2RVJA

Nmr structure of epithelial splicing regulatory protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of Epithelial splicing regulatory protein 1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Epithelial splicing regulatory protein 1
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rvjA01
2RU3A 4F02A 2DB1A 1D9AA 5DDPC 3MUMP 2XNRA 1H2UX 4LMZA 1YWXA 2EVZA 3BS9A 1VQNS 4WFNQ 1WEXA 2DO0A 2MZTA 1NJIT 2MZJA 3P3DA 3S6EA 2D9PA 2O3DA 5LXRA 2DHAA 4F25A 2ZJQQ 2L9WA 4UQTA 1VQPS 2LA6A 2M4MA 2JX2A 2RS8A 5D77A 2SXLA 4TU9A 3B4DA 2VOOA 2KXHA 3SXLA 3CCES 3VAKA 1RKJA 3CC4S 1ZZFA 3UD3P 1U1NA 3UE2A 2J0SD 3BO2A 2OIHA 5DM6Q 3HI9A 1K8AT 2MKKA 1M5KC 3ZZZA 3EGNA 2DGUA 1H2TZ 1KD1T 2DGTA 1N88A 5JVGQ 1HA1A 2I2YA 4Y00A 2JVRA 1UAWA 3TO8A 2DNHA 2V94A 2B0GA 2DO4A 1WHXA 1HL6A 2Q79A 2X1FA 2NZ4A 1WG1A 2GO9A 2MQQA 1QVGR 1VC5A 5LXYA 2L08A 1WEZA 2M8HA 2DNQA 2E5HA 2F9DA 1VQ5S 3CXCR 2DGQA 1XN9A 2MGZA 2DHGA 1F9FA 2M70A 1X5PA 1WELA 2DNYA 2MKIA 3UCZP 2CJKA 2MMYA 2DIUA 3CC7S 1VQOS 1M5PC 1X5TA 2D9OA 4QPTA 4OZ1A 4IUFA 4C7QA 2MZQA 3MD1A 4BS2A 2DGXA 1FJCA 1FJEB 1X4BA 3PIOQ 1OO0B 1AUDA 2LMIA 1U2FA 2DH9A 1SJRA 2LXIA 4A8XA 2U2FA 3MDFA 3CMAS 1X4CA 4TU8A 1VBZA 2ADCA 5GAEU 2DGVA 3J7ZT 3U1LA 2MQMA 1X5OA 3MD3A 5DETA 2KYXA 2N82B 3MURP 2HGNA 4M5DB 3CULA 2CQDA 5IQQA 1SJ4P 2CQ0A 1U1KA 3HHNB 3DLLQ 1JJ4A 2AYMA 2CPYA 3MUVP 2CQ4A 2DNPA 4CQ1A 1VC6A 3MXHP 1FT8A 1WTBA 4Z2XA 2OSQA 2MY7A 4QQBA 1P1TA 5GAHU 2N7CA 2KG1A 2DGSA 1U1RA 1DRZA 1U1QA 1U6FA 4EGLA 1X4GA 3BO3A 2J0QD 2CQ3A 4U67Q 2M9KA 2MHNA 1VQ7S 4ED5A 2DNOA 3PIPQ 2K3KA 2DITA 4UY8T 2BZ2A 3UWTA 1YJ9S 1W2BR 2U1AA 1FHTA 2KVIA 4CIOA 2LCWA 4W92B 2XNQA 4F26A 1Q82T 1X4AA 3EX7B 1BY9A 2DGWA 2KM8B 5LJ3Y 4C4WA 5DM7Q 3CCUS 3CCJS 2XS5A 2LQ5A 4QU7A 2MQLA 2G4BA 1IQTA 2DNNA 3I56S 4ERDA 1N8RT 2MSSA 2YH1A 2DNKA 3CD6S 2KFYA 2RVJA 3FEYB 2LKZA 5H1SV 3CCMS 2MKSA 3CUNA 5FJ4A 5EN1A 3G8TA 1UFWA 2HGLA 4WFBQ 2MZSA 2VODA 2JWNA 2VONA 4CH0S 1WHWA 3B4MA 1SJQA 3VAFA 2ADBA 2DNZA 4WF9Q 2MY8A 2LYVA 4Y0FA 2KRRA 4YB1P 2MKHA 2LEAA 5HO4A 1VBXA 2M88A 3NMRA 1ZH5A 2CPEA 1X4HA 2OJ3A 3VAGA 2OTLS 1PO6A 3Q2SC 2L41A 5ITHA 2DH8A 2JRSA 1B7FA 2HZCA 3MUTP 3CCRS 2F3JA 3FEXB 3NS6A 1DZ5A 1H2VZ 3THPA 4WKRA 1L3KA 2FC8A 2AYGA 2HGMA 2K8GA 3EGZA 3ULHA 2E5GA 1O0PA 1VQLS 3P6YC 1WI8A 3VF0B 5LSOA 3D2WA 1KC8T 3LQVA 4YOEA 1WG4A 2KRBA 1K73T 2QEXS 5GMKa 1WI6A 2DHXA 2RT3A 3TP2A 2MZRA 2M8DB 1A9NB 4TLQA 3CCVS 3DXBA 5IFMA 3L3CA 1VC0A 1A7GE 3I55S 2CQBA 2YH0A 2DHSA 2MSTA 2J76E 1U1PA 1U6BA 2I38A 4IOAQ 2KXFA 2CPIA 5IM0A 5D78A 2PE8A 4J5OA 5GVQA 3S01A 2DGOA 2MJNA 3SDEB 2OSRA 1RK8A 4LJMA 1X4EA 4OZ0A 2UP1A 1QVFR 1S79A 1SJ3P 1WF0A 2ZJPQ 3CPWR 1HD0A 1U1MA 3J7YU 2AD9A 1SJFA 2FHOB 3VALA 4LIRA 3BEGB 2MPUA 4CH1A 1YJWS 1SXLA 3G4SS 2CPZA 1FNXH 1VQ9S 2CQHA 3H2VE 3RW6A 2MQPA 3UD4P 1Q7YT 2X1BA 1KOOA 2MXYA 1FXLA 2RRBA 2DISA 3IWNC 3NNCA 3V4MA 4WIIA 2CPXA 1OPIA 2CPDA 2DNMA 1Q81T 2RNEA 4W90B 2G0CA 2EK1A 1R8PA 2WBRA 1S72S 1X4FA 5LSLA 2LXUA 1DHMA 1UW4A 2N3OA 4PKDB 5GAGU 3S7RA 2N3LA 4P6QA 1YJNS 3VAJA 2ERRA 3Q2TC 4IOCQ 5CXTA 2LA4A 1Q86T 2JVOA 2KHCA 3U1MA 4PR6A 3H2UB 2LECA 2MJUA 3CTRA 3ZZYA 2MKCA 1YI2S 3IRWP 3CCQS 1N54B 2DH7A 5HL7Q 2QA4S 1DBDA 1D8ZA 3NNHA 2CQ1A 1UP1A 1VQKS 2XS2A 4V19X 5BJRA 5LJ5Y 2F9JA 2E5IA 1YITS 1X5SA 2DNRA 2A3JA 3G71S 3LPYA 4ZKAA 5MLCV 1JJ2R 2KI2A 2NLWA 4FXWA 1OWXA 2MZ1A 1U1OA 3RW7A 2RQ4A 2RQCA 2HVZA 2KG0A 3R1LA 5DDQC 1M90T 1WF1A 3VAMA 2FC9A 2RS2A 2GHPA 1H6KX 1QM9A 5CYJA 1OIAA 3MI7X 1CVJA 2OTJS 2D3OR 2MKJA 3S8SA 4RU2A 2XB2D 2G1DA 1NO8A 3SDEA 2KU7A 1PGZA 3K0JA 2CQGA 1KQSR 2PEHA 5IM0B 3G9CA 2HYIB 2CQCA 3SMZA 1G2EA 2CPFA 4PRFA 3VAIA 2MYFA 2DIVA 3CCLS 2X1GA 4IO9Q 2FY1A 3CCSS 2YWKA 3G8SA 3N9UC 2KXNB 1VQ8S 3G6ES 2MGZB 1VQ4S 3R1HA 2CQPA 2DNLA 2X1AA 2DNGA 2YTCA 1WHYA 4TU7A 2CPJA 2BOPA 3P49B 1KOHA 2DK2A 3UCGA 2ZJRQ 2J8AA 2YKAA 2VOPA 2LEBA 3CMES 2E44A 2QFJA 1YTYA 1X4DA 1YHQS 2KM8C 2KN4A 1JMTA 3OW2R 4QU6A 2AYEA 5GADU 1WG5A 3MOJB 1FO1A 2CQ2A 1WEYA 1WWHA 1HD1A 2KT5A 2M0GB 4C0OC 2KH9A 1VQMS 1VBYA 4WCEQ 1YIJS 1R8HA 1U1LA 3CF5Q 1NU4A 2CPHA 2EK6A 1K9MT 4FXVA 3VAHA 3NS5A 1JJHA 5CA5A 2XS7A 3TYTA 1ZZNA 3P5TL 5DDOC 1M1KT 1WHVA 1WF2A 2M2BA 2M52A 3G96A 4YUDA 5JVHQ 2MB0B 1URNA 1P27B 2CQIA 2E5JA 3US5A 2MQOA 4WFAQ 3R27A 2M7SA 2XSFA 3UCUP 1M5OC 2RUGA 1M5VC 2AYBA 2MQNA 3NNAA 5DDRC 3BO4A 3THTA 1X0FA 1VQ6S 2RRAA 1FJ7A 1N52B 2FPHX 3JB9k 3CC2S
chains in the Genus database with same CATH superfamily
