2SAKA

Staphylokinase (sakstar variant)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
SYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOKINASE
publication title Three-dimensional structure of staphylokinase, a plasminogen activator with therapeutic potential.
pubmed doi rcsb
molecule tags Plasminogen activator
total genus 22
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.130 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2sakA00
1C78A 1SSNA 1C77A 1C76A 1C79A 1BUIC 2SAKA
chains in the Genus database with same CATH superfamily
2L00B 2DAJA 4LLGM 4WWNA 2KX3A 2FAZA 3UIPB 1DYQA 4L23A 1F0ZA 2KO3A 2QSDA 3TSSA 3P4SB 1BMLC 3HRDD 2QEJC 2XK5A 3QX1A 1I4RA 2Z59B 1YJJA 4LNFA 1I4XA 1ZGUB 1JALA 2KFJA 4EZKA 1Y8RC 3K9OB 1HE8A 1TKYA 4DDGD 1NENB 4P16A 4KX6B 1AYFA 3VUXA 1E6EB 1HZ6A 2G45B 1R4MI 1OGWA 2D07B 2INNE 3H1UA 2CHXA 3NZUA 4JWUC 1DOIA 2AQ1B 1L0VB 2ZVNA 4LK0M 4OZAA 1FEHA 2W3RA 4C56C 2TSSA 1HZ5A 4ARCA 1KFYB 5C23A 1RLFA 4IM0A 2RD0A 3VUYA 3E56A 5H92C 1GAQB 4YXDB 3DHHC 4ICUA 2K39A 4IUMB 3V60A 2ACZB 5IN7A 4ZRQA 1NDDA 1KH0A 3BVMA 3IG3A 4MGYE 4FULA 1R4MB 2BTEA 3KYCD 4PS8A 1I4QA 1I7HA 1LQBA 1UELA 2KWVB 2K8CA 3K9PB 1WSPA 3VR9B 4GSWA 4RGMA 4LNOA 2NR2A 1EF5A 4L1BA 2CR5A 2HE7A 2PMVA 2M0AA 4GMVA 4W9LA 1CJEA 5HI1A 2KFKB 4NAWB 4TUUA 3VVWB 4PS7A 2BVCA 1P7EA 5E6JA 1ZXIA 3UGBB 1U4AA 2WXHA 3R3MA 2LJIA 4GLSC 3AEBB 1SSNA 1C77A 3Q6BA 3R2TA 3HUIA 1P98A 1V1PB 4W9FA 4MDKE 4BKSA 4BOSC 1N6ZA 2BS3B 1E9MA 4HK2A 3EHVA 1X1MA 2L0FA 3GOEA 3U7DA 1F2RI 3BVZA 3P4PB 4WQMA 3AE1B 1STEA 2ZW1A 2LRUA 2RR9A 4MM3A 1TT5B 3W5VB 1GC7A 1F52A 3RNCC 3U30A 1EWYC 1WF9A 4IM3A 3VRAB 3EGRA 3TL5A 4YTNB 2GOWA 2K8HA 4DHJB 4N59A 5EDSA 5D94A 2VZKB 3Q8AA 2NVUI 4N9F4 