D7FA 3LDRA 4Q8KA 2RHPA 1AR82 2DUOA 4CDUC 4WV8A 3OBAA 1VBE3 5LB6A 1F31A 1UYYA 1N1TA 3DYPA 3T0BA 4FXKB 2J1RA 2JDNA 1W8ZA 1YQCA 2ARCA 4LK6A 1OT5A 4HK9A 2YC0A 2ZGOA 5FQ0B 1JHJA 1RUG2 4NOTA 4IV1B 4WM7B 4YZ5A 1BEV1 1IS5A 5JSOA 1YO8A 4PF5A 1OOPA 4DZGA 1GQHA 5A7WB 3KT4A 4QU1A 1ENQA 4XF3A 2QQMA 2Y0OA 5IUQA 5TSWA 1UIJA 5CEHA 1M06G 2GC3A 1MQTA 1SBDA 5EFUA 2A7AA 1CAUB 2AC1A 1BXHA 1Z7S1 2VQ0A 3ZSJA 5BNQA 3LWCA 1YEWA 1RUJ1 3D3AA 4LBQA 2D97A 2WUHA 1GFF2 2Z2SB 1RUH2 1U5YA 1DZRA 2NZ9A 1RUF2 1LGCA 2ZX3A 1W9TA 3FJSA 3RGBA 3MW4A 2BV4A 1UN1A 2VH9A 4XDOA 2HEVF 5LA0A 2RMU1 1Q5OA 1S0BA 4ARYA 2WBKA 3HVDA 3N36A 3MUZ1 5H9SA 4P9IA 3ALQA 3MF9A 4AEJA 1HRI2 3ZSKA 1SG3A 4BIFA 4G3YC 1UKGA 2P17A 1IHMA 3MLJA 4HLTA 1SACA 4UFIA 1EPWA 5FYVA 1W06A 1GWMA 4Q0VA 5DN2A 2OX0A 3AXDA 2R6QA 5K8SA 4QXBA 2VMFA 3WDUA 2XB6C 2WSVA 3VKNA 2PHFA 1FMD3 5A7OA 3NKGA 4IGOA 4B29A 4OUSA 2AEZA 3C3VA 3I3QA 4GD4A 3MF6A 4AI9A 2R7EB 2AYHA 1QXPA 2VZQA 5BNPA 4M4PA 2XL7A 3Q8EA 1IGOA 4OZOA 3CNAA 3GDBA 5JZGA 5I8SA 3EJKA 1S0IA 4M3CB 3WF3A 2RM23 1K5MB 5FMDA 3ZR5A 1STMA 2G9GA 2JE7A 5DG2A 3NW4A 2ZA9A 1VBC3 1ZZ6A 3WQBA 3FFQA 2A70A 4N7UA 4O61A 1DGWA 2VULA 3OYWB 3AMHA 4Y1XA 2Z5WA 1RJ8A 3WY6A 3WP6A 5LASA 5FP4A 4AAXA 4ZONA 3JD73 1IOAA 4COUA 3ZN5A 4CCLA 4H7MA 5FUNA 1UZYA 3C7OA 5DZFA 4RGKA 1ALYA 1EV12 4XW3A 5BNPC 1PVXA 3VBOB 2BZDA 1QDCA 4GH4A 4KWKA 2OIIA 3A0KA 4K1ZA 2ZX4A 3H42B 2NMOA 1MZEA 4FI9A 3U10A 1JBCA 2R0FA 3ZVXA 1SCRA 4LT5A 1FOD1 1JN2P 5IVBA 4OULA 3U4XA 2AH2A 3I2HA 2BNNA 5F37A 2OVUA 2O0OA 4YG0A 3TYJA 4TWTA 2B45X 3DYMA 1LHVA 1SLAA 4NAOA 4UT5A 5FTTC 1LTEA 4X6QB 4AI3A 5BNNC 3LOBA 1NG0A 1NQJA 4LHKA 1NY71 3O1OA 2RJKA 1WZXA 4AFBA 1PIV2 4UW4A 1I3HA 2Z79A 4OQ9A 1Z7S3 4GH4C 3AKQA 4R4XA 4QHZA 5A3PA 4BM8A 1GZWB 2IZWA 5C9AA 3OPTA 4JDOA 3T4HB 2VOVA 4HT1T 4AK3A 5JVVA 1RYYA 4HKOA 4YSFA 1QOSA 3NVCA 1X8MA 4CP2A 4I2OA 1U5ZA 1XYPA 3IDEA 1UY3A 3SLIA 2KXLA 1F4AA 4FOWA 1XNDA 2GNDA 2ZAAA 2RMU3 1LECA 3N9QA 3MV11 1DGRA 3HQUA 4KNCA 1WCUA 1WCQA 3KD4A 1O8PA 2XR4A 1QXRA 2DUPA 3H0OA 1C5HA 3ACFA 1VBA2 3BI3A 1O59A 2F4PA 2E6VA 5C9AC 4XUNA 4Q26A 4Y4RA 1NCQA 1ND3A 1NE6A 2BDRA 5HCBA 2XJTA 3AKRA 4BB3A 3ZMNA 3SHRA 1YYNA 1XSRA 1CR7A 4QWNA 3LZZA 2BPA2 4ZS3A 4FFFA 4QPGC 5FP9A 4BYYA 1AR73 5C8CA 4N53B 2QZ3A 4KI5M 5LBCA 2J42A 4UI9L 1MEC2 1AUYA 1HX6A 1SPPA 3D5OA 4CEWA 2A3WA 3BU0A 4Q4V2 2G19A 1XPWA 3LA7A 4QX7A 1OC1A 1RC6A 5FZOB 2WWUA 4I0WB 3OTFA 3THDA 3RFRA 1L3JA 4DEVA 2VW1A 5FPLA 4E8DA 2DVBA 2X29A 4P02B 3CKHA 3RWKX 1VIWB 1OLMA 2Y60A 1HN0A 3G7DA 2IVIB 5DUUA 5A6QA 1XNCA 1GNHA 5A7NA 3U37A 3KCXA 2ZX1A 1DZTA 2VR4A 3TEXA 4GIQA 1SHWB 5GLVA 4NAMA 5C8CC 4P5YA 3T4VA 2XJQA 4BHPA 1GLHA 1A8MA 1QQP1 4R4ZA 2CSGA 1N3OA 1CVNA 3AYCA 2VE1A 3B94A 5FO8B 3AJZA 4MHRA 3VDBA 4AR2A 1WBLA 2QVSB 4BQYA 5IVFA 1SLTA 2RS52 4GMP1 1S0FA 3AZXA 1FOD3 2BNMA 3WINE 4HETA 5D2AA 2BWAA 2MEV1 3K48A 1Z78A 1DYPA 1Q8PA 5JOXA 4LBJA 3T2TA 4LIUA 4TTGA 4XCBA 3HN3A 4TZDA 2GP3A 1FPN2 5CNAA 4HPKA 4Q4Y2 2Q8CA 3BTYA 1XNBA 2C5DA 1R082 3JB8A 4KG8A 5C70A 5JI9A 1ULPA 4ES9A 1NLRA 1W9WA 3NJYA 2C26A 4YW6A 2J1AA 4FPOB 2R0HA 4LA3A 4V2VA 1RIRA 4NRQA 2ZGPA 4PQ9A 1YCIA 4N9HA 2VTXA 3UYJA 4EZHA 4M0NA 2WT1A 1VRH1 2R071 4LE4A 2HWE2 2WL1A 5GKAC 4LBOA 4NPMA 2XJUA 1PK6A 3WV6A 5I0RA 4DUXA 1NLSA 1RUD3 1WMFA 4XEZA 4XZPA 1AL22 1PHMA 5FZIA 3OGGA 3FL7A 4LO6B 3S5QA 4RQPA 2ZJCA 5C5TA 1J3RA 1ND2B 1W9YA 1CAXB 1HLCA 4RHV1 2KD7A 4OHYA 5T5OA 4CZSA 4FOVA 4TXWA 3VHPA 4WM8A 1JH5A 4B7KA 2BFUL 2LTNA 2QJVA 4CDWB 1CAVA 5FXZA 3T08A 2VNRA 2IWGB 1VBE2 2PLV3 3FLTA 3KMHA 4EN6B 4EN9B 1LKNA 3I3DA 1Q8VA 1W2TA 2PA7A 2JXAA 1QNWA 1W0PA 2EAAA 2JG9C 5F39A 4O9EA 2XVGA 4MX3A 4V1PA 2DCZA 4DUVA 1WUVA 4K8RB 3V0BB 2SBAA 2XBO1 4XMIA 5FK7A 3A23A 2NP0A 1JXNA 3F95A 4JKKA 2XLAA 1CGPA 2ARBA 2ZZJA 3I59B 4DIQA 2YYOA 2W95A 3W20A 2W92A 1CWPA 4LE3A 3OUIA 3ASIA 4AQSA 4XFHA 4WVMB 3IKWA 3VDCA 5JSRA 1DGWX 2CDPA 2D3RA 1F15A 1ENRA 3CHXA 3ELNA 3OCPA 4K3UA 3ZXLA 4URTA 3LOIA 4SLIA 1FV2A 1V6IA 4IV1A 3ME2A 5CZKA 2W1QA 2ZHLA 1UMZA 1AJKA 4QPIC 2GSYA 1ASJ1 2D6OX 3EQEA 1AR81 4HVQA 4GKYA 4IE6A 5C6CA 3O1SA 1RITA 1PZ9A 5T5JA 2ZMNA 3UNPA 1B35A 3VZNA 1QQP3 4YM0A 4AFDA 1LHNA 5JXGA 5C8WA 1AR93 3AZYA 3VBHA 1KS5A 4Q0QA 5I0TA 1JOPA 5A7SA 4DXTA 2LW8A 4XPVA 3VL9A 4GMP3 4OMCA 3ZLIA 5FZ7A 1WCKA 1HXS1 3BOPA 5CIRA 1DG6A 1ZREA 1DGRN 4MHUA 3ZPOA 4Z2AA 2QQWA 2ID4A 1FV3A 3J8F3 4HVOA 1N3QA 1XNAA 4MZUA 4FO9A 1ZZ7A 4XOGA 5IT6A 4DQAA 5KBFA 4GWJA 1N1YA 4XFAA 5F7UA 3C7GA 1DQ4A 3OPWA 1BJQA 1FNYA 1ZRRA 2NPIA 2WWSA 4LUKA 1FMD2 3VN4A 5IAXA 2N7GA 4G9SB 3VBUC 1UZVA 5H9QA 3GM8A 2BOJA 1RUH1 2VQAA 1MS4A 3DGTA 3VBHC 4HVRA 1VRH3 1PX3A 3THCA 2R073 3KHCA 3WXPA 5J3UA 1RUF1 1HJGA 3ZIXA 3DECA 5J36A 2RM22 2JDMA 2BVVA 3B9IA 4BQ2A 1IPSA 1DF0A 1VBC2 4AG4A 5L36A 1U5IA 1C57A 3GJBA 4JC1A 3R4UA 4MH0E 2VZOA 4XF0A 1W05A 4XJZA 3SKVA 3T2QA 2CTVA 4AEDA 1UIKA 2C1FA 3ES4A 5EJ1B 3NAPB 3SKJE 1JTZX 3CDZB 3B7MA 4RHV3 1DZQA 1GICA 4XDQA 4CDXA 1NOVA 3HNBM 3IB3A 5HPOA 1SZBA 2YBPA 4PHZA 1PX4A 1S0DA 1A6CA 2WZPP 4E4ZA 3GBFA 4XHBA 5DZGA 4HN0A 1NAEA 5CFDA 3JBG1 1D0HA 2GNMA 5HCHA 5E16A 1J1LA 1J1TA 1HN1A 2JWPA 3NWKA 1PO21 2XBO3 5AFEA 3DEMA 4WZFA 5C4WA 1W28A 2QUOA 1TNFA 2EIDA 4FXGB 2OKXA 3MLKA 2OZJA 4LBNA 1YIPA 1BQPA 3VD3A 4AEDC 1UZZA 1E5IA 2W1SA 3VKLA 2YBSA 3TBDA 1PVC1 5G04L 4WVVA 3QD6A 1LOCA 1NCRC 1NQDA 1REFA 4XMAA 3WF4A 1S55A 1W3VA 1XSQA 3ZXJA 1W2UA 5IVCA 1Z7S2 1SFNA 3E1F1 1XNKA 1LGBA 5FPXA 1ASJ3 1G9DA 1Q43A 1UX6A 5A3WA 5CFDC 4CXYA 5LZ6A 1J58A 1RJ7A 1NLQA 1ZRCA 2WLPA 2YDEA 1JU4A 3WP3A 4XAAA 3ZN6A 4A41A 1GSLA 5FCCA 2PHXA 5FZ3A 2VU9A 4ZKTB 1LHOA 4QB2A 4BQXA 4BQ4A 5C3QA 4E9KA 3KSCA 1EUUA 4HG6B 1I9RA 2RMU2 3LCPA 4PT6A 2WYSA 3KQ4B 2W5FA 2DFCA 2G1MA 2D40A 1ACCA 1HXS3 1E5RA 5F5QA 3FN9A 1S2KA 4YZ4A 4KMQA 5JIAA 5ABJA 2BERA 5FRAA 4KU7A 4XC9A 4IEUA 1YWKA 4NHMA 3OSDA 2VZTA 4YW1A 5I93A 1US2A 5E89A 5HCAA 1SBFA 1HIXA 2QTWB 2WO1A 5EV7A 3H1WA 4BQ1A 4Z07A 5F6KA 4N43C 1KDKA 3VDDA 3HOBA 3PVEA 4NWWA 2QQUA 1UU5A 3EXUA 1RMU1 1AR72 2XHNA 3QBQA 1AXKA 2WNVB 2P5BA 3ABZA 5JAXA 2E7QA 3RZMA 2DF7A 2AUYA 2XVKA 1GWKA 4NIHA 1P8JA 2ARAA 3V64A 1VR3A 1HQNA 3ACIA 5T50A 2GC2A 3SEPA 1XE0A 4UFHA 2ZEWA 5ABJC 1GMMA 3QH6A 4MGSA 4QDRA 5FO9B 4NVPA 2QQOA 3T3YA 1W03A 4QHBA 2ZX2A 3V0AA 1ST8A 3ITQA 2IXLA 4OI4A 1RL3A 4LIVA 1ZRIA 3WEZA 1U5XA 1UY0A 5HV0A 4QDSA 5IHRA 2ARXA 3C7HA 4UF0A 4YM1A 1SFYA 5C7GA 1JUIA 2FDKA 2WZR1 1Q8QA 1LCLA 3DYOA 4IEPA 1G9BA 2GP5A 1HB4A 3ZKUA 3ZYIB 2BBVA 2WT0A 2DVDA 1R1ZA 2P3YA 3O14A 5DAXA 3LKJA 1FI2A 4YW5A 3WF1A 1D0GA 4LBLA 1HRV3 3O5SA 5JOWA 1MEC1 4J25A 3JBG3 4XURA 5IVVA 1F8VA 4N7IA 1FOD2 4FPLA 2D6MA 1PM4A 3WCRA 4D6RA 2I2SA 1S1AA 1PO23 1XC6A 4Q4V1 1O91A 2UYBA 3WQ1A 2BQPA 1DQ0A 5KHHA 1LOGA 4S2FA 3GALA 3PMEA 1MVEA
chains in the Genus database with same CATH topology
