2RVJA

Nmr structure of epithelial splicing regulatory protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
MPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGDAFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epithelial splicing regulatory protein 1
publication title NMR structure of Epithelial splicing regulatory protein 1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rvjA01
3BEGB 2MZ1A 1P27B 4WFNQ 1FJCA 2M70A 1M5VC 2DO4A 2GHPA 3G6ES 2D9OA 3B4MA 2CPEA 2K8GA 2MQQA 1JJ4A 2MGZA 1F9FA 3IRWP 3VAFA 2KRBA 1U1MA 2VODA 2RQ4A 2I38A 3CUNA 1YJ9S 4U67Q 1S72S 1AUDA 1H2TZ 2BZ2A 2RQCA 4LMZA 1S79A 1N54B 2DNOA 4CH0S 4TU7A 2ADCA 4RU2A 2CQHA 2FY1A 2DNPA 1WEXA 5IQQA 4LJMA 4QQBA 2CQPA 2LECA 2KG0A 4FXWA 2E5JA 2LEAA 5JVGQ 1WTBA 2EK6A 4QU6A 1QVFR 2MY7A 2LXIA 1VQ4S 3G9CA 2CPZA 5LXRA 1WHYA 4V19X 2CPFA 1VQOS 3CMAS 2I2YA 3ULHA 1WI8A 2RVJA 2RNEA 2FPHX 5CXTA 1U1RA 2KI2A 4TLQA 1U6BA 1FNXH 5GADU 3R1HA 3VAJA 1VQPS 3SDEB 1K73T 1KOOA 3VF0B 4QPTA 1HL6A 1G2EA 4Y00A 1UW4A 2YH0A 1FJ7A 3CULA 4WFBQ 1XN9A 1OIAA 5LSOA 3SDEA 3JB9k 3Q2SC 4YB1P 2DNQA 4BS2A 2DNMA 2MZJA 1X0FA 3SXLA 3OW2R 2XNQA 2OSRA 2M9KA 4F02A 3MDFA 1WHWA 4Y0FA 2CPYA 3UWTA 5DDQC 3CCVS 5LJ3Y 5GVQA 3CCQS 3MI7X 2YH1A 4QU7A 2KU7A 2V94A 3CC2S 5H1SV 4CIOA 1R8PA 5DDRC 1N52B 2MQPA 1Q86T 1O0PA 2AYMA 4WKRA 2XS5A 5DETA 1ZH5A 2U1AA 3THPA 2CQ4A 1VQ5S 2LA4A 4IOAQ 1YIJS 4IUFA 1U1PA 2LQ5A 3EGZA 1N8RT 2A3JA 3G8TA 3MUMP 1SXLA 3CCES 2KM8C 1KOHA 3LQVA 2M7SA 2N82B 2G1DA 5D77A 1VQ9S 3CCLS 1WWHA 1YJWS 2D9PA 3CCMS 1R8HA 1Q82T 1RK8A 3U1LA 2M2BA 1N88A 5HO4A 1YJNS 2PE8A 2ADBA 1JJ2R 2RRAA 2DISA 3V4MA 2CQGA 1X4AA 2DO0A 1M5OC 2MMYA 1Q81T 2HGMA 1PGZA 2VOOA 3UCUP 1OO0B 3CCRS 1X4GA 1YHQS 1U1NA 2MQNA 1WELA 1VBZA 4CH1A 3BO3A 2CQIA 3CCUS 2O3DA 2CQDA 3G4SS 3D2WA 1A7GE 2KM8B 1JMTA 2PEHA 3CC4S 2DNYA 1VBXA 2LYVA 4IO9Q 2DNZA 2CPHA 2RRBA 3NNCA 4W90B 2L08A 3IWNC 2OTJS 3DLLQ 3EX7B 2HZCA 2KT5A 3S7RA 2NZ4A 2ZJRQ 4WIIA 1X4HA 4Z2XA 3UCZP 1P1TA 2MSSA 2DGXA 4WCEQ 1YWXA 3G96A 4F25A 1SJ3P 3B4DA 2G0CA 2YTCA 5GMKa 2ZJQQ 2ERRA 2HGNA 1D9AA 3VAHA 1VQMS 3P6YC 1HD1A 3ZZZA 2J76E 2L41A 2MJNA 3CF5Q 1VQ6S 1JJHA 2Q79A 1X4FA 3ZZYA 3G8SA 5MLCV 2MYFA 2N3LA 3UD3P 1WEYA 2MKHA 1WG4A 2JRSA 3FEYB 2L9WA 1IQTA 4CQ1A 3P49B 2M88A 5ITHA 2XS7A 1FXLA 2MZSA 3BS9A 1VQKS 4ED5A 1NO8A 2LCWA 2OSQA 3N9UC 2MKSA 3CC7S 3MUTP 2JWNA 2DGUA 2VOPA 1BY9A 4UY8T 3MXHP 1QVGR 2CPJA 2DIVA 1WG1A 2CPDA 5CYJA 2HYIB 1SJQA 5FJ4A 2M4MA 3I56S 5D78A 2D3OR 1DHMA 2GO9A 2SXLA 1WHVA 3BO2A 1UFWA 2QFJA 2JX2A 2CQ2A 1D8ZA 2KFYA 3J7YU 2MZTA 2MQMA 2DGQA 2CJKA 1U2FA 1FO1A 1DRZA 2XSFA 2X1AA 5DDPC 2KRRA 2E44A 3UD4P 2OIHA 2CQCA 2MKJA 1UP1A 4W92B 2MZRA 3EGNA 1PO6A 3TYTA 1M1KT 1X5SA 1VQLS 2LXUA 1M5PC 3CTRA 2VONA 2MZQA 2KHCA 2KYXA 2MB0B 4OZ1A 3CCJS 3VAIA 2MXYA 1VC5A 1X4BA 1CVJA 1QM9A 2G4BA 1WG5A 3VAGA 2DNLA 2JVRA 2ZJPQ 3HHNB 3CXCR 3VAMA 4M5DB 3MUVP 2CPXA 1X5PA 5GAEU 3PIOQ 2M8DB 1M90T 2KXNB 1WF2A 2EVZA 2LEBA 1H2VZ 4PRFA 3Q2TC 2J0QD 1KQSR 2NLWA 4J5OA 4WF9Q 1B7FA 3NS6A 3PIPQ 3BO4A 1Q7YT 1OPIA 2CQ0A 1DBDA 5GAHU 3LPYA 2J8AA 2DNGA 2X1FA 2RT3A 1HD0A 2DIUA 1L3KA 4C4WA 4YUDA 1X4CA 2MGZB 2OJ3A 2E5GA 2DGVA 2DNHA 2JVOA 4WFAQ 2HGLA 3L3CA 4TU9A 4PKDB 2M52A 1YI2S 3MD3A 1K8AT 3NMRA 5LXYA 1NU4A 3J7ZT 1VQ7S 2E5HA 2QA4S 2DHSA 4ZKAA 4PR6A 1H6KX 2LKZA 2YKAA 2KH9A 1FJEB 1OWXA 2EK1A 2KG1A 2DNRA 4EGLA 1VBYA 2DHXA 2FC8A 2KVIA 1SJFA 1SJ4P 3UE2A 2MY8A 2FC9A 3U1MA 3RW6A 3NNHA 2QEXS 3FEXB 3TP2A 1NJIT 4YOEA 1WHXA 2KXHA 3HI9A 2F9DA 2B0GA 5DM7Q 3P3DA 2MKIA 2KXFA 5CA5A 2RUGA 1HA1A 2F9JA 3NS5A 3R27A 2XNRA 3MURP 3CCSS 2RS2A 1ZZFA 3G71S 2MHNA 1H2UX 1A9NB 1DZ5A 2MJUA 1VC6A 3P5TL 3THTA 2DHGA 4TU8A 1VC0A 2FHOB 3DXBA 4P6QA 2DGSA 1RKJA 1X4DA 1X5TA 4OZ0A 3H2UB 1U1OA 5DM6Q 2MPUA 2DHAA 1W2BR 2YWKA 2BOPA 1U1LA 3S8SA 3K0JA 2CPIA 2LMIA 3RW7A 4LIRA 2MQLA 2DNKA 2DH7A 4C7QA 2X1GA 4IOCQ 1ZZNA 2DK2A 5LJ5Y 5EN1A 2DH9A 1UAWA 2KN4A 1KD1T 3S01A 2XS2A 1M5KC 3MD1A 3VAKA 2AYEA 1FHTA 5IM0B 2J0SD 2X1BA 2N7CA 2AYGA 2DNNA 5GAGU 1WEZA 1WF1A 2F3JA 2DITA 4F26A 5IM0A 3CD6S 3MOJB 1SJRA 3S6EA 4FXVA 5IFMA 3H2VE 2N3OA 4ERDA 1X4EA 2RU3A 3CPWR 1WF0A 4C0OC 5DDOC 2OTLS 2U2FA 3I55S 3NNAA 4UQTA 2CQ3A 3TO8A 2AD9A 1FT8A 5BJRA 5JVHQ 2K3KA 2M8HA 1VQNS 2CQBA 2E5IA 2MKKA 2CQ1A 1YTYA 2MSTA 1U6FA 2AYBA 3SMZA 1URNA 3CMES 2DGTA 1U1KA 1YITS 2HVZA 1WI6A 2MKCA 5LSLA 3UCGA 1X5OA 2WBRA 3R1LA 1KC8T 2MQOA 2M0GB 2DB1A 4A8XA 2UP1A 2DGWA 5HL7Q 1U1QA 2LA6A 2DH8A 2XB2D 3VALA 1K9MT 1VQ8S 2DGOA 2RS8A 3US5A
chains in the Genus database with same CATH superfamily