1SV5A 3PNIA 4WTYA 2GVDA 2FHMA 3LH2S 1D9AA 4A48A 1G4CA 2EVZA 4LMZA 1HBUB 5D0EA 2JLGA 2G2ZA 3KKFA 3GB0A 4LSNA 5I42B 2DVIA 1Q8LA 2OEKA 2MZJA 1ZAVA 2ACMA 4DCOB 4DV6F 1QJHA 1W26A 4ILRA 3RUBL 5LXRA 3JXOA 4B3MJ 1LW2B 4I7FB 3FC9A 2VG5A 1RYSA 1RWXB 4ANEA 4PQUB 1BQMA 1S6UA 2ZVSA 2ZJQQ 3I32A 3HVTA 4LFBJ 2ALYB 3LP0A 4UQTA 3W5XA 3KUHA 3L7PA 3D67A 4LFAF 2ZHAA 2JX2A 2RS8A 1UWAA 4L6V3 3B4DA 4J90A 3QJLA 3IR5B 3TZWA 5B0AA 4CLKA 4ZHRA 3CCES 3VAKA 1H38A 5AT1B 1HNXJ 1EP4A 3X3UA 2VJUA 3UE2A 2OPQA 2J6UA 3AODA 4JI7J 3LWLA 2J0SD 1TL3A 1RI7A 3OFGA 1RHJB 4DR4J 1S9GB 5CQGA 4KGMA 4C98A 3GIMA 3JSMA 1NXIA 1VR6A 4ZCLA 4PEOA 4B17A 1HNVA 1SUQB 4DSLA 1CSJA 1KFDA 3ZO7A 1LWCB 1PJ6A 1QAIA 2LP4A 1TK0A 5CCLA 4CT8A 3ZZZA 4GO7X 1LWEB 3EVMA 1B3TA 1Z4UA 4USWA 3MTJA 4QCLA 2W2PP 1U0HB 1WNEA 2EFOA 3AJ2A 3KK2A 1N88A 2VZ9A 3CT9A 2BE9B 2UXDJ 4Y00A 3AOCA 3D6MB 3OXFA 3GWCA 5L9NA 2J9EA 3JQMA 1UVKA 2PD1A 4F67A 4ZVGA 4ZLNA 1IM6A 1BXNA 2QMUB 2FVQA 3GYXB 3OPKA 4ID8A 4B08A 1KRPA 3OBIA 3QGHA 4I6AA 1WHXA 4R8UB 5LMNJ 2IVMA 3GP9A 1TVRA 4KHMA 4UY85 2VV5A 4PG5A 2X1FA 1IBKJ 2GHWA 2V8GA 1PBAA 2GO9A 2QA4G 2F1FA 1HR0F 2OFGX 3FCWA 1H0HB 3MR7A 2HRYA 4IG0B 4ITSA 2Z30B 2R7RA 3R5BA 4GKJJ 3AT1B 2HK3A 4XIUA 1RUSA 5DLGA 2E5HA 2B7BB 4DR7J 2F4VJ 4DR1F 2DGQA 2MGZA 2XY7A 5B0EA 3FRZA 2C22A 3OTBA 4NLGA 3ZZRA 3ITHA 2XSJB 3G6VA 3OSNA 1TK5A 1T9YA 4NX9A 2V4JB 2XMMA 2A2DA 4IFYB 4DV5J 4AD6A 2LDYA 4FVMA 1ZS6A 4N5SA 5KFXA 2XSJA 2DNYA 4P75A 3V6JA 4KO0B 1EX8A 2VASA 2VBYA 4HTJA 4Q0BB 2DIUA 3VV2B 5A8WB 4WKYA 2B6AB 2XMTA 3H20A 1X5TA 2HNYA 1R7IA 2HG4A 3CDWA 3AB2B 2OMOA 3BGUA 4RW9B 4F4WA 1HYSB 4BS2A 1M0SA 1FJCA 2ATCB 5HROB 2N7YA 4HI2A 1JX4A 1OO0B 2HQGA 3G2XA 4ZVRB 2QT7A 2CUYA 1TV6A 5E33A 1U2FA 2EEYA 3LPEA 4TY9A 2ILYA 3DLBA 1NHKL 4RJVA 2VKZG 1HMVB 1FTRA 1R8AA 1SV5B 1VBKA 2KYZA 4PXDA 4URSA 4A8YA 1VBZA 1RT5A 1S1WA 2EG2A 2IVYA 4WYLA 3L7UA 5F8MA 1SQEA 3J7ZT 3RR8A 3HHLD 3LP1A 2VBZA 3M6WA 2RMLA 2AT1B 4F2RA 4OZ5A 3NAIA 4C8ZA 1KLMB 3JSYA 4CYUA 4G1IA 3M8SA 1NB7A 2L3MA 4NCBA 5KT5A 2R7WA 5C42A 4JYAJ 3D0GE 5I3PA 3TJAA 2C2OB 3CD5A 2WOMA 3DHWC 2HQCA 2E7WA 2LFVA 3DDNA 2GAHC 1NHVA 2UU9F 2WVCA 3AQOA 3H8YA 4NLVA 3CULA 2BE2A 2CQDA 5EWEA 1NK7A 1SJ4P 8RUCA 1BGXT 4BBYA 4ED6A 4X4PA 4KHRA 1JJ4A 4OX9F 4E8UA 2WB4A 1SKRA 1EP4B 5KFYA 4CQ1A 1C0TB 1HWJA 1FT8A 1WC5A 3GV8B 2W2MP 4QQBA 4ED8A 2HLUA 1NPPA 1S6OA 2OKQA 2FLOA 3M4XA 3ZXWA 2V8VA 1Q8KA 2MKYA 1TUVA 3J7YI 4M95A 3CJ8A 4DR5F 5HLFA 2HWIA 3V6KA 3KK1A 1X4GA 4DF4A 2M9KA 4ED5A 2DNOA 1Y3JA 2OEMA 2K3KA 3IP0A 2VC0A 5AXNA 1BD6A 4Y6IA 5FDLA 1R0BG 2ZH3A 2KZMA 4NXNF 4LVNP 2HS3A 3K7RA 4ID5B 1Q7LB 2BE7D 2LCWA 4USKA 4NLTA 2ZZMA 5L8RC 3VZHA 2M5YA 2EFNA 2VFTA 4KPCA 1X4AA 4JI6J 2W2NP 1VYAA 3EDRB 4ZPDA 2DRBA 2JFDA 5LJ3Y 1HW8A 5AXLA 3CB4A 4KBIA 1ZA2B 1FD2A 4X65F 4QWCA 2DCUB 2QL9B 2CJYB 3FSXA 3GONA 4QR0A 4USIA 4KHPJ 4NLOA 4RZRA 2G4BA 2GZOA 4GKKF 2QL7B 3OXGA 2O01C 4RX6A 1RA6A 2HEKA 2R7XA 4JBCA 4ZVSB 2EKYA 2YH1A 2ZKUA 2DNKA 3MM5A 1ZM9A 3CD6S 2O1PA 1VCTA 2OPRA 1NJXA 3HHLC 5B0CA 1JLGA 2QN6B 5D4LA 1JLEB 2LKZA 3M8QA 3UR0A 2VUGA 5J2QA 2IBKA 4RU9A 4TYBA 3W2WB 3D5MA 2BACA 2V2ZA 2ZWOA 5HATA 3UNYA 4DBQA 2R2RA 3TARA 3OR1A 5FJ4A 1FKOB 2BUNA 2UU9J 2R7OA 3K5NA 2KDOA 1A6LA 2QG9B 3RAMA 2W4DA 5E3PA 3W2WA 1HWKA 1OY9A 4OLOA 2NPFA 4WFBQ 2HFZA 3AFGA 3L95X 5D8HB 1UCNA 3J81U 1PC5A 2OPPB 4MKAA 1JNZB 1N5QA 1QDUB 2KJVA 2ADBA 1GEHA 1HBNB 4FPIA 1REGX 2CVIA 2HZAA 3OL8A 5KG2A 1NHUA 4KKOB 5FLXU 1FE0A 4LR8A 2FYXA 2LEAA 5DLFA 4TXSA 2E5LF 1S1VB 1B70B 1CULA 2RHQB 4ES3A 1ZM2A 1ZAWA 2FVCA 3NOGA 4DL3A 3QO9A 1KHWA 3Q2SC 5AJ3F 2NCKL 3N4WA 4CDIA 2COLA 2EKNA 2OPQB 2HZCA 4OV1A 1QAYA 2CNNB 4WU3A 3TEGA 1LWXA 4OIXA 3AD7C 4RUAA 4B9UA 1DZ5A 3MM9A 4PXCA 5DS7A 4WKRA 1L3KA 1CS4A 2DHHA 3M2RB 1CQNA 1R0CB 1GFWB 2XY6A 3F0NA 2HIQA 3C14A 3H5SA 4X66J 3M6VA 4DI6A 5HMWA 1X9SA 2K8GA 3LAKA 3EGZA 5CYMB 3ULHA 5KT2A 1O0PA 4KQZA 3P6YC 3DHXA 1G3OA 1WI8A 2GFFA 3DGPA 3VF0B 4IYQA 5LSOA 5SZTA 2N4DA 2IYIA 3HXMA 4K4YA 4LQ3A 1HQEB 1D09B 2ATLA 1HNIB 2YKMA 4JI0F 1RXOB 1Q95G 3KLVA 4P72A 2WVEA 4WU2A 1UZHA 3HT3A 4IOBA 4ZITA 3MM8B 3HVRA 2UZAA 2XHCA 1K44A 2EFVA 3W1YC 1S6PA 5HBMA 4LBIA 3DXBA 1L3TA 4I2PA 4DPYA 3IGVA 3CDAA 3I55S 2ADCA 5CYQB 3BSAA 1E6VB 2WCXA 5IWAJ 2D41A 3A3PB 4OYZA 1D9FA 2AGPA 3FBCA 3QSYB 1YJRA 8AT1B 2V9WA 3K17A 4ZS6A 4ECRA 1TKXA 4IOAQ 2DY1A 3C16B 3RAXA 1HFEL 2Y3YA 5IM0A 2KB2A 3C6TB 2HMIB 3OHAA 5GVQA 2DGOA 4DUZF 1B4SA 3TQEA 2UP1A 3RRGA 4CO3A 2XBPA 5L38A 3K8WA 4A8XA 4O23A 4LF4F 1WF0A 2ZJPQ 5FIIA 3CPWR 1FRIA 4C8YA 4CH7A 4CZCA 3J7YU 3PY8A 4RR5A 2C2RA 1SJFA 3JQJA 1YRXA 3BEGB 5KFEA 4CH1A 1SXLA 1Z1ZA 1TKZA 3G4SS 1K1SA 1NJWA 3ZFVA 1XR5A 3DRSA 5KFSA 1Q7YT 3MEGA 1KOOA 4IH7A 4ZVQB 1AB8A 3PTWA 2MXYA 2VFVA 1FXLA 2BMBA 1B0VA 3KTQA 1K47A 3IWNC 4WTOB 5KOWA 1Z2ZA 2DR6A 2FHJA 1HNIA 4ZPWR 3FMBA 2OPRB 3NNCA 1HYSA 2BJ7A 1RAAB 2CPXA 4XAKA 3I4PA 4HT7A 1V5IB 2ZE2B 3A12A 4OYOA 3R2DJ 2NQPA 2EK1A 3ILIA 4PYAA 2ZM6F 3GMGA 4WJBA 4CWBA 2GIQA 3DC2A 3NLCA 2VA3A 1R8PA 3KUEA 3HD1A 4NXMJ 4C3KA 1T8EA 4LFAJ 2D69A 2KFZA 4ENOA 4TY8B 2IJRA 1TL7B 2Q6BA 4PKDB 5F8LA 3MCSA 2XQCA 2GX8A 4DV4F 4JI1J 4P2SA 2N3LA 4P6QA 3S7RA 3NGTA 5IT4A 3CJ2A 1HPZB 3KLEB 2ASLA 1HLWA 3QO9B 4AT1B 1N0VC 2LA4A 3W64A 1CQMA 1OY6A 2KHCA 1FESA 1FFGB 3GJTB 4FYWB 4IG0A 4PYDA 4C11A 5E41A 3H4BA 2WVBA 3H2UB 2MHEA 1RAEB 2VPWB 1U02A 3W60A 1KQGB 3NGSA 3IRWP 3CCQS 2W4PA 3BJYA 2RU9A 4CNZA 5HL7Q 3H4DA 1D8ZA 3KG0A 4U8VA 3GFZA 4DSFA 1XMQJ 3M30B 4NEZA 4BLGA 3WX4A 4XPEA 1VQKS 4H4OB 4GC7A 3R6LB 2HHPA 4NA1A 3DM2B 3K5LA 1R6YA 3KDOA 1ICEB 3WDOA 2AEMA 2PMWA 4J37A 3CJSA 2HPUA 1HW9A 3CIMA 2L9DA 1TELA 3GTYX 1AUSL 3BO4A 1VRUA 4QIVA 1FRHA 4J9NA 1JJ2R 5CHCB 1JLBB 4FXWA 2CJAA 3AXKA 2YNFA 4IQXA 3T19A 4P52A 2MZ1A 3C19A 1IR2A 2FHKA 2HFOA 1ZAXA 1I1GA 3MM5B 2AP6A 3MTKA 5GMEA 4QW8A 2RQCA 4GKJF 4IO1A 4MK8A 1LK5A 3VVTA 1KS2A 