2J22A 2YFZA 3HPNA 3CQOA 1CZVA 4L0PA 4GWIA 4MO3M 3VD5A 2VZUA 3K77A 4UOJA 2XONA 1OF4A 3PUIA 4IUGA 4PQQA 2J1TA 4BJ0A 1W8NA 1UYXA 2YC4A 2VCBA 4W8JA 2XQXA 3K4ZA 1JYWA 2VMDA 3OBAA 1UYYA 3K4AA 3DYPA 3T0BA 2J1RA 2EICA 2LS6A 1OT5A 1JHJA 1GNYA 3LQCA 4CU8A 5IFPA 3LE0A 4GZ9A 3FHAA 2QQMA 3MO4A 2J1VA 4DUWA 4XUOA 3C7EA 2VMCA 2WN3A 1L7QA 4RYDA 3JXSA 3UETA 3HNMA 2Y6GA 1JZ4A 3D3AA 5JXHA 2WUHA 3HEIA 1UXXX 1MPXA 2YC2A 3T2PA 1JU3A 2C9KA 2DDUA 3VD7A 2QQIA 4D8MA 1W9TA 4CUBA 5LA0A 2J7MA 3WNMA 1W9SA 4QX0A 2WN2A 3CIHA 4ARYA 2W91A 2WBKA 3MUZ1 3NNGA 4QAWA 4XVHA 1JZ8A 2WZEA 3MUY1 1JZ7A 3J7HA 1SG3A 1F4HA 3I3BA 3OB8A 1UY1A 5DN2A 4MGQA 2VMFA 1W0NA 4XUTA 4LKSA 4A42A 1BHGA 4D0QA 2E32A 2R7EB 2VZQA 4M4PA 4ZY9A 4OZOA 1OF3A 3GDBA 1O8SA 2ZEYA 3BN6A 4MADA 3WF3A 1J83A 2B9VA 5IFTA 3OGVA 4BXSV 3FHQA 3WQBA 4A4AA 2BGPA 4XUPA 4ZXEA 3WNNA 1WKYA 5G05L 2V72A 5LA2A 2VQUA 4AAXA 4KWUA 1H6XA 5B4XA 3C7OA 1UXZA 3CZUA 4QB1A 2BZDA 2VQTA 1XNTA 1YQ2A 4FI9A 3P1IA 5B4NA 1TG7A 2WDBA 3I2HA 4A44A 2RJ2A 1W99A 4YPJA 1UWWA 3DYMA 1JZ3A 3CMGA 1JYXA 2HYXA 2W1UA 1GOFA 4W4ZA 1GOHA 1GUIA 1L7RA 1DP0A 1J84A 1RYYA 3K4DA 3EYPA 1D7PM 1UY3A 1F4AA 2VO5A 2QBXA 1CIYA 3LEKA 3MV11 1I5PA 3MV01 1W8OA 2ZEZA 1WCQA 3LEGA 4P08A 2ORZA 1O8PA 1K45A 4JKMA 3OGRA 3ACFA 1NKGA 1O59A 4BK5A 4XUNA 4JHZA 4OYUA 2QQKA 1TVGA 4LQRA 3HNYM 2J1UA 4KI5M 4RN5A 3IAPA 2W46A 3GXUA 4P00B 4UI9L 2VOTA 5IJRA 2V5DA 3ECQA 2XOMA 2X09A 4QX3A 1XPWA 4DEVA 3THDA 4E8DA 1JYNA 2VJXA 2W94A 4P02B 4QX1A 3CKHA 2QQJA 1JI6A 1K42A 3WF0A 4A45A 5CYYA 3U37A 2VTFA 2VR4A 4XZUG 3I2GA 1SHWB 4P5YA 1JYVA 4M4RA 3VDBA 3I2JA 2VZPA 2BGOA 2ZEXA 4TTGA 2J1EA 3HN3A 2VZ1A 1UY2A 3PUHA 3IDAA 4QDQA 4CU9A 4CUAA 4BK4A 3I2IA 5C70A 1ULPA 4QB6A 1W9WA 5JR2A 2C26A 1NUKA 2J1AA 1UY4A 1CZTA 5DMYA 2VZSA 5HXMA 2RVAA 2V4VA 5JXJA 1GU3A 1JZ2A 2DCKA 2WAOA 4DUXA 3OGSA 3FL7A 5DQ0A 4E8CA 4CU7A 3W5MA 3A7QA 3ZM8A 3K46A 5JMOA 4DXSA 3LPGA 2J1SA 3EB7A 1KGYA 2Y6HA 2KD7A 3T2OA 3C8XA 5J1XA 4TXWA 2EIEA 3T08A 3C7FA 3I3DA 2E33A 2YB7A 4LPLA 2QQNA 3T0AA 2HLEA 1UYZA 4DUVA 3A21A 3A23A 3NQHA 3K75B 4JKKA 2VZ3A 5LA1A 1ULOA 3T09A 3IIIA 2WAAA 2W95A 2W92A 2Y6JA 2PQSA 3VD9A 2B4KA 4JX0A 3VDCA 4W50A 2L9LA 2CDPA 2VM9A 3I2FA 1UX7A 3LEIA 2VZVA 5CZKA 3VD4A 5EIYB 4BDVB 2W1QA 4A3ZA 2VCAA 4A6OA 3IAQA 3UNPA 3HJRA 5JUVA 3WNPA 5JXGA 3OG2A 2EIBA 2WQ8A 3NJVA 4DXTA 2LW8A 3MBWA 1DLCA 4OMCA 4ZZ5A 3F2ZA 1UMIA 4Z2AA 4ZZ8A 2ID4A 1XNAA 2JE8A 3I97A 2CDOA 4GWJA 5F7UA 4DEQA 1IQDC 3C7GA 1US3A 2JDAA 4ARXA 4PF1A 4CUCA 3GM8A 1NX9A 4QX2A 4MOAA 1PX3A 3THCA 2WO3A 3DECA 4LHSA 4OMDA 5DPNA 4AG4A 2WABA 2VZOA 4JKLA 4OUEA 3SKVA 3T2QA 5EJ1B 3SKJE 3CDZB 1LNSA 2ZXQA 4XUQA 1PMHX 2W47A 3WSOA 3HNBM 3IB3A 3SEEA 5HPOA 1CZSA 3BGAA 1OD3A 2E26A 3P6BA 1PX4A 3ACHA 3UESA 1NAEA 1DYOA 3VDAA 2ORXA 5A1AA 1HN1A 2VCCA 2EIDA 2OKXA 3ACGA 3VD3A 2W1SA 2RV9A 2DCJA 5C71A 3T0DA 3CZJA 2WO2A 5G04L 4CVUA 1JZ6A 3W5NA 3WF4A 4DXRA 2VL4A 2Y6LA 3WNLA 4CU6A 2X10A 3E1F1 2JD9A 3OEBA 5LCWL 5EJZB 1JU4A 4A41A 3I2KA 2WZ8A 2QQLA 1JZ5A 3OEAA 4QB2A 2BBAA 1EUUA 4HG6B 4PT6A 2WYSA 2W5FA 2VZRA 5FUIA 3I3EA 1CX1A 3FN9A 1OH4A 3WNOA 2W3JA 2Z4FA 4KMQA 1H6YA 2BERA 1T2XA 2W1WA 2VZTA 1US2A 2WO1A 4ET7A 2JKXA 2VMEA 3HOBA 4UAPA 1SDDB 2XHNA 1KEXA 3ABZA 1P8JA 3ACIA 2Y64A 5I0DA 3SEPA 2X05A 2ZEWA 1PMJX 1GMMA 3LPFA 4MGSA 1UZ0A 4QDRA 1EUTA 3ETPA 2QQOA 3WF2A 3GGLA 2Y6KA 2Y8KA 5IYYA 3WEZA 3NJXA 1UY0A 4QDSA 2YFUA 2E31A 5IHRA 3C7HA 4QPWA 1UMHA 5C7GA 3A22A 1K12A 5JXIA 2W9XA 3DYOA 2W87A 2VC9A 2YG0A 3WF1A 1GQPA 3WNKA 3AC0A 1K3IA 2C4XA 4XURA 1GOGA 1XC6A 3NRUA 1R64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J22 A;  2YFZ A;  3HPN A;  3CQO A;  1CZV A;  4L0P A;  4GWI A;  4MO3 M;  3VD5 A;  2VZU A;  3K77 A;  4UOJ A;  2XON A;  1OF4 A;  3PUI A;  4IUG A;  4PQQ A;  2J1T A;  4BJ0 A;  1W8N A;  1UYX A;  2YC4 A;  2VCB A;  4W8J A;  2XQX A;  3K4Z A;  1JYW A;  2VMD A;  3OBA A;  1UYY A;  3K4A A;  3DYP A;  3T0B A;  2J1R A;  2EIC A;  2LS6 A;  1OT5 A;  1JHJ A;  1GNY A;  3LQC A;  4CU8 A;  5IFP A;  3LE0 A;  4GZ9 A;  3FHA A;  2QQM A;  3MO4 A;  2J1V A;  4DUW A;  4XUO A;  3C7E A;  2VMC A;  2WN3 A;  1L7Q A;  4RYD A;  3JXS A;  3UET A;  3HNM A;  2Y6G A;  1JZ4 A;  3D3A A;  5JXH A;  2WUH A;  3HEI A;  1UXX X;  1MPX A;  2YC2 A;  3T2P A;  1JU3 A;  2C9K A;  2DDU A;  3VD7 A;  2QQI A;  4D8M A;  1W9T A;  4CUB A;  5LA0 A;  2J7M A;  3WNM A;  1W9S A;  4QX0 A;  2WN2 A;  3CIH A;  4ARY A;  2W91 A;  2WBK A;  3MUZ 1;  3NNG A;  4QAW A;  4XVH A;  1JZ8 A;  2WZE A;  3MUY 1;  1JZ7 A;  3J7H A;  1SG3 A;  1F4H A;  3I3B A;  3OB8 A;  1UY1 A;  5DN2 A;  4MGQ A;  2VMF A;  1W0N A;  4XUT A;  4LKS A;  4A42 A;  1BHG A;  4D0Q A;  2E32 A;  2R7E B;  2VZQ A;  4M4P A;  4ZY9 A;  4OZO A;  1OF3 A;  3GDB A;  1O8S A;  2ZEY A;  3BN6 A;  4MAD A;  3WF3 A;  1J83 A;  2B9V A;  5IFT A;  3OGV A;  4BXS V;  3FHQ A;  3WQB A;  4A4A A;  2BGP A;  4XUP A;  4ZXE A;  3WNN A;  1WKY A;  5G05 L;  2V72 A;  5LA2 A;  2VQU A;  4AAX A;  4KWU A;  1H6X A;  5B4X A;  3C7O A;  1UXZ A;  3CZU A;  4QB1 A;  2BZD A;  2VQT A;  1XNT A;  1YQ2 A;  4FI9 A;  3P1I A;  5B4N A;  1TG7 A;  2WDB A;  3I2H A;  4A44 A;  2RJ2 A;  1W99 A;  4YPJ A;  1UWW A;  3DYM A;  1JZ3 A;  3CMG A;  1JYX A;  2HYX A;  2W1U A;  1GOF A;  4W4Z A;  1GOH A;  1GUI A;  1L7R A;  1DP0 A;  1J84 A;  1RYY A;  3K4D A;  3EYP A;  1D7P M;  1UY3 A;  1F4A A;  2VO5 A;  2QBX A;  1CIY A;  3LEK A;  3MV1 1;  1I5P A;  3MV0 1;  1W8O A;  2ZEZ A;  1WCQ A;  3LEG A;  4P08 A;  2ORZ A;  1O8P A;  1K45 A;  4JKM A;  3OGR A;  3ACF A;  1NKG A;  1O59 A;  4BK5 A;  4XUN A;  4JHZ A;  4OYU A;  2QQK A;  1TVG A;  4LQR A;  3HNY M;  2J1U A;  4KI5 M;  4RN5 A;  3IAP A;  2W46 A;  3GXU A;  4P00 B;  4UI9 L;  2VOT A;  5IJR A;  2V5D A;  3ECQ A;  2XOM A;  2X09 A;  4QX3 A;  1XPW A;  4DEV A;  3THD A;  4E8D A;  1JYN A;  2VJX A;  2W94 A;  4P02 B;  4QX1 A;  3CKH A;  2QQJ A;  1JI6 A;  1K42 A;  3WF0 A;  4A45 A;  5CYY A;  3U37 A;  2VTF A;  2VR4 A;  4XZU G;  3I2G A;  1SHW B;  4P5Y A;  1JYV A;  4M4R A;  3VDB A;  3I2J A;  2VZP A;  2BGO A;  2ZEX A;  4TTG A;  2J1E A;  3HN3 A;  2VZ1 A;  1UY2 A;  3PUH A;  3IDA A;  4QDQ A;  4CU9 A;  4CUA A;  4BK4 A;  3I2I A;  5C70 A;  1ULP A;  4QB6 A;  1W9W A;  5JR2 A;  2C26 A;  1NUK A;  2J1A A;  1UY4 A;  1CZT A;  5DMY A;  2VZS A;  5HXM A;  2RVA A;  2V4V A;  5JXJ A;  1GU3 A;  1JZ2 A;  2DCK A;  2WAO A;  4DUX A;  3OGS A;  3FL7 A;  5DQ0 A;  4E8C A;  4CU7 A;  3W5M A;  3A7Q A;  3ZM8 A;  3K46 A;  5JMO A;  4DXS A;  3LPG A;  2J1S A;  3EB7 A;  1KGY A;  2Y6H A;  2KD7 A;  3T2O A;  3C8X A;  5J1X A;  4TXW A;  2EIE A;  3T08 A;  3C7F A;  3I3D A;  2E33 A;  2YB7 A;  4LPL A;  2QQN A;  3T0A A;  2HLE A;  1UYZ A;  4DUV A;  3A21 A;  3A23 A;  3NQH A;  3K75 B;  4JKK A;  2VZ3 A;  5LA1 A;  1ULO A;  3T09 A;  3III A;  2WAA A;  2W95 A;  2W92 A;  2Y6J A;  2PQS A;  3VD9 A;  2B4K A;  4JX0 A;  3VDC A;  4W50 A;  2L9L A;  2CDP A;  2VM9 A;  3I2F A;  1UX7 A;  3LEI A;  2VZV A;  5CZK A;  3VD4 A;  5EIY B;  4BDV B;  2W1Q A;  4A3Z A;  2VCA A;  4A6O A;  3IAQ A;  3UNP A;  3HJR A;  5JUV A;  3WNP A;  5JXG A;  3OG2 A;  2EIB A;  2WQ8 A;  3NJV A;  4DXT A;  2LW8 A;  3MBW A;  1DLC A;  4OMC A;  4ZZ5 A;  3F2Z A;  1UMI A;  4Z2A A;  4ZZ8 A;  2ID4 A;  1XNA A;  2JE8 A;  3I97 A;  2CDO A;  4GWJ A;  5F7U A;  4DEQ A;  1IQD C;  3C7G A;  1US3 A;  2JDA A;  4ARX A;  4PF1 A;  4CUC A;  3GM8 A;  1NX9 A;  4QX2 A;  4MOA A;  1PX3 A;  3THC A;  2WO3 A;  3DEC A;  4LHS A;  4OMD A;  5DPN A;  4AG4 A;  2WAB A;  2VZO A;  4JKL A;  4OUE A;  3SKV A;  3T2Q A;  5EJ1 B;  3SKJ E;  3CDZ B;  1LNS A;  2ZXQ A;  4XUQ A;  1PMH X;  2W47 A;  3WSO A;  3HNB M;  3IB3 A;  3SEE A;  5HPO A;  1CZS A;  3BGA A;  1OD3 A;  2E26 A;  3P6B A;  1PX4 A;  3ACH A;  3UES A;  1NAE A;  1DYO A;  3VDA A;  2ORX A;  5A1A A;  1HN1 A;  2VCC A;  2EID A;  2OKX A;  3ACG A;  3VD3 A;  2W1S A;  2RV9 A;  2DCJ A;  5C71 A;  3T0D A;  3CZJ A;  2WO2 A;  5G04 L;  4CVU A;  1JZ6 A;  3W5N A;  3WF4 A;  4DXR A;  2VL4 A;  2Y6L A;  3WNL A;  4CU6 A;  2X10 A;  3E1F 1;  2JD9 A;  3OEB A;  5LCW L;  5EJZ B;  1JU4 A;  4A41 A;  3I2K A;  2WZ8 A;  2QQL A;  1JZ5 A;  3OEA A;  4QB2 A;  2BBA A;  1EUU A;  4HG6 B;  4PT6 A;  2WYS A;  2W5F A;  2VZR A;  5FUI A;  3I3E A;  1CX1 A;  3FN9 A;  1OH4 A;  3WNO A;  2W3J A;  2Z4F A;  4KMQ A;  1H6Y A;  2BER A;  1T2X A;  2W1W A;  2VZT A;  1US2 A;  2WO1 A;  4ET7 A;  2JKX A;  2VME A;  3HOB A;  4UAP A;  1SDD B;  2XHN A;  1KEX A;  3ABZ A;  1P8J A;  3ACI A;  2Y64 A;  5I0D A;  3SEP A;  2X05 A;  2ZEW A;  1PMJ X;  1GMM A;  3LPF A;  4MGS A;  1UZ0 A;  4QDR A;  1EUT A;  3ETP A;  2QQO A;  3WF2 A;  3GGL A;  2Y6K A;  2Y8K A;  5IYY A;  3WEZ A;  3NJX A;  1UY0 A;  4QDS A;  2YFU A;  2E31 A;  5IHR A;  3C7H A;  4QPW A;  1UMH A;  5C7G A;  3A22 A;  1K12 A;  5JXI A;  2W9X A;  3DYO A;  2W87 A;  2VC9 A;  2YG0 A;  3WF1 A;  1GQP A;  3WNK A;  3AC0 A;  1K3I A;  2C4X A;  4XUR A;  1GOG A;  1XC6 A;  3NRU A;  1R64 A; 