4NXMJ 6FDRA 3C8YA 1P27B 2HMIA 3MTKA 2QC3A 2VG6B 1TU0B 5HLFB 4DL6A 3G6ES 4OYPA 1CC8A 3B4MA 1SQFA 5F0UA 2Z2YB 1S1VB 3VAFA 2P8IA 4U67Q 4X4VA 5HVFA 5KFLA 2DR6A 4C48A 2VQFJ 4KR0B 1VRTA 1N54B 5CQGA 2G2YA 1HQUB 3DOLB 3K5NA 2EK6A 1LQ9A 1Q8BA 2MY7A 2LQJA 1GAOA 1U0HB 1Z1ZA 4KBIA 1JLQB 3WC2A 2JFKA 4WWSA 5K9FA 1VQOS 2I2YA 5CYQA 3EVWA 2LFVA 1FESA 5ETLA 1K73T 5C24A 4OX9F 1DTTA 3DLGB 3DLEA 3BSNA 1VIOA 3MMCB 1FDBA 3H59A 2MZJA 2VFVA 4PG4A 1FD8A 3TR5A 1SC3B 2VBZA 1F3FA 5A8RA 1NJYA 5KG6A 2ZZNA 3D67A 4C8KA 1RWUA 1U02A 2GMLA 2YH1A 4PEOA 4WZQA 4PYAA 4IUFA 1NJZA 3IRXA 5A8WB 3SEOA 4WK3A 3BGFA 2AHOB 3H5YA 2JHEA 6FD1A 3A1YG 3U1LA 5KOXA 3N79A 3QGPA 3I0RB 3D0HE 4K50A 9ATCB 2UU9J 3M9OB 4UY85 1VBZA 4DPYA 3QQCD 2YNHB 1BQXA 2ZWPA 4ID8A 3BGLA 3MR2A 3CC4S 1S1XA 2GMHA 4DUZJ 5C5JA 3OFEA 3R6GB 4NLXA 4Z2XA 3SZ2A 2ERRA 3I5BA 1UVLA 4DV1F 1PYSB 2GVDB 3JYTB 1HR0J 3GPAA 1FK9B 3TUPA 1JQGA 2ZH8A 2V8VA 1TR0A 4WTOB 5ADZA 5KT7A 4IG0A 2BQ3A 1L3TA 2DIVA 2H1YA 2BOAA 3IO1A 2V8PA 3VR1A 4FS2A 3PW0A 2C2OB 2UUBF 3J7YU 3GSIA 3ZNJ1 4CWBA 1LK7A 3H42A 1XR5A 2MZRA 4M5IA 1TUVA 1PBUA 3RG6A 2CKWA 2OD4A 4F3QA 4IFVA 3LP1B 3HPOA 1JIHA 2M8DB 2H51B 4X62F 4ZOSA 2E7WA 1HHSA 1S0NA 2NREA 3Q2TC 5F41A 4OZJA 3R7SB 1RSCA 5AJ3J 2DIUA 4YUDA 4BBYA 4J7CA 3FNNA 5D4NA 4HACA 3L7UA 4Q44A 1EB0A 3A3OB 5ETOA 4JI5J 3LA0A 2O66A 2ALYB 2E7VA 4LUBA 3PV8A 4NLDA 3FEXB 2R8HA 1EQMA 2BANB 4YOEA 4WU3A 3AHPA 4PXBA 3GU0A 1X8DA 1HNVB 2EC2A 2R7TA 4Y2CA 3KLIA 3G71S 2RU9A 4LSLA 4DS4A 2IMWP 5D8HB 3PYGA 1N6QA 5J2QB 1F6TA 1LFPA 4U95A 4YB5A 1AZSB 4KE5A 1S9GB 4Y2MA 4PWWA 2DK2A 4EYIB 4P9SA 4MIWA 1UEVA 2KN4A 2LDIA 1U26A 1HQ2A 2PI4A 1LW2A 1HMVA 4QWAA 2WVFA 2VICA 1B7YB 3CEDA 1WKKA 1WKJA 2GVZA 4CT9A 5DZ6A 4J37A 2CZ9A 2CQ3A 3KLEA 2V69A 2COLA 1OPZA 1TUGB 4A47A 4QYZJ 4K7QA 1U6FA 3UCGA 5GAGI 4I2PB 2B5JA 2H5IB 2DGWA 4HTIA 4P52A 3BBCA 3HXMA 3CDAA 3J80U 3BKTA 1HBNB 3OTOF 3PX0A 4MYUA 2EBEA 4IQMA 3W63A 2RQCA 2MQ8A 4JB8B 3S1TA 2HHHJ 3MM7B 2FZKB 1GQEA 5IWAF 1RACB 4XTTA 1RT7A 4USKA 3DOLA 2W4PA 1R8CA 2IC3B 1URRA 1OJ4A 2RVJA 3M1VA 3N6LA 2IYIA 1HL6A 3NBPB 4PPZA 1UW4A 2CFXA 5EUHA 5M2PA 2FZGB 4FNHA 1U48A 3MEEA 2MLZA 4USIA 2J9EA 3Q8PB 4Y0FA 2D3UA 1MG7A 5GVQA 2GZOA 2L9NA 2YQ1A 2HFNA 1FERA 3KXDA 1TL1A 1O0PA 5FLXY 1G1XA 2NYIA 4OX6A 3FBBA 1O6XA 4LF6J 3NRBA 5HBMB 3HJVA 1B0VA 1AW0A 3C15A 1R8HA 2RRAA 4YY3F 2BJ1A 1T8EA 2DO0A 3GYGA 1Q81T 5DG9A 4LSNB 1L5UA 1Q53A 3HVAA 2UV8G 1BHNA 4HDGA 3AJDA 2CQIA 1CQMA 3DKDA 3A8IA 2V6AA 1EIYB 1X9MA 3Q24A 1REGX 3DLHA 1GK8A 3R2CJ 3BV8A 2ZHBA 2UUTA 3F44A 3TZWA 2D3O1 3ZZPA 1H3DA 4W98A 1ZTWA 2NZ4A 4P7TA 4ZHRA 5IQ6A 1P9YA 4F4YA 3PEHA 2HS0A 4QIWD 1TKZB 1UPPA 3JSMB 4JI4J 2OPQB 3ZZZA 1BXNA 4IFYA 3K17A 3CF5Q 5FD1A 3V6HA 4ZVHA 2EG1A 2CWXA 1WG4A 2IDEA 3UNGC 4BC9A 2R2UA 1FK9A 1FWPA 3QIPB 4B9SA 4DPOA 5KFIA 4AQYJ 1NK8A 4RUBA 4ZN3A 2ACYA 2GIQA 5KTQA 2UXBJ 1S9EB 1QY7A 1XMOF 4OYBA 2JFDA 1FO1A 4RW9A 5DDPC 4S0MA 2JC0A 3UD4P 4C9DA 3W64A 3TYTA 2C3UA 4Q43A 2V2VA 2R4FA 3G6VA 3QIDA 4IOBA 1GX6A 1EZZB 3UVJA 2GJ2A 3C66A 3HSDA 3M2RB 2OFGX 3CXCR 3A4TA 3DU6A 2Y8WA 3PIOQ 1WD6A 4RBVA 3GFHA 3TEHB 4DWIA 1WORA 4DV4F 4WF9Q 1TMMA 3PIPQ 1ZS6A 2WVCA 4C4WA 2JZ5A 2QT7A 4DU7A 5HANA 4OX8A 2M52A 2EFGA 4DR1F 3JXOA 1TL5A 4ZKAA 1H6KX 1FJEB 3QGGA 3BN7A 1RE1B 2DHXA 5K8OA 1SJ1A 2EFPA 2W01A 2J6UA 5C2GA 3QJPA 3B82A 2N4DA 2X51A 1SH3A 1WC1A 4OLPA 4ED0A 4QWDA 2BANA 4ECZA 3UQSA 3GZ7A 2DHGA 3BZQA 2APOA 2FHOB 4RW6B 3TWZA 3N5FA 1Y7PA 3PYEA 2FYXA 3PR4A 2X1GA 3PFOA 5DGBA 1U6ZA 2C2DA 2XS2A 1T9VA 5HMWA 4UT4A 4PWDA 3QJJA 2JH3A 1R0AB 1IVZA 1S0VA 4MMOA 1WEZA 4NZ0A 3N01A 4UUXA 4NXNF 1U2CA 3KKFA 4B9LA 4DSIA 3OR1A 4L3NA 2YWFA 1IR0A 2J9DE 1IBMJ 2JEFA 3ZTPA 4AUKA 1YTYA 1PAEX 3EUNA 1NDLA 4O3SA 1IR2A 2FTRA 2DH8A 3MFHA 1RWMB 4OI0A 4ED7A 1KTQA 4MKAA 2KZMA 4JP8A 5KFHA 3GILA 1WOSA 3FGVA 4Q2LA 2DR5A 4LRCA 3T5HA 1R6YA 2RQ4A 3KLFB 4Q8FA 3KWMA 8ATCB 1PJ5A 3MM6A 4MIAA 1TK0A 5IQQA 3M05A 3AQPA 1LEOA 1IBLF 3NG8A 3BGRB 4FVMA 4DV3F 4DF4A 4LF7F 3PHEA 1WI8A 4O0IA 2IC3A 5KFZA 2RQKA 2V9KA 2AJ1A 3MMAB 3AOBA 1X9WA 1SV5A 1X0FA 3SXLA 3C19A 5J1NA 3TJ9A 1LFWA 4RUHA 2BMBA 3M7VA 4QU7A 4FNIA 3KHHA 5DDRC 2V4QA 2IPOB 1AA1B 3THPA 3HSGA 1WC4A 2Q6BA 1W7WA 2HBYB 2G1DA 2DRDA 1RTHB 4G65A 5AE1A 3R2DJ 3VVTA 1MMNA 1RHMB 3PX4A 5A8KB 2EWHA 1N5YB 4FZVA 4DSFA 3V4MA 1QAJA 1F5BA 3Q83A 3W2WB 4M8LA 2YKNB 2UUAF 3RB6A 1X4GA 5KFUA 4CO4A 4CLPA 2CQDA 3G4SS 2CVIA 1A7GE 2IRXA 4H4OB 3PKMA 1FXRA 2B4PA 2H4YB 3VTIA 1CC7A 4WKYA 2R7OA 5KT2A 2BYCA 1X4HA 4L6V3 2HGNA 1HPZB 4HDHA 3TUIC 1VQ6S 1TKZA 3G8SA 2MYFA 5HP1B 4DHVA 4O3NA 2HHVA 4KGKA 1UPMB 1RTIA 1BY9A 3RAMA 5LMNF 5FJ4A 2Z2LA 1IBKF 3J81Y 5J1PA 4RUCA 1RT5A 2DGQA 2XSFA 4DCJB 1R8AA 2MEWA 2UXDJ 4QIEA 3T41A 4CP5A 3CJ3A 5C42B 5DLFA 4F7VA 4ILLA 2JDJA 2XC9A 1NLKL 2IM2A 3FFIA 1OSCA 1BE4A 1GT8A 1VK3A 3NY0A 1XK8A 2VDIA 3QT7A 2NSBA 1YJVA 2DNLA 3KMSA 3WIVA 4H4MB 4O0NA 1P6TA 1V9OA 2R7WA 1RT1A 3K7RA 2BABA 3FCWA 3QPIA 4KV8B 4DG1B 5BR8J 2E5LF 2WOMA 1H7XA 2HVHA 4FBTA 2V68A 3JSBA 5I42B 1SBRA 4ECRA 2V50A 4LR7A 1GNKA 4LFBJ 2NYHA 1U7LA 2K7KA 4ZVFA 2XY6A 3MEGA 1NBEB 2PMWA 4KFBB 2IA6A 1X60A 1UVIA 1Q79A 4CLFA 1NJIT 4NXMF 3P3DA 1SH2A 4RPFA 5K8NA 3LP0A 3WHIA 2RKIB 3W8GA 4URSA 2I5JA 1DZ5A 2AJ4A 3M32A 2DRAA 4EU0A 4ZLJA 2VQFF 3DXBA 2Z58B 3BJYA 1GXUA 2DGSA 1U1OA 3KG4A 1EAYC 3ISZA 2O1PA 5HSPA 4PQUB 4RW6A 1S0OA 1ROFA 3OXLA 5GMDA 2DH7A 3CJRA 1VHIA 3CDUA 2BBEA 3CIMA 1CJUA 4NZ6A 3ETOA 3S01A 3GMGA 2NPFA 3FEZA 3KNGA 3QRQA 4EYHB 4X4RA 3MOJB 4OHWA 4FXVA 3CJQA 4ERDA 2GHWA 5J2NA 4A8OA 4B3RJ 4C0OC 2F65A 2OTLS 3FSYA 1FA0A 2RH3A 5KT6A 2QYCA 1KFSA 5KFGA 2MSTA 1JLEB 4CCHA 2XYGB 2VASA 4KGXB 5G0RA 4ZLNA 4RX6A 4URGA 2LA6A 4DQIA 2RS8A 2GV1A 1YBAA 1EARA 5SUHA 3UR3C 2XMAA 4K4ZA 2WK4A 1F9FA 5ETTA 4BDPA 3VVUA 1Q1KA 4L72B 4MKYA 