4OHZA 5G0RB 1M90T 2QSFA 2FC9A 3HULA 4L76A 2GHPA 1H6KX 3AD8C 4LREA 1S1UA 1JLQA 2BW2A 3MM7B 2ASJA 4OX8A 3EICA 3GU0A 1E6VA 2VF3A 2Z2YB 3C15A 1IKYA 1MW7A 1U2CA 5K14A 2R8IA 4A4JA 2QMXA 1KTVA 2CJXB 4RBUA 4IQMA 2FY8A 3KLFA 2EWHA 1NO8A 3OJSA 1ZPWX 2KU7A 1Q16B 3BGOP 3DKDA 1WC6A 4C6AA 4ZMMA 3LO3A 1KQSR 3J80Y 2YKPA 1TFYA 4Y28C 4DV4J 1RT4A 4LF2A 3G9CA 1FX2A 1KDNA 1T9WA 2HBQB 3M6XA 3IRXB 2X3GA 4RW9A 2CRLA 1N6QA 2BJ1A 3O3LA 7AT1B 2CQCA 3CWJA 1AFJA 5IC6B 2CPFA 4OI1A 3SV4A 1F3VA 3C3LA 4B3OB 4PRFA 5D0HA 2I5JA 1E6YB 3DGVA 3H40A 3VAIA 1NCLA 3HSJA 1KWMA 5IS2A 3SV3A 3CCLS 3OLAA 4IO9Q 2KHDA 4BWJA 4IDKA 3ZZ0A 1SIZA 3WC2A 1OYEA 4WXWA 3MM9B 3IFEA 3IAM9 3KJFB 4I68A 4U95A 1VQ8S 1NUEA 3QIPB 1UVNA 3QGPA 3FKBA 4O4GB 3GIIA 3RBDA 1PYSB 4RNNA 4CLZA 3TANA 3PW2A 1N32F 3R1HA 5HJYA 4DR3J 1CJKA 3W61A 3H0PA 4FPRA 4KJIA 2NYHA 4U8YA 4EBEA 2FLPA 1T3OA 2YX7A 2NXJA 4CM2A 2BOPA 2DK2A 2JEIA 4EO6A 1LQ9A 2J8AA 2BQ3A 2VA2A 2VOPA 2F63A 1SBRA 2LEBA 4LSZB 4Q2LA 5C2GA 4AXIA 4DZDA 3CMES 5AXMA 1YTYA 3W3SA 2BJ8A 3PW5A 1YHQS 2YPZA 2KM8C 3K2YA 4P73A 1JMTA 3QZ8A 4Z7YA 4DR5J 2CNKB 2VG7A 4WXOA 1FFWB 2BXJA 2LVWA 3HHEA 1FO1A 1O6XA 1LWEA 4DG1B 4RKUC 4FZVA 2AGOA 4K59A 1WWHA 1FWPA 4DR2J 4HH0A 1S6QB 2OI2A 4MFBA 4F04B 2KH9A 1VBYA 1HR0J 4B9TA 1NZAA 2VDIA 1DY3A 2AU0A 1YIJS 1YJNS 3KOAA 1UJ4A 2ZDPA 1X9MA 2XMWA 4JV2A 2B6AA 3M8PB 1MMDA 1NU4A 2ASYA 1U1LA 2NSBA 3DNCA 3Q83A 2C2MB 3V5RA 1JNRB 4JI6F 3I9V9 4KO0A 1HHSA 4USTA 4J9MA 1S1XB 4LF6J 4MYUA 3G87A 1SC4B 2V0NA 3TJ9A 1C4AA 1FNMA 2AHOB 2B51A 4I2QB 3IBCB 4TN2A 4ED0A 3PW0A 2PDAA 1ZZNA 5LSRA 4ED1A 4OFZA 4FF1A 4K4UA 1RTHA 2M52A 4I7FA 2PA3A 3GZ7A 4AYBD 3G96A 1N36J 1FJGJ 2Q66A 2QJ3A 2E5JA 3SCJE 1J5OB 1F5CA 2IA0A 4MTPA 2DR9A 3TUPA 3WBZA 4DR4F 1JLCB 4DQQA 5IT9Y 1I94F 1EQMA 1TL1A 1JLFB 4ZCKA 3UCUP 2UXBF 1F5AA 1H98A 1S7IA 1U24A 1WKJA 2A10A 3AAWB 4HI1A 1Y00A 4RNOA 2XGPA 4F4YA 1SQGA 4U6PA 3E3XA 2CZVC 1S49A 3IMQJ 5JUMA 4J9LA 1RT3B 3OTDA 3B6BA 4FDFA 3OVAA 3I9ZA 3ENVA 3B78A 2CZ4A 3MECB 4KE5A 3PYEA 3W66A 2RRAA 1N52B 1SJ1A 3D3CJ 2CG4A 2UUTA 2ZKTA 5GAEI 3CC2S 4C8MA 2FJVA 3HSDA 4KV8B 1YJVA 1Q53A 2E1MC 2JL9A 3U7JA 3GIJA 1ITPA 1KKHA 5DZ6A 2BJEA 2Y1LB 4R0JA 3BREA 1XERA 5C24A 3SEOA 2UUCJ 1C0TA 3FQKA 3DLHA 1NEEA 1WEXA 1I3OB 1UPPA 4OZ2A 3SCKE 3SFGA 2MZTA 1TL5A 1CEZA 4WZMA 1S57A 3IO1A 4WWSA 4UW2A 1VDHA 2Z2ZA 3S6EA 3BR8A 3CD7A 3SSQA 2EFQA 1MU2A 2YNGA 2KL8A 3DU6A 1EAYC 1UMJA 1JXVA 4H4KC 1HNZF 1RWWB 3GYNA 3UO0A 3AA8A 1C2PA 2D3ZA 2M4MA 4K2JA 5D77A 2HWHA 2SXLA 5F0UA 3W9HA 3SXLA 3W9JA 1ZZFA 4C9DA 1S76D 4GMKA 3GIRA 1RQ0A 4UOFA 4O44A 2JNJA 3T6JA 3AQPA 5T14A 2YWEA 3HI9A 4LR9A 4URQU 2ZD1B 5DO2A 3KK3A 2FLLA 4CCHA 1MROB 1M5KC 2ACYA 2LQ8A 2Y0SD 2FDNA 5J2MA 3M2VB 1LWFA 2DYAA 4XDCA 5EWGA 1R31A 4TVAB 3AJ1A 4LRAA 3SQGA 1ZYQA 5KFRA 1YX2A 4C2MA 2YNHA 4ZP8A 5HQMA 1N33F 1RHKB 3PCOB 5I3UB 5JVGQ 2A6OA 2I2YA 2YWGA 1YBUA 1X0PA 2JVRA 4X84A 4CT9A 1UEUA 3TO8A 4BCAA 1G1XA 2MLXA 4UT4A 4AL7A 2JEFA 5B0BA 2GC8A 4F0HA 1DQ9A 3QLHA 2V94A 5HQ8A 2DO4A 1HHTP 2X7IA 1HL6A 4BWMA 3DDIA 3SFUA 1UVLA 1EKSA 1RLCL 1WG1A 3O1LA 5IZHA 4J9PA 1RE1B 1QVGR 3CJ5A 4RUHA 2H5JB 2LU1A 4JI0J 3ITHB 3M32A 3D54A 3A13A 2ROPA 3KK3B 3M8RA 2M8HA 4QYRA 4ZN1A 4Z7CA 1HNXF 2QGFB 2C2ZB 1GXUA 1QAJA 4TLRA 3HO1A 4I64A 3OFHA 3L9ZA 2FJDB 1S1TB 3D28A 5DGBA 4LF8F 2XO6A 3B82A 5M2RA 3SZ2A 2PA8D 4IG3B 2FD2A 3JSBA 4DHVA 2FVSA 2E9RX 1F9FA 2JH3A 1LW0A 2M70A 1N34J 1X5PA 2XYHB 3F44A 3FMWA 3IM8A 3TA1A 4OLPA 4ZLPA 1QTNB 3NP5A 3M05A 3OQ2A 1IR1A 4NLQA 3NRBA 2OH2A 2QYCA 2MMYA 2RKIA 2ZH2A 1M5PC 3R2CJ 4FS2A 4QPTA 4ETXA 4OZ1A 2HHUA 3MD1A 2DGXA 4MKYA 1M5HA 3P4UB 1X4BA 2EPIA 2MQ8A 3PIOQ 4O3NA 2B4OA 5EWFA 2LMIA 2XCAA 2DH9A 3MEEB 1SJRA 2B5JB 1C4CA 2PT0A 3NY0A 1WKKA 2LXIA 1LWCA 1DLOB 3LA0A 3NGDA 2KKHA 3HVAA 3CMAS 4DUTA 1HWUA 3L09A 3RBXA 3KFWX 3QLHB 2P6TA 7FDRA 1PJ5A 3M9OB 3JSMB 1FKAF 4NXNJ 1AT1B 1G6BA 3FK4A 3C6UB 2B4UA 3PKYA 2CWKA 4OJ1A 4WYWA 3UDCA 2HNZB 3U1LA 4I4BA 1KVIA 4YFUA 1RAIB 4PUOB 4CLWA 4NL5A 3TNVA 2XMUA 4K8RA 3BKUA 2B8QA 1IKXB 4FBUA 1GMUA 2HVHA 4DV5F 4XDDA 5CD4A 4X4RA 3MURP 1P8GA 3BBFA 5LMUF 4PQUA 3BN7A 3UNGC 4DV3F 2WK4A 4N77A 1SCJB 1SKSA 1KTQA 4C8KA 1RWNB 4A8SA 1S1UB 3UDEA 1U1KA 2IMWP 3HHNB 3DLLQ 3K89A 1PJ7A 2AIRB 2HBRB 2QZ8A 3EM1A 1PILA 5IV3A 2CPYA 4A8WA 4KGXB 5CD4H 1IBLF 3R5CA 1S97A 1SI9A 2C2NA 2Y1IA 1SC1B 3BGRB 4Q7AA 2YQ3A 3VR1A 2W7PA 2C1EB 2FJWA 4Y2KA 1WTBA 4HVZA 4PUOA 4EK2A 4YB5A 4ECZA 2DGSA 1NM2A 1U1RA 5F8IA 1WDTA 3PRBA 1T3NA 3IG1A 4YS2A 2YWFA 1D3WA 1GTHA 2J0QD 5EGYA 1SC3B 3IR6B 4PPZA 1WKLA 2VBXA 3BYRA 4AUKA 1DTTA 2F40A 5DG9A 5A76A 4I6YA 4N8NA 4UY8T 2YWWA 4K4XA 4B02A 4OJHA 4G1QA 4S0MA 4X4QA 4PG4A 2U1AA 3I0SB 3WIUA 4ED2A 4W92B 3TUIC 5D4OA 3ZNUA 1M1HA 2QMWA 4NMLA 5HVFA 2BJDA 4X4UA 2BEFA 1FRKA 3POTA 2P8IA 4NZ0A 3IA0A 2Z2MA 1FRXA 5ADZA 2GQCA 3HKZD 4JI2F 2QE5A 5M2UA 2R8GA 4DSJA 1VQ6S 2QA1A 3P5BP 3AY0A 3X1LB 2ZOFA 3NMAA 2YQ1A 5CAAA 2XHWA 2R7TA 3QFHA 4ALZA 4QU7A 4NE9C 5DQIA 1JJCB 2MQLA 1LXJA 3E01B 1X9WA 1IJFB 2DNNA 3I56S 3TVKA 2VBWA 4RLEA 2JEJA 4ERDA 4JUZA 3PW4A 1N8RT 1OYDA 3QNWB 4EFAC 2MEWA 4L3KA 2GJ2A 2XM3A 3T1HJ 4WP8A 3KLEA 2BANB 3TQ1A 2JJ4D 2VIHA 5A2QY 3CIZA 