#chains in the Genus database with same CATH topology
 2J22 A;  1LOE A;  2EA7 A;  4CTE A;  5D8A C;  1Q8S A;  1ZX5 A;  1PVC 3;  2Y0I A;  4GWI A;  3RS6 A;  5HBA A;  1NY7 2;  5FZH A;  2CGO A;  2PTM A;  2VUA A;  3AVR A;  4IE0 A;  3K2O A;  1H2L A;  2XON A;  4QD2 A;  4HSL A;  4PQQ A;  4BJ0 A;  4K9S A;  2J1T A;  3M3C A;  4MGK E;  3SC7 X;  1W8N A;  2BTV C;  1XOY A;  2WT2 A;  5LY2 A;  2VCB A;  3WW1 A;  2XQX A;  4XXA A;  5BNN B;  1IS4 A;  1REE A;  5J09 A;  1W2N A;  3O0V A;  3ON7 A;  2GZW A;  1IS6 A;  2ZMK A;  4RFT 0;  4JGY A;  3WVJ A;  1RUD 2;  2P4E A;  4LO5 B;  3K4A A;  4IV3 C;  3ZYH A;  3H3L A;  3TEY A;  1RIN A;  1R09 2;  5HXV A;  1YI7 A;  2R04 3;  3M3I A;  2OXB A;  4CCJ A;  3LE0 A;  2G4I A;  1FPN 1;  1NE4 A;  4Y24 A;  2ET1 A;  3R0R A;  4EN7 B;  3AZW A;  3WOG A;  1SLC A;  1UD1 A;  4E27 A;  2YU1 A;  3RI9 A;  4NHX A;  1LU1 A;  2DVG A;  2J1V A;  3IIA A;  3LFI A;  4K21 A;  4DUW A;  2R06 3;  3C7E A;  1GQG A;  2PLV 2;  2WN3 A;  3MLL A;  1L7Q A;  5GLU A;  1EY2 A;  1RMU 3;  3HNM A;  2Y6G A;  3UET A;  4MGZ E;  1F5F A;  5JXH A;  1JZ4 A;  4AGG A;  3HEI A;  5A33 B;  4FSJ A;  3ILR A;  3SXW A;  4M3C F;  1CAX A;  1H8T C;  3E6B A;  5FXX A;  3TEW A;  3WG4 A;  3T2P A;  2C9K A;  1NXM A;  5EYY A;  1AL2 1;  5T55 A;  5FY5 A;  1U12 A;  1IPK A;  4D3W A;  4QPG B;  1KFU L;  2J7M A;  3WNM A;  3NKT A;  3H3Z A;  1W9S A;  4FFG A;  4A2U A;  1V70 A;  2WN2 A;  3CIH A;  2R30 A;  1VBD 1;  4YNI A;  1TMF 1;  3ZKY A;  4QAW A;  1HV0 A;  3NNG A;  4K20 A;  3IMN A;  4Y22 A;  3S6P A;  2WZE A;  1ZZC A;  1JZ7 A;  4COZ A;  4IE5 A;  3FBM A;  1FT9 A;  4NIG A;  3I3B A;  3P5B A;  3OB8 A;  3GHN A;  4TN7 A;  1V6O A;  2HBU A;  1UY1 A;  2JDZ A;  3I59 A;  1QY4 A;  5FP7 A;  2WZR 3;  4E2G A;  4YG6 A;  3EMR A;  1AR9 2;  2HJI A;  1VJ2 A;  4BQ5 A;  4A42 A;  4JGZ A;  4D0Q A;  2VMH A;  3NNL A;  1MEC 3;  1AXZ A;  3MFC A;  2VUD A;  4COV A;  2P37 A;  4LLF A;  1O6U A;  4FFI A;  4UBH A;  1OF3 A;  4Q4V 3;  1O8S A;  2ILM A;  2FCV A;  2UY9 A;  3SNM A;  2ZKL A;  2B9V A;  5IFT A;  3J8F 2;  3PUR A;  2A75 A;  1QJF A;  2A3X A;  2D5H A;  1RXG A;  1X33 A;  4BXS V;  1E57 A;  1KIT A;  1D4M 2;  2YBK A;  3BYW A;  1CAW B;  1W90 A;  2BW8 A;  2YU2 A;  2XXZ A;  4MXW B;  3UKV A;  3WNN A;  4CCD A;  1WKY A;  2V72 A;  4FPE A;  2VQU A;  2BYV E;  3ZN4 A;  3IBM A;  3CU7 A;  4KWU A;  4ZU4 A;  1S0J A;  1XXN A;  1OUR A;  3VGI A;  5L73 A;  4CXW A;  1J3P A;  4JGZ C;  1VRH 2;  1UXZ A;  2R07 2;  3D6E A;  4YVW C;  1H1A A;  1UU6 A;  3MEP A;  5F5I A;  3WZ1 A;  4D6S A;  2LM3 A;  3CZU A;  4LUL A;  4JAA A;  1XNT A;  1W6Q B;  4BXF A;  1GBG A;  4LO4 B;  3LSE A;  3RJR A;  1D4V B;  4URA A;  2XLF A;  5FZC A;  4AI2 A;  3AP5 A;  5IVY A;  2DCY A;  4JHT A;  4OHX A;  4A44 A;  2H0V A;  3KV5 A;  2RJ2 A;  4LO7 A;  1W99 A;  3DL3 A;  4YPJ A;  4AFM A;  3WUD A;  3U0Z A;  1UWW A;  4RHV 2;  5FWJ A;  3CMG A;  3GNE A;  4XJU A;  1JZ3 A;  2V73 A;  3QAC A;  4DO0 A;  2HYX A;  4ONU A;  4BOW A;  3W58 A;  3ZSE A;  3D8C A;  5LEK A;  1V0A A;  4I30 A;  4HKL A;  1DP0 A;  1DU3 D;  2ZGM A;  4ITC A;  4W65 A;  2TUN A;  4PDW A;  5EYX A;  1UO9 A;  4EZ4 A;  5JWP A;  3OF1 A;  4X8P A;  3FBY A;  4EN0 A;  3NAP A;  2XBO 2;  3EYP A;  4Y1V A;  4XYX A;  3WW4 A;  4PCR A;  1D7P M;  4CEY B;  5CAZ A;  4FQ4 A;  3VV1 A;  3WLU A;  1AL2 3;  4IEW A;  5LK5 A;  3DPR A;  3UGH A;  3OD4 A;  4Q4X 1;  1H1M A;  5JOY A;  4MGI E;  3I2D A;  1CIY A;  3LEK A;  1I1E A;  3NMB A;  3ST7 A;  1I5P A;  1QIQ A;  1VBD 3;  1TMF 3;  3OPZ A;  3W21 A;  5BUV A;  1K5J A;  2EXJ A;  3H8R A;  3LEG A;  4KQ7 A;  4P08 A;  1YC6 1;  1K45 A;  2ZML A;  4LBQ D;  5DUX A;  1SLL A;  1ASJ 2;  1YFX A;  5ANN A;  4UFJ A;  4BK5 A;  2JG8 A;  2Q8O A;  5GZC A;  3INA A;  4ASL A;  3MGU A;  5AVP A;  3H7Y A;  4LLO A;  3T1L A;  5IK4 A;  1EAH 1;  2QQK A;  1S2B A;  4HK8 A;  2DU0 A;  4BQ3 A;  4LQR A;  5AC9 1;  3USS A;  5E6H A;  3CO2 A;  4QPI B;  2WSU A;  1W6P B;  3LD8 A;  1POV 1;  3A4U A;  2QQP A;  3GXU A;  3S7I A;  1HXS 2;  4QT6 A;  2VOT A;  1COV 1;  3NO8 A;  3AMM A;  4OLL A;  4BIO A;  4CCM A;  2V5D A;  3WUC A;  4NE9 A;  3QLQ A;  2D98 A;  4RGG A;  1W6M B;  1D2S A;  3BOW A;  5CBL A;  1XU1 A;  2B39 A;  5KXD A;  1UAI A;  4NPR A;  4LK7 A;  4NHY A;  2DVA A;  5T3N A;  5FZB A;  3S7E A;  5FR3 A;  3M3O A;  2FHR A;  3ZIW A;  5IAV A;  1TE1 B;  3B5L B;  3O7O A;  4TSV A;  5IK5 A;  4XZU G;  4DY3 A;  2DWR A;  1OOP C;  1XJA A;  2GH2 A;  1JYV A;  4V2W A;  1S0G A;  4DY5 A;  1AJO A;  4ASM B;  5ACA 1;  5LW9 A;  3VBU B;  1QNY A;  2X5I B;  2VZP A;  3GZE A;  5CAD A;  5GJ6 A;  5CG8 A;  1MQT C;  4E2Q A;  5L7O A;  3PL0 A;  3CJI B;  4YAR A;  1AYM 1;  2IFW A;  1O3R A;  1Y9Q A;  2UWA A;  1BBT 1;  2WNV A;  1VLN A;  2ZEX A;  3DXT A;  2WNO A;  4UYB A;  4XXP A;  1S0E A;  1IZ3 A;  1GZT A;  1JYT A;  1RED A;  1SLI A;  3PUH A;  3JQX A;  3IDA A;  5JDB A;  4PIY A;  2FMD A;  4BK4 A;  3OD0 A;  4QKN A;  1AR7 1;  2ZCW A;  3I8T A;  5JI7 A;  5A3N A;  2WKK A;  2B8M A;  1HRV 2;  4L11 A;  4QX5 A;  3JBG 2;  2RVA A;  5GLT A;  4F3J A;  4IEY A;  4SBV A;  2V4V A;  5JXJ A;  3BTX A;  1PO2 2;  4CCE A;  1GU3 A;  5L7O C;  4YM2 A;  5AVA A;  2DCK A;  2KR2 A;  3FUQ A;  3I4I A;  3VKF C;  5B2G B;  3HIF A;  4ZU5 A;  5A3O A;  2EIG A;  4Q4X 3;  1PVC 2;  4IXL A;  2WFP A;  3M1H A;  1A78 A;  1WD4 A;  2Y34 A;  1JYC A;  4HAN A;  5DQ0 A;  3A7Q A;  1AX1 A;  5JR7 B;  1W8F A;  1OLR A;  2D5F A;  4DXS A;  2W68 A;  4KWL A;  2JD4 A;  3EB7 A;  4FFH A;  3OBT A;  3Q8F A;  4MXV A;  4AEM A;  3B93 A;  3GYD A;  4B4Q A;  3KT1 A;  5J1X A;  3TWI A;  2TEP A;  5JZG C;  2IFR A;  3GHM A;  1QJZ A;  4UW6 A;  3I49 A;  1NCR B;  4LKE A;  1JMU B;  1F5J A;  5FZL A;  3H50 A;  2VOW A;  4R9B A;  1EAH 3;  5AC9 3;  2QQN A;  4I3G A;  3FLR A;  5FMC A;  3T0A A;  2ZGS A;  3V65 A;  4FCA A;  1G9A A;  1POV 3;  3DV8 A;  2A6X A;  1RXF A;  2R04 2;  3AJY A;  1CIW A;  3Q9O A;  1GZ9 A;  4QXK A;  4QGL A;  3ZO0 B;  1COV 3;  1O7F A;  1OHF A;  2A6Z A;  1BYH A;  1ULO A;  3T09 A;  3L2H A;  3HN1 A;  2JIC A;  1JOJ A;  1AF9 A;  2YZ4 A;  4YW4 A;  4IQP A;  2NMN A;  2PN5 A;  4NUB A;  3RDI A;  3VB9 A;  3OGJ A;  4LKF A;  2IXH A;  4Z8B A;  2L9L A;  3BKZ A;  2R06 2;  2VM9 A;  1W2A X;  1MS9 A;  1Z0H A;  4ATF A;  1WLT A;  5KHI A;  4LR4 A;  1RMU 2;  3GJA A;  3HR9 A;  2JIG A;  1MAC A;  2QNK A;  5I0U A;  4HN1 A;  4A6O A;  5DAB A;  3VHR A;  4IEX A;  1RUD 1;  4B7E A;  1YQ5 A;  2XGX A;  3HJR A;  3IPV A;  1OFN A;  2Q4S A;  4N43 B;  5ACA 3;  3AP4 A;  4UW5 A;  4YVS A;  1Y9G A;  1R09 1;  4YZ2 A;  2CNA A;  4GAZ A;  3PUA A;  2SLI A;  3SH4 A;  3MBW A;  2NQY A;  1DLC A;  4PI2 A;  3UT0 A;  5K9Y A;  3ZFG A;  4ZZ5 A;  5L9B A;  1AYM 3;  3F2Z A;  1UMI A;  1FAY A;  1BBT 3;  3N7J A;  4P9J A;  5FMO S;  4NRM A;  1MR5 A;  2LRP A;  1OBN A;  4HOO A;  2VTX J;  2WR9 A;  2JE8 A;  2PLV 1;  4RR3 A;  5GZF A;  2WZR 2;  2ARE A;  2ZAH A;  3PLQ A;  4WVW A;  2DTY A;  1US3 A;  2CAU A;  2VNG A;  3OJB A;  1PO1 1;  1ULG A;  2UWC A;  2VBD A;  3RYP A;  4CUC A;  1PM7 A;  2GH8 A;  4YVS C;  5FJK A;  5A7P A;  4Y33 A;  3IDC B;  4Y20 B;  4CPB A;  2GN7 A;  5F3G A;  1A34 A;  5KC6 