1LO5D 1WFYA 4HKQA 4W9EA 1WIAA 3ZTCA 2VRRB 2PE6B 1UWMA 2SEBD 4Q2JA 1VRAB 1JQ4A 2MJ3A 2RPQA 3RNGC 2IO2B 1JWSD 1TBEA 2RMMA 5IA7A 1TTNA 3ZXVA 2KYWA 2WXGA 2O2VA 2KT7A 1GUAB 3BIID 2LRWA 2D3GA 3Q3JA 3V05A 1GOZA 3P1MA 3I63C 4WJNA 1VZ6A 2IO1B 3NZ3A 2L76A 2A5UA 2MH7A 3ZYYX 2QCZA 3Q3MC 4DWFA 1PUTA 1ZKHA 3AE8B 1NI2A 2BYTA 1TGZB 3RPFC 3SHQA 4KKJA 1WGRA 4O1NA 3Q8CA 4R3DA 4JX1C 1SGHA 3NVVA 1FRRA 4LDTB 1H4RA 3Q3OC 4JE3B 1OQQA 2EELA 1WJ6A 4IOIE 4GIVA 1V97A 2GMIC 3RT3B 2OHFA 5CTRC 4DQOC 5CHFA 4BZAA 4NY0A 1UF0A 2K9XA 3AN1A 1XXGA 4A3OA 2WNMA 3FAHA 3T3NA 2M56B 1T6BX 4RGTA 4USAA 3AE9B 4IWQA 1WJ4A 3PRZA 5EE1A 1AARA 2BWES 3VQIA 1WGYA 4DHZE 1UZXB 2UYZB 4P6VF 1K51A 1HTQA 1WM2A 2KKCA 3Q69A 3TCAA 4NQLB 2NBUA 5AEKB 2IO0B 3I9V1 1UBIA 1FXIA 1JRUA 1K50A 1M4VA 3MTNB 5JH5C 3BYYB 3VTUA 2YVCA 5D3DA 3AMZA 4KGRA 2LVQA 2HD5B 4NJ7A 5IOIA 3ZDTA 4C80A 4F1SA 2LI5A 5AZFA 3ZNID 5G2NA 1BT0A 3PSEB 3TEYA 3LXFA 2JY6A 1SE9A 5BYQA 2PE9A 2BB5A 4B95A 2K5PA 4ZHOA 3IBEA 5LXHA 3ALBA 3I57A 2KTFA 2LHEA 4WJQA 1J7BA 4KSLC 3T9LA 1S3SG 2JUOA 2ZZPB 1AW7A 2KDEB 4K7UA 1NVID 4WWMA 1BUIC 2NPTA 2NPTB 3E9SA 1ISNA 3FILB 3WA0A 1GC6A 1WJUA 2IGGA 2LZ6A 5C1ZA 2Y5CA 3QK0A 2D11A 1BXTA 4W9DA 2N9KA 2WXMA 1FFUA 1SJED 1V49A 2K6QA 1TIFA 3KUDB 1UWXA 1YOVB 4XYCA 1TS4A 1NBFC 3D32A 4MGIE 3LDZE 3WCQA 1YQ4B 4HPPA 3DBRI 4ZRJA 1QOAA 1UD7A 2M19A 2KANA 3APDA 1T0RC 2LWPA 2ZNVB 1LM8B 1WXSA 2ZPNA 1PGAA 4TKNA 1MFWA 2JF5A 2YEPB 4NJCA 1CMXB 2HTHA 1WE6A 4M8MA 3FKYA 2LHDA 3PGEA 2GBKA 1YX5B 2HTME 4II2B 2ZJDA 2KXJA 1F2RC 3WALA 1WX9A 2WDTB 1QILA 1YQ3B 3V62A 3RNEC 2FUHB 1GB4A 3P4QB 2REXA 3TIXA 3ML9A 1CZPA 3DBRB 4RH6A 2C7HA 4YT0B 4MH0E 3RMKC 1C4PA 2Y3AA 3PT2B 4DXAB 2GBMA 4OVZA 2YLMA 2I2YA 4FA6A 2IYDB 1Q1OA 3H8HA 