2E66A 3ISND 4O4GA 4ZP9A 4OZNA 5B0FA 1J5EJ 1Q8IA 2OO4A 3FEYB 2MKSA 4O0IA 5KFLA 5KFIA 4F36A 4DV6J 2VB6A 2IY5B 5E3CA 4F4XA 1ZTTA 4CNYA 3G8TA 4IFVB 3CJKB 2XWYA 4PPDA 2GCFA 1WACA 2HGLA 2I5JB 3H5XA 1WSRA 3T5HA 3J7A1 1S7HA 4LT6A 2MZSA 2C42A 4Y3CA 3SCLE 4RPFA 2ZM6J 2VODA 2UVUA 1I94J 1IBLJ 1RTDB 4YY3F 4C8LA 1QTMA 2FQQB 1WHWA 1SJQA 3FQLA 1MLAA 3UN3A 3QSIA 2HBYB 3D0HE 2UXCJ 4PWUA 2HQDA 2MY8A 3EGVA 3SYZA 1T95A 4DG1A 1IBMJ 1IWGA 5A6WA 3SQGB 4RNHA 4HHHA 4DR3F 3RB6A 1KSPA 4XTTA 1KN6A 4KGVB 1SL1A 2LQ9A 1ZH5A 4JI8J 2ZD1A 4DQPA 2AW0A 1LXNA 1KVJA 3TZYA 3VAGA 4ZCIA 2OTLS 4ELVA 3MHYA 2H48B 3AD9C 2RDDA 3LAMA 3PHTA 5ITHA 4DWIA 1SPBP 9RUBA 3U27A 3W5ZA 1FXRA 3M9MB 2FTRA 5HP1A 4ZPTR 1JXLA 3FEXB 5G0RA 4UQGA 3H90A 3O2IA 1S9EB 2GA7A 3BR9A 1TMMA 2CFXA 4NYZA 4Q43A 3FBFA 5KG6A 2ZHBA 3C16A 1YJTA 3N79A 1RTIB 2H5IB 5SUHA 1SC6A 1N5SA 4RWXA 2E5GA 4ECUA 1VQLS 1JLBA 3UR3C 2OD4A 3D2WA 4O3SA 2R2UA 3IWXA 4YOEA 1WG4A 4HLBA 1AZSB 1Z2LA 3IG1B 5GMKa 1JXEA 1WI6A 1N5VA 3KDNA 4P2XA 2MZRA 4WP3A 3FEZA 4DPOA 2ZC4A 3NGKA 3TUZC 4ZVUB 3MM8A 4DSEA 1A9NB 5DG8A 2HHVA 1NKBA 3DOKB 3CCVS 1RWMB 5IFMA 1DTQB 2QX0A 2CJBA 3UPFA 1J5EF 3MAAB 1VC0A 4K0KF 1D0EA 5F41A 5L39A 3BSCA 2CQBA 2HWTA 2J9DE 2PMHA 3TAMA 2VDHA 2YH0A 3MECA 4A8FA 4NXMF 4KFBA 2AF6A 3OV7A 2CWXA 2D74B 4PCQA 4DF8A 2HNDA 2I38A 1JLFA 3G86A 1LFWA 3G6XA 3PACA 4RW6A 4USUA 3S01A 1IKWB 2K1RB 5AXKA 5AJ3J 1TZ0A 4Y34A 5IT9U 1ACMB 3R5JB 4LRCA 2HS0A 4DMZA 2J7KA 2NXUA 1T9TA 1JKHA 2RF2A 3A3OB 1H74A 1V6HA 3MEDB 2XGQA 1UA1A 2CIMA 3TAMB 1YJWS 3VALA 4LIRA 1VQ9S 4I2QA 4YN3B 4WZQA 2I8EA 3H5YA 3FRYA 5KFWA 1DTQA 1UJ5A 2BQUA 2B5JA 2MQPA 1FJGF 3IR7B 3UD4P 4P74A 3MPUB 2ZE2A 3RAQA 1T11A 2RRBA 3OT9A 4M8LA 1HBOB 1HBNA 1Y3KA 2DISA 2AWZA 2XZWA 3MZIA 3V4IA 1OQ6A 4LF8J 2C2DA 1RACB 3ET6B 1AZSA 4YMEA 2A18A 3ZNJ1 2D1CA 2FJAB 2CAJA 3TX8A 2BANA 3T1YJ 1UA0A 4X62J 1OPIA 2L48A 2Q43A 2QLFB 1NSQA 1S10A 1Q81T 3J7AN 2V2QA 1K0TA 4W90B 3PJ9A 3EVWA 4CLTA 2HHSA 3NKYA 4DQSA 5IWAF 1CPZA 1MNEA 4KAIA 2N3OA 5KFPA 3V6DA 2ZBCA 3W2VB 1JLGB 4WK1A 1RZMA 1C1CA 1C1CB 1VRTA 6FD1A 2N4CA 3D4JA 4UUXA 1Q0NA 3DCAA 3QPIA 3VAJA 4Y2AA 2ERRA 2HRTA 2RHSB 4IOCQ 2K2PA 1IN0A 4O3OA 3HFKA 3OL9A 1BUXA 3DRRA 3LP2A 1KR4A 3QAUA 1TKXB 3TEHB 5LMNF 3R3TA 1BWEA 1MN9A 3EMTA 2XZDB 2MJUA 1T03A 3ZZYA 3WHIA 1AA1B 4JI3J 1JIHA 2F7VA 2QV6A 4U9RA 5K5MA 1RAJA 5D4NA 1N33J 2HVIA 2CQ1A 1NSAA 3W65A 1UP1A 1KVKA 3QIPA 4IRCA 1S0OA 3RW6A 3HKWA 3N0VA 3UI3A 1RU1A 3PRDA 3KYLA 1HKAA 2DD8S 4QIGA 5LJ5Y 3R5DA 2E5IA 3M8PA 2VFUA 3BGRA 4HDGA 4FYDA 4IFVA 4NZ6A 1X5SA 2KVQE 2M3DA 2VG6A 3CJKA 5KFTA 4K5RA 5HQLA 4DL6A 4DV1F 4DL5A 3VTIA 4K4ZA 1HQEA 4LBPA 3LPYA 1U48A 4ZKAA 4F0KA 2AZ1A 4X64F 2PIIA 1YJUA 3BQ2A 1OQ3A 1JKHB 4Q8FA 2VPXB 2AEJA 2WZ1A 2XYPB 5DRKA 2EFPA 4P71A 4PWWA 2NYIA 1RT4B 4USMA 3SSSA 3GYGA 4KY3A 1HQ2A 3BGFA 3RW7A 4AQYJ 4K4VA 2AJFE 1IKWA 1PIEA 2LLZA 3PJWA 1WSVA 4Q44A 4DLEA 3R1LA 3CCTA 3D66A 4EI2A 1MSWD 1RABB 3VAMA 5K20B 2ABYA 1KBRA 4QJVA 1PG5B 4ZPCA 5K14B 2XYGB 1QM9A 1XMOF 2LEPA 4NLDA 1FF2A 3Q8SB 2OTJS 1FDAA 2DR7A 2OPSA 2Z56B 2J0WA 5B09A 5KFDA 2YX4A 2YPYA 1UEKA 4KKOA 2NREA 3ZTPA 3GFHA 2J7WA 1EARA 4OI6A 4B3TJ 4UTGA 5IM0B 3W8GA 3R97A 2RUSA 1DAXA 1UVJA 3RBZA 1VI7A 2IM2A 3TA2A 2JOQA 3GV5B 3RR7A 2ZH8A 3EVOA 1I51B 5KFOA 1UPMB 2ZFHA 2VQEF 1SL0A 3QRPA 2V63A 5KFCA 2IJNA 1FI4A 2E5LJ 3CCWA 1RTZA 5HMZA 2MYFA 3EJMA 1VMBA 1ZBTA 2X1GA 1OMSA 3EXCX 3F41A 4MK7A 3VQSA 5LOQA 3A1YG 1R0AB 5CZVA 1KQKA 3MR5A 1L3VA 2YWKA 4DX7A 2W9CA 2PI4A 4NRTA 1TL1B 2WAQD 4Q5VA 1FERA 3KLIA 1DFDA 3HHKA 1WTFA 5K9FA 1YQHA 5KG5A 1N5TA 3ADAC 1VQ4S 1ZM3A 3D0IE 5A6PA 2ZBIA 1GNKA 1RDRA 1SIWB 1U8SA 1RBAA 2DNLA 2HLTA 3M6UA 5CYMA 3PYDA 1Y5NB 1VHIA 1EJ7L 2NXNA 2RB7A 2V67A 1V3SA 2GQQA 3AOBA 5AE1A 2CPJA 4DU7A 4DV0F 4DLGA 3UCGA 1IKXA 1WOSA 2GQ2A 3MEKA 2OUGA 4LIWA 4PXEA 3RG6A 2YKAA 2DR8A 1S1XA 3M7VA 2Z2LA 2GJIA 1XC9A 3LOUA 2W9AA 4K7QA 3VGTA 2E44A 4HR2A 1QUVA 1UZDA 1X4DA 2RD5C 4TY8A 1D8YA 2V4RA 1S0VA 4B3RJ 2G0IA 3M2UA 3GV7B 4OYXA 2A2CA 2E1CA 3KHLA 4ELUA 3OW2R 4E98A 4QU6A 4JI5F 5B0GA 4LFCJ 2YKNA 1WG5A 3N6MA 3TRGA 3TW0A 4A8OA 4L75A 5KT3A 4KSEB 2CQ2A 1A0OB 1TUGB 2RRNA 4KYZA 1WEYA 3DOMA 3RYLA 4CP5A 5GAHI 3I96A 4YB1P 1UJ6A 5E3QA 4EZ6A 2EC2A 3KJVB 3HZEA 4OI0A 2F5GA 4DR6F 3GJQB 4GKKJ 2IRXA 2V2VA 1GMVA 4HACB 4CM0A 4F3MA 2UUCF 1NKEA 4TQRA 1URNA 4AL5A 1YKWA 2H4WB 3DRSB 2YY3A 1R89A 2GGPB 2DEJA 4KGKA 2DKOB 1B7YB 1WC1A 4X62F 3HT0A 4BC7A 5J2PA 4M5KA 5DDOC 4IR1A 1CJVA 1J27A 1S1TA 1CJKB 1WF2A 1VQSA 2BV3A 3G8QA 4CTAA 4YR2A 3WZ0A 5B0DA 1P27B 2FZGB 4F4AA 3E51A 4WFAQ 3DXSX 1IUJA 1IM4A 1TL3B 3GCWP 4PXBA 4KT0C 4C0BA 2XSFA 4M5JA 1M5VC 4FF3A 1H73A 4ZHRB 2BABA 2MQNA 4JI2J 2GMJA 3E8OA 4FYYB 5DDRC 2ZH9A 1C1BB 4NPOA 3NEKA 1QAXA 3D1HA 1T9VA 2D7SA 2I1RA 1FJ7A 2FPHX 4NLUA 2V8PA 4NLYA 2RILA 4ILLA 2JDJA 4HDHA 4F4KA 2RU3A 2HFUA 3TWZA 1S6PB 1RHRB 4Y2CA 5HBMB 4F02A 3V81A 2DB1A 2PGCA 1RT6B 5DDPC 4DR7F 1H2UX 3GG0A 1YWXA 2OEJA 9ATCB 4YQWA 2AZ3A 3CJ3A 3FBEA 1VQNS 1U49A 1GX6A 4LVOP 4EZ9A 2P5VA 2QLXA 3I6PA 3EXYA 3M8YA 4DPXA 1BLUA 3OLBA 4TKTA 1LWFB 3V81B 1NJIT 3P96A 5HSPA 3BF4A 3HJVA 4NOHA 4DCJB 3KK1B 1NZ8A 2O3DA 4FBTA 2EFGA 3T41A 