1FKAF 3OR2B 3MM5A 5JVGQ 3I6PA 1JXLA 2UU9F 2XMUA 4DJBA 3VQTA 5KFVA 2CPZA 3GFYA 1P1LA 3MMBB 3Q8RB 2FPHX 5CXTA 4LRFA 3IS9B 4N7TA 1SKUB 4Y00A 5HMYA 3CIZA 4N41A 3CULA 3RRKA 2Z30B 3M9MB 2XY5A 4ED8A 2Y1IA 3WQPA 3I31A 2NUUG 4FYWB 3OTCA 3K5LA 3KJVB 3CO0P 3PW7A 1LK5A 3LWMA 1HR0F 2ZUAA 1GEHA 2QFIA 3R5DA 1WSVA 2UUCJ 5EWEA 2BXJA 2EC0A 4O44A 3CC2S 5DGAA 4WKRA 4Y34A 5DETA 2Z4PA 1ZH5A 1BQNA 2ZH6A 3X3UA 4DCPB 3NOGA 2BR0A 2QGFB 4I6AA 3G8TA 3KDOA 1PJ6A 1FRMA 4M5JA 1F1BB 2HK3A 1RK8A 1MU2A 1I5OB 2PD1A 2HNDB 2UVUA 1PGZA 3W2WA 3TVKA 4ZVSB 4ZPDA 2O3DA 1O5JA 3D2WA 3JTNA 2GAHC 1JMTA 2BJDA 1T9TA 3MMJA 1VBXA 2GS8A 1QDUB 4OZLA 2FJVA 4QPXA 3IFEA 4P2SA 3SYZA 2KT5A 3AD7C 2Y0SD 1FKPB 4MKBA 4AXJA 1T3NA 5IT4A 1D9AA 3W5ZA 3VAHA 4AFFA 3U02A 3EVMA 2L41A 1YKWA 5AJ3F 1JJHA 3H4BA 3GSDA 4KHPJ 4O23A 1WEYA 3DM2B 4KKOB 4LFCJ 4JI5F 3C16A 1J5OB 2XI3A 1RT2B 2JWNA 3OTEA 2DGUA 3EZOA 2HQGA 4UY8T 5B0FA 4TY8B 4N5SA 1B70B 3DDNA 2PMHA 4ECYA 5ETSA 1IKXA 2ACMA 3QNWB 2CDRB 3M8PB 3GIRA 3HDSA 4NLRA 1OMSA 2W9CA 5A2QY 2NUHA 2ZH3A 3GIMA 2YNGB 1U24A 1VJQA 1UP1A 1GXLA 1S1WB 1ZM3A 2G1HA 3D66A 1N4LA 4KAIA 1KVKA 4TQSA 1QM9A 2YKQA 1SQGA 4RW7B 4OIXA 2H65B 2HFVA 3NKYA 4H4MA 1V5IB 1T94A 2ZDOA 4ZJLA 2BKNA 2QL9B 3NS6A 4KV8A 1S99A 2WW4A 3PCOB 3EM1A 1RAHB 1PBAA 3GWCA 2EFOA 4WFAQ 3CJ5A 1VHFA 1K8AT 4LBPA 5J1EB 2ASYA 1TFYA 2DHSA 4HYKA 4DR5J 2K06A 4EGLA 2MY8A 1RTDA 5KFWA 3CD7A 2FC9A 3OLBA 2QEXS 4KFBA 1G6BA 1HLWA 1SPBP 1J5EJ 4BWMA 2RDJA 2BW7A 3C14B 1U4BA 2FJAB 4IR9A 2QLXA 4Q7AA 3MURP 2BV3A 3DRSB 1RT6A 1A9NB 3JTOA 3CD5A 2FVQA 4B9NA 3TZYA 3EICA 2HHHF 1WC0A 1KBRA 3V6JA 2BOPA 4CNZA 1YX2A 1U1LA 1F2HA 2XCAA 2W8KA 3GB0A 1TV6A 1ZZNA 4EEYA 2C2KB 2KFNA 4O4GB 2GIRA 1N48A 2X1BA 2DNNA 3HCXA 3SFGA 2DVIA 1OY9A 5F9LA 3BH7B 4RLEA 4ER8A 3CD0A 1WF0A 1AT1B 2QMWA 3BPSP 3W7BA 1KHVA 4DX5A 3VHQA 3BM7A 2E5IA 3KUHA 4DX7A 1FRLA 3NS7B 3PY8A 2XMVA 1WI6A 4V19J 3SIPB 2HQIA 4OV1A 2XHWA 2XB2D 1EETA 3IA0A 2ZH9A 4NLOA 4FN5A 3FJ2A 1FRXA 5I3UB 4P75A 3M8YA 3KNAA 5BYRA 3CJKB 2GHPA 4USVA 2A2CA 2ZD1A 2CPEA 2DEIA 4FDFA 1U1MA 4QYRA 1YJ9S 1NHKL 1TL7A 5KFPA 3ZFVA 4KC5A 2YWEA 2HAFA 1FJGJ 1EQ0A 3PM9A 2HQCA 5H9EJ 1C0UB 1VYAA 2GQCA 4NYOA 1TVRA 1E6VA 1KN6A 1YZ6A 1H0HB 1Z4UA 1LWEB 4ZJQA 1U2RA 2CJBA 2A6MA 2YKMB 4W4MA 3CMAS 3OFFA 2VB6A 2V0NA 5H9FJ 3LUYA 4K4YA 1NDPA 1LW0A 4CLLA 4ZVOB 4AE5A 1YRXA 2LEPA 1HNZJ 2DHHA 4JI4F 3KJNB 1S49A 3M8WA 3QWPA 3MI7X 2KT3A 3TOQA 3FZBA 3AFGA 4DF8A 2V94A 4J9KA 3IM8A 2MQPA 2AYMA 2ZZTA 1HBUA 1TKTB 4AQYF 2U1AA 1YZ7A 2CQ4A 1VQ5S 2LA4A 1Z2ZA 1SH0A 5SZTA 3TAQA 4KB7A 1Q8KA 3IMQJ 2QN6B 2FJWA 1CJTB 4CLUA 2PFFB 1AUSL 3O44A 5DJBA 4TKTA 4Z7CA 1JLGB 5HQ8A 1CS4A 2V5HG 3KK2B 1WOPA 3GJTB 1OO0B 1SQEA 1YHQS 4KHMA 1RP5A 1IN0A 2IDLA 3OUYB 3CO9A 4YR3A 4OFZA 4XDDA 1SKSA 3D5MA 2L08A 3Q8YA 2QSWA 3NMAA 5KG0A 5ETQA 2A1BA 2HG4A 4G1PA 2P5VA 2V9WA 3FKBA 5E5NA 4GC7A 3MM9B 1CJVA 4QWBA 5F8NA 4I69A 3IWLA 3UD3P 3TUJC 1KWMA 3I96A 2AMCB 4Z7YA 1QVGR 5AE3A 1H73A 2QG9B 4DFPA 2OO4A 2QA1A 5EX0A 5D78A 4R5PB 4ZCMA 4LBIA 1NK0A 5L8RC 2ZE2B 2KFYA 3M8PA 2HIQA 1FEHA 4Y3CA 1RGVA 2J0XA 4P73A 2FY8A 2X1AA 1K44A 2VG5B 4X62J 4QW9A 2LXFA 3CJ0A 2OMLA 2YNGA 3VCDA 1ZM4A 3A8JA 1T03A 2VONA 4EBCA 4TVAB 1RXOB 2XWYA 4DEZA 3HHNB 4RW7A 1VDHA 4IDKA 5DLGA 4YEAA 4DN0A 2F8HA 2LEBA 4NMLA 1YRTA 5KFAA 3BGOP 3M2VA 1S12A 2C22A 5DZ7A 3JAMU 2XLKA 1L3KA 3OD2A 2IRYA 4ZCLA 5B0EA 4F4ZA 1IBMF 2DNHA 1G4CA 2HGLA 3RBDA 3DGVA 3PVXA 4BHQA 2XCPA 5GAEI 4DN9A 1F2GA 2HBZB 2LKZA 4N8NA 1VBYA 1SJFA 4DL2A 2C2MB 4J9NA 3GIJA 3NS5A 4LFAJ 1YLXA 3W61A 2AF6A 5HQMA 3DRSA 1U09A 4TXSA 5C2CA 4TU8A 1RHRB 5D0RA 4P6QA 3DYAB 3K89A 1W2BR 2IM3A 3R97A 2LMIA 4HTJA 5CYMA 3IP0A 3CCZA 3QLHB 2EPIA 4NLYA 3F41A 3NOCA 3V81B 2AYGA 3CCTA 4M5HA 3EJMA 5D0EA 2DITA 4F3MA 1WC3A 3HZEA 3H98A 4LQ9A 1U0SA 1NK4A 1LNQA 3T5JA 1ZM9A 1DQ8A 3LF0A 3R6LB 5L1KA 3BSOA 2E66A 1GMUA 2AYBA 1M1GA 4NEZA 4ZPCA 5KFDA 4PG8A 2BJ9A 2AEFA 2M0GB 2OEJA 3PKYA 4NA2A 4KJIA 5DRKA 1NB7A 1JKHA 3MR6A 2HURA 2A6OA 4LRDA 4CTAB 3DLKA 2CIMA 1TZ0A 4KIAA 2AIRB 5KT5A 4PUOB 4J9SA 1BQMB 2GNKA 3DGPB 4FF3A 1RQ0A 1S79A 4LF1A 1FI4A 2GO8A 2ADCA 2CQHA 2FY1A 3QGHA 1RYRA 4OMFG 2ROPA 2QL5B 2BKPA 1UJ5A 2HPUA 4OYAA 4OYOA 3HM9A 4LR8A 4YR0A 3SSQA 3NCRA 3G9CA 4P7VA 3EZUA 2ZBRA 5T7LB 3NWRA 1EJ7L 4A8KA 1Z2LA 2H4WB 3VF0B 5KFRA 4K4UA 4EZ6A 1IBCB 4BS2A 2DNMA 1IM4A 1OSDA 3Q8UA 3D1OA 3VV2B 1JLFA 3MDFA 4D3HA 3IN5A 4OV6A 1N33J 1KVIA 4CIOA 2AU0A 3B78A 2XS5A 2QA2A 4FXDA 1NNDA 3FQLA 3HSJA 4ZP7A 4H54A 4UZCA 2KM8C 4U7CA 4OI1A 2B8QA 2N82B 1S76D 5E3AA 3HVTB 4ED2A 4K0KJ 4I6YA 2XZDB 2UXDF 3ET6B 2MQNA 2DT9A 4WK1A 1IUJA 3SFUA 1H38A 5L38A 5J2MB 2NXUA 4RZRA 2HHUA 1LXJA 2KM8B 2DXFA 3WZ0A 2LYVA 4IO9Q 4X84A 3TA2A 1RJJA 2WB4A 3DRRB 2F63A 2C1EB 2IA0A 3TRGA 1RB0A 5BR8F 3EXCX 3HKWA 4CYUB 3TAMA 1IKWB 5IC4B 3MM9A 4CLKA 1E6YA 4LFBF 4PCQA 4DR4J 2D74B 3KK3B 3F0NA 1HBOB 1N32J 2RRNA 3QMQA 4WE1A 3FQKA 2CPJA 2AGOA 3OL9A 4ZLPA 3QFWA 5CYJA 2M4MA 1RWWB 2BJEA 3VZHA 1DHMA 2SXLA 3FSXA 4Y65A 3V2UC 1MN9A 4NCGB 2J6SA 2RAQA 2WSFC 2OIHA 3BR8A 3L4BC 2C2EA 4YQWA 2IAJB 1K1SA 4OZ1A 1M5HA 3NGRA 3UFCX 5C25B 1U47A 2NPIA 1V5VA 1X5PA 3R5BA 2W7OA 4DR1J 4A8SA 4RUAA 2C2NA 1Q8LA 