1B1ZA 2M17A 1PDXA 4M0WA 1Z2MA 3CSTA 3B1LX 2CU1A 4RF0A 1SIFA 4DHJD 2DZIA 1YN5A 3AE4B 4KZCA 2GBRA 3Q3NC 2LGSA 4J3OD 4C7YA 2V1YA 3NVYA 3J9CA 3H9DA 4N58A 5LNK1 4C4VB 3O13A 2LGIA 1QZEA 3GZNI 2QILA 2G9HD 2LASA 1F1HA 4QAYA 3BWUD 2D3BA 2RGFA 3AB5A 1EUVB 1T0SC 4KGSA 4AOFA 2MEKA 1JRPA 1MHHE 1XLNA 1E8YA 2XBBC 1SBBB 2CKHB 1N63A 3L4PA 4MACA 2MW5A 2C7MB 2LD9A 2K22A 4IDIA 3WIMA 2CU3A 4EE2A 5G5GA 4NQKE 3Q2AC 2DAFA 4JWSC 2X8XX 1WXQA 3RD2A 3SEBA 3MJ5A 3U2SC 3U7ZA 2FCMA 3Q3FA 3NS1A 3A9JA 1IBXA 1M94A 2RDHA 2L8JA 3SR6A 3I3TB 2BS2B 3DVNU 1JWAD 4RFBA 1LFDA 2V3NA 2WX0A 4JPSA 2KJRA 5JXVA 2JX5A 3Q8FA 1V8CA 1WX8A 3L17A 4EKUA 1V80A 3H7SA 3A9KB 1Q0WB 2MBQA 3DBSA 3DQVA 3SFEB 4AS1A 2LUEA 1ET6A 2W3SA 3DWMA 4JL9A 3PZ7A 4B0EA 2WYQA 1FIQA 2IGDA 2WXNA 2ZW0A 2GRIA 1E7PB 4ACFA 3IT4B 4YSZB 2JZZA 2WHIA 1VR9A 3UF8A 2IY0B 3PVLA 4IWOA 4GXBA 3NRZA 4I6PA 4HJKA 1P0RA 3EA6A 2Y5BB 2XK5B 3TBLD 3UINB 1SIJA 4DXGA 4F8CB 4YWGG 4W9GA 4GB9A 1VDVA 3AE2B 2WXOA 4EZJA 1RAXA 3N30A 1WRIA 1N60A 2JYEA 3R2IA 2QDFA 2PIAA 4GOCA 4PYZA 2J53A 2ON8A 3DVGY 5E6OA 2N0SB 2V3PA 4CO7A 4DBGA 4DK5A 1YMHE 1FMAD 1P3QU 1XD3B 2WXPA 5HHDG 2FE8A 1VJKA 3AI5A 5CX3A 1EU3A 1WX7A 3GB1A 2KDBA 1L4ZB 4MT5A 1ZDXA 2KD0A 1WM3A 4YTMB 1MJDA 3AEDB 2EMSA 1J0GA 2LUMA 3APCA 1ACCA 3CIRB 4TQ0A 4RM9A 5AUKA 3L08A 4ANUA 1KLVA 4RNAA 1GJZA 1D4BA 4RCOA 2J52A 2I1KA 1MI0A 3TJPA 1PFDA 2OOBB 1ET9A 4PYUA 5AZGA 1IGDA 2JU6X 4M01A 2MBHA 3B2FA 3PO0A 4W9HA 4WURA 2AEHA 2MSED 3W1SC 2BYVE 1L7YA 3AULA 1MG4A 1LGRA 1AWDA 1WXAA 4HDOA 4KVGB 3W1YA 3QIJA 3GE8C 3JVZX 1Y56A 5EE9A 4A3PA 3IAS1 1UNSA 5G55A 1V5TA 4W9JA 2J0JA 4II3B 1WE7A 4F7ZA 1GB1A 2BYEA 2D3AA 2IZVB 1B9RA 2V0GA 3AE3B 4G11A 2HJ8A 1TY0A 2O6VD 1TJEA 1TKGA 3RNAC 2FCSA 2NCNA 2G4SA 4HPMB 