A;  1OVS A;  2WO3 A;  2NLR A;  2P2K A;  1S4C A;  3NV1 A;  4OMD A;  1XYO A;  5FP8 A;  2I74 A;  2K46 A;  5F3I A;  5JOZ A;  5FZD A;  2KA3 A;  3ZFE A;  2HEW F;  4XTP A;  1UOJ A;  3ZSM A;  1GNZ A;  1NCQ C;  1ND3 C;  4PBP A;  3O1T A;  4JKL A;  5FIX A;  2VNV A;  4OUE A;  2FD8 A;  2F6B A;  3O1P A;  4OVE A;  3AXE A;  5IK7 A;  5FPA A;  2HWB 1;  1OXC A;  3LB9 A;  3PUQ A;  1OPO A;  5FLJ A;  3R6S A;  1LNS A;  2BJS A;  5D8A B;  5FZF A;  3WP5 A;  4DPN A;  1EP0 A;  2HEY F;  2BEO A;  3PIG A;  5FYH A;  3RRD A;  3SEE A;  3R4D B;  1AR9 1;  3BGA A;  4CEW C;  2E26 A;  3UL2 A;  2Z69 A;  4QKD A;  3ZDV A;  4FVV A;  3RJ2 X;  4TLF A;  5EJ3 A;  5BNO B;  3UES A;  1DYO A;  2EXH A;  3ZFE C;  4AW7 A;  1AVB A;  4JQT A;  1H4G A;  4UW3 A;  4HBN A;  1YHF A;  3J8F 1;  3GZA A;  3GZT B;  1C8M 3;  1N47 A;  4OHW A;  3VBR A;  2A5Z A;  1D4M 1;  4LKD A;  2VOK A;  4MYE A;  4IV3 B;  1HQL A;  2RV9 A;  5K0U A;  3OUJ A;  4YLZ A;  1KRI A;  3CZJ A;  2VD7 A;  2W52 A;  4RS5 B;  1AX2 A;  4BE3 A;  1RHI 2;  4XBN A;  1TZO A;  4DRR A;  2PQQ A;  4K40 A;  3AP9 A;  3W5N A;  3VBF A;  5IWF A;  2LUW A;  2P3K A;  4Q29 A;  3ZFF A;  2IXK A;  4AYU A;  5KC5 A;  2XPJ A;  2JEM A;  3KT7 A;  2B46 X;  4FT8 A;  4QHO A;  4KG0 A;  4XIO A;  3N9O A;  3I2K A;  2OQ7 A;  1R09 3;  1BLZ A;  1GV9 A;  4OQ8 A;  5L9R A;  2G9F A;  3VBS A;  1VBD 2;  2OPK A;  1TMF 2;  2AGS A;  5FUI A;  3ZMO A;  1CQ9 A;  4YWA A;  4YYO A;  1PZ8 A;  1Y3T A;  2GMM A;  1CX1 A;  1OH4 A;  4XAB A;  1R1A 1;  1WWY A;  2Z4F A;  2WNU B;  1T2X A;  2W1W A;  4XET A;  2B5H A;  1RUC 2;  4CEY A;  3ZFF C;  2XWJ B;  2DTW A;  1IPJ A;  1HV1 A;  5CFC B;  1ENX A;  3PJY A;  2WRA A;  4YW2 A;  1PK6 C;  4AVS A;  1NA1 B;  4PLN A;  4LOT A;  4F7Z A;  3ETQ A;  1PO1 3;  4OHV A;  2H0B A;  1G86 A;  2OZ6 A;  1C1F A;  1GP4 A;  1X9P A;  1KS4 A;  3D82 A;  4RQP C;  1LB2 A;  4IET A;  5A3M A;  2GMP A;  5DAW A;  1W6O A;  4Y5Z 0;  3VBS C;  1C8N A;  1XRU A;  2VG9 A;  2Y64 A;  3KHB A;  2LRO A;  1UF2 C;  1DBN A;  4KGG A;  4WM8 C;  3JB4 C;  3WF2 A;  4Q0P A;  5FQ0 A;  4X8N A;  4QQ2 A;  2HWD 1;  2Y8K A;  4WM7 A;  3PJQ A;  5IYY A;  1LOB A;  3WG3 A;  4QQL A;  4K1Y A;  3WNX A;  4X6R B;  2HWB 3;  5A7W A;  1DQ5 A;  1QH7 A;  2KM2 A;  2RDN A;  4Y1Y A;  1OUS A;  4QPW A;  4BWO A;  1YFY A;  3A22 A;  3KF3 A;  2E51 A;  4LXL A;  3RMY A;  5JXI A;  3FZ3 A;  1YLL A;  3HBZ A;  1SQ4 A;  2E7A A;  2CWS A;  2ZHM A;  2VC9 A;  1WW7 A;  1CAU A;  3MW2 A;  3KVA A;  3UV9 A;  3THT A;  2HWF 1;  4Q5O A;  3DN7 A;  4Q4W 1;  4GUL A;  5SV8 A;  4CP9 B;  5GM0 A;  2JDH A;  1C4R A;  1GOG A;  4YVW B;  5FPB A;  5FY8 A;  1ZZ8 A;  4ES8 A;  4IL7 A;  4XCA A;  1RVF 2;  3H8U A;  4QX8 A;  5FPV A;  4IV1 C;  4WM7 C;  3CF6 E;  4ERO A;  1R64 A;  3USU B;  1D4M 3;  3PVO A;  2AEY A;  4QXH A;  3U75 A;  3BTZ A;  2CL2 A;  3DKW A;  1POQ A;  5F2S A;  1V6N A;  1B35 C;  1E5H A;  5FZA A;  4P9W A;  4UOJ A;  2P3J A;  2C6S A;  4LOR A;  1QJU 1;  4BH9 A;  1W6N B;  1AR6 1;  3CJI A;  3M4F A;  3ZYP A;  4OCT A;  3WP4 A;  3ZX7 A;  4AI1 A;  2Q8D A;  1UYX A;  1ONA A;  4BA6 A;  4W8J A;  4ATE A;  2PHW A;  1AXY A;  3KQR A;  2O8O A;  2NYY A;  2ZAC A;  3KCY A;  4GWN A;  4DNY A;  3K4Z A;  4AOC A;  2VMD A;  4YGC A;  4HL0 A;  5FLI A;  4ZU7 A;  1OA2 A;  2DV9 A;  3AYD A;  4B1L A;  2LS6 A;  3KGZ A;  4AFA A;  4W6Y A;  1QDO A;  2B42 B;  4Q4X 2;  1M4W A;  2VVD A;  3VZM A;  4GQ7 A;  1NYW A;  4C91 A;  1GNY A;  4QU2 A;  3LQC A;  2ZHK A;  3PNA A;  1WCS A;  3M8L A;  1QOO A;  1QH6 A;  1W9F A;  1R1A 3;  2ENR A;  2WS9 3;  4M3C A;  3U78 A;  3URF A;  1K5M A;  4RFR B;  2IVJ A;  4Y3O A;  3RZK A;  3FHA A;  3QCW A;  4UFK A;  1HB1 A;  2W08 A;  4GB3 1;  3Q8A A;  4CDQ B;  1Y43 B;  3OYW A;  4XUO A;  1OUX A;  4KH9 A;  2IC1 A;  1X8E A;  1HRV 1;  2GC0 A;  2VMC A;  4L92 A;  5JCT A;  1EAH 2;  1IG3 A;  1OQ1 A;  1W8H A;  1AL0 G;  4RYD A;  1ZYB A;  5AC9 2;  1O3T A;  3JXS A;  2XLG A;  1O4T A;  1ZA7 A;  5F1R A;  4MG2 A;  4IEZ A;  1UXX X;  2YC2 A;  2A1X A;  5FYM A;  4CDU B;  4DS0 A;  1CPN A;  4GAL A;  1S0C A;  3KGL A;  4MV2 A;  1COV 2;  1RUI 1;  4IEO A;  3VBO A;  5LBB A;  2QQI A;  3MIG A;  3PUS A;  4CDX C;  4D8M A;  5A6X A;  4CUB A;  3N4M A;  2XKP A;  1ULC A;  3RZG A;  4I01 A;  4JRA A;  2ZPX A;  1QKQ A;  4N8M A;  4YFZ A;  2HWD 3;  4U36 A;  2DFB A;  2VGD A;  4XVH A;  1JZ8 A;  2AAC A;  2YUE A;  3MUY 1;  3J7H A;  5K7P A;  4FOQ A;  2TNF A;  4NIA A;  1OLM E;  4LIT A;  3MYX A;  3J7M A;  3VZK A;  1OPM A;  2X8K A;  1LHW A;  4MET A;  4XDP A;  5C4W C;  4MGQ A;  3VHO A;  5E8A A;  4ZXK A;  1YJK A;  3R05 A;  3WG2 A;  4EV0 A;  1W0N A;  3JZV A;  4XUT A;  5ACA 2;  4CCK A;  1TME 1;  4YGE A;  1QEX A;  2ZGR A;  2IXC A;  1BHG A;  2HWF 3;  3U1X A;  2R04 1;  5I8T A;  4Q4W 3;  4FQZ A;  1GZW A;  4Y26 A;  4ZY9 A;  5FV3 A;  5A70 A;  1AYM 2;  4NPL A;  4FAG A;  1Y9M A;  4AQT A;  1BBT 2;  4EWA A;  1LAJ A;  1J83 A;  3JU9 A;  3SCF A;  2FCT A;  5J98 B;  4DRV A;  3CL1 A;  3BUC A;  1NZI A;  2VW0 A;  5FYU A;  5KXC A;  5EZW A;  2IXI A;  2R06 1;  2VBP A;  4A4A A;  1MQT B;  4AVV A;  4XUP A;  4QM9 A;  4ZXE A;  4Q0S A;  5F2W A;  1LJ7 A;  3BTA A;  2GME A;  3RZJ A;  4N9I A;  5G05 L;  1QJU 3;  1AR6 3;  2XKO A;  4LBQ B;  1H6X A;  1PNG A;  4IEQ A;  1V6J A;  3J7N A;  4UXA A;  1PGL 2;  3BPS A;  4QMA A;  1G9C A;  4LA2 A;  3VZO A;  5DG1 A;  4PIZ A;  1JW6 A;  1CES A;  3POI A;  1YQ2 A;  3LSD A;  2GNT A;  4PBO A;  3KF5 A;  2GN3 A;  1X50 A;  4C0B A;  4Y5T A;  3ZXK A;  5KHG A;  4N53 A;  3D0J A;  1WME A;  1TG7 A;  1YFW A;  2WDB A;  2OW4 A;  3VDD C;  2VY0 A;  3N9M A;  4ORF A;  1W39 A;  2WC2 A;  1ZBA 3;  4AHX A;  1W2O A;  5F9T A;  4GKX A;  1CJP A;  2RDQ A;  4DMI A;  1VMF A;  5FZO A;  3UK9 A;  3T30 A;  4GB3 3;  3R4S A;  2W1U A;  3NST A;  5FKC A;  3WT3 A;  3AMN A;  1OLQ A;  1QJX 1;  2XJP A;  5I8Y A;  4GJY A;  1BMV 2;  5LWB A;  4ZPI A;  4EJR A;  4XF1 A;  5BNP B;  2FDG A;  5FZ9 A;  1FXZ A;  3K4D A;  2VW2 A;  1C8M 2;  1RUI 3;  3CLP A;  2Q0A A;  1QU0 A;  3RYR A;  1LRH A;  5FY9 A;  1ZBE 1;  2QBX A;  2W0X A;  3TNP B;  5FMB A;  2YY1 A;  5JPN B;  3Q8C A;  3N35 A;  3NV4 A;  3QH7 A;  3O1R A;  1O5L A;  1W8O A;  2JDP A;  5DUW A;  4AVC A;  4H14 A;  4QQO A;  4OI0 A;  2ZEZ A;  1PNF A;  4FPY A;  1DLL A;  2D6L X;  4AF9 A;  3MPB A;  4ZHN A;  1WA6 X;  4JHZ A;  2FMY A;  5FFO C;  4OYU A;  1SEF A;  1CPM A;  4Y4Y A;  4GH4 B;  3ZYB A;  3TN9 1;  3WCS A;  5FMO L;  3Q8B A;  1TME 3;  4RS5 A;  1TVG A;  5A1F A;  1WMX A;  3HNY M;  1IKP A;  3UGF A;  3ZYR A;  1MVQ A;  1RGS A;  5C3O A;  3IAP A;  2W46 A;  4P00 B;  2FCU A;  4PLO A;  2UU8 A;  5H9P A;  5KR7 A;  3AKT A;  4NRP A;  4AZZ A;  2MNG A;  5FZE A;  1MS8 A;  5LRR A;  4XFI A;  1GP5 A;  2XOM A;  3ECQ A;  4QX3 A;  4U2A A;  4WVZ A;  4CCO A;  2WLQ A;  3K3N A;  1RHI 1;  2BNO A;  1JYN A;  2W94 A;  2QQJ A;  1JI6 A;  5FUP A;  1C28 A;  4JGY C;  3POF A;  3ROU A;  5A3T A;  2BVB A;  1PO1 2;  1SFP A;  1HW5 A;  3T1M A;  1OA3 A;  1TNR A;  2Q1M A;  3WF0 A;  1ND2 A;  5L9V A;  4NID A;  4A45 A;  1K42 A;  5C9A B;  1A8D A;  5CYY A;  1YIF A;  3SH5 A;  2VTF A;  3RVH A;  1UPS A;  4UFM A;  2WNU A;  3D4K A;  4FPH A;  4CDW A;  5APA A;  1Q8O A;  3ZYF A;  2PAE A;  3NV2 A;  3J9S A;  1UU4 A;  2VEC A;  4M4R A;  2I07 B;  5CFC A;  3I2J A;  1PGW 1;  4JQR A;  1NA1 A;  2D3S A;  4EWE A;  3V0B A;  3M2M A;  4OUM A;  2ERF A;  5FKB A;  2B7Y A;  2ZX0 A;  3PIJ A;  4DIN B;  1RUC 1;  2BWC A;  2HWB 2;  2Y33 A;  4FPJ A;  3GCX A;  3RPQ A;  4KGQ A;  4RGA A;  2WA4 A;  1VAV A;  4QDQ A;  2R1D A;  5FBZ A;  1DQ1 A;  2UYA A;  1ZVF A;  3AX4 A;  4WVM A;  3I2I A;  