4PWDB 5A8KA 2HW3A 1GT8A 3K59A 5LMUJ 5FD1A 3MCMA 2A0FB 4OI2A 4MKBA 4NRUA 1YVFA 4JYAF 1N36F 1Q1KA 3SCIE 5F0WA 4JI4F 4TU9A 1T05B 2VOOA 5T7LA 1RHMB 2VPZB 1RKJA 3CC4S 3UD3P 1U1NA 1RHQB 2DT9A 1IXKA 1JLAA 1RBOB 2OELA 1VIOA 5LL6d 2VQFF 3KHRA 1S77D 2ZOMA 2QIFA 3BO2A 1LK7A 2OIHA 1NDKA 3GILA 4TQSA 2C28A 2H3EB 3NBPB 4Y65A 3NCQA 4J7CA 4JI8F 2BQRA 3N6NA 5I3QA 1Q79A 2DGUA 3OVSA 1U09A 2C2KB 4WFYA 4C0HA 5DJBA 3I4HX 2DGTA 4QR2A 3JAMY 1KD1T 3PYGA 4UUWA 1HA1A 2R7UA 4FNHA 1RLDA 1QE1A 1HI1A 1ZA1B 2UUBF 4QZVB 4KV8A 5H9FK 4CRJA 4ZP6A 3UVJA 1RAFB 4IH6A 3KLGA 1SQFA 2APOA 1ZOTA 5F9NA 3W9IA 2B0GA 1AROP 2Q79A 1FKOA 1OJ4A 4X4SA 1S48A 3OR1B 1U0HA 1U25A 3T6BA 1URRA 2NZ4A 4LF4J 2G1HA 5G4DA 1CC8A 2MQQA 1NAQA 4OYBA 3ICLA 1VC5A 2NXEA 1UFKA 4RW4A 2IVFB 4ANCA 3PFOA 2PN6A 4HHJA 1FK9A 2A6MA 4G65A 4K2XA 5BR8J 2DNQA 2F9DA 2VU5A 3I5CA 1VQ5S 2ILZA 2IM1A 5H9EJ 3CXCR 4Q0BA 1GH8A 4EBDA 2LDIA 2QTWA 4J9RA 4QWBA 2K06A 1N56A 2ZHOA 4ZPAA 4IDKB 1N4LA 3BKTA 1WELA 3PX0A 1QD1A 4YP3A 4ICLB 2QRRA 3UCZP 2CJKA 2RE1A 4AQYF 2UV8G 4D3HA 4DV0J 2AGQA 2Q6CA 5GMDA 1N6QB 5KOXA 4LRFA 2WB1D 4NLSA 1RA7A 4W98A 4U96A 4C7QA 2ZH5A 4R0EA 1PAUB 3DLGA 3OR2B 2W9CB 1F9EB 2A1BA 2E7XA 2YNHB 3ENQA 4FS1A 2HBZB 2QLWA 2DEIA 1AUDA 1XIQA 3K8VA 2VG7B 5JJBA 4NASA 1NDLA 2U2FA 2V9KA 1DQAA 3M1VA 3MDFA 4R8UA 2YXLA 4HEA9 4TU8A 5U47A 2XC9A 3FUYA 2W24A 3HD2A 1W7WA 5GAEU 5GAGI 2MTLA 1JLQB 2CDQA 2P9GA 3MM7A 4K4TA 2W01A 2XLJA 1F5BA 4URGA 5THWA 3CCZA 5HN0A 5J1NA 6FDRA 3U02A 4DEZA 1RWPB 2F4FA 2VC1A 1F3FA 2MQMA 3MD3A 3O44A 3Q8VA 4DU8A 1TR0A 2UV8A 5DETA 5LT5A 2NPIA 2JC1A 2HFSA 2KYXA 4CLYA 4EEYA 4DOZA 3D9BA 1R43A 5J2NA 5D6GA 4ZLJA 2PI5A 2HGNA 4I67A 2J7UA 4M5DA 4M5DB 2L9NA 4CTAB 3QT8A 5L9XA 3R5AA 2PSZA 3HVWA 1VGYA 3QMQA 3ETMA 1T7PA 4LQ9A 4ZP7A 5K8NA 2DR5A 2AYMA 3MUVP 2CQ4A 2QL5B 3MXHP 1IKVA 1RSCA 1LV5A 2RH3A 3P45B 3O5TB 5L1KA 2G13A 1SH2A 3LP1B 3O8WA 3LP0B 3ZTQA 4C3LA 3BDEA 3Q8RB 4J9VA 1DRZA 4OHYA 4OX6A 2K3IA 1RT5B 4H4KA 5KFBA 4TNOA 1LW2A 3K5MA 3RTVA 3ENAA 1T02A 4AXJA 3GPAA 4N41A 3OTOJ 3T9NA 3W5YA 4PG7A 3VGVA 3T5LA 1RT3A 5C25A 3R7NB 4IRDA 4B3RF 4FVCA 4QYZJ 4LSNB 2GVZB 2BZ2A 1R8CA 1YRTA 2W7AA 1W2BR 2KVIA 2B43A 2BVZA 2D3O1 5ETQA 5AE3A 4ZPBA 4C8NA 1Q82T 2HNYB 3T3FA 4B9MA 3DFEA 2C3YA 4O3PA 3PR5B 5L1IA 1F1BB 2ZBQA 4LRDA 3HFZB 3NCPA 4ECYA 5DGAA 1P1LA 3TR5A 1TL7A 5A8RB 4QPXA 1IBMF 2IHR1 4GVLA 5DM7Q 3DLKA 3CCUS 2XS5A 2Z57B 1V3ZA 3QAEA 1WOPA 3QT6A 3QYYA 4JI7F 1IQTA 3QT5A 4JV0A 3R7BB 4M5GA 1YRUA 1YZ6A 2H1YA 5KFKA 4YB6A 1BWVA 4DPWA 1MWYA 2CZ9A 4IRKA 3DRPA 3KLIB 1N48A 2RVJA 2F65A 1X31C 4XO0A 2YVSA 4MJKA 5H1SV 3KHHA 3D3BJ 3ZZUA 2W8KA 2JLFA 2DXDA 4O3QA 3KWMA 1N34F 1VK8A 2DBBA 1SB6A 4OQJA 1SH3A 4PG8A 2JLEA 4WE1B 4WE1A 3I31A 2C3MA 4N76A 1TAUA 1HNZJ 4OYWA 1NJZA 3M30A 1JLEA 3M8QB 1QSSA 1UFLA 3DI6B 3BPDA 4CH0S 5LM7E 3PVXA 3B4MA 7FD1A 4P2FA 3KJVA 3VAFA 4DSKA 4FYVB 2DNZA 2DJWA 1TFWA 3AA9A 4WF9Q 4O4RA 4KGZB 2AJ2A 1NK8A 3C6TA 2KRRA 5CCMA 2MKHA 5HO4A 1H7XA 1NLKL 2HK2A 2M88A 4ZJQA 4C11B 2R2SA 2HAIA 4NI2B 3NMRA 2ALZA 1JB0C 2CPEA 4DJBA 1T9XA 1X4HA 1QY7A 4IKAA 1S9GA 4KB7A 2VPYB 5A8RA 2RF2B 5E0OA 3VWSA 1O5JA 3QRQA 3ZC4A 4JP8A 4YDXA 4DV7F 4I2PB 1HQUA 2UXBJ 2ZH6A 1AFIA 2J9CA 2NS1B 2F3JA 1H72C 1Y10A 3THPA 3GLJA 4CO1A 4NYPA 2FC8A 3VHQA 2G9OA 1LNQA 4RW6B 4ID5A 1XBWA 5KFUA 2AYGA 4B9VA 1RWVB 3FVYA 4ANDA 4X4OA 1WJ9A 1CJUA 3DYAB 3MMCB 4I0WA 2VG5B 3LWMA 1RBLA 2XMJA 2WRMA 4KFBB 2ZH7A 3EE3A 2G2OA 1FA0A 1K73T 4FNIA 1U2RA 2QEXS 2XTJP 1GQEA 4PAAA 1CJUB 2E1PA 3DYAA 4NLPA 4UOGA 1GAOA 1RJJA 3JS9A 3TP2A 1S9FA 4JI1F 2M8DB 1HNWF 2AKWB 3ILLA 4DS5A 3CJ0A 3BBBA 4CLFA 2YKOA 1AXQA 2GVDB 1IKVB 3TI0A 3AOAA 2J8SA 3QWPA 3J81j 3MWBA 1VQYA 2BJ9A 3BN4A 3NGRA 2V5HG 3DN9A 4UOHA 3L3CA 1EQ0A 3MR2A 2BE2B 2DHSA 4OHWA 2V2KA 2MSTA 1Y5LB 2VICA 1U1PA 4DV2J 2HVEA 3U1NA 1FKPA 4LF5F 1U6BA 4X2BA 2CPIA 4G1PA 3CJTA 2NZCA 3L4BC 3G6YA 2ZZNA 3DRRB 2PE8A 1FTCA 1U47A 4LJMA 1KLMA 2ZUAA 3H59A 2VL1A 3IM9A 4CYUB 4X4NA 5HP1B 4OZ0A 2HHHJ 3MR6A 3GSDA 1RKIA 1Y4ZB 2VFRA 3AB4B 2ROGA 5C2CA 3TOQA 1IBKF 1VRUB 2BA9A 3HHDA 3P8BB 1U1MA 5CZXA 4EWTA 2ZBPA 2ZBRA 1FNXH 2P6SA 3HSGA 2O66A 2CPZA 4A46A 2HURA 3AXMA 1U4BA 2ZDOA 3PEJA 1MWZA 1FWKA 3DM2A 1YJ7A 4H4OA 3DLGB 3OR2A 1UTAA 1F2HA 1M5SA 2W1BA 2YKMB 3ET6A 3KJQB 3HDSA 3PX6A 4LF6F 1RAHB 1P9YA 1CBKA 2W4CA 3KG1A 2B9WA 2FZCB 1HBOA 1W2IA 1VIXA 2HKEA 2CPDA 2DNMA 3DGPB 3H42A 3RU0A 4NZ7A 4DL4A 2G0CA 4RWWA 1T9UA 2EBGA 2IPOB 1EB0A 3MMJA 4BC9A 1VJQA 5H9EK 4IFYA 1CLFA 3BQ0A 1NDPA 1X4FA 2LXUA 2V4JA 3OD2A 2JSXA 3N28A 3UDLA 3QRRA 4YR3A 3LANA 2HHXA 1F2GA 1YSJA 2UXCF 2CXEA 5GAGU 3KG4A 1WDDA 5KFVA 4ATNA 3ZTOA 3GR1A 5K8PA 1T03B 2CADA 2E9ZA 4ZLLA 1U8WA 4OJGA 2OGUA 5CXTA 3Q2TC 5ETRA 3QZ7A 4WPAA 3CNQP 1GK8A 4B3MF 4RW4B 2R8KA 1HWLA 2Z4PA 3E01A 3W62A 1TP7A 4EO8A 5HMXA 2DCLA 2GVZA 2IJFA 3KXDA 4P7VA 3FFIA 1FVQA 3CTRA 4NLWA 5JXSA 4ZVTB 2UVVA 1BQNB 1N54B 2DH7A 2OP5A 5L1JA 1DBDA 4YEAA 5F8HA 1L3UA 4QIEA 2OPPA 3NNHA 3KLGB 2KT3A 3POTB 3HHLB 1IWAA 1UWBA 3QATA 1R27B 2DRDA 2B3TB 3LF0A 1Y9OA 2AJQA 1N32J 1T0TV 2Q3PA 4Z37A 2F9JA 3C8YA 5KAKA 1KLNA 4RNFA 1YITS 1LFPA 2IA6A 2CYYA 1RT2B 4QOTA 4ECXA 3K5PA 2A3JA 5EX0A 3G71S 