1RU2A 4JI3J 3VGUA 3IGVA 2CNOB 4L73A 2WONA 3OSNA 1OPIA 4B3RF 1LWCA 3ZC4A 1S1TA 2X1FA 3KUEA 3MM8B 2QSFA 3OHAA 1IR1A 2BJ7A 2JVOA 3V4IA 2W9BA 1ITPA 3MD3A 5ETKA 3LAMA 1VRTB 4UQGA 2QA4S 1OWXA 4J90A 2FGOA 3UE2A 2FVSA 2VD3A 1WHXA 3BSAA 2B51A 4LSZB 2E9ZA 2KYZA 3GE9A 2MKIA 2RUGA 1HA1A 1NHVA 3OHBA 2QTWA 4QR1A 5CYQB 2HHXA 2IM1A 1TELA 1ZPVA 2QRRA 4NPOA 2LU2A 2N4CA 2UVWA 3KJFB 1X5TA 4OZ0A 2BRKA 2ZOGA 4DSEA 1DTTB 2CYYA 3DYAA 2FHJA 1WJ9A 4IOCQ 1B3TA 5E3CA 4ES2A 5A8RB 4CT8A 2MKYA 3SBMA 1FHTA 5HVHA 4NE9C 3QLHA 4I68A 1RISA 3GV8B 2F7VA 1YBTA 5ETMA 2QLBB 3MHYA 3H2VE 3R5JB 3PZPA 2ALZA 1YDLA 5JVHQ 4XDCA 2CQBA 2VFRA 4Q0BA 5LSLA 2WBRA 3QGIA 5KT3A 3IBCB 4ZJOA 4A8XA 5HMZA 4A8WA 4E8UA 4KHRA 1VQ8S 4GVLA 2Z2ZA 1VISA 2DR8A 2W1BA 3NCQA 4I7FA 1C1BA 1IBLJ 3H5UA 4MFBA 3CUNA 1S1XB 1VOMA 1Q8IA 1SIZA 4PUOA 4J9OA 1BQMA 3DGPA 3KHGA 7FD1A 7FDRA 1SKWA 3ILIA 4FXWA 4N77A 4ES1A 1UVMA 2ZNZA 2D69A 5LXRA 4A8YA 3ITHA 3OJUA 1T02A 2R2RA 2OMOA 4KT0C 4A46A 2H5JB 2K2PA 4QPTA 1WNEA 2YH0A 3K8VA 4NOHA 3PJWA 3SCKE 1S0MA 2OSRA 5BYSA 5E7OB 4ECUA 1RBAA 2ZZMA 3JQKA 2F4FA 5DDQC 5K14A 1WC6A 4UTGA 4KHPF 3RRHA 2OHDA 2GX8A 4LFCF 1JLBA 1R6VA 3NGKA 1FVSA 2XLIA 2DRBA 1FNMA 1R27B 1U1PA 4KH1B 1FDAA 2QIFA 3QRPA 3THVA 4PQAA 2M7SA 2Z8QA 2LP4A 4K2XA 4IFVB 1KR4A 1XC9A 5K8PA 2DISA 3LWLA 1XEZA 3SCJE 2V4JB 3D7SB 2J7UA 2HGMA 1NJWA 2DJWA 3MAAA 3L7OA 4X2BA 3GP9A 1NAQA 2YBVA 4I6WA 4DU8A 2W2OP 3TA1A 2PEHA 3MZIA 4HACB 3MPDA 3ENQA 5F8GA 3SCIE 2HZCA 3L9ZA 4CH7A 2PIIA 3UCZP 1RHKB 2E9TA 3ZTRA 2V2QA 3AH6A 4QIVA 5LMNJ 5LL6d 1GFWB 3DRRA 3UN5A 3AT1B 4AT1B 4B9TA 4M5LA 3DLJA 4ZPTR 1Y00A 3QFHA 1NSAA 3MGJA 3KLIB 4ED6A 5E2QA 3W9JA 1VI7A 3MAQA 2W8LA 2XS7A 2MZSA 3OL8A 2NSCA 5B0BA 4IKAA 5LSRA 5C7PA 4DR5F 2E1PA 4WIQA 3KK3A 1UWBB 1BWEA 1TK8A 1JXEA 3I56S 1J5EF 4HR2A 3QAUA 4I67A 4DUYJ 3AOCA 2JX2A 3MPYA 1LW2B 4X4TA 1DRZA 4TQRA 3W5XA 3DMJA 1C1CA 1Y0HA 2R7VA 4GVBA 1HFEL 4WTYA 1QUVA 2GVZB 3C6TB 1M5PC 1LXNA 1N34J 3KLEB 1VMBA 4USUA 4I2QA 2MXYA 1VC5A 4B3SJ 4ED3A 3DOMA 3GQCA 1P8GA 2B5JB 2FB0A 2KXNB 3HD2A 3DHWC 4WP9A 5A6WA 4B08A 4Q2MA 1KQSR 4OI6A 3D0IE 1PCAA 1NK5A 5GAHU 2H5EA 2DNGA 1XIQA 4Q8EA 4B3MJ 2OJ3A 2DGVA 3MM8A 1UEKA 3L3CA 1YI2S 4PG5A 1I51B 2C3MA 2GIFA 1NSQA 5E3RA 3SQGA 2VG7A 2JLFA 1RT7B 4R0EA 2ATCB 2RDDA 3DRYA 3O8WA 3HI9A 5RUBA 2OPPA 2VKZG 3T6JA 4DV6J 3TZZA 3BDEA 5BYQA 5F8HA 3IXQA 3WC0A 2XNRA 5KG2A 2RS2A 1T9XA 3AJ1A 4X65F 1H72C 3PEJA 3M1VB 3EMTA 2IYGA 2I1RA 4M5KA 1FJGF 1OY6A 2V67A 3OVBA 2VJUA 5FDLB 3PACA 4LIRA 3NLCA 2VFSA 3MEEB 4H4KA 1LKZA 4DV2J 5BXIA 1ZPWX 5H9EK 2C3OA 2Z56B 1S48A 1A0OB 2B4UA 4HHHA 4EWTA 2ZKUA 2N7CA 2ZH1A 1U49A 1VFJA 2I8EA 1TL1B 1SJRA 4RW4A 3NGSA 3M4XA 4Y2AA 5H9FK 1MWZA 3WIUA 2M8HA 2MKKA 2CQ1A 2JNJA 3C15B 4LF8F 1HNZF 1URNA 3K5MA 1FCAA 4FYYB 4ECTA 4KQZA 2BUNA 2F4VJ 1JLAA 4LF9J 1N5VA 2OUGA 4NLVA 1XMQF 3LGMA 4XPEA 2E29A 2FHJD 4IRDA 3N28A 2D9OA 3CVKA 2MGZA 1Q5VA 2VV5A 1AUDA 1H2TZ 2ZM6J 3SI8A 2FD2A 4JV0A 2YPYA 2OEMA 1BUXA 4ZHRB 4LJMA 4Y28C 5ETNA 1ZM2A 4CO2A 3E8OA 5IT9U 1PG5B 3E01A 1FFSB 2DY9A 4Y6IA 3ZTSA 2Z2MA 2HQ3A 4U8YA 2HS4A 4IFYB 5B09A 3R8YA 4KRWA 1KKHA 2CPFA 2HBRB 2J8SA 2KT2A 2Z0GA 2ZBCA 3A12A 1QE1A 4MAKA 2YPZA 3SDEB 1G2EA 1FJ7A 2FHKA 1C0TA 1UKUA 1XN9A 2HQDA 2AX0A 1NH7A 2OKQA 3J7AN 4WXOA 1Y5IB 1HWKA 1FWKA 4K2JA 3K57A 1DTQB 4I4BA 1ACMB 3RJMB 2XI2A 4RW9B 3DOKA 2HBQB 4E0DA 1YRUA 1G7CB 4DUTA 2CWKA 3UVJB 5KFNA 3L09A 4ZMMA 3I0SB 4GMKA 4OYWA 1REVA 5KAKA 1NUEA 1L3VA 3CCMS 4A8MP 2HHPA 1KQFB 1M5OC 1IXKA 1XQIA 4ZP8A 2R8GA 2V4JA 4ECXA 4JI0J 4CH1A 1YJRA 1HHQA 4NI2A 4F0KA 5E0OA 4DR7J 1TKXA 2ZVIA 3O5TB 5U47A 1Q78A 5IZHA 3S7RA 4DQQA 4OYZA 1QTNB 3H2LA 3KMQA 2YNIA 2KFZA 1YWXA 3AQOA 3ELHA 3U27A 2ZJQQ 2YTCA 3IWXA 2BM0A 2I9SA 2PEBA 1RWVB 1TL3A 3MR5A 1KLMA 1PKUA 3ZZ0A 1P9QC 3CC7S 1MMLA 1M0SA 1RTZA 1KRPA 2NXNA 2WVBA 4YDXA 2GHVC 5THWA 3AODA 3EPGA 1OS5A 4G3IA 3TQEA 1UWBA 5E3QA 4YB7A 4CO5A 2BEFA 3C6UA 4PWDB 4LFAF 1UCNA 2QMUB 4K4VA 3G82A 1PJ7A 2MKJA 3OR1B 1X5SA 3UNYA 2WSCC 3W9HA 3H20A 3C6TA 4DLEA 4WFXA 4XPCA 1GTEA 3VAGA 1BC6A 2ROEA 2LQ8A 1EHWA 2ZJPQ 3T3FA 8AT1B 4I0WA 3MPUB 5D0GA 1ZOTA 2DTJA 1WF2A 2EVZA 4RNOA 3MF5A 4K4TA 3H25A 2B4VA 1HNIA 2A0FB 2IMOA 4DXLA 3FVYA 3PR5B 1Y11A 2CQ0A 1L3UA 1NSKL 3PX6A 2RIJA 3KLHB 2XMMA 4U6PA 1FFGB 3MM6B 2W4CA 2GAGC 1CLFA 2BKOA 3M6XA 2YKAA 1KQKA 1LV5A 4E98A 1YGYA 2KVIA 1HYSB 3ENVA 5AXNA 1F0XA 3A3PB 3BQ1A 2B7BB 2F9DA 2CJ9A 1S7HA 4NCAA 2E9RX 4WU2A 3UDVA 2EW9A 4ZPWR 2VPYB 4PZVA 1NSPA 3KOAA 4M1KA 3CDBA 4PABA 4ID5A 4P72A 4DX6A 3R7NB 1CBKA 2VFTA 1QSLA 1SV5B 5FDLA 3O2IA 2V8GA 4DSLA 2PN6A 2WBMA 2G2OA 2R2TA 2BE2A 1HARA 1UZDA 5HROA 2F3JA 2ZHAA 1UA0A 5IFMA 4FBUA 2F8MA 3UDCA 4N76A 2K3KA 3QO9A 1CSJA 1KSPA 1A6LA 2E7XA 1X5OA 3PRBA 4DQPA 4C8ZA 1YJTA 3M8QB 1XNRF 3R7BB 3VALA 3HO1A 4K8RA 3OFHA 2DGOA 1N33F 4DR6J 4K5RA 3D1HA 1M5VC 4BLGA 4KY3A 4DL5A 4XAKA 2MHEA 1TMJA 2B9EA 2XMJA 3EE3A 1NH8A 2HS3A 4K0KF 4CZCA 3HF5A 1ULRA 2CQPA 2YWGA 2FLOA 1C4CA 1TP7A 2QO3A 2KVQE 5B0DA 4RNNA 2KO1A 1PSDA 5EGYA 2YX1A 1WHYA 4NLTA 2OPRB 4HL9A 3QATA 3ZTQA 2QMXA 3DDIA 4YDDB 3D54A 3H40A 1RTIB 2GJIA 4OJHA 3RYLA 3SDEA 4J9UE 2DNQA 4F3OA 2Y8YA 3AB2B 4CI0B 3D0GE 3OXFA 4J9RA 