2XH6 A;  2OQ6 A;  4QB6 A;  4CUA A;  1QJX 3;  1NUK A;  4CDW C;  3O12 A;  2BUK A;  3X29 B;  3H8O A;  5C8C B;  5DMY A;  3RYK A;  2MHF A;  2VZS A;  5CB7 A;  4XAC A;  2JJ6 A;  3PHM A;  5FYT A;  5C3P A;  1QMJ A;  2JX9 A;  4XJ9 A;  4CEW B;  1JZ2 A;  2WAO A;  5F3E A;  1VPH A;  1Y7B A;  3MPP G;  4Q2F A;  5FOJ B;  3OGS A;  1LR5 A;  4L99 A;  2YPD A;  4DXZ A;  3TEZ A;  1O4Y A;  1ZBE 3;  4E8C A;  3AVS A;  4I02 A;  4CU7 A;  2QDN A;  3W5M A;  4S2G A;  3ZM8 A;  1UKR A;  1ULD A;  1UOB A;  5JMO A;  3KWV A;  3N9N A;  2BFU S;  2J1S A;  1HQW A;  2Y6H A;  2D44 A;  2C9A A;  2RDS A;  3AKP A;  2P1B A;  2QDR A;  1UPI A;  2XHK A;  1CD3 G;  2DCT A;  2D43 A;  4IW3 A;  3O0W A;  3TN9 3;  1LHU A;  3LGR A;  4BMB A;  4LPL A;  2IXJ A;  3GF6 A;  2XUM A;  3MHZ A;  2VVF A;  5LY1 A;  1RVF 1;  1F35 A;  2XJR A;  5M0T A;  2JB8 A;  2FDI A;  3NQH A;  4XJW A;  3E5Q A;  2RG4 A;  4KL1 A;  4DOU A;  4F8A A;  1XB9 A;  1V00 A;  4F83 A;  1R1A 2;  5LA1 A;  2WS9 2;  4XFG A;  3III A;  3UGG A;  4DB5 A;  3NL1 A;  3MIF A;  3O1V A;  4HPK B;  4PI0 A;  2Y6J A;  1RHI 3;  5F5C A;  1KQR A;  2ETE A;  3AKS A;  5BV6 A;  4JX0 A;  5BYN A;  3VD9 A;  4W50 A;  1AYN 2;  3HMY A;  1LEN A;  4RD7 A;  3I3M A;  2RJL A;  3I2F A;  1Y4W A;  2XL9 A;  4HMZ A;  4WZC A;  2VZV A;  4FPK A;  5EIY B;  2C0Z A;  3PTY A;  1WW5 A;  2VCA A;  5HI0 A;  1ODN A;  3BIW E;  2AR6 A;  3BPZ A;  3NNM A;  3AP6 A;  3O1M A;  3BOD A;  1PK6 B;  2K0G A;  3MIC A;  3ZYJ B;  1XU2 A;  1LOD A;  5JUV A;  3I7D A;  2CY6 A;  1DDL A;  2JG9 B;  3AYA A;  5J48 A;  3OG2 A;  2WQ8 A;  3AB0 A;  1ZA4 A;  2PAM A;  1LES A;  1LOF A;  1UL9 A;  2CWM A;  2R32 A;  4RQP B;  5E1R A;  2GDF A;  4I0A A;  2HWD 2;  2VXR A;  1QJY 3;  4K7J A;  2VBB A;  4QXC A;  1RUC 3;  2OUJ A;  4PDW C;  1IG0 A;  2JE9 A;  1EPZ A;  1HJF A;  1W8U A;  5A32 A;  1JYI A;  4WM8 B;  3NAP C;  1E5S A;  5FZ1 A;  2WO7 A;  1CAV B;  1SMV A;  1VAL A;  2CDO A;  2Q8E A;  4DEQ A;  1ULF A;  2JDA A;  1N1S A;  4JCK A;  4MGY E;  3DCQ A;  3JCI A;  3DPR C;  3TOJ A;  4A3X A;  2ZGL A;  4E4H A;  2CU5 A;  2HWF 2;  4XAE A;  4ZS2 A;  1NX9 A;  4Q4W 2;  4QX2 A;  4K6B A;  4MOA A;  1W8W A;  4W6X A;  2RS3 1;  4I09 A;  4LUM A;  1WGP A;  3IT8 A;  1V6K A;  1G6N A;  1G9F A;  3IWZ A;  1ENS A;  4YZ3 A;  3N7L A;  4BME A;  3APB A;  4IDZ A;  5DPN A;  5LBE A;  1VAM A;  2JG8 C;  2WAB A;  3N9P A;  4E2S A;  5CA6 A;  3POG A;  3BIE A;  3AZZ A;  1FX5 A;  4NHK A;  3VL8 A;  1QJU 2;  4A7Y A;  1L7L A;  4GWM A;  1AR6 2;  1ZZ9 A;  4YRD A;  4A7K A;  4BZ4 A;  1VE0 A;  2ZXQ A;  1PMH X;  2W47 A;  3PMS A;  4MSV A;  1B35 B;  1CZS A;  2PHR A;  3DF0 A;  1OD3 A;  2YMZ A;  2A71 A;  4TYS A;  4Z2W A;  5FXW A;  1GAN A;  2CHH A;  3DKQ A;  3VBH B;  2ZKN A;  1APN A;  2VUC A;  4XIK A;  2Q1F A;  4Q1P A;  1KFX L;  3WQ7 A;  5FXV A;  3VDA A;  1RVF 3;  2ORX A;  5LAT A;  3KCC A;  3RZZ A;  5GZD A;  3NV3 A;  2YRO A;  1MZ5 A;  5SV5 A;  2CYF A;  2VCC A;  3IZO A;  4AE2 A;  4NMI A;  3HBK A;  3S30 A;  4QQH A;  2V4A A;  1ZBA 2;  1VBB 1;  4CP0 A;  3ACG A;  1WBF A;  3HD8 B;  1UW8 A;  3K3O A;  4AGR A;  5DZE A;  2DCJ A;  1TQ5 A;  5FY1 A;  3O1U A;  5EPA A;  2WO2 A;  4GB3 2;  1DGL A;  2QCS B;  4CVU A;  1JZ6 A;  4MGT A;  1JHN A;  5ISL A;  4J1W A;  1VB4 A;  2A6Y A;  1H4H A;  3I54 A;  5DUV A;  4D69 A;  3H7J A;  1PGL 1;  1QHD A;  3K51 A;  2VL4 A;  1ZZB A;  3WNL A;  4B8E A;  4CU6 A;  2X10 A;  1AHS A;  1OQD A;  2Q30 A;  4EWD A;  4FAH A;  3RMX A;  5EJZ B;  4OHZ A;  5ANQ A;  3FC0 A;  3WDX A;  2WNV C;  3POJ A;  1RUI 2;  2DU1 A;  1LOA A;  1O5U A;  2XG3 A;  3HQX A;  4B4P A;  2QQL A;  2ADE A;  3OEA A;  4PIX A;  1FNZ A;  3H9A A;  4I0B A;  1RUO A;  1WW6 A;  2H6B A;  3G6J B;  1VP6 A;  2R1B A;  2Q1Z B;  3BB6 A;  3HT2 A;  4FP2 A;  4LTA A;  5LK7 B;  5FZM A;  3DUI A;  5CKM A;  4AED B;  2QKD A;  1KJR A;  2H6C A;  2W3J A;  3MIE A;  4CDX B;  1KD7 A;  2RE9 A;  1LED A;  5JLV A;  4MLO A;  4CA9 A;  3NJZ A;  5FBJ A;  2ZBJ A;  5FZG A;  3PVB B;  3KZ4 C;  1RUN A;  1S2E A;  4ET7 A;  1BMV 1;  2JKX A;  4B4R A;  3HAG A;  5ERL A;  4XE9 A;  1W8T A;  1B09 A;  2W2I A;  4UAP A;  1TME 2;  5DAQ A;  1OI6 A;  5GLW A;  4JTO A;  3ILN A;  4CCN A;  4L97 A;  5CFD B;  4HZF A;  1XBF A;  1C8M 1;  2PHT A;  2RS3 3;  2ZTN A;  3MFA A;  4AL9 A;  2JDY A;  5FYS A;  5BNN A;  5C4W B;  4S2H A;  2D6P A;  1YI9 A;  3JQW A;  4Y1Z A;  5I0D A;  2DVF A;  1H2K A;  4EQV A;  1O4Z A;  4FTS A;  2EVX A;  3E5U A;  3MW3 A;  5FZ8 A;  1PMJ X;  2YPJ A;  1UZ0 A;  3ETP A;  1W3X A;  1Q56 A;  3BU7 A;  3AL6 A;  3IMM A;  2XUE A;  1MZ6 A;  1H2N A;  3POB A;  4YGD A;  1RUE 1;  1V6M A;  1BEV 3;  4FTE A;  3PVN A;  2YFU A;  2E31 A;  4NII A;  5J37 A;  4CPB D;  4XBQ A;  5FJH A;  4AXO A;  4JRL A;  1K12 A;  2ZGQ A;  3UKN A;  2VMG A;  3FLP A;  3W9A A;  3ZN6 B;  2QQV A;  2W87 A;  3LA3 A;  5FYC A;  3TAY A;  4O9G A;  2WNE A;  4IE4 A;  4QPY A;  4I3P A;  5FO7 B;  1BK1 A;  3VLB B;  4NRO A;  3ATG A;  1GQP A;  3FHI B;  3WNK A;  2XML A;  3AC0 A;  4GMP 0;  2A6V A;  2C4X A;  2NN8 A;  3HT1 A;  4NHL A;  5DDJ 1;  4AVB A;  5A33 A;  3L9J T;  4M01 A;  4CUG A;  1RUJ 3;  2XDV A;  1X9T A;  2VPV A;  3NRU A;  1VBB 3;  2OUH A;  5ABJ B;  5HV4 A;  1V9U 2;  3HWJ A;  5JPM B;  4P14 A;  1CX4 A;  4QPG A;  3CQO A;  1J3Q A;  1CZV A;  3FWE A;  4L0P A;  1OQE A;  1X36 A;  2DUQ A;  3OOX A;  2DBN A;  2PHL A;  3VDD B;  3K77 A;  1QJX 2;  3MDP A;  5CKQ A;  1OF4 A;  4XQD A;  4H2A A;  4L8Q A;  4IUG A;  2Q5T A;  5F8P A;  3TRS B;  4OZX A;  2FQP A;  3OBR A;  2YC4 A;  2DBI A;  3ZFG C;  1ZM1 A;  5IVJ A;  1OSG A;  3H1M A;  3TB0 A;  1OMI A;  1CN1 A;  1JYW A;  5DAP A;  3M3E A;  4Z82 A;  5IW0 A;  1BK0 A;  5I91 A;  2YV8 A;  1IS3 A;  2RS1 1;  1OVP A;  1H2M A;  2EIC A;  3O0X A;  1GYK A;  1ZNP A;  4RR3 C;  1ZBE 2;  3S57 A;  4OI2 A;  2EXI A;  4CU8 A;  5IFP A;  4CRQ A;  3FE5 A;  2ES3 A;  2MPF A;  3SH3 A;  1F9K A;  1WD3 A;  3N3H A;  2FDF A;  1H1I A;  2EAL A;  2JEC A;  4GZ9 A;  4UF0 B;  5KHJ A;  1G8W A;  5KHK A;  3MO4 A;  3PU8 A;  2B9U A;  2QE3 A;  5CIS A;  1I5Z A;  2Y26 A;  1CAW A;  1JS9 A;  4MXW A;  2EAK A;  3TN9 2;  3S0M A;  2WFF 1;  4FPG A;  1N3P A;  1QJE A;  2K9Z A;  4QM8 A;  1VMH A;  2V5Y A;  3ILF A;  5A6Z A;  1GWL A;  2BP6 A;  4LBK A;  5A32 B;  3MIH A;  1MPX A;  4YW7 A;  5LRS A;  1OFS A;  2O8Q A;  1JU3 A;  2GNB A;  5H9R A;  2DDU A;  3VD7 A;  4M0H A;  1W6Q A;  1OD5 A;  5GLZ A;  2UY8 A;  2VAU A;  4COW A;  5IK8 A;  3WHT A;  4QX0 A;  4GA9 A;  4Y5S A;  1N1V A;  2LAL A;  2W91 A;  3WDT A;  1RTV A;  1LEM A;  1KJL A;  1SCS A;  1BCX A;  1D2Q A;  1RUE 3;  3VZJ A;  1GZC A;  1F4H A;  3WDV A;  2JDU A;  1U0A A;  4P9L A;  1NXD 1;  1BVV A;  3RG0 A;  2P3I A;  3SIS A;  3H1Y A;  2WQZ C;  1GKB A;  3WW3 A;  3ZDS A;  4E4S A;  4QKF A;  4XIL A;  4JGY B;  3VBR C;  4JDN A;  3ZSL A;  2G9Z A;  2HBT A;  3OY8 B;  4LKS A;  4J6G A;  4EE2 A;  3V56 A;  4IGQ A;  4D7S A;  5K0U C;  1PGW 2;  1H8T B;  2O14 A;  5DAV A;  1MZF A;  1W0O A;  1HDK A;  2E32 A;  3B02 A;  2CGN A;  5DDJ 3;  3MZH A;  2A3Y A;  2WS9 1;  2HKX A;  3VBF C;  1QJY 2;  2HYK A;  4MAD A;  2ZEY A;  3BN6 A;  4IGP A;  1O3S A;  4S2D A;  5GZE A;  1X7N A;  2A6W A;  3KV9 A;  5I0S A;  3OGV A;  1AYN 1;  4XFF A;  2GU9 A;  3FHQ A;  4EN8 B;  3H8X A;  2JG9 A;  4FBF A;  2BGP A;  3SIT A;  2ZGN A;  2HWC 1;  1XYN A;  5LA2 A;  3LDK A;  4OFG A;  1VB2 A;  2WA3 A;  5B4X A;  5CU1 A;  3ZXG A;  3A0N A;  4XJ8 A;  3B3Q E;  4QB1 A;  2VQT A;  4XTM A;  2RR1 1;  5JIU A;  3AMP A;  4LBM A;  1PZ7 A;  2RS1 3;  4CEY C;  2FDH A;  4K8F A;  2WIN B;  2OT7 A;  2P34 A;  1VRB A;  2PMW B;  2WJS A;  1W6P A;  4QPI