1GX5A 3QQCD 3PFEA 2W2QP 2MDAA 3CSKA 5MAOA 5D15A 1KEKA 4OL8A 3N5FA 2F8EX 1XEZA 1HNVB 1SUQA 3DRPB 3GCXP 1OWXA 1PYOB 3TZXA 2IFXA 4LSLA 3PO4A 5C42B 3BKFA 2HVZA 2KG0A 2F8MA 2AX1A 4QIWD 2HQFA 5DDQC 3DMJA 3QGIA 1WF1A 4FP9A 4KPYA 3LGMA 2G0JA 3OTOF 2RS2A 3JTPA 2HRUA 2QC3A 1OIAA 3NG8A 2IDEA 1N5YA 1F9HA 2DTJA 3HVTB 2I6WA 3OVBA 3MEDA 2ZUGA 3GIKA 1CVJA 2D3OR 1OS5A 4RUBA 5F3TA 5A8KB 2IC3A 3KMQA 2XMKA 4KTQA 4RU2A 3KJNB 4XPCA 2G1DA 3SDEA 2IMOA 1UEVA 3K0JA 4E2FB 2CQGA 4RW8B 2PEHA 4OZLA 3ZZTA 5I42A 2RSQA 3CVKA 4ECWA 1Q4RA 2ZVIA 1XMBA 4DN0A 3KMSA 1FVSA 4F50A 4ER8A 2HYIB 5C25B 4MIBA 4EBCA 3VGUA 4DCPB 1UW9A 3PG9A 5IOLA 3SMZA 1G2EA 2VFSA 1KHVA 1NKCA 4OI4A 4F3OA 1V3RA 3OTCA 1UVIA 4L74A 4EUVA 1DLOA 4P10A 5K8MA 4GVBB 4DV3J 4DFJA 1IBCB 4UF4A 4MMOA 1YBTA 1RAOA 3HZGA 2KXNB 4ED3A 3WIVA 4JI4J 4ILMA 2Y8YA 4JV5F 3HCXA 3G6ES 3GFXA 3T1YF 2O5DA 2MGZB 1FRMA 3MCOA 5KFFA 1CJTA 2ZH4A 1K1QA 2EI5A 2RAQA 5E3RA 1S99A 3NWGA 4ES1A 1FD8A 2IRUA 2OFHX 3PKMA 1F60B 2QA2A 2JEGA 1CULB 2HQIA 4ZVEA 5J2NB 4DFMA 3RB4A 1WHYA 4F7VA 2H54B 1S0MA 2HS4A 4OJ3A 4BHQA 2GGPA 2RJZA 1S9EA 2GO8A 3Q0AA 4F0MA 2ZJRQ 3BSNA 1NH7A 4FF2A 3C66A 1ULRA 3LW5C 3V2UC 4IR9A 3OFEA 3HK2A 4HHUA 5HVGA 4B3TF 2JC0A 2QFJA 3IXQA 4OYIA 2YWHA 5AE2A 3HP6A 2FVPA 2R8HA 3M32B 4B3SF 4K0KJ 4A8KA 2GS8A 4KR0B 4MT1A 3M8WA 3R8YA 1RCXB 5GADU 3J7Z5 3CDBA 1TV6B 1W25A 2C2EA 3MOJB 5DZ7A 1B99A 1FE4A 3KK2B 2B9XA 1I6JA 1FDNA 2M0GB 5C7PA 3DU5A 4ZIWA 4NCGA 5JMNA 4P7TA 1GMWD 4NEYA 2GIFA 4DPTA 1BQXA 1RB0A 4DZ6A 3UN5A 1R8HA 1PC4A 3Q8UA 2R7VA 3CF5Q 5A8WA 3I82A 2BKPA 3HSZA 5KG0A 2VHGA 2W8LA 3EZUA 3UN2A 1S5ZA 4KH0B 2PEBA 4M94A 1JJHA 5CA5A 3UQSA 3AH6A 1T05A 3SBMA 4P2MA 5KFGA 3TYTA 3WC0A 2GV1A 2B4PA 4X65J 3P5TL 4W4MA 2XZTB 1NK0A 2V4QA 2XY5A 3BH6B 1MROA 1WHVA 3BM7A 1JK9B 1TKTA 5KT7A 3BSOA 5JVHQ 2O67A 5ETMA 4Q45A 2MQOA 4YDDB 2CKWA 4MYTA 3DDKA 1UKUA 5D4PA 2M7SA 1Q5VA 4KC5A 1M5OC 1IQZA 3EDQB 3NCRA 3NNAA 1P6TA 1JQGA 1RT6A 4JI5J 3FBBA 3LGHA 3T5KA 4ZJOA 1X0FA 1TVRB 2R7SA 3QJPA 1MG7A 2XO7A 3IGNA 5IV4A 1SL2A 3RZAA 2Y8WA 1NBEB 2KT2A 3IC1A 4NLXA 3W7BA 2LQJA 4KIAA 5IC4B 3JB9k 3MAAA 3UVJB 4G3IA 3EZ5A 2WBMA 3MMBA 3RBEA 3Q8QB 4L3NA 3DOKA 5BYQA 1TL4A 1REVB 4RW7A 2W9BA 1QE1B 2R4FA 5ETTA 3MUMP 4N56A 3A3NB 4DUYF 2WSFC 5E2QA 2XNRA 1D9DA 3BS9A 2HQ3A 2BM0A 4USVA 5T41A 5EHHA 4WFNQ 4BDPA 2WHOA 1MWQA 2DO0A 2BM1A 4ZA1A 2UUBJ 1WC4A 4RW7B 3P3DA 3I5AA 1VLYA 3MMBB 2D9PA 2WW4A 3NBPA 5C5JA 5FLXY 2OPSB 3RRHA 4DFPA 1NPKA 3LGNA 2AMCB 2DHAA 2WOMB 2WSEC 3CJ4A 2L9WA 3R6GB 4F25A 4E0DA 1HBMB 1WORA 4KRWA 3PR4A 5EDWA 1OSCA 1VQPS 1MMNA 1I5OB 2LA6A 3FZBA 1ROFA 2QLJB 1JLAB 3MPDA 4Q2MA 2EG1A 4HT5A 4D3GA 3CO9A 2H9ZA 2KXHA 3F56A 4J9KA 1EHWA 4ECSA 3R5GA 4RNMA 3ILOA 3KHGA 1UL3A 4ZPVR 1ZM4A 4NWBA 3IWLA 3QFWA 2WVDA 1YLXA 2ZNYA 2H65B 4HACA 4XK8C 1BQMB 5DM6Q 2FLNA 1K8AT 2MKKA 3VQTA 2YNIA 2P9EA 1HMVA 2NUUG 3H5UA 4J91A 4LUBA 4DV1J 3CGIA 4HTIA 2H4YB 5E7OB 3EPIA 4L73A 3AHPA 3EGNA 2V68A 3FCVA 4X64J 1H2TZ 4YY3J 1RISA 3B8HA 4PZVA 2CVEA 2I0XA 1UAWA 1RTDA 1KONA 3M2UB 2ZZTA 1B0PA 2DNHA 4USJC 2DPIA 5J1PA 3OL7A 3TAPA 5ETOA 4LR7A 3H25A 3JTOA 5D0RA 4UZBA 2IBOA 3PJXA 2J6TA 3BDPA 2FJEB 4ICLA 5J1EA 1EETA 1RYRA 3D68A 2J0XA 5F3ZA 4G6VB 3MAHA 3MMAB 4MIAA 3TX0A 1XMOJ 2D3UA 2FIUA 4OZ3A 4C8OA 4EYIB 2I9SA 2V34A 2EC0A 4U7UD 1KP6A 3I0RB 5LXYA 1LKZA 2V50A 1BC6A 1BHNA 4HH1A 1B64A 2L08A 1WEZA 5KT6A 2GW8A 4M5NA 4N8OA 4WFXA 4FF4A 3NGUA 2QYGA 2GIRA 4QWDA 1VRTB 3MPVA 1FRJA 1XN9A 2G2YA 4X66F 1YGYA 1QLNA 1FK9B 2BRLA 3W2VA 1EIYB 5KG1A 2AEFA 2PC6A 3MOZA 2DHGA 1VBXA 1TKDA 1FCAA 3IBFB 1S59A 2CDRB 5L46A 1ZETA 2B4VA 2IIHA 2OD6A 3L7OA 2GAGC 4F3QA 2MKIA 3DLEA 3OUYA 3I87A 1RTJB 4RO0A 4K50A 2R42A 3HFVA 4X4TA 1JWWA 4HYKA 4NA2A 1VQOS 1NK9A 3CC7S 2D9OA 3HPOA 4CI0B 2YBVA 1XTZA 4EU0A 1VOMA 4DUZJ 4ELTA 2MZQA 4KH1B 4IUFA 3J81Y 2RQMA 3I0SA 1SH0A 5ETLA 3I0RA 4C48A 4U7CA 2XLIA 4O0NA 2ZITA 4ECQA 1FJEB 3D6FB 5D3GA 2UUWA 5GADI 2W9BB 4TYAA 3PXGa 3PX4A 4GVBA 5HJXA 2OMLA 1E6YA 2QFIA 2V8DA 1X4CA 3ILJA 3OTEA 3WQPA 3ZTSA 3ZZPA 4I1TA 3NXZA 4LF1A 1D1UA 2OLWA 2EBEA 4M1KA 2IM3A 2P2CB 1XR6A 1VRQC 2DGVA 3GR0A 2B7CB 3IRXA 1TMJA 3UD5A 4QYZK 2E1RA 5HVHA 8ATCB 3JYTB 5IQ6A 2V8HA 1C0UB 5T7LB 1X5OA 4CO4A 4K5SA 1JLCA 5L1LA 3FDSA 2YX1A 4DX8H 1NH8A 4V19J 1KNZA 3QWUA 2N82B 3G82A 4DR1J 1U0SA 2BRKA 2NSCA 3PZPA 4DS4A 1WC0A 2YNIB 2WONA 1GMWA 2WONB 1TKTB 3R7SB 1B0TA 2BDPA 3C15B 4N7TA 4P9SA 3H2LA 5IQQA 2CQ0A 3G82B 1CC7A 1RADB 2KFNA 3CJQA 4LF9F 3Q24A 3Q23A 3EZOA 3BO3A 4KHPF 2J9DA 3NS7B 3Q8YA 2DNPA 3DMJB 4FYXB 3OL6A 1VC6A 2IAJB 1HBUA 3TJ8A 4DR6J 4OV6A 1OSDA 5KFAA 2CA9A 4Z2XA 1HNWJ 2OSQA 2MY7A 1R0AA 1P1TA 5GAHU 4LSLB 4ZN3A 2E29A 2N7CA 2KG1A 1LEOA 2AX0A 2Y0BB 2FGOA 4ZK7M 3MR3A 1U1QA 1MU2B 1U6FA 2YNGB 2HFVA 4M5LA 1V5VA 4EGLA 2VH7A 5DQHA 4CO5A 2XCPA 2CQ3A 3MEEA 3QIDA 4PQAA 4U67Q 1C1BA 2MHNA 1VQ7S 1NK5A 1NMEB 5HANA 3PIPQ 2DITA 1RT2A 3JSRA 4ETZA 1TQLA 3UWTA 3MAQA 2BBEA 1YJ9S 1FHTA 4CIOA 3DRXA 2XNQA 4F26A 2VD3A 3MM6B 3KLHA 1UWBB 3PDNA 3DOLB 3MPWA 1SKUB 3EX7B 1BY9A 1FNOA 2RKIB 4OHVA 2DGWA 3PW7A 2KM8B 1CJVB 5ETPA 5KG3A 5DG7A 1XNQJ 5CABA 3V6DB 4C4WA 2Y9HA 3CCJS 2LQ5A 3NWRA 3M9NB 4GC6A 3IS9B 