3CCVS 2F1FA 5IT0A 4F4KA 3I9V9 2HRTA 1RT5B 1HWUA 5HI7A 5I3QA 1DTQA 5H1SV 3M6VA 2FUG9 4DR4F 5G4DA 3OSPA 3N0VA 2HFUA 4DDFA 1N32F 3FFIB 1IJFB 4ITSA 1L3SA 1U8SA 4PXEA 3LQVA 3ISND 4JI2J 1R0CB 1KONA 3G6YA 3I0SA 5LMUJ 4NASA 2P2CB 3ZZUA 1RT1B 2MMYA 1LWXA 1VS3A 2R7SA 1EP4A 5CCMA 2WOMB 3HFKA 3PYFA 2HLUA 3L95X 1D1UA 4MJKA 4P10A 3ZO7A 4A8QA 1ZA1B 4ELUA 3FBFA 3MEGB 1R8BA 2WZ1A 2ZOFA 4ZVGA 3PJ9A 4JBCA 2PMZD 1GMVA 2KJWA 4A4JA 3EZ5A 4RJVA 3A13A 4JI3F 1VCTA 4WCEQ 4F25A 2CJAA 1V3ZA 2WAQD 1PIEA 3LP0B 2MJNA 3M2UA 1X4FA 1RABB 2K1RA 2I5JB 2OLWA 3M32B 3P49B 3W62A 4CM0A 2GC8A 4WPAA 2LVWA 1NKEA 3N9UC 1M5SA 5CD4A 4OHYA 4CM2A 2EEYA 5HK4A 4DV0F 1HKAA 1AFIA 1F60B 4JV5J 4X64J 3MCMA 2EKYA 1CJUB 3BKFA 3TI0A 2QFJA 4EFAC 2YWHA 2VL1A 2MZTA 2MQMA 4OJGA 1IM6A 2R8JA 2HHTA 3H4DA 2E44A 4U9RA 4ZVQB 5J2NB 1T05B 5E3PA 3CT9A 4IO1A 4CNYA 4UZBA 2MZQA 2KHCA 3NP5A 1QD1A 1GMWA 2GCFA 2VKRA 4ZIVA 3J7YI 3BKUA 4DLGA 5G0RB 4USMA 4WZMA 3IGNA 5D15A 3G8QA 1Q16B 3T6BA 4QBUA 1W26A 3J80Y 2J0QD 4UW2A 4C8YA 3ICLA 4R8UA 5I4MA 2DR9A 1S6PB 1WTFA 2KTQA 4OZ5A 1VK8A 3KLHA 3NGDA 4PR6A 1PC4A 3IAM9 2EK1A 2KG1A 1N36J 3BYPA 2JLGA 3MM5B 2H9ZA 2GA7A 5IC6B 1FE0A 3ZNUA 2KXHA 1HYSA 4DQSA 5CA5A 2VDHA 3R27A 2A10A 3KLGA 1H2UX 3AY0A 1RAEB 1F5CA 2MJUA 2HKEA 5AXLA 5J2PA 1U25A 4YP3A 1S10A 1RT3A 2DHAA 4LVOP 3FSIA 2DXEA 2MQLA 4LRAA 5EX3A 4M94A 1SC4B 2HNZA 3VZIA 1RADB 2IRUA 1RAFB 4RU9A 4RO0A 1HQEA 3R3TA 2GMJA 2R7QA 1D9DA 2FLNA 3HHLA 4NLWA 5GAGU 4DCOB 1WF1A 4O44B 4F26A 1KS2A 2QV6A 1BQNB 3BF4A 2U2FA 3CJ8A 3ZZTA 1FNOA 2R2SA 1SL0A 1YITS 4F0HA 4HVZA 1RT4B 4C0BA 1MU2B 3SV4A 3R5AA 1NK6A 1Q95G 2PDAA 3M8QA 3NCPA 4OYXA 2CAJA 3UD5A 3MCOA 1RAGB 1X31C 2HWHA 2B7CB 2DR7A 3NXZA 3R9LA 3IRWP 4PAAA 1S72S 5KFJA 4C8MA 1MLAA 2FLLA 2DNOA 4LF2A 4RNFA 2EI5A 4LBHA 4QR2A 3LAKA 4QQBA 5HN0A 3U1NA 2E5JA 4QU6A 4U7UK 1TK5A 2BRLA 3DI6B 2KL8A 1AXQA 4F36A 2RNEA 1U6BA 2OPRA 2ZEJA 3C16B 3PFEA 1S1UA 4XO0A 2K3IA 4N47A 3GG0A 3TX8A 2FJEB 1IKXB 4O3PA 2PA8D 4DPXA 1HNWJ 2Z57B 2D41A 2IVFB 5JXSA 2DPJA 2CPYA 3UWTA 5LJ3Y 3GCXP 2W9CB 5CH7B 2LLZA 3AA8A 4OJ1A 3HHKA 5HVGA 1JXVA 4Z37A 2CG4A 4LREA 1W2IA 3LOUA 1ZAVA 1XR7A 5DG8A 2ABYA 1J2VA 3KLVA 1KOHA 1VQ9S 4OHVA 2Y3YA 4DUYF 1RAOA 1Q82T 2VA3A 1N88A 2PE8A 4KGMA 3I5CA 2XGQA 3KK1B 1T7PA 2L48A 2W4DA 1NK7A 2QYGA 4KPYA 4MK8A 3SSRA 1N34F 2YX4A 2VF3A 3U7JA 3BREA 3AB4B 4ETXA 2DNYA 4B3SF 3NNCA 5F8IA 2IJFA 1B99A 1RAIB 5F8MA 1RTDB 1Q7LB 3M6UA 1P1TA 3CB4A 2OPSA 2OH2A 4GO7X 5KFKA 2VC1A 1TAQA 2Y1LB 5MLCV 1RT6B 1Y10A 3M6WA 4B3MF 4NZ7A 2VZ9A 3DNCA 2M88A 1VQKS 2BQUA 4X66J 1NO8A 2LCWA 1CPZA 2P6SA 2AJFE 2R9LA 3MR7A 2AJ2A 4ZP6A 3RB4A 1JWWA 2HYIB 1SJQA 1TV6B 1SUQA 4B3OA 4DV6F 3FBCA 5EHHA 5IXUA 4P2XA 3TAPA 1NXIA 3EXYA 1D8ZA 3TZXA 1TUWA 3MECA 1JLCA 4HHJA 5FLXU 2V2KA 2C2ZB 4W92B 1VLOA 1RDRA 3DRXA 3UO0A 3CTRA 1T05A 2XG8A 1QTMA 1WACA 2KYXA 1TKDA 3CCJS 3VAIA 4DV2F 1X4BA 2GFFA 9RUBA 2ASJA 2QJ3A 2JOQA 1DLOA 3LP2A 2CPXA 1ZAXA 5L1JA 3M8RA 1YG0A 3JQMA 1EETB 3P4UB 5LOQA 2NLWA 1B7FA 4LR9A 1HD0A 1RBOB 2ZD1B 2FJBB 3PO4A 2E5GA 2ZVSA 1ZETA 1TL7B 4PKDB 1S6PA 1DQAA 3POTA 3HK2A 1SJ4P 2F4VF 2J9CA 4LF9F 2VQEF 2XMKA 4GO5X 1CULA 3TP2A 1TVRB 3QZ7A 2E1RA 1E6VB 1F5AA 4JOUA 4CLTA 2F9JA 5E41A 1GMWD 1ZZFA 3LGHA 4P2FA 2HZVA 2AX1A 1VC0A 2ZM6F 1FVQA 1X4DA 2X3DA 4I1TA 1LW0B 5K20B 3KYLA 2DKOB 3K0JA 2ILYA 1ZAWA 1AROP 1PILA 2DNKA 4Y2IA 5DS7A 1S77D 4ECSA 5ETRA 3OL7A 2NXJA 1Q5YA 1UJ4A 2CNKB 4CLZA 4B9VA 4K4SA 2PC6A 1FWLA 3CD6S 1T0TV 2FJXA 4IG3B 5GADI 1HBUB 3NGTA 2XQCA 5DDOC 1FDNA 4E2FB 4JI6J 5KFBA 3O1LA 3SMZA 1NDCA 4B9UA 4OZNA 4TY9A 3R1LA 4OHXA 2DY1A 4DSJA 1CS4B 1RT4A 4OYMA 4ECWA 2HSEB 5D4PA 3KG0A 4WFNQ 2M70A 3KUGA 1YK9A 5CCLA 1JJ4A 1KLNA 1XJWB 3MEDA 4UOHA 3HKZD 4M5GA 3HHLD 1Y5LB 3D6TB 1WEXA 2VBWA 4M5MA 1KQGB 4FYXB 1WTBA 4ENOA 1R0BG 3BQ2A 4JI0F 1CJVB 3QSIA 1FX4A 2VHGA 2J0WA 1NPRA 4FF1A 3AA9A 2EG2A 3DI6A 4DSKA 4C11A 4AXIA 2VBXA 2XO6A 4DR7F 3K5PA 3I9ZA 4L74A 3TW0A 2XGPA 3B8HA 1S6QA 3OW2R 2ZNYA 2XNQA 3Q23A 3T9NA 2YKOA 3I87A 1FKOA 4DL7A 2M5YA 1KTVA 3GJRB 5L39A 2KU7A 5D3GA 5F9NA 1R8PA 4DPWA 2AV5A 2B4OA 3AD9C 4IOAQ 5GMEA 1N8RT 1T03B 4OZ2A 1NZAA 4RKUC 1IKYA 5F3TA 1PYOB 1VBKA 1JJ2R 4QW8A 4IDKB 1NJXA 4FP9A 4RWXA 1X4AA 2BX6A 1B0PA 2ZDPA 3KK1A 2WRMA 3CCRS 1XMBA 3FRZA 3GFXA 4HT5A 1UA1A 2VG6A 3M2VB 5HLFA 4BC7A 2OFHX 4DV5F 1S1VA 3EVOA 4LT6A 5L1IA 3LPEA 2J7WA 4EI2A 3JS9A 4XIUA 3DLLQ 1HQUA 2BE7D 1G3OA 5T14A 4OZ3A 2DGXA 3ZZRA 5F8JA 1XNQF 1SJ3P 5HJXA 3OFGA 1U0HA 1RHJB 3BDPA 4RBUA 2WVDA 4DPUA 1JLQA 2XYHB 3CW2C 3HHDA 3GJQB 1VJWA 4ED5A 4ANEA 1KFDA 2MKSA 4O3RA 2VOPA 3DLGA 2ZOMA 3LW5C 3MMCA 3T1HJ 4N8OA 3GIKA 3BSCA 1UFLA 5CYMB 1S6UA 4DR3J 4DFJA 2W2PP 1T3OA 1UFWA 1XR6A 1IWGA 2CQ2A 4PG7A 3OBIA 2KRRA 4WP3A 4JUZA 2AGPA 1S4EA 5HMXA 1PO6A 2DBBA 3FBEA 4JV1A 2NXCA 2YX7A 4WP8A 4USTA 2PSZA 2MB0B 4MK9A 1N5TA 3EWGA 3B54A 5A8WA 5KT4A 3IAS9 3GV7B 4YR2A 4DX8H 1CG2A 4A48A 1CVJA 3RR8A 4ICLB 1HIYA 2CXEA 5DO2A 1S97A 1RWPB 4UF4A 5A6PA 2W24A 1JKHB 3I0RA 2JEIA 4J91A 3FK4A 4CO0A 4NCBA 1QUPA 3DLKB 3TEGA 4J5OA 1Q7YT 2YNHA 2RT3A 4UUWA 5FIIA 1IQZA 2O5DA 3W1YC 4ANDA 2BVZA 2VU5A 5HJYA 4YHHJ 4X65J 1NU4A 4WFYA 3FMBA 5KOWA 3SV3A 4DR6F 4KSEB 4RL1A 