A;  3GZU C;  3P1I A;  5A3L A;  5B4N A;  4Y22 B;  3V0A B;  2YGL A;  2FZ1 A;  2P6C A;  5CG9 A;  3J4U H;  3VHN A;  4W6W A;  4JDM A;  2R49 A;  5KXB A;  2BU9 A;  5T54 A;  4BLJ A;  4AVT A;  1JYX A;  1W6M A;  2VXJ A;  2OA2 A;  4FP3 A;  2VMI A;  2XVL A;  3B00 A;  4XF9 A;  2A73 B;  4QGN A;  1FAT A;  1GOF A;  4NR1 A;  4HFS A;  4W4Z A;  1GOH A;  2F4L A;  2WFF 3;  3E5X A;  1GUI A;  1VAK A;  1L7R A;  2YHJ A;  4JGZ B;  4FTB A;  1J84 A;  2D93 A;  2XJV A;  4C90 A;  4JZR A;  2K2S A;  1WLD A;  2AEN A;  5EXO A;  3B69 A;  2R16 A;  3P3N A;  2VO5 A;  3VBU A;  2X5I A;  1YNA A;  4P9Y A;  1LUL A;  1RUG 1;  4FPF A;  3BAL A;  3MV0 1;  1UCX A;  4LMF A;  2VCM A;  4AGV A;  4FPC A;  2ORZ A;  2MEV 3;  4JKM A;  3OGR A;  1OKQ A;  4AHW A;  5J7M A;  1YUD A;  1NKG A;  1VMJ A;  4C1X A;  5FK8 A;  3LIG A;  3AM2 A;  3E97 A;  4WBB A;  4CYD A;  2D3P A;  2ZGK A;  3ZXD A;  1UZW A;  2J1U A;  2PEL A;  3POE A;  4NN0 A;  3WG1 A;  4LJH A;  1UQX A;  3NNF A;  4RN5 A;  2X5I C;  1YXW A;  2EF6 A;  4LHN A;  5FZK A;  1ZBA 1;  4BU2 A;  3CJX A;  2ZAB A;  1C5I A;  3AZV A;  3UJQ A;  1X82 A;  1IQA A;  5IJR A;  3WD5 A;  3CJI C;  4CSW A;  2FDJ A;  3UKT A;  2X09 A;  5JSP A;  4YG3 A;  1MS5 A;  3H3U A;  2YGM A;  1AYN 3;  2O1Q A;  3AFK A;  2VJX A;  4CE8 A;  4QX1 A;  5J96 B;  4HKW A;  3RI8 A;  3OUH A;  2HWC 3;  4COY A;  3GCW A;  3SCH A;  1HRI 1;  2VVE A;  3POY A;  1BKZ A;  1HB3 A;  4IES A;  4PDW B;  5FDB A;  3L2Y A;  4R9D A;  3JD7 2;  4AHY A;  2RS3 2;  2BOI A;  3I2G A;  2WII B;  4P9G A;  5IAT A;  5JMC A;  4IND A;  5A80 A;  5FZ4 A;  2RR1 3;  2WQ4 A;  1NCR A;  3POS A;  1K5M C;  3DPR B;  3ZPY A;  2E63 A;  2JIJ A;  4NWV A;  5FOB B;  4XFC A;  3KLS A;  4IE7 A;  4AFC A;  2BGO A;  5FP3 A;  3KVB A;  2XWB B;  2Y38 A;  1GP6 A;  5FPU A;  1BEV 2;  2J1E A;  2JEN A;  5KXE A;  2VUJ A;  2OPW A;  2VZ1 A;  5FZ6 A;  1WCD J;  1UY2 A;  2JG8 B;  3AYE A;  1T6G C;  4PLM A;  4CU9 A;  4RA0 A;  4H7L A;  3VBO C;  1SBE A;  5EQU A;  1MS1 A;  2ZGU A;  5JR2 A;  1TEI A;  2CAV A;  1UY4 A;  2ET7 A;  1H9W A;  1CZT A;  1QOT A;  3KV6 A;  4TLG A;  4YW3 A;  4BCU A;  1OOP B;  3RWN A;  5HXM A;  2ZS6 B;  1EV1 1;  1RUJ 2;  2VNO A;  2XJS A;  3FFZ A;  4HSJ A;  5LEJ A;  4BQW A;  1AR8 3;  1VBB 2;  2NM1 A;  4N43 A;  5A6Y A;  2E53 A;  2ZZQ A;  2UUR A;  1AX0 A;  2PHD A;  1RUG 3;  5K4L A;  1URX A;  1QGL A;  4JV4 A;  3QOP A;  3K46 A;  2HH9 A;  5FYI A;  3LPG A;  1KGY A;  2FBE A;  4NO4 A;  3RZL A;  2GAU A;  3T2O A;  5GAL A;  1YFU A;  3C8X A;  1ZRD A;  2EIE A;  4Q8L A;  3ZYG A;  4LOS A;  1OKO A;  5C3S A;  4AAP A;  1PIV 1;  5AFB A;  3C7F A;  5FRE A;  5KWR A;  4A7Z A;  4AEK A;  4GJZ A;  4LNV A;  2E33 A;  2YB7 A;  3AL5 A;  3WW2 A;  4ASK A;  5CVR A;  2HLE A;  1UYZ A;  3SMH A;  3U4S A;  3TNQ A;  4YZ1 A;  5L7O B;  3U07 A;  4Y20 A;  3JUU A;  1RUH 3;  3A21 A;  4O65 A;  2OYZ A;  1V9U 1;  3K75 B;  1HKD A;  3S5A A;  2VZ3 A;  5DXD A;  5HCF A;  5F6L B;  1RUF 3;  2WAA A;  3C2U A;  2ZHN A;  3U14 A;  3LA2 A;  4AI8 A;  1ULE A;  2PQS A;  2Y6F A;  2B4K A;  3LFM A;  1JOD A;  4HXC A;  1DIW A;  3B01 A;  3WQ0 A;  5L19 A;  3ZR6 A;  3EHK A;  3ES1 A;  2JDK A;  1NZC A;  1HRI 3;  1OH3 A;  1UX7 A;  3LEI A;  4D7Y A;  2BRT A;  4Q27 A;  1DYK A;  3VD4 A;  4BDV B;  4CP1 A;  4XF4 A;  5JZG B;  1VBA 1;  4N53 C;  4A3Z A;  4MVT A;  2JB4 A;  5D8A A;  3VKM A;  3E6D A;  3IAQ A;  4B1M A;  1XQN A;  5C5U A;  4XQW A;  5FLH A;  4EYU A;  1W04 A;  3WNP A;  4ISR A;  2EIB A;  3NJV A;  2PYT A;  3IN9 A;  5BNO A;  1HB2 A;  2YXS A;  2F17 A;  3CBN A;  4R52 A;  5T5P A;  1DQ6 A;  5FPZ A;  1MS3 A;  1QWR A;  3P3P A;  3ZXE A;  3SCG A;  4D7T A;  2EXK A;  1RUE 2;  4ZZ8 A;  3PU3 A;  3M7A A;  3WHU A;  4GXL A;  1QXJ A;  5A3U A;  1DCS A;  3W59 A;  4IV3 A;  5E88 A;  3I97 A;  1H8V A;  3AMQ A;  4KBZ A;  4UWD A;  1DFQ A;  1IQD C;  4LEJ A;  1OA4 A;  4G4F A;  5FAX A;  4ARX A;  2PXJ A;  4D6Q A;  4PF1 A;  3VUO A;  4Z1V A;  1T6B X;  4BLI A;  5LA9 A;  4AWD A;  1ZRF A;  2ATF A;  3U11 A;  3RZH A;  5DDJ 2;  1J59 A;  5F5A A;  4QKB A;  1EYB A;  3UJO A;  3WDY A;  1EV1 3;  4B3N A;  4BIS A;  4N90 A;  5BNO C;  4XHX A;  4LHS A;  3EO6 A;  4A6S A;  4BPZ A;  1CJD A;  2ZOE B;  4AHZ A;  4AI0 A;  1UOG A;  5A7Q A;  5FWE A;  3CEW A;  1BVP 1;  1MS0 A;  2GAL A;  2RS5 1;  3KV4 A;  3LF7 A;  3OY8 A;  4Y1U A;  4LHL A;  1SDW A;  3OBZ A;  1H8T A;  4Q1R A;  3KS7 A;  2V09 A;  4H3W A;  4RS5 C;  2DUR A;  4J1X A;  3N7K A;  3LEM A;  3DXU A;  4XUQ A;  4Q4Y 1;  3WSO A;  4CCC A;  1H9P A;  1XE7 A;  1R08 1;  2I45 A;  3IPV B;  3LDB A;  3ZXA C;  3MI8 A;  1FYU A;  1PIV 3;  4YVS B;  2BGC A;  3P6B A;  4C8D A;  4Z92 B;  1AZD A;  3AK0 A;  3J26 N;  4RSU A;  1A3K A;  2RS1 2;  3ACH A;  4H55 A;  3ZXF A;  3FMG A;  1QJY 1;  4JTN A;  3B9C A;  1PMI A;  3PDQ A;  3ZFG B;  5A1A A;  2HWE 1;  2C24 A;  1V9U 3;  2PAK A;  4D94 A;  1ND2 C;  4JVA A;  5FY4 A;  1Q3E A;  1NCQ B;  1ND3 B;  1KXG A;  3NNJ A;  1QF3 A;  2FZ2 A;  5C71 A;  4XQ4 A;  4L2N A;  3T0D A;  2WNU C;  4RR3 B;  4AQ6 A;  4XFB A;  3GBG A;  1BZW A;  4M3C E;  2E7T A;  1WLC A;  1YJL A;  4R9C A;  5CFC C;  2WFF 2;  2RDR A;  3AFG A;  5D1I A;  2Y6L A;  5EP9 A;  4C1W A;  4P9X A;  1JUH A;  1NA1 C;  4DXR A;  3AP7 A;  1SPP B;  1VBA 3;  2JD9 A;  3KM5 A;  3OEB A;  1YQ8 A;  3THP A;  2ADD A;  5LCW L;  2CV6 A;  2CGP A;  1VBE 1;  2WYF A;  2WZ8 A;  3FUO A;  1UNB A;  1I6X A;  1UYP A;  3M70 A;  3ZFE B;  1JZ5 A;  1QQP 2;  2BBA A;  4IER A;  4UFL A;  3I2O A;  3IDB B;  2QZ2 A;  3M3Q A;  2OS2 A;  4CP9 A;  5C33 A;  4HON A;  4YVW A;  2VZR A;  5FYZ A;  3I3E A;  1LU2 A;  5FY7 A;  1CON A;  3RNS A;  3WNO A;  3WDW A;  1NT0 A;  1O3Q A;  2MEV 2;  1H6Y A;  1XE8 A;  1G7Y A;  4PJY A;  4RL7 A;  3USU A;  1V6L A;  3PTR B;  5EWS A;  2PHU A;  2TBV A;  3BCW A;  5FYY A;  4YM3 A;  3GBW A;  1LGN A;  4E4D X;  3WR0 A;  3LIH A;  3RQ0 A;  2VME A;  3LAG A;  5IVE A;  1SLB A;  1C3H A;  2IUW A;  2DYC A;  1WA4 A;  1SDD B;  2Z42 A;  4KWJ A;  1W6N A;  1WMD A;  2XQR A;  4CXX A;  1POV 0;  4NJ4 A;  4XJA A;  3VKO A;  1KEX A;  5CKN A;  5F32 A;  3E6C C;  4AQ2 A;  5D21 A;  5EHD A;  4KBB A;  3VBR B;  4P5H A;  4C0H A;  4LO8 A;  1ODM A;  1YRZ A;  2WWJ A;  4Q0U A;  2X05 A;  5K0U B;  1PGS A;  3SQO A;  5FZ0 A;  3LPF A;  4KU8 A;  1RB8 G;  2RS5 3;  1EUT A;  5T5L A;  3GGL A;  2VOX A;  2GC1 A;  1UOF A;  2HWC 2;  2Y6K A;  4QGM A;  3MIB A;  5BXX A;  3VBF B;  4DFS A;  1JOB A;  3VZL A;  1WW4 A;  3N7M A;  4UBG A;  3NJX A;  4R8H A;  3ZFF B;  4R9A A;  1DQ2 A;  1H30 A;  5LBF A;  5T52 A;  3EBR A;  1FPN 3;  1YQ6 A;  3WX5 A;  4Q4Y 3;  1UMH A;  3D0S A;  1F2N A;  1R08 3;  2W9X A;  4IEV A;  4MUV A;  3N9L A;  4M00 A;  2RR1 2;  4ISQ A;  4CDQ A;  4QQP A;  1FMD 1;  2YG0 A;  3MID A;  2D6K A;  2X53 S;  2D6N A;  1DHK B;  4XBL A;  1K3I A;  4YGB A;  5F3C A;  2QFE A;  5BY5 A;  3IM0 A;  3POW A;  3VBS B;  3ACL A;  3ENR A;  5GZG A;  2HWE 3;  4CDU A;  3BVC A;  3HQR A;  1C1L A;  1KDM A;  4FOY A;  1GR3 A;  2RM2 1;  3J7L A;  4OI1 A;  2E9Q A;  2JKB A;  2P6H A;  2YFZ A;  3ORJ A;  1VBC 1;  4AVA A;  3HPN A;  2AZ5 A;  4MO3 M;  2UWB A;  3VD5 A;  1WLW A;  2VZU A;  2ZGT A;  2W39 A;  4YFW A;  3ZOI A;  3JD7 1;  1IKQ A;  3KB5 A;  4CDQ C;  4O7X A;  5BPX A;  3PUI A;  5FY0 A;  1LOF C;  5C3R A;  2PFW A;  5A1L A;  3FX3 A;  1H0B A;  4L9B A;  3RSJ A;  5FYB A;  1W6O B;  2D7F A;  3LDR A;  4Q8K A;  2RHP A;  1AR8 2;  2DUO A;  4CDU C;  4WV8 A;  3OBA A;  1VBE 3;  5LB6 A;  1F31 A;  1UYY A;  1N1T A;  3DYP A;  3T0B A;  4FXK B;  2J1R A;  2JDN A;  1W8Z A;  1YQC A;  2ARC A;  4LK6 A;  1OT5 A;  4HK9 A;  2YC0 A;  2ZGO A;  5FQ0 B;  