4Y2MA 5IT0A 5BR8F 5BXIA 2H5EA 2HHQA 2MSSA 1J5OA 4QBUA 3HMJG 4F2SA 2YKQA 4DQRA 1Q5YA 2B56A 3HM9A 3A8KA 3J80U 1PSDA 2KFYA 4X4VA 3ZTRA 2GNKA 3A8JA 2ZH1A 2ZC3A 3NAHA 3CCMS 5F8NA 3DOMB 4GO5X 1AW0A 4AL6A 3CUNA 4PABA 5EN1A 2YKNB 4JOUA 3DLJA 4M5MA 5A0YA 2OAUA 1VFJA 2VKRA 5A0YB 4RUCA 2W2OP 1UFWA 4QWEA 1U45A 2XEXA 2XWXA 2WVFA 4ED4A 2WSCC 2PFDA 3OXLA 2GHVC 2JWNA 4DN9A 1IVZA 3BZQA 4GRSA 5KFQA 3CDUA 1NK4A 2E1AA 1RP5A 4J9OA 3Q89A 4NMXA 3PEHA 2VONA 3Q86A 3QJJA 2V6AA 4NCGB 3OJUA 1YK9A 1U6ZA 1S6QA 3BBCA 3RGIA 4ES2A 1FEEA 2Z8QA 4WK3A 3THVA 1RWOB 3W63A 1X60A 4O3RA 2LYVA 1GXTA 1RWUA 2K1RA 2ZNZA 2RDJA 5H9FJ 4UZCA 3WX8A 4H4MA 4Y0FA 4OX7A 1WC3A 4ED7A 3LP2B 2GMHA 5E3AA 3QGGA 5ETSA 1VS3A 1RT1B 2HNDB 4ZIVA 5F9LA 5J2PB 3MCNA 1FWLA 1IKYB 1RAGB 2MLZA 2OJ3A 4CO2A 4ZCMA 2HHTA 1PO6A 3FSYA 5EUHA 2L41A 4DV2F 3PO5A 4LF5J 2Y1RI 1P9QC 4M63A 2DH8A 2JRSA 2WW8A 5KFZA 4R5PB 3MUTP 3CEDA 2HHHF 2POKA 2DRAA 1B7FA 3FJ2A 3CCRS 3NS6A 3CO0P 1H2VZ 2R7QA 3AJDA 4FN5A 2B9EA 2V69A 2VQEJ 1FDBA 2NR0A 1RWKB 4A8MP 3OSPA 2QO3A 1WOOA 2JHEA 3FGVA 2MLYA 1HHQA 3BYPA 2HGMA 1DURA 2BW7A 4RL1A 3ENWA 3MFIA 3LALA 2HVDA 3T5JA 4B9SA 2YNFB 4ECTA 5KFMA 6AT1B 1KC8T 1NSKL 2CJ9A 1UETA 3LQVA 2KRBA 5HAOA 3JAMU 3MPYA 4A8QA 2XMVA 3EUNA 2FVRA 2KZZA 2HIYA 4J9QA 2IM0A 3D6HB 2DHXA 2CJQA 2DXEA 2QSWA 2RT3A 2PFFB 4K4WA 2BKNA 3UDVA 3CW2C 3D1QA 4R25A 5C24B 3ELHA 3T1HF 3T1AA 1LOUA 4DX5A 1REVA 2F4VF 3O6QA 4TLQA 1ZTWA 2IAJA 3TA0A 1F6TA 4I56A 4HKQA 4MH8A 1A7GE 1YDLA 2YQ0A 4R5PA 1XQIA 2XI3A 3ISNC 1XNRJ 3OHBA 1MMLA 2DY9A 5KT4A 4DR2F 1BE4A 2J76E 4CLSA 1RT7A 5ETNA 4HL9A 2KXFA 4QWAA 4F8RA 4LF7J 5D78A 1IR0A 4RW8A 4J5OA 3HJFA 3UFCX 2MJNA 5KFJA 3SDEB 2AQ4A 2OSRA 1RK8A 3KLFB 1X4EA 1AYEA 1OPZA 3CD0A 4OYPA 1HQUB 4RBVA 1RT7B 3N5BA 4ZVHA 1QVFR 5F8JA 1S79A 2FHJD 2IC3B 4M5IA 2UVWA 3EYZA 1SJ3P 1S4FA 2NUHA 2Z58B 3EPGA 3C6UA 4MK9A 5E5NA 1HD0A 1N5YB 4QR1A 2AJ1A 1S0NA 2AD9A 2UUAF 2BR0A 2FHOB 1FDDA 2H51B 1O51A 1TAQA 2MPUA 3T9ZA 5I4MA 1X7VA 4NYOA 1NSPA 1S1VA 2CQHA 2VG6B 3H2VE 1J2VA 2JFKA 4J9UE 1NNDA 4OHXA 1Y5IB 2B9YA 4ZOSA 2X1BA 3R9LA 5K8OA 1VISA 2R2TA 3PYFA 3S1TA 2GMLA 3KNAA 1XMQF 1HARA 2HHWA 2LXFA 3ETOA 3V4MA 3DRYA 4I69A 5ETKA 4JB8B 3TZZA 1DJ0A 4WIIA 4ZVFA 2FB0A 3BGLA 1UVMA 1R3NA 2FUG9 3JTNA 1RTJA 2AJ0A 3MEGB 2RNEA 5BYSA 4DSIA 1RTIA 1HI0P 2FZKB 4M5HA 1KFSA 4CLLA 1TKZB 4A47A 2BKOA 2C3PA 2WBRA 4IG3A 1S72S 5LSLA 2UVRA 5CH7B 1DHMA 2Q1LA 5J2QB 1X8DA 1UW4A 2QLBB 4OX9J 1GTEA 2XG8A 3GQCA 2BJ3A 4B9LA 3C46A 5KG4A 3LUYA 3D7SB 1TK8A 2UXDF 1BMQB 1BQNA 4YHHF 4ZVPB 4MAKA 5D0GA 3MFHA 2WTFA 1K0VA 3M8ZA 1CG2A 3SQOP 1ELOA 1PAEX 1HWIA 2C3UA 1Q86T 3A8IA 2JVOA 2FJXA 3TUJC 2HMIA 1TUWA 2ROEA 2ZWPA 1ZPVA 3BH7B 4H4MB 1FKPB 3U1MA 1SKWA 1KQFB 4B3SJ 2IRYA 4PR6A 3N01A 3VGSA 3MMAA 1VK3A 4ZDNA 3VZIA 4AFFA 3NOCA 4ECVA 2LECA 1F0XA 2MKCA 3K57A 1YI2S 1HPZA 2RIJA 3E2EA 4DPUA 2QA4S 5CYQA 2VJVA 2EW9A 1DQ8A 2PO4A 3NL0A 2PMZD 3UW1A 2XS2A 3V4IB 3GE9A 3FCHA 2OHDA 4N47A 5BJRA 4V19X 2AV5A 4OYAA 1NRKA 1PBUA 1Y11A 1NDCA 1RCOB 2W25A 5I3UA 3TAQA 3SSRA 2DNRA 3CE8A 4JV1A 1EKRA 2HZVA 4LFBF 4F4ZA 2UUAJ 2XMAA 1Q8BA 2F8HA 3PHEA 5J2MB 2BX6A 5MLCV 1OY8A 3KNGA 1L5UA 2KI2A 2NLWA 2XULA 1GXLA 5HLFB 1N0UA 3VCDA 1QUPA 4C3MA 4JV5J 5KG7A 1U1OA 4QW9A 2VQFJ 2RQ4A 4O44B 4ZVOB 4C97A 4DL2A 1VLOA 3Q8PB 3F73A 3PRVA 5B08A 4WFZA 1TTHB 2LU2A 3JYTA 3IS9A 2CNLB 4U7UK 1VHFA 2E9TA 3IN5A 3GJRB 4ZJLA 2K7JA 4OZJA 5EX3A 3HLUA 2B8PA 5CYJA 3KUGA 4DL7A 4LFCF 3BB5A 3MI7X 3EGWB 2RDIA 2MKJA 4DXLA 1QSLA 3S8SA 1RU2A 1FRLA 2RQKA 4NI2A 4OYMA 1YZ7A 2BYCA 3MM6A 1NPRA 1FFSB 3KLHB 3QT7A 1M1GA 4QIFA 3RRKA 2XB2D 2W7OA 3HF5A 4J9SA 2KJWA 2Z0GA 4RBTA 1PGZA 4NLRA 3RB3A 5D3GB 1YG0A 2HAFA 5ETVA 4YHHJ 1DARA 1DTTB 1T94A 3DI6A 1FXDA 1U26A 3RB0A 3IAS9 4K4SA 4OMFG 5IXUA 3MF5A 1S12A 1SVDA 2BOAA 2J5AA 5RUBA 2Y1JA 2ASDA 1S4EA 3B54A 3D1OA 3M1VB 1XR7A 2R3VA 4H54A 2R8JA 2DIVA 4V1Ak 1Y0HA 1XK8A 1HI8A 3ZZOA 3ONQA 5KTQA 4JI3F 3RJMB 4CO0A 3CCSS 2FY1A 3G8SA 2CG8A 4LBHA 4YB7A 2K7KA 3N9UC 5HROA 3HHLA 4DV7J 4OI3A 2HSEB 4WBFA 3SI8A 2DXFA 1L3SA 3H7HB 1YBAA 4MKVA 4B9NA 1H7WA 3FNNA 3M2VA 3GG1A 3IBWA 1APSA 4NA3A 4EYHB 3EWGA 2CQPA 1RTHB 3FFIB 2ZEJA 3MMCA 1RT1A 3SIPB 2X1AA 5KFHA 4CLPA 2DNGA 2YTCA 3QBCA 2NXCA 3C14B 1PKUA 4L72B 4PG6A 4TU7A 1R6VA 1IJEB 4CLUA 3P49B 1KOHA 3C2PA 1CS4B 3M2RA 3A8EA 3DLKB 1Q78A 1V9OA 2AJ4A 1C0UA 2CNOB 3W8PA 4LF9J 1RHUB 3VVUA 1EETB 2LQBA 1MN7A 5J1EB 4PWDA 3N6LA 1O8BA 2HNZA 3TVYA 5KFNA 2P9CA 3GSIA 4YR0A 1NJYA 2KN4A 1Y7PA 4FXDA 1FX4A 3TVZA 4Y2IA 4MFBB 5HK4A 2X3DA 4FKYA 1NK6A 2AYEA 5FDLB 3BPSP 3GJSB 3JQKA 5HI7A 4USHA 1QSYA 1TU0B 2ZOGA 3OFFA 2IYGA 1HD1A 2JZ5A 2KT5A 4C0OC 5B7WA 5HMYA 4DUYJ 1VQMS 3CDEA 4WCEQ 3BQ1A 1XJWB 2C3OA 3BV8A 4NCAA 3ISZA 1VJWA 3CJRA 5M2PA 4Q8EA 4WP9A 3FSIA 2CPHA 1PCAA 2KO1A 4WIQA 2EK6A 2HFNA 3OUYB 3D6TB 3DLEB 4FXVA 3VAHA 1K9MT 1HIYA 3LTOA 3MGJA 3NS5A 1EZZB 1XWLA 3FZ2A 5DQGA 1LW0B 1XNQF 2XS7A 2E7VA 2IDLA 1G7CB 1R8BA 2GJFA 3HX9A 2DPJA 4LRBA 1HBMA 1H3DA 2EXUA 3PV8A 4DFKA 2XLKA 3GFYA 1M1KT 1U7LA 3K5OA 4AE5A 2M2BA 2MB0B 5BYRA 4DX6A 4YUDA 2X51A 3Q22A 3V6HA 3PM9A 3DOLA 5F8GA 2J6SA 1RGVA 1FEHA 2CQIA 1CJTB 1PYTA 2XI2A 2FJBB 3US5A 3A4TA 1NB2A 3R27A 4DDFA 1WUUA 1WD6A 2FGCA 4DL0C 4MIWA 2RUGA 5A2QU 4G1QB 2AYBA 2KTQA 4FKXA 3CMQA 2R9LA 1XNRF 4UOCA 3I5BA 3THTA 4EMDA 4DQIA 4IH5A 4I6WA 3H98A 3K58A 1S1WB 4B3OA 4LF7F