2GVDA 5L46A 3JYTA 4ES3A 1FRHA 4F67A 3THTA 1HWJA 2KDOA 3MPVA 1WDDA 2MPUA 3LGNA 5B0CA 3DRPB 4USHA 1C4AA 4X4SA 3J81U 1OYEA 1JLFB 1UAWA 4KYZA 4LF8J 2ILZA 3UR0A 3CSKA 4KO0B 5KFEA 2RJZA 1T11A 2F40A 3FUYA 1UJ6A 2FZCB 2ZBQA 4IG3A 4UQTA 1XMQJ 2AD9A 1KEKA 1FT8A 3PXGa 3IBWA 1HWLA 4HH0A 2D3ZA 4DL0C 3LP1A 1U1KA 5D4OA 4UOFA 3NEKA 2VC0A 3H90A 3VQSA 3US5A 4LF4J 2E1CA 3K59A 2GQ2A 4URQU 4EBEA 2DO4A 3I82A 2K8GA 2OP5A 1VRUB 2EKNA 1GTHA 3G2XA 4JI2F 5LMUF 4TU7A 3T9ZA 2DEJA 4P71A 2ATLA 1MWYA 1XBWA 1VQSA 4IRCA 5T41A 1QVFR 2YVSA 2IVYA 2E1AA 4CRJA 3G86A 3TAMB 1HNVA 1CQNA 3BBFA 4FYDA 1O51A 3JTPA 1S7IA 1E6YB 1ZTTA 1FNXH 5JMNA 5GADU 5J2QA 4PPDA 1MW7A 3FZ2A 3IC1A 1I94J 2DCLA 4Y2KA 4WFBQ 4WE1B 1AZSA 2PGCA 1S9GA 4NEYA 2M9KA 1QAYA 4GC6A 4L3KA 3HLUA 2RILA 3OTDA 4JYAJ 1F9HA 1RLCL 2J9DA 1N0UA 3I5AA 4EUVA 3OQ2A 2V4RA 4ECQA 5EDWA 1ICEB 5KFSA 5L1LA 3HULA 5F3ZA 5CZVA 1FXDA 3ZZOA 4X64F 4JV5F 1DAXA 1YJWS 1DFDA 4RR5A 3W2VB 4I2PA 4OQJA 4JI7J 3P5BP 1D0EA 4DFKA 1RWNB 3W8PA 2WONB 3CE8A 1LWCB 1S1TB 1HBNA 4C3LA 1NHUA 4G1QB 3V4IB 2W9BB 1OYDA 3L7PA 1UTAA 1HHTP 2HEKA 4NRTA 3W9IA 3DU5A 3RU0A 4LF5J 1RWOB 3MM7A 5B0AA 3G6XA 1X9SA 5CD4H 5B08A 4ZS6A 3LANA 2DCUB 3Q0AA 1V3RA 1HWIA 2BJ3A 2ZH5A 4GKKJ 2L9WA 1VR6A 4CQ1A 1NK9A 1FXLA 2J6TA 2V34A 4Q5VA 1FD2A 4FF4A 1IWAA 4X4OA 2OSQA 3W5YA 3NBPA 3MWBA 1N36F 2RUSA 4FF2A 3TNVA 1TL4A 2HLTA 2FHMA 2B6AB 1WHVA 3BO2A 1U8WA 4JI8J 3CJTA 3AAWB 2HVEA 1T9WA 3R5CA 4TYBA 1MSWD 2VJVA 1UZHA 2WHOA 3A3NB 1SIWB 3KHRA 3H5SA 4ED1A 3GONA 4ZCIA 1SCJB 1M1KT 4EMDA 5HBMA 4PYDA 4UOGA 2RMLA 4Q0BB 5HQLA 2HWIA 2IIHA 4ICLA 1T95A 4NMXA 1OQ3A 3OVAA 3X1LB 3MCSA 4LSNA 4PRFA 2R42A 2V8DA 4I7FB 4TLRA 1C1BB 2XHCA 1SB6A 4B3TJ 2LQBA 1I1GA 4MFBB 2POKA 1O8BA 1JNZB 1ZBTA 3O3LA 5KFYA 3BYRA 3KHLA 2VH7A 3HVWA 4CDIA 4ZVUB 8RUCA 3OT9A 5DM7Q 2ZC4A 4IQXA 3JSMA 4OYIA 2OPQA 4HI1A 4C0HA 3M8SA 1HW8A 2XYPB 3OL6A 3GIIA 5LM7E 3ITHB 2MHNA 1VC6A 3P5TL 3P45B 3QIPA 3BR9A 4DS5A 2FJDB 3RAXA 3GFZA 5DM6Q 4USWA 2F8EX 1S9EA 3CJSA 5LJ5Y 2WB1D 4WFZA 2C42A 5EN1A 2DH9A 3DRPA 1JB0C 4TN2A 1YQHA 5K14B 3MD1A 4CLYA 3VAKA 4AL5A 5A2QU 2M3DA 2J0SD 3PJXA 5IOLA 4ALZA 1S5ZA 1XNRJ 3VGSA 3S6EA 4KO0A 1JLBB 4ECVA 3T1AA 3MEKA 3JQJA 2VPWB 4DV7F 3OLAA 2GGPB 2VPXB 1VQNS 3CMQA 3UI3A 1HNWF 3M2RA 2HVZA 2MKCA 1DARA 1NPKA 2ZBIA 2FQQB 3MR3A 3MAAB 3FCVA 5B0GA 3LALA 2XEXA 1SI9A 3D4JA 3W3SA 3GR0A 1J27A 5AE2A 1VRUA 2QLFB 3EGWB 4LMZA 2QZ8A 4HEA9 4O3OA 2VIHA 3T1YF 4RU2A 1YBUA 2DNPA 2JEGA 2LECA 3N6NA 3D1QA 2QX0A 7AT1B 2C2RA 2OEKA 2FVRA 3BGUA 2JL9A 1F3VA 4GRSA 5EWGA 5AXMA 5M2RA 4TNOA 4TLQA 2XZTB 3VAJA 2ZH7A 1BWVA 2HW3A 4DBQA 1KVJA 4XK8C 1RCXB 3FMWA 3QJLA 1F9EB 4YB1P 1D3WA 3UPFA 4QOTA 2JSXA 5CZXA 2AWZA 3D6FB 2G0IA 1MROB 1R0AA 1RU1A 3DMJB 1C1CB 4X66F 4C3MA 3HFVA 1Q86T 4GVBB 2BACA 3N5BA 4WBFA 2VPZB 3RR7A 4ZP9A 2W2MP 1MMDA 3IG1B 2A3JA 3IBFB 3CCES 4I2QB 3D6MB 1FRKA 5D77A 2AZ3A 1I3OB 5JUMA 3GV5B 3CCLS 3K5OA 2YY3A 3DOMB 4DR2J 5IV3A 4ZK7M 2WW8A 2V2ZA 3D3BJ 3W2VA 1X0PA 2HFOA 2VOOA 3ENAA 3UCUP 4C3KA 4UOCA 4DL3A 2X7IA 4U7UD 5HAOA 1RKIA 2B9YA 3JAMY 1UVNA 1BGXT 4OI3A 2NR0A 2Q6CA 2R7RA 3KLFA 4G1QA 4ANCA 3GJSB 4W90B 2Q43A 2NXEA 2D1CA 1QSSA 5IS2A 4HKQA 4G6VB 3SQGB 3CNQP 2VG7B 3G96A 4H4KC 2HVIA 3B4DA 2G0CA 2IJRA 3PRVA 3BGRA 2OPPB 4DV0J 2RDIA 4DOZA 3M9NB 2CJQA 4RNMA 2HNYB 4DUZF 1IQTA 1WC5A 3OJSA 3A8KA 2W25A 1RYSA 3MMAA 4HI2A 3H0PA 4DL4A 2AW0A 2D3OR 4IH7A 2DPIA 4QCLA 5A76A 1APSA 5KG7A 4MT1A 2B6AA 1K0VA 1PAUB 4C2MA 5B7WA 2VBYA 3QSYB 4NL5A 4J9PA 2ZWOA 3J7Z5 1SVDA 2AKWB 4RW4B 3EGNA 1B64A 4R0JA 2OAUA 1VQLS 2RB7A 2LXUA 2W2QP 1WUUA 2HVDA 3TQ1A 1RTHA 1WG5A 4C6AA 2HRUA 1NB2A 5A8KA 2BW2A 4CO1A 5GAEU 4M63A 1N5YA 1JLAB 2YKNA 2IM0A 2UXCJ 3HT0A 2J8AA 3K2YA 3ISNC 1NM2A 3H7HB 1X4CA 4NLQA 4ILMA 2MGZB 4H4OA 4ZITA 4JI6F 3UDLA 2HHQA 5ETVA 2H3EB 2HHSA 1H98A 2OGUA 1SL1A 3E3XA 2KH9A 2CZVC 2W2NP 3TUZC 2FC8A 4NLPA 2V8HA 1Y3JA 3RW6A 4YN3B 3NNHA 4BCAA 4RWWA 3E01B 4F2SA 1HPZA 2XSJB 4C8NA 5A0YB 2G2ZA 2RHQB 5HP1A 2OD6A 4F4WA 2ZHOA 1QE1B 1R3NA 1RKJA 2O01C 1GXTA 1C0TB 1QAIA 2XTJP 1XERA 4IR1A 2XLJA 3LH2S 4C7QA 1NDKA 1CJKB 3MOZA 4K4XA 3WX4A 4YB6A 1TAUA 2Y1RI 4OHZA 1M5KC 2AYEA 3PO5A 4JI1J 1DY3A 5IM0B 3AJ2A 1FF2A 3PW5A 3DOKB 2AZ1A 4K4WA 5C42A 3BH6B 3CPWR 3NNAA 2CA9A 3TO8A 1GH8A 4F2RA 1REVB 4ZPBA 4IYQA 2GGPA 3RTVA 1KC8T 2DB1A 3E51A 1ZA2B 4X4UA 1SC6A 1R31A 1WSRA 1D8YA 2KB2A 4DG1A 4J9VA 1EKRA 2UUWA 2MZ1A 2H54B 1S9FA 3AD8C 2W7AA 2MQQA 5I42A 4NI2B 5ETPA 4QYZK 1TKXB 4ZPVR 1HW9A 1TFWA 3W65A 2HQFA 5KFTA 2KG0A 2I6WA 2YNIB 2AEJA 4ZDNA 3G87A 4GKJJ 1NMEB 2FVCA 2G13A 1HI1A 5M2UA 1PC5A 1TL3B 4V19X 2RKIA 1HNXJ 1H74A 1U1RA 1KLMB 1Y9OA 5D6GA 5I3PA 1KOOA 2GJFA 4QWCA 4PQUA 1NRKA 2CVEA 1VQYA 4NA3A 1KNZA 4P74A 4LIWA 4ATNA 3BBBA 4F02A 1NKCA 2CADA 3C6UB 3DFEA 4F4XA 2KZZA 3Q8VA 2Q66A 4K5SA 3GTYX 1OQ6A 1UVJA 2NS1B 4YFUA 3G82B 1MROA 4JV2A 3P96A 5F8LA 2HFSA 3OXGA 3RRGA 2XM3A 5D4LA 3M8ZA 4QIFA 3T1HF 2W9AA 3CGIA 2AQ4A 3IG1A 3T5LA 1JLEA 3ZXWA 4DR3F 4HT7A 1WWHA 3RUBL 2D9PA 1MNEA 5HO4A 3EPIA 2DXDA 2L9DA 1YSJA 1HNIB 4QJVA 3PW4A 4LF6F 2B9XA 3HHEA 1QLNA 4EK2A 3BO3A 3CCUS 1Y4ZB 4U96A 4C98A 4I64A 2D7SA 4ZLLA 3N6MA 3AXKA 2DNZA 5F0WA 1UL3A 3TA0A 