1JHJ A;  1RUG 2;  4NOT A;  4IV1 B;  4WM7 B;  4YZ5 A;  1BEV 1;  1IS5 A;  5JSO A;  1YO8 A;  4PF5 A;  1OOP A;  4DZG A;  1GQH A;  5A7W B;  3KT4 A;  4QU1 A;  1ENQ A;  4XF3 A;  2QQM A;  2Y0O A;  5IUQ A;  5TSW A;  1UIJ A;  5CEH A;  1M06 G;  2GC3 A;  1MQT A;  1SBD A;  5EFU A;  2A7A A;  1CAU B;  2AC1 A;  1BXH A;  1Z7S 1;  2VQ0 A;  3ZSJ A;  5BNQ A;  3LWC A;  1YEW A;  1RUJ 1;  3D3A A;  4LBQ A;  2D97 A;  2WUH A;  1GFF 2;  2Z2S B;  1RUH 2;  1U5Y A;  1DZR A;  2NZ9 A;  1RUF 2;  1LGC A;  2ZX3 A;  1W9T A;  3FJS A;  3RGB A;  3MW4 A;  2BV4 A;  1UN1 A;  2VH9 A;  4XDO A;  2HEV F;  5LA0 A;  2RMU 1;  1Q5O A;  1S0B A;  4ARY A;  2WBK A;  3HVD A;  3N36 A;  3MUZ 1;  5H9S A;  4P9I A;  3ALQ A;  3MF9 A;  4AEJ A;  1HRI 2;  3ZSK A;  1SG3 A;  4BIF A;  4G3Y C;  1UKG A;  2P17 A;  1IHM A;  3MLJ A;  4HLT A;  1SAC A;  4UFI A;  1EPW A;  5FYV A;  1W06 A;  1GWM A;  4Q0V A;  5DN2 A;  2OX0 A;  3AXD A;  2R6Q A;  5K8S A;  4QXB A;  2VMF A;  3WDU A;  2XB6 C;  2WSV A;  3VKN A;  2PHF A;  1FMD 3;  5A7O A;  3NKG A;  4IGO A;  4B29 A;  4OUS A;  2AEZ A;  3C3V A;  3I3Q A;  4GD4 A;  3MF6 A;  4AI9 A;  2R7E B;  2AYH A;  1QXP A;  2VZQ A;  5BNP A;  4M4P A;  2XL7 A;  3Q8E A;  1IGO A;  4OZO A;  3CNA A;  3GDB A;  5JZG A;  5I8S A;  3EJK A;  1S0I A;  4M3C B;  3WF3 A;  2RM2 3;  1K5M B;  5FMD A;  3ZR5 A;  1STM A;  2G9G A;  2JE7 A;  5DG2 A;  3NW4 A;  2ZA9 A;  1VBC 3;  1ZZ6 A;  3WQB A;  3FFQ A;  2A70 A;  4N7U A;  4O61 A;  1DGW A;  2VUL A;  3OYW B;  3AMH A;  4Y1X A;  2Z5W A;  1RJ8 A;  3WY6 A;  3WP6 A;  5LAS A;  5FP4 A;  4AAX A;  4ZON A;  3JD7 3;  1IOA A;  4COU A;  3ZN5 A;  4CCL A;  4H7M A;  5FUN A;  1UZY A;  3C7O A;  5DZF A;  4RGK A;  1ALY A;  1EV1 2;  4XW3 A;  5BNP C;  1PVX A;  3VBO B;  2BZD A;  1QDC A;  4GH4 A;  4KWK A;  2OII A;  3A0K A;  4K1Z A;  2ZX4 A;  3H42 B;  2NMO A;  1MZE A;  4FI9 A;  3U10 A;  1JBC A;  2R0F A;  3ZVX A;  1SCR A;  4LT5 A;  1FOD 1;  1JN2 P;  5IVB A;  4OUL A;  3U4X A;  2AH2 A;  3I2H A;  2BNN A;  5F37 A;  2OVU A;  2O0O A;  4YG0 A;  3TYJ A;  4TWT A;  2B45 X;  3DYM A;  1LHV A;  1SLA A;  4NAO A;  4UT5 A;  5FTT C;  1LTE A;  4X6Q B;  4AI3 A;  5BNN C;  3LOB A;  1NG0 A;  1NQJ A;  4LHK A;  1NY7 1;  3O1O A;  2RJK A;  1WZX A;  4AFB A;  1PIV 2;  4UW4 A;  1I3H A;  2Z79 A;  4OQ9 A;  1Z7S 3;  4GH4 C;  3AKQ A;  4R4X A;  4QHZ A;  5A3P A;  4BM8 A;  1GZW B;  2IZW A;  5C9A A;  3OPT A;  4JDO A;  3T4H B;  2VOV A;  4HT1 T;  4AK3 A;  5JVV A;  1RYY A;  4HKO A;  4YSF A;  1QOS A;  3NVC A;  1X8M A;  4CP2 A;  4I2O A;  1U5Z A;  1XYP A;  3IDE A;  1UY3 A;  3SLI A;  2KXL A;  1F4A A;  4FOW A;  1XND A;  2GND A;  2ZAA A;  2RMU 3;  1LEC A;  3N9Q A;  3MV1 1;  1DGR A;  3HQU A;  4KNC A;  1WCU A;  1WCQ A;  3KD4 A;  1O8P A;  2XR4 A;  1QXR A;  2DUP A;  3H0O A;  1C5H A;  3ACF A;  1VBA 2;  3BI3 A;  1O59 A;  2F4P A;  2E6V A;  5C9A C;  4XUN A;  4Q26 A;  4Y4R A;  1NCQ A;  1ND3 A;  1NE6 A;  2BDR A;  5HCB A;  2XJT A;  3AKR A;  4BB3 A;  3ZMN A;  3SHR A;  1YYN A;  1XSR A;  1CR7 A;  4QWN A;  3LZZ A;  2BPA 2;  4ZS3 A;  4FFF A;  4QPG C;  5FP9 A;  4BYY A;  1AR7 3;  5C8C A;  4N53 B;  2QZ3 A;  4KI5 M;  5LBC A;  2J42 A;  4UI9 L;  1MEC 2;  1AUY A;  1HX6 A;  1SPP A;  3D5O A;  4CEW A;  2A3W A;  3BU0 A;  4Q4V 2;  2G19 A;  1XPW A;  3LA7 A;  4QX7 A;  1OC1 A;  1RC6 A;  5FZO B;  2WWU A;  4I0W B;  3OTF A;  3THD A;  3RFR A;  1L3J A;  4DEV A;  2VW1 A;  5FPL A;  4E8D A;  2DVB A;  2X29 A;  4P02 B;  3CKH A;  3RWK X;  1VIW B;  1OLM A;  2Y60 A;  1HN0 A;  3G7D A;  2IVI B;  5DUU A;  5A6Q A;  1XNC A;  1GNH A;  5A7N A;  3U37 A;  3KCX A;  2ZX1 A;  1DZT A;  2VR4 A;  3TEX A;  4GIQ A;  1SHW B;  5GLV A;  4NAM A;  5C8C C;  4P5Y A;  3T4V A;  2XJQ A;  4BHP A;  1GLH A;  1A8M A;  1QQP 1;  4R4Z A;  2CSG A;  1N3O A;  1CVN A;  3AYC A;  2VE1 A;  3B94 A;  5FO8 B;  3AJZ A;  4MHR A;  3VDB A;  4AR2 A;  1WBL A;  2QVS B;  4BQY A;  5IVF A;  1SLT A;  2RS5 2;  4GMP 1;  1S0F A;  3AZX A;  1FOD 3;  2BNM A;  3WIN E;  4HET A;  5D2A A;  2BWA A;  2MEV 1;  3K48 A;  1Z78 A;  1DYP A;  1Q8P A;  5JOX A;  4LBJ A;  3T2T A;  4LIU A;  4TTG A;  4XCB A;  3HN3 A;  4TZD A;  2GP3 A;  1FPN 2;  5CNA A;  4HPK A;  4Q4Y 2;  2Q8C A;  3BTY A;  1XNB A;  2C5D A;  1R08 2;  3JB8 A;  4KG8 A;  5C70 A;  5JI9 A;  1ULP A;  4ES9 A;  1NLR A;  1W9W A;  3NJY A;  2C26 A;  4YW6 A;  2J1A A;  4FPO B;  2R0H A;  4LA3 A;  4V2V A;  1RIR A;  4NRQ A;  2ZGP A;  4PQ9 A;  1YCI A;  4N9H A;  2VTX A;  3UYJ A;  4EZH A;  4M0N A;  2WT1 A;  1VRH 1;  2R07 1;  4LE4 A;  2HWE 2;  2WL1 A;  5GKA C;  4LBO A;  4NPM A;  2XJU A;  1PK6 A;  3WV6 A;  5I0R A;  4DUX A;  1NLS A;  1RUD 3;  1WMF A;  4XEZ A;  4XZP A;  1AL2 2;  1PHM A;  5FZI A;  3OGG A;  3FL7 A;  4LO6 B;  3S5Q A;  4RQP A;  2ZJC A;  5C5T A;  1J3R A;  1ND2 B;  1W9Y A;  1CAX B;  1HLC A;  4RHV 1;  2KD7 A;  4OHY A;  5T5O A;  4CZS A;  4FOV A;  4TXW A;  3VHP A;  4WM8 A;  1JH5 A;  4B7K A;  2BFU L;  2LTN A;  2QJV A;  4CDW B;  1CAV A;  5FXZ A;  3T08 A;  2VNR A;  2IWG B;  1VBE 2;  2PLV 3;  3FLT A;  3KMH A;  4EN6 B;  4EN9 B;  1LKN A;  3I3D A;  1Q8V A;  1W2T A;  2PA7 A;  2JXA A;  1QNW A;  1W0P A;  2EAA A;  2JG9 C;  5F39 A;  4O9E A;  2XVG A;  4MX3 A;  4V1P A;  2DCZ A;  4DUV A;  1WUV A;  4K8R B;  3V0B B;  2SBA A;  2XBO 1;  4XMI A;  5FK7 A;  3A23 A;  2NP0 A;  1JXN A;  3F95 A;  4JKK A;  2XLA A;  1CGP A;  2ARB A;  2ZZJ A;  3I59 B;  4DIQ A;  2YYO A;  2W95 A;  3W20 A;  2W92 A;  1CWP A;  4LE3 A;  3OUI A;  3ASI A;  4AQS A;  4XFH A;  4WVM B;  3IKW A;  3VDC A;  5JSR A;  1DGW X;  2CDP A;  2D3R A;  1F15 A;  1ENR A;  3CHX A;  3ELN A;  3OCP A;  4K3U A;  3ZXL A;  4URT A;  3LOI A;  4SLI A;  1FV2 A;  1V6I A;  4IV1 A;  3ME2 A;  5CZK A;  2W1Q A;  2ZHL A;  1UMZ A;  1AJK A;  4QPI C;  2GSY A;  1ASJ 1;  2D6O X;  3EQE A;  1AR8 1;  4HVQ A;  4GKY A;  4IE6 A;  5C6C A;  3O1S A;  1RIT A;  1PZ9 A;  5T5J A;  2ZMN A;  3UNP A;  1B35 A;  3VZN A;  1QQP 3;  4YM0 A;  4AFD A;  1LHN A;  5JXG A;  5C8W A;  1AR9 3;  3AZY A;  3VBH A;  1KS5 A;  4Q0Q A;  5I0T A;  1JOP A;  5A7S A;  4DXT A;  2LW8 A;  4XPV A;  3VL9 A;  4GMP 3;  4OMC A;  3ZLI A;  5FZ7 A;  1WCK A;  1HXS 1;  3BOP A;  5CIR A;  1DG6 A;  1ZRE A;  1DGR N;  4MHU A;  3ZPO A;  4Z2A A;  2QQW A;  2ID4 A;  1FV3 A;  3J8F 3;  4HVO A;  1N3Q A;  1XNA A;  4MZU A;  4FO9 A;  1ZZ7 A;  4XOG A;  5IT6 A;  4DQA A;  5KBF A;  4GWJ A;  1N1Y A;  4XFA A;  5F7U A;  3C7G A;  1DQ4 A;  3OPW A;  1BJQ A;  1FNY A;  1ZRR A;  2NPI A;  2WWS A;  4LUK A;  1FMD 2;  3VN4 A;  5IAX A;  2N7G A;  4G9S B;  3VBU C;  1UZV A;  5H9Q A;  3GM8 A;  2BOJ A;  1RUH 1;  2VQA A;  1MS4 A;  3DGT A;  3VBH C;  4HVR A;  1VRH 3;  1PX3 A;  3THC A;  2R07 3;  3KHC A;  3WXP A;  5J3U A;  1RUF 1;  1HJG A;  3ZIX A;  3DEC A;  5J36 A;  2RM2 2;  2JDM A;  2BVV A;  3B9I A;  4BQ2 A;  1IPS A;  1DF0 A;  1VBC 2;  4AG4 A;  5L36 A;  1U5I A;  1C57 A;  3GJB A;  4JC1 A;  3R4U A;  4MH0 E;  2VZO A;  4XF0 A;  1W05 A;  4XJZ A;  3SKV A;  3T2Q A;  2CTV A;  4AED A;  1UIK A;  2C1F A;  3ES4 A;  5EJ1 B;  3NAP B;  3SKJ E;  1JTZ X;  3CDZ B;  3B7M A;  4RHV 3;  1DZQ A;  1GIC A;  4XDQ A;  4CDX A;  1NOV A;  3HNB M;  3IB3 A;  5HPO A;  1SZB A;  2YBP A;  4PHZ A;  1PX4 A;  1S0D A;  1A6C A;  2WZP P;  4E4Z A;  3GBF A;  4XHB A;  5DZG A;  4HN0 A;  1NAE A;  5CFD A;  3JBG 1;  1D0H A;  2GNM A;  5HCH A;  5E16 A;  1J1L A;  1J1T A;  1HN1 A;  2JWP A;  3NWK A;  1PO2 1;  2XBO 3;  5AFE A;  3DEM A;  4WZF A;  5C4W A;  1W28 A;  2QUO A;  1TNF A;  2EID A;  4FXG B;  2OKX A;  3MLK A;  2OZJ A;  4LBN A;  1YIP A;  1BQP A;  3VD3 A;  4AED C;  1UZZ A;  1E5I A;  2W1S A;  3VKL A;  2YBS