4RM8A 4WQOB 1N61A 1K8RB 1RFAA 2NS5A 4RMAA 3DHGC 4WJPA 4YL8A 3VAWA 2B76B 4FN2A 4ARIA 1VZ8A 5AUIA 1FXAA 4MM3B 2WS3B 1MPEA 1RRBA 2WDQB 3LJ3A 1KLUD 3L10B 2DZJA 1SJHD 1DGJA 4D2KA 2KOXA 2ZCCA 1L5PA 2KHWB 4WAFA 3PZ8A 1HA5A 1G6JA 1FNVA 2L52A 5JHBA 4BAXA 2E3TA 4FHJA 5BYRA 2ASQA 1J19A 2BW2A 3UI3A 1KJTA 2MQJA 4XE0A 2K1FA 4TMAB 1Q10A 2GI9A 2WX1A 3HM3A 1ZPSA 1I35A 3ZJTA 4ANVA 4B6WA 2BKRB 3GS2A 4IW0A 1E8ZA 2LXCA 1NYQA 1OFFA 3ENEA 4MELA 3M3JA 4B0MA 2XN9C 4LNIA 4US8A 4OVVA 1P9DU 1WRDB 2M1MA 1ZE3D 1UGJA 5IKCM 4ZYNA 3ZXRA 1SE3A 4KIKA 1XLQA 2L32A 5FR6A 3ZGZA 3V6CB 3PS6A 4G3XB 2JRHA 2LVOA 3ZRCA 1UGMA 2DZKA 2C9WB 2KC1A 3JW0X 5GMVA 3ML8A 4YSYB 2LGYA 4GN1A 1YX6B 1UUPA 1L4DB 4OZCA 2BWFA 4P7IA 1D5XC 1QF6A 3H6NA 3SDLC 4FJYA 2WDVB 1YNTE 2M8SA 3H7PA 3M95A 4PK1A 4ZOHC 3ABVB 3HVDA 4NAMA 1WI0A 1I4PA 4HLEA 1J7CA 3UQBA 4W9IA 1Z5SB 4K3CA 1EF1A 1GG3A 4AJYB 1ZW7A 2L05A 4GDLA 2V4LA 3VTVA 3VRBB 4FHKA 1TS5A 3OAWA 3JYUA 3BY4B 1KF6B 2CS4A 2OJWA 1SF0A 5J2RA 1D5ZC 2AYOB 4ANWA 1YN4A 3L13A 2INPE 3EC8A 1TYGB 2H88B 1PGXA 1JWBD 1K52A 1RWSA 1WGHA 2J7QB 4M00A 1D3ZA 2KWDA 4IC7B 3N20C 1V6EA 2NMQA 3N1ZC 2WXLA 3URYA 3GE3C 4PT5A 5C2TB 3ZW3A 2G4DB 1J7AA 1ESFA 1P7FA 2HJ1A 2PEAA 4XC2A 3AM9A 2JZPA 3A1QA 2IY1B 3A1QB 3PPAA 5FK9C 2MX2A 1V1OA 1UH6A 5DPRA 1FXTB 1FFVA 1HEZE 3CMMB 4J6IA 1JW9D 1VCBA 3BINA 2J42A 1EM7A 2WGSA 4W9KA 2KZRA 3PREA 4HCNB 3SD5A 4AUQC 4BKTA 1T3QA 1IP9A 2FUG1 2WU2B 1NEKB 5BO4B 5D2MB 2BPSA 2KWCA 3B08A 4HDQA 1SXTA 4HWIB 2N7JA 5H8YE 3IHPC 4IM2A 2N9EB 4WAAA 1EU4A 4NZLB 4CQNA 1E7UA 1OQYA 4WWPA 2N1WA 2Q5WD 4KV2A 2KN4A 1A5RA 1TZ1A 4RF1A 3DVNV 2UU7A 3DBLI 4MJSA 4KSKC 3WAOA 2L83A 2KDIA 2K8BA 4BKGA 4A55A 1WXMA 3BVGA 2W9NA 2QHOA 1VZ7A 2JQRB 3HK0A 3PHWB 2Z0DB 1KLGD 1YJIA