chains in the Genus database with same CATH topology
1SV5A 3PNIA 4WTYA 2FHMA 3LH2S 1D9AA 4A48A 4LMZA 2EVZA 1HBUB 2JLGA 3KKFA 3GB0A 4LSNA 5I42B 2DVIA 1Q8LA 2MZJA 1ZAVA 4DV6F 1QJHA 4ILRA 5LXRA 1LW2B 4I7FB 2VG5A 1RYSA 4PQUB 1BQMA 1S6UA 2ZVSA 2ZJQQ 3I32A 3HVTA 3LP0A 4UQTA 3L7PA 4LFAF 2ZHAA 2JX2A 2RS8A 4L6V3 3B4DA 3QJLA 4WZMA 3IR5B 4ZHRA 5B0AA 3CCES 3VAKA 1H38A 1EP4A 3X3UA 3UE2A 2OPQA 2J6UA 3LWLA 2J0SD 1TL3A 1RI7A 3OFGA 1S9GB 5CQGA 4KGMA 4C98A 3GIMA 3JSMA 4ZCLA 4B17A 4DSLA 1HNVA 1SUQB 1CSJA 1KFDA 1QAIA 1LWCB 1TK0A 5CCLA 4CT8A 3ZZZA 4GO7X 1LWEB 1Z4UA 3MTJA 4QCLA 1WNEA 2EFOA 3AJ2A 3KK2A 1N88A 2VZ9A 3CT9A 4Y00A 3OXFA 5L9NA 3GWCA 2J9EA 1UVKA 2PD1A 4F67A 4ZVGA 2FVQA 3GYXB 3OPKA 4ID8A 4B08A 1KRPA 3OBIA 3QGHA 4I6AA 1WHXA 4R8UB 4UY85 2IVMA 2X1FA 1TVRA 4KHMA 2VV5A 4PG5A 2GHWA 2V8GA 2QA4G 2GO9A 2F1FA 1HR0F 2OFGX 1H0HB 2HRYA 4IG0B 4ITSA 2R7RA 3R5BA 4XIUA 5DLGA 2E5HA 2B7BB 4DR1F 2DGQA 2MGZA 2XY7A 5B0EA 3FRZA 2C22A 3OTBA 4NLGA 3ZZRA 3ITHA 2XSJB 3G6VA 3OSNA 1TK5A 4NX9A 2V4JB 2XMMA 2A2DA 4IFYB 2LDYA 4FVMA 4N5SA 5KFXA 2XSJA 2DNYA 3V6JA 4KO0B 4HTJA 2VASA 2VBYA 4Q0BB 2DIUA 5A8WB 4WKYA 2B6AB 2XMTA 3H20A 1X5TA 2HNYA 1R7IA 2HG4A 3CDWA 3AB2B 2OMOA 3BGUA 4RW9B 4F4WA 1HYSB 4BS2A 1M0SA 1FJCA 5HROB 2N7YA 4HI2A 1JX4A 1OO0B 2QT7A 5E33A 1TV6A 1U2FA 4TY9A 2ILYA 3DLBA 2VKZG 1HMVB 1FTRA 1R8AA 1SV5B 2KYZA 4URSA 4PXDA 1VBZA 4A8YA 1RT5A 1S1WA 2EG2A 2IVYA 4WYLA 5F8MA 1SQEA 3J7ZT 3RR8A 3HHLD 3LP1A 2VBZA 3M6WA 2RMLA 4F2RA 4OZ5A 3NAIA 4C8ZA 1KLMB 3JSYA 4G1IA 3M8SA 1NB7A 2L3MA 4NCBA 5KT5A 2R7WA 5C42A 3D0GE 5I3PA 3CD5A 2WOMA 3DHWC 2E7WA 3DDNA 3CULA 1NHVA 2UU9F 3AQOA 4NLVA 3H8YA 2BE2A 2CQDA 5EWEA 1NK7A 1SJ4P 1BGXT 4BBYA 4ED6A 4X4PA 4KHRA 1JJ4A 4OX9F 4E8UA 2WB4A 1SKRA 1EP4B 5KFYA 4CQ1A 1C0TB 1HWJA 1FT8A 3GV8B 4QQBA 4ED8A 2HLUA 1S6OA 2OKQA 2FLOA 3M4XA 2V8VA 3J7YI 4M95A 1TUVA 4DR5F 5HLFA 2HWIA 3V6KA 3KK1A 1X4GA 4DF4A 2M9KA 4ED5A 2DNOA 1Y3JA 5AXNA 2K3KA 2VC0A 1BD6A 4Y6IA 5FDLA 2ZH3A 4NXNF 4LVNP 2HS3A 3K7RA 4ID5B 1Q7LB 2LCWA 4NLTA 2ZZMA 5L8RC 3VZHA 2M5YA 2EFNA 2VFTA 1X4AA 4ZPDA 2DRBA 2JFDA 5LJ3Y 1HW8A 5AXLA 3CB4A 4KBIA 4X65F 1FD2A 4QWCA 2DCUB 4QR0A 3FSXA 4USIA 4NLOA 4RZRA 2G4BA 4GKKF 3OXGA 2O01C 4RX6A 1RA6A 2R7XA 4JBCA 2EKYA 2YH1A 2ZKUA 2DNKA 3MM5A 1ZM9A 3CD6S 2O1PA 2OPRA 1NJXA 3HHLC 5B0CA 1JLGA 5D4LA 1JLEB 2LKZA 3M8QA 3UR0A 2VUGA 5J2QA 2IBKA 4RU9A 4TYBA 3W2WB 3D5MA 2BACA 2R2RA 3TARA 5FJ4A 4DBQA 3OR1A 1FKOB 2BUNA 2R7OA 3K5NA 2KDOA 1A6LA 3RAMA 2W4DA 5E3PA 3W2WA 1HWKA 2NPFA 4OLOA 4WFBQ 5D8HB 2HFZA 3L95X 1PC5A 2OPPB 4MKAA 1JNZB 1N5QA 2KJVA 2ADBA 1HBNB 2CVIA 3OL8A 5KG2A 1NHUA 4KKOB 1FE0A 5DLFA 2LEAA 4TXSA 2E5LF 1S1VB 4ES3A 1ZM2A 1ZAWA 2FVCA 4DL3A 3QO9A 1KHWA 3Q2SC 5AJ3F 3N4WA 2COLA 2OPQB 2HZCA 4OV1A 1QAYA 4WU3A 4RUAA 4B9UA 4OIXA 1DZ5A 3MM9A 4PXCA 5DS7A 4WKRA 1L3KA 3M2RB 1CQNA 2XY6A 2HIQA 3H5SA 1X9SA 3M6VA 5HMWA 2K8GA 3LAKA 3EGZA 5CYMB 3ULHA 5KT2A 1O0PA 4KQZA 3P6YC 3DHXA 1G3OA 1WI8A 2GFFA 3DGPA 3VF0B 4IYQA 5LSOA 5SZTA 2N4DA 2IYIA 3HXMA 4K4YA 4LQ3A 1HQEB 2ATLA 1HNIB 2YKMA 4JI0F 3KLVA 4WU2A 3HT3A 4IOBA 3MM8B 3HVRA 2UZAA 2EFVA 1S6PA 5HBMA 1L3TA 3DXBA 4I2PA 3IGVA 3CDAA 3I55S 5CYQB 3BSAA 1E6VB 2WCXA 2D41A 1D9FA 2AGPA 2V9WA 1YJRA 4ZS6A 4ECRA 1TKXA 4IOAQ 3RAXA 1HFEL 5IM0A 2KB2A 3C6TB 2HMIB 3OHAA 5GVQA 2DGOA 4DUZF 2UP1A 3RRGA 4CO3A 2XBPA 5L38A 3K8WA 4O23A 4LF4F 1WF0A 2ZJPQ 5FIIA 3CPWR 1FRIA 4C8YA 4CZCA 3J7YU 3PY8A 2C2RA 1SJFA 1YRXA 3BEGB 5KFEA 4CH1A 1SXLA 1Z1ZA 1TKZA 3G4SS 1K1SA 1NJWA 3ZFVA 1XR5A 3DRSA 5KFSA 1Q7YT 3MEGA 1KOOA 4IH7A 2MXYA 2VFVA 1FXLA 1B0VA 3KTQA 3IWNC 5KOWA 1Z2ZA 3NNCA 2FHJA 1HNIA 4ZPWR 3FMBA 2OPRB 1HYSA 2CPXA 4XAKA 3I4PA 4HT7A 2ZE2B 2EK1A 2ZM6F 3GMGA 4WJBA 2VA3A 2GIQA 3DC2A 3NLCA 1R8PA 4C3KA 1T8EA 2KFZA 4TY8B 2Q6BA 4PKDB 5F8LA 3MCSA 2GX8A 4DV4F 4P2SA 2N3LA 4P6QA 3S7RA 5IT4A 2ASLA 3CJ2A 1HPZB 3KLEB 1YJNS 3QO9B 1N0VC 2LA4A 1CQMA 2KHCA 4IG0A 1FESA 4C11A 5E41A 3H4BA 3H2UB 2MHEA 2VPWB 1KQGB 3IRWP 3CCQS 2W4PA 3BJYA 2RU9A 4CNZA 5HL7Q 3H4DA 1D8ZA 3KG0A 3GFZA 4DSFA 3M30B 1VQKS 3WX4A 4XPEA 4H4OB 4GC7A 2HHPA 4NA1A 3DM2B 3K5LA 1R6YA 3WDOA 4J37A 2HPUA 1HW9A 3CIMA 2L9DA 1VRUA 4QIVA 1FRHA 4J9NA 1JJ2R 5CHCB 1JLBB 4FXWA 2CJAA 2YNFA 4IQXA 3T19A 2MZ1A 4CO0A 2FHKA 2HFOA 3MM5B 1ZAXA 1I1GA 3MTKA 2AP6A 4QW8A 2RQCA 4GKJF 4IO1A 4MK8A 1LK5A 1KS2A 4OHZA 5G0RB 1M90T 2QSFA 2FC9A 2GHPA 1H6KX 1S1UA 1JLQA 2BW2A 3MM7B 2ASJA 4OX8A 1E6VA 1IKYA 1MW7A 2R8IA 5K14A 4A4JA 2QMXA 1KTVA 4RBUA 4IQMA 3KLFA 2EWHA 1NO8A 3OJSA 1ZPWX 2KU7A 1Q16B 4ZMMA 1KQSR 3LO3A 3J80Y 2YKPA 1TFYA 4Y28C 1RT4A 3G9CA 3M6XA 3IRXB 2X3GA 4RW9A 2CRLA 1N6QA 3O3LA 2CQCA 3CWJA 1AFJA 2CPFA 4OI1A 3SV4A 3C3LA 4B3OB 4PRFA 2I5JA 1E6YB 3H40A 3VAIA 5IS2A 3SV3A 3CCLS 3OLAA 4IO9Q 2KHDA 4BWJA 4IDKA 3ZZ0A 1SIZA 3WC2A 4WXWA 3MM9B 3IFEA 3IAM9 4I68A 1VQ8S 1UVNA 3QIPB 3QGPA 4O4GB 3GIIA 3RBDA 4RNNA 3TANA 3PW2A 1N32F 3R1HA 4FPRA 4KJIA 4EBEA 2FLPA 1T3OA 2YX7A 2BOPA 2DK2A 2JEIA 4EO6A 1LQ9A