4OX9J 3EX7B 3NWGA 4QR0A 3OR2A 3KTQA 1DJ0A 2XBPA 4K59A 5MAOA 4AYBD 1NKBA 2EXUA 1W25A 1HD1A 1KDNA 1NCLA 3CDWA 3ZZYA 5KFFA 3MMBA 4USJC 2CJXB 2J7KA 3FEYB 1FE4A 2KKHA 5ITHA 2HNYA 3K8WA 4YHHF 5L9XA 3IS9A 2EFVA 3MUTP 4ID5B 2VUGA 2QE5A 4CO3A 2Y1JA 3RGIA 1WG1A 2B8PA 1XTZA 4ZPAA 3HZGA 2GO9A 3QAEA 3KJVA 3CWJA 3PNIA 2BE2B 3TVYA 5HROB 1V6HA 3HT3A 5DG7A 2CQCA 3TJAA 3JSYA 2UXBF 2QLWA 4EO8A 2A2DA 3ILLA 3I4PA 2AJ0A 2UVVA 4U8VA 2BQRA 2A18A 2JVRA 3QO9B 3ILJA 3VAMA 4M5DB 4LQ3A 3NL0A 1Y3KA 3I4HX 1HBMB 2HNDA 2R7XA 4YS2A 4DV1J 2VQEJ 3ILOA 1S57A 1DBDA 2BDPA 1N56A 4D3GA 2RF2B 4ZN1A 4J9QA 1UW9A 2AEMA 4TU9A 2E1MC 2E5HA 2DD8S 2DNRA 3DHXA 2Y0BB 3Q8QB 1FKPA 3WBZA 4LF4F 5E33A 4ELTA 1MWQA 1EKSA 2P6TA 2UUBJ 4L76A 1Q4RA 4KGZB 2XSJA 5A0YA 3DM2A 3PG9A 2ZC3A 4KKOA 2X3GA 3W66A 1J5OA 3LO3A 1RT2A 4TY8A 3S8SA 4KPCA 4F0MA 2HK2A 2QA4G 1WOOA 1AYEA 3O6QA 3DXSX 4C97A 4OJ3A 4CLSA 1RTJB 1CJKA 1KD1T 1TQLA 3OTBA 2ZFHA 2XMTA 1RAAB 5IM0A 4DQRA 3H8YA 3T5KA 1X4EA 5DQIA 3OVSA 4AD6A 3KG1A 1I94F 1S1WA 4I56A 3KDNA 3QRRA 3E2EA 1RZMA 4L75A 3KFWX 3N4WA 1KP6A 2NZCA 4B9MA 2QL7B 3CMES 4MKVA 4JYAF 4X4NA 2Q1LA 1QAXA 2J5AA 4F50A 1K9MT 2UV8A 3MTJA 1SC1B 1EP4B 4F4AA 3BEGB 1UWAA 1FJCA 1N0VC 1S6OA 1RLDA 3LTOA 2PA3A 1YJ7A 2KRBA 2I38A 2B43A 4WJBA 5J1EA 5K8MA 2FVPA 3HP6A 4CH0S 2NCKL 1S59A 4JI7F 3QWUA 1RA7A 3OPKA 1FTCA 4LRBA 4MTPA 5LT5A 2ZBPA 2CG8A 1RA6A 4PXCA 4O3QA 2AT1B 3KJQB 4NRUA 4FS1A 3C14A 3M2UB 1CEZA 3BB5A 2YQ0A 2K1RB 3ULHA 3TARA 3JSRA 1UVKA 2WSEC 2YQ3A 1SKRA 1FTRA 2RE1A 1RUSA 1VQPS 2HIYA 4RNHA 4ILRA 1RWXB 4LF5F 4OL8A 2B3TB 5LSOA 3JB9k 2YXLA 1NPPA 5JJBA 4HH1A 4O4GA 1RAJA 1RBLA 3IM9A 4GKKF 4BWJA 2WCXA 1YVFA 4OI4A 1JNRB 1R89A 1N52B 3ETMA 3GYNA 3RB3A 3PHTA 3OTOJ 2LQ5A 3EGZA 2Y9HA 3PYDA 1SXLA 2MLYA 1UFKA 4DV5J 2XZWA 4CLWA 4JI8F 2C3PA 4PG6A 1YJNS 2ADBA 5CHCB 2ASDA 5IWAJ 3M30B 4Q45A 2BA9A 5I3UA 1XWLA 3CJKA 4R8UB 1XNQJ 2DYAA 2HFZA 2IJNA 5HATA 2JJ4D 2VFUA 2CPHA 2YNFB 4X4QA 3IWNC 4AL7A 2IY5B 4RBTA 2ROGA 4KTQA 1VIXA 1C0UA 2MSSA 5KFMA 4R25A 1R43A 3QBCA 5KG1A 4M5NA 1LWEA 4A8FA 3P6YC 3PDNA 2ZH2A 4ZVPB 3NAIA 2Q79A 4TYAA 3KLGB 4B3TF 2YKMA 2MKHA 2WVEA 5K5MA 3HHLC 2JRSA 2EBGA 5J2PB 1X7VA 3AXMA 1ELOA 1Y5NB 4PXDA 3BS9A 1RT3B 4EBDA 4IH5A 2BE9B 3PRDA 2O67A 4QZVB 2B56A 2I0XA 3TJ8A 2CPDA 1JX4A 1FDDA 2HNZB 5KFOA 2BJ8A 2K7JA 2ASLA 3C3LA 4FVCA 2IBKA 1HQEB 3IR5B 4IH6A 1JK9B 3VGVA 1FX2A 4YY3J 1U2FA 3HHLB 3EGVA 1D09B 1IJEB 1TKTA 3CJ4A 3TVZA 2UVRA 3DLBA 5DQHA 4G1IA 4F8RA 3RB0A 5KFCA 1CJTA 1K1QA 1RCOB 5KG3A 4NYZA 3Q22A 2PO4A 2KJVA 1RI7A 1JLGA 3MUVP 2KHDA 3B6BA 1VGYA 3FRYA 1R7IA 2P9EA 3HSZA 1M90T 4M5DA 2XMWA 3KK2A 1LOUA 1H2VZ 2AGQA 1HBMA 3FCHA 1V3SA 3LPYA 4YMEA 3OUYA 3SQOP 3V6KA 2XULA 1Q0NA 5KFXA 2RF2A 1VQ7S 3AOAA 3MAHA 3QYYA 4FYVB 3RAQA 3U1MA 2IVMA 2F5GA 5GAHI 4ZIWA 2H48B 5IT9Y 2B0GA 4V1Ak 1XMOJ 1T9YA 3CJ2A 4DZ6A 3HJFA 3CCSS 3QZ8A 2RD5C 1GX5A 2RQMA 1BD6A 4PWUA 4ZCKA 1TTHB 1S1UB 3H2UB 2YWKA 2CPIA 3R5GA 2BM1A 4RW8B 4ELVA 3ZTOA 3WX8A 2ZKTA 5KG4A 4KH0B 3DN9A 3IR7B 4R5PA 4FPIA 1RHUB 1MN7A 2ZE2A 3GCWP 3QT5A 3EDQB 2L3MA 1RTJA 1JJCB 4ZVTB 3IR6B 4NLUA 2CZ4A 1DQ9A 2VG5A 3V6DB 4DV4J 1AFJA 2G9OA 2RU3A 3OV7A 3NAHA 3I55S 1IKVB 3SSSA 4FKYA 2CDQA 4P2MA 5BJRA 2C28A 1LWFB 3HD1A 3NGUA 3DDKA 2PI5A 2OI2A 4MYTA 3D6HB 1NZ8A 1U1QA 1QSYA 2HMIB 4DPTA 3GLJA 3RBEA 4QWEA 3UN2A 3QT8A 2ZH4A 3K58A 2Q3PA 4ZA1A 2LU1A 2VODA 4MH8A 1NEEA 2BZ2A 2N7YA 2GQQA 4DR2F 2RSQA 2CNLB 4MK7A 2MTLA 4EO6A 5CABA 2LEAA 3C46A 2RHSB 2OPSB 2LXIA 1VQ4S 4DMZA 2CJYB 3PTWA 2FIUA 2IBOA 2KI2A 4ZVRB 5C24B 3FC9A 2UZAA 3R1HA 4NXNJ 2R7UA 3DLEB 2QLJB 3HVRA 1OIAA 2WTFA 3Q2SC 1WKLA 2CRLA 2W7PA 2V63A 4EZ9A 4DZDA 3CCWA 2HHWA 3EDRB 4F04B 3C2PA 1SUQB 4B3OB 2B9WA 1WHWA 1EX8A 3ADAC 3CCQS 3D3CJ 2G0JA 3V81A 4O4RA 3I32A 3DCAA 3MECB 1JLCB 1HI0P 4NX9A 3IRXB 2NQPA 1YIJS 1BMQB 2JC1A 5KFQA 2FGCA 3MUMP 2AJQA 1UMJA 2ZITA 2XO7A 3TANA 1DLOB 2M2BA 3LP2B 1SL2A 2UUCF 2LDYA 2CNNB 2CQGA 6AT1B 3HX9A 1KHWA 2FLPA 3MFIA 4NYPA 4CTAA 1N5SA 1UEUA 1U1NA 1WELA 4DV3J 1HI8A 3M30A 3T19A 3ONQA 2ZUGA 4J9MA 5EWFA 4C8OA 4LF7J 3BQ0A 4HHUA 3FDSA 2RRBA 3RBZA 2OELA 1OY8A 1WDTA 2OTJS 3J7A1 3POTB 2C3YA 3HMJG 2YNFA 2R3VA 2YWWA 2ZJRQ 4WIIA 2HRYA 3Q86A 1CULB 2P9GA 5GMKa 3PW2A 4DFMA 1VQMS 1RHQB 2UXCF 3WDOA 4AL6A 2J76E 3V5RA 1DURA 5T7LA 2N3LA 3MPWA 3VWSA 2YKPA 4IG0B 2R8IA 3MXHP 3HFZB 4DI6A 1FRIA 1H7WA 4M95A 4KGVB 3GG1A 2MLXA 1QJHA 1C2PA 5D0HA 3EYZA 3DC2A 2CJKA 4IRKA 3QT6A 3SCLE 1D9FA 5CAAA 2UUAJ 1FRJA 4NLGA 1N5QA 2AP6A 4WXWA 1RWKB 1ZYQA 4OX7A 5KG5A 1VLYA 1FFWB 4OLOA 4C8LA 4NWBA 1PYTA 2CUYA 2PFDA 1T9UA 5AT1B 2G4BA 3HVTA 2GW8A 4FPRA 3UN3A 4N56A 5AXKA 2FDNA 1B0TA 4JI1F 2VA2A 1AB8A 3RZAA 2XY7A 3W60A 1B4SA 3ET6A 3BO4A 2IFXA 5J2MA 3Q8SB 2MDAA 2EFNA 3D28A 3CDEA 4LVNP 3MEDB 3NMRA 1YJUA 3F56A 1UETA 5LXYA 3J7ZT 2JEJA 3RBXA 4B17A 3A8EA 4NA1A 4ETZA 2XWXA 2P9CA 2HAIA 3GYXB 3TX0A 2EFQA 1BLUA 4B02A 2KXFA 4WYLA 4CYUA 1IBKJ 4LSLB 1K0TA 1IKWA 4MIBA 4FKXA 4C11B 1N6QB 3ENWA 3GR1A 3J81j 3UW1A 4WYWA 1S4FA 5IV4A 1I6JA 1HBOA 2JLEA 3D68A 4NLSA 3UDEA 5DQGA 3RW7A 1S6QB 3F73A 1U45A 2PT0A 4DV7J 3BPDA 3Q89A 4GKJF 1FKOB 4RW8A 4J9LA 3BN4A 3MCNA 1HMVB 2HWTA 2HZAA 3VGTA 4ED4A 1HNXF 4ZVEA 3H5XA 4NCGA 5D3GB 4X4PA 1K47A 4QIGA 2R8KA 2N3OA 2E5LJ 5L9NA 2IHR1 1FEEA 3V6DA 3P8BB 2IAJA 1IKVA 1IKYB 5C25A 1M1HA 3D9BA 2DGTA 4OI2A 1VRQC 1LWFA 2MQOA 4HLBA 2UP1A 5HL7Q 3T1YJ 2LQ9A
chains in the Genus database with same CATH topology
1FRXA 5I3UB 4K5RA 3D1HA 6FDRA 5B0GA 3C8YA 3KNAA 1P27B 5BYRA 3LALA 3MTKA 3CJKB 2HMIA 2VG6B 1M5VC 2XEXA 5HLFB 4DL6A 2GHPA 3G6ES 1SI9A 1CC8A 2A2CA 3B4MA 2ZD1A 2CPEA 4DL5A 4XAKA 5F0UA 1S1VB 3VAFA 1U1MA 4QYRA 3W3SA 1YJ9S 2MHEA 3GR0A 4U67Q 5AE2A 4X4VA 5KFPA 1VRUA 5KFLA 3ZFVA 3EGWB 4LMZA 2QZ8A 2XMJA 4HEA9 4KR0B 4KC5A 4O3OA 1VRTA 1N54B 2YWEA 3T1YF 5CQGA 1NH8A 2HS3A 4RU2A 4K0KF 4CZCA 3HF5A 2DNPA 1HQUB 1ULRA 3PM9A 2JEGA 2CQPA 2LECA 3N6NA 2YWGA 5H9EJ 3D1QA 3DOLB 1C0UB 2FLOA 2GQCA 4NYOA 3K5NA 2EK6A 1TVRA 1LQ9A 1C4CA 1TP7A 1Q8BA 2C2RA 1E6VA 2MY7A 1KN6A 2QO3A 5B0DA 1H0HB 1Z4UA 2LQJA 4RNNA 1GAOA 1LWEB 2KO1A 1PSDA 1U2RA 2CJBA 5EGYA 2FVRA 1Z1ZA 4KBIA 2YX1A 1JLQB 1WHYA 3WC2A 2JFKA 4NLTA 2OPRB 4HL9A 2YKMB 3BGUA 5K9FA 1VQOS 3CMAS 2JL9A 2I2YA 3OFFA 2VB6A 5EWGA 5AXMA 5CYQA 5M2RA 2V0NA 4TNOA 4TLQA 2QMXA 5H9FJ 1FESA 3VAJA 2ZH7A 2HW3A 1KVJA 4DBQA 4YDDB 4XK8C 1K73T 3D54A 3LUYA 4K4YA 5C24A 4OX9F 1DTTA 3DLGB 1LW0A 3H40A 1RTIB 2GJIA 3FMWA 4OJHA 3RYLA 3QJLA 3DLEA 3SDEA 4YB1P 3BSNA 1VIOA 2DNQA 3MMCB 1FDBA 3H59A 2MZJA 4F3OA 1D3WA 4AE5A 1YRXA 3UPFA 2LEPA 2VFVA 4PG4A 3AB2B 1FD8A 3TR5A 4QOTA 2JSXA 2VBZA 5CZXA 4CI0B 4JI4F 3D0GE 5A8RA 1NJYA 3OXFA 5KG6A 2ZZNA 2AWZA 4J9RA 1S49A 3CCVS 4C8KA 1RWUA 2F1FA 5IT0A 4F4KA 3I9V9 3QWPA 1RT5B 3MI7X 2KT3A 1HWUA 1MROB 2GMLA 3TOQA 3FZBA 2YH1A 5HI7A 1R0AA 4DF8A 2V94A 5I3QA 4J9KA 1DTQA 3DMJB 1C1CB 5H1SV 3M6VA 2FUG9 4DR4F 5G4DA 4C3MA 4X66F 3OSPA 3N0VA 4WZQA 1Q86T 2MQPA 2AYMA 1HBUA 1TKTB 2BACA 3N5BA 4AQYF 2U1AA 4DDFA 1N32F 2VPZB 2CQ4A 1VQ5S 2LA4A 3RR7A 1Z2ZA 4IUFA 1SH0A 3FFIB 4ZP9A 1NJZA 5SZTA 3IRXA 3TAQA 4KB7A 1MMDA 3IG1B 1IJFB 2A3JA 4ITSA 1L3SA 5A8WB 3CCES 2FJWA 4I2QB 1U8SA 4PXEA 3SEOA 3LQVA 4WK3A 3ISND 1FRKA 3BGFA 2PFFB 5D77A 5JUMA 3GV5B 3CCLS 3K5OA 3O44A 5DJBA 3H5YA 2JHEA 6FD1A 1KONA 2YY3A 3A1YG 4TKTA 1JLGB 3G6YA 3I0SA 3U1LA 5KOXA 3N79A 5HQ8A 3ZZUA 3QGPA 1RT1B 4ZK7M 3I0RB 2WW8A 2V5HG 3W2VA 3KK2B 3D0HE 2MMYA 4K50A 1VS3A 1X0PA 2HFOA 2R7SA 2VOOA 3UCUP 1OO0B 1SQEA 1YHQS 4KHMA 4C3KA 1EP4A 4UOCA 5CCMA 4DL3A 2WOMB 3M9OB 4UY85 1VBZA 3HFKA 2YNHB 1BQXA 2HLUA 1RKIA 2B9YA 3JAMY 1RP5A 3L95X 1IN0A 1D1UA 3OUYB 4ID8A 4MJKA 3CO9A 1UVNA 1BGXT 4OI3A 2NR0A 2Q6CA 2R7RA 3BGLA 3MR2A 3KLFA 1S1XA 3CC4S 4A8QA 4YR3A 4ELUA 4OFZA 3MEGB 1R8BA 2GMHA 4G1QA 4XDDA 1SKSA 5C5JA 3D5MA 4W90B 2L08A 2ZOFA 4ZVGA 2Q43A 3OFEA 2QSWA 4JBCA 2D1CA 3NMAA 4NLXA 2PMZD 2KJWA 4A4JA 5KG0A 3EZ5A 5IS2A 1QSSA 4HKQA 2A1BA 2HG4A 4G1PA 4G6VB 4Z2XA 4JI3F 3SQGB 2VG7B 2P5VA 4WCEQ 3G96A 3SZ2A 4F25A 4H4KC 2V9WA 2HVIA 3B4DA 2G0CA 2ERRA 3I5BA 5E5NA 1UVLA 3BGRA 4DV1F 2CJAA 2OPPB 4GC7A 1V3ZA 2RDIA 2WAQD 3MM9B 4QWBA 5F8NA 4DOZA 4I69A 3LP0B 2MJNA 3M2UA 3JYTB 3IWLA 3M9NB 2CJQA 1X4FA 4RNMA 1FK9B 2HNYB 2K1RA 2I5JB 3TUJC 3UD3P 4DUZF 2ZH8A 2OLWA 3M32B 1IQTA 3P49B 3OJSA 2V8VA 3I96A 2GC8A 2W25A 1TR0A 5ADZA 2LVWA 5KT7A 1NKEA 3N9UC 4IG0A 1RYSA 1M5SA 3MMAA 4OHYA 2BQ3A 1QVGR 1L3TA 5AE3A 4HI2A 2DIVA 4DV0F 4DFPA 2OO4A 2QA1A 1AFIA 3IO1A 1F60B 5EX0A 4DL4A 2AW0A 5D78A 3VR1A 2EKYA 4R5PB 2D3OR 4ZCMA 4FS2A 3PW0A 4IH7A 1NK0A 5L8RC 2DPIA 2ZE2B 4QCLA 3TI0A 2QFJA 1APSA 5KG7A 4EFAC 2YWHA 2UUBF 2KFYA 2VL1A 3M8PA 3J7YU 2HIQA 2MZTA 2B6AA 1FEHA 2MQMA 4OJGA 1K0VA 4Y3CA 1RGVA 4C2MA 5B7WA 2J0XA 2VBYA 2R8JA 4NL5A 2X1AA 2HHTA 4J9PA 3H4DA 2E44A 4U9RA 3J7Z5 2VG5B 1LK7A 1XR5A 4RW4B 4QW9A 2MZRA 2LXFA 3EGNA 5J2NB 1B64A 1T05B 4R0JA 3CJ0A 2OMLA 2YNGA 3VCDA 5E3PA 2OAUA 1VQLS 3CT9A 1ZM4A 2RB7A 2LXUA 1TUVA 4IO1A 4CNYA 1T03A 2VONA 2MZQA 2KHCA 2CKWA 2OD4A 3NP5A 4EBCA 3TQ1A 2XWYA 2GCFA 2VKRA 1RTHA 1WG5A 4F3QA 4IFVA 3J7YI 2HRUA 3LP1B 4DEZA 3HHNB 4DLGA 5G0RB 4WZMA 3HPOA 5A8KA 1JIHA 2BW2A 4CO1A 5GAEU 4M63A 3IGNA 1N5YA 4RW7A 2M8DB 3G8QA 4IDKA 5DLGA 4X62F 4YEAA 4ZOSA 4DN0A 1Q16B 1JLAB 2E7WA 2F8HA 2LEBA 3T6BA 2YKNA 1HHSA 1YRTA 4NMLA 1S0NA 4QBUA 2NREA 5KFAA 3Q2TC 3J80Y 2J0QD 2IM0A 4UW2A 4C8YA 3ICLA 5F41A 4R8UA 4OZJA 3M2VA 2C22A 2J8AA 5I4MA 3K2YA 3ISNC 2DIUA 2XLKA 1L3KA 4YUDA 4BBYA 2DR9A 1S6PB 1X4CA 2IRYA 4NLQA 4ZCLA 4H4OA 3FNNA 5D4NA 5B0EA 1WTFA 2MGZB 4F4ZA 1IBMF 2KTQA 2DNHA 4JI6F 3UDLA 4Q44A 4OZ5A 2HGLA 3RBDA 3PVXA 2HHQA 4BHQA 2XCPA 5GAEI 4DN9A 1H98A 2HHSA 1VK8A 3KLHA 1SL1A 1F2GA 3E3XA 3NGDA 2KH9A 4PR6A 1PC4A 2LKZA 3IAM9 2CZVC 2EK1A 3TUZC 2KG1A 4N8NA 1VBYA 2O66A 2FC8A 4NLPA 1SJFA 2V8HA 4LUBA 2JLGA 3MM5B 2H9ZA 1Y3JA 3RW6A 3NNHA 4BCAA 2GA7A 4NLDA 3PV8A 4RWWA 3FEXB 2R8HA 4DL2A 2BANB 4YOEA 1FE0A 3E01B 2KXHA 4WU3A 4F2SA 1HYSA 1HPZA 3AHPA 4J9NA 4DQSA 3GIJA 4PXBA 5CA5A 2XSJB 1X8DA 1HNVB 4C8NA 5A0YB 3NS5A 2A10A 3R27A 4Y2CA 2R7TA 3KLGA 3KLIA 3G71S 2RU9A 2AF6A 1H2UX 4LSLA 5HP1A 3AY0A 4DS4A 1F5CA 2MJUA 2OD6A 5AXLA 4F4WA 2ZHOA 3DRSA 1U09A 4TXSA 1U25A 4TU8A 5J2PA 2IMWP 5D8HB 1N6QA 1QE1B 4YP3A 5J2QB 4P6QA 1R3NA 1S10A 1RT3A 1RKJA 3DYAB 1LFPA 2DHAA 4YB5A 2O01C 4LVOP 2IM3A 1W2BR 1GXTA 1C0TB 3FSIA 1QAIA 1XERA 2LMIA 4HTJA 4IR1A 2MQLA 4KE5A <