A;  3TBD A;  1PVC 1;  5G04 L;  4WVV A;  3QD6 A;  1LOC A;  1NCR C;  1NQD A;  1REF A;  4XMA A;  3WF4 A;  1S55 A;  1W3V A;  1XSQ A;  3ZXJ A;  1W2U A;  5IVC A;  1Z7S 2;  1SFN A;  3E1F 1;  1XNK A;  1LGB A;  5FPX A;  1ASJ 3;  1G9D A;  1Q43 A;  1UX6 A;  5A3W A;  5CFD C;  4CXY A;  5LZ6 A;  1J58 A;  1RJ7 A;  1NLQ A;  1ZRC A;  2WLP A;  2YDE A;  1JU4 A;  3WP3 A;  4XAA A;  3ZN6 A;  4A41 A;  1GSL A;  5FCC A;  2PHX A;  5FZ3 A;  2VU9 A;  4ZKT B;  1LHO A;  4QB2 A;  4BQX A;  4BQ4 A;  5C3Q A;  4E9K A;  3KSC A;  1EUU A;  4HG6 B;  1I9R A;  2RMU 2;  3LCP A;  4PT6 A;  2WYS A;  3KQ4 B;  2W5F A;  2DFC A;  2G1M A;  2D40 A;  1ACC A;  1HXS 3;  1E5R A;  5F5Q A;  3FN9 A;  1S2K A;  4YZ4 A;  4KMQ A;  5JIA A;  5ABJ A;  2BER A;  5FRA A;  4KU7 A;  4XC9 A;  4IEU A;  1YWK A;  4NHM A;  3OSD A;  2VZT A;  4YW1 A;  5I93 A;  1US2 A;  5E89 A;  5HCA A;  1SBF A;  1HIX A;  2QTW B;  2WO1 A;  5EV7 A;  3H1W A;  4BQ1 A;  4Z07 A;  5F6K A;  4N43 C;  1KDK A;  3VDD A;  3HOB A;  3PVE A;  4NWW A;  2QQU A;  1UU5 A;  3EXU A;  1RMU 1;  1AR7 2;  2XHN A;  3QBQ A;  1AXK A;  2WNV B;  2P5B A;  3ABZ A;  5JAX A;  2E7Q A;  3RZM A;  2DF7 A;  2AUY A;  2XVK A;  1GWK A;  4NIH A;  1P8J A;  2ARA A;  3V64 A;  1VR3 A;  1HQN A;  3ACI A;  5T50 A;  2GC2 A;  3SEP A;  1XE0 A;  4UFH A;  2ZEW A;  5ABJ C;  1GMM A;  3QH6 A;  4MGS A;  4QDR A;  5FO9 B;  4NVP A;  2QQO A;  3T3Y A;  1W03 A;  4QHB A;  2ZX2 A;  3V0A A;  1ST8 A;  3ITQ A;  2IXL A;  4OI4 A;  1RL3 A;  4LIV A;  1ZRI A;  3WEZ A;  1U5X A;  1UY0 A;  5HV0 A;  4QDS A;  5IHR A;  2ARX A;  3C7H A;  4UF0 A;  4YM1 A;  1SFY A;  5C7G A;  1JUI A;  2FDK A;  2WZR 1;  1Q8Q A;  1LCL A;  3DYO A;  4IEP A;  1G9B A;  2GP5 A;  1HB4 A;  3ZKU A;  3ZYI B;  2BBV A;  2WT0 A;  2DVD A;  1R1Z A;  2P3Y A;  3O14 A;  5DAX A;  3LKJ A;  1FI2 A;  4YW5 A;  3WF1 A;  1D0G A;  4LBL A;  1HRV 3;  3O5S A;  5JOW A;  1MEC 1;  4J25 A;  3JBG 3;  4XUR A;  5IVV A;  1F8V A;  4N7I A;  1FOD 2;  4FPL A;  2D6M A;  1PM4 A;  3WCR A;  4D6R A;  2I2S A;  1S1A A;  1PO2 3;  1XC6 A;  4Q4V 1;  1O91 A;  2UYB A;  3WQ1 A;  2BQP A;  1DQ0 A;  5KHH A;  1LOG A;  4S2F A;  3GAL A;  3PME A;  1MVE A; 
#chains in the Genus database with same CATH homology
 2J22 A;  2YFZ A;  3HPN A;  3CQO A;  1CZV A;  4L0P A;  4GWI A;  4MO3 M;  3VD5 A;  2VZU A;  3K77 A;  4UOJ A;  2XON A;  1OF4 A;  3PUI A;  4IUG A;  4PQQ A;  2J1T A;  4BJ0 A;  1W8N A;  1UYX A;  2YC4 A;  2VCB A;  4W8J A;  2XQX A;  3K4Z A;  1JYW A;  2VMD A;  3OBA A;  1UYY A;  3K4A A;  3DYP A;  3T0B A;  2J1R A;  2EIC A;  2LS6 A;  1OT5 A;  1JHJ A;  1GNY A;  3LQC A;  4CU8 A;  5IFP A;  3LE0 A;  4GZ9 A;  3FHA A;  2QQM A;  3MO4 A;  2J1V A;  4DUW A;  4XUO A;  3C7E A;  2VMC A;  2WN3 A;  1L7Q A;  4RYD A;  3JXS A;  3UET A;  3HNM A;  2Y6G A;  1JZ4 A;  3D3A A;  5JXH A;  2WUH A;  3HEI A;  1UXX X;  1MPX A;  2YC2 A;  3T2P A;  1JU3 A;  2C9K A;  2DDU A;  3VD7 A;  2QQI A;  4D8M A;  1W9T A;  4CUB A;  5LA0 A;  2J7M A;  3WNM A;  1W9S A;  4QX0 A;  2WN2 A;  3CIH A;  4ARY A;  2W91 A;  2WBK A;  3MUZ 1;  3NNG A;  4QAW A;  4XVH A;  1JZ8 A;  2WZE A;  3MUY 1;  1JZ7 A;  3J7H A;  1SG3 A;  1F4H A;  3I3B A;  3OB8 A;  1UY1 A;  5DN2 A;  4MGQ A;  2VMF A;  1W0N A;  4XUT A;  4LKS A;  4A42 A;  1BHG A;  4D0Q A;  2E32 A;  2R7E B;  2VZQ A;  4M4P A;  4ZY9 A;  4OZO A;  1OF3 A;  3GDB A;  1O8S A;  2ZEY A;  3BN6 A;  4MAD A;  3WF3 A;  1J83 A;  2B9V A;  5IFT A;  3OGV A;  4BXS V;  3FHQ A;  3WQB A;  4A4A A;  2BGP A;  4XUP A;  4ZXE A;  3WNN A;  1WKY A;  5G05 L;  2V72 A;  5LA2 A;  2VQU A;  4AAX A;  4KWU A;  1H6X A;  5B4X A;  3C7O A;  1UXZ A;  3CZU A;  4QB1 A;  2BZD A;  2VQT A;  1XNT A;  1YQ2 A;  4FI9 A;  3P1I A;  5B4N A;  1TG7 A;  2WDB A;  3I2H A;  4A44 A;  2RJ2 A;  1W99 A;  4YPJ A;  1UWW A;  3DYM A;  1JZ3 A;  3CMG A;  1JYX A;  2HYX A;  2W1U A;  1GOF A;  4W4Z A;  1GOH A;  1GUI A;  1L7R A;  1DP0 A;  1J84 A;  1RYY A;  3K4D A;  3EYP A;  1D7P M;  1UY3 A;  1F4A A;  2VO5 A;  2QBX A;  1CIY A;  3LEK A;  3MV1 1;  1I5P A;  3MV0 1;  1W8O A;  2ZEZ A;  1WCQ A;  3LEG A;  4P08 A;  2ORZ A;  1O8P A;  1K45 A;  4JKM A;  3OGR A;  3ACF A;  1NKG A;  1O59 A;  4BK5 A;  4XUN A;  4JHZ A;  4OYU A;  2QQK A;  1TVG A;  4LQR A;  3HNY M;  2J1U A;  4KI5 M;  4RN5 A;  3IAP A;  2W46 A;  3GXU A;  4P00 B;  4UI9 L;  2VOT A;  5IJR A;  2V5D A;  3ECQ A;  2XOM A;  2X09 A;  4QX3 A;  1XPW A;  4DEV A;  3THD A;  4E8D A;  1JYN A;  2VJX A;  2W94 A;  4P02 B;  4QX1 A;  3CKH A;  2QQJ A;  1JI6 A;  1K42 A;  3WF0 A;  4A45 A;  5CYY A;  3U37 A;  2VTF A;  2VR4 A;  4XZU G;  3I2G A;  1SHW B;  4P5Y A;  1JYV A;  4M4R A;  3VDB A;  3I2J A;  2VZP A;  2BGO A;  2ZEX A;  4TTG A;  2J1E A;  3HN3 A;  2VZ1 A;  1UY2 A;  3PUH A;  3IDA A;  4QDQ A;  4CU9 A;  4CUA A;  4BK4 A;  3I2I A;  5C70 A;  1ULP A;  4QB6 A;  1W9W A;  5JR2 A;  2C26 A;  1NUK A;  2J1A A;  1UY4 A;  1CZT A;  5DMY A;  2VZS A;  5HXM A;  2RVA A;  2V4V A;  5JXJ A;  1GU3 A;  1JZ2 A;  2DCK A;  2WAO A;  4DUX A;  3OGS A;  3FL7 A;  5DQ0 A;  4E8C A;  4CU7 A;  3W5M A;  3A7Q A;  3ZM8 A;  3K46 A;  5JMO A;  4DXS A;  3LPG A;  2J1S A;  3EB7 A;  1KGY A;  2Y6H A;  2KD7 A;  3T2O A;  3C8X A;  5J1X A;  4TXW A;  2EIE A;  3T08 A;  3C7F A;  3I3D A;  2E33 A;  2YB7 A;  4LPL A;  2QQN A;  3T0A A;  2HLE A;  1UYZ A;  4DUV A;  3A21 A;  3A23 A;  3NQH A;  3K75 B;  4JKK A;  2VZ3 A;  5LA1 A;  1ULO A;  3T09 A;  3III A;  2WAA A;  2W95 A;  2W92 A;  2Y6J A;  2PQS A;  3VD9 A;  2B4K A;  4JX0 A;  3VDC A;  4W50 A;  2L9L A;  2CDP A;  2VM9 A;  3I2F A;  1UX7 A;  3LEI A;  2VZV A;  5CZK A;  3VD4 A;  5EIY B;  4BDV B;  2W1Q A;  4A3Z A;  2VCA A;  4A6O A;  3IAQ A;  3UNP A;  3HJR A;  5JUV A;  3WNP A;  5JXG A;  3OG2 A;  2EIB A;  2WQ8 A;  3NJV A;  4DXT A;  2LW8 A;  3MBW A;  1DLC A;  4OMC A;  4ZZ5 A;  3F2Z A;  1UMI A;  4Z2A A;  4ZZ8 A;  2ID4 A;  1XNA A;  2JE8 A;  3I97 A;  2CDO A;  4GWJ A;  5F7U A;  4DEQ A;  1IQD C;  3C7G A;  1US3 A;  2JDA A;  4ARX A;  4PF1 A;  4CUC A;  3GM8 A;  1NX9 A;  4QX2 A;  4MOA A;  1PX3 A;  3THC A;  2WO3 A;  3DEC A;  4LHS A;  4OMD A;  5DPN A;  4AG4 A;  2WAB A;  2VZO A;  4JKL A;  4OUE A;  3SKV A;  3T2Q A;  5EJ1 B;  3SKJ E;  3CDZ B;  1LNS A;  2ZXQ A;  4XUQ A;  1PMH X;  2W47 A;  3WSO A;  3HNB M;  3IB3 A;  3SEE A;  5HPO A;  1CZS A;  3BGA A;  1OD3 A;  2E26 A;  3P6B A;  1PX4 A;  3ACH A;  3UES A;  1NAE A;  1DYO A;  3VDA A;  2ORX A;  5A1A A;  1HN1 A;  2VCC A;  2EID A;  2OKX A;  3ACG A;  3VD3 A;  2W1S A;  2RV9 A;  2DCJ A;  5C71 A;  3T0D A;  3CZJ A;  2WO2 A;  5G04 L;  4CVU A;  1JZ6 A;  3W5N A;  3WF4 A;  4DXR A;  2VL4 A;  2Y6L A;  3WNL A;  4CU6 A;  2X10 A;  3E1F 1;  2JD9 A;  3OEB A;  5LCW L;  5EJZ B;  1JU4 A;  4A41 A;  3I2K A;  2WZ8 A;  2QQL A;  1JZ5 A;  3OEA A;  4QB2 A;  2BBA A;  1EUU A;  4HG6 B;  4PT6 A;  2WYS A;  2W5F A;  2VZR A;  5FUI A;  3I3E A;  1CX1 A;  3FN9 A;  1OH4 A;  3WNO A;  2W3J A;  2Z4F A;  4KMQ A;  1H6Y A;  2BER A;  1T2X A;  2W1W A;  2VZT A;  1US2 A;  2WO1 A;  4ET7 A;  2JKX A;  2VME A;  3HOB A;  4UAP A;  1SDD B;  2XHN A;  1KEX A;  3ABZ A;  1P8J A;  3ACI A;  2Y64 A;  5I0D A;  3SEP A;  2X05 A;  2ZEW A;  1PMJ X;  1GMM A;  3LPF A;  4MGS A;  1UZ0 A;  4QDR A;  1EUT A;  3ETP A;  2QQO A;  3WF2 A;  3GGL A;  2Y6K A;  2Y8K A;  5IYY A;  3WEZ A;  3NJX A;  1UY0 A;  4QDS A;  2YFU A;  2E31 A;  5IHR A;  3C7H A;  4QPW A;  1UMH A;  5C7G A;  3A22 A;  1K12 A;  5JXI A;  2W9X A;  3DYO A;  2W87 A;  2VC9 A;  2YG0 A;  3WF1 A;  1GQP A;  3WNK A;  3AC0 A;  1K3I A;  2C4X A;  4XUR A;  1GOG A;  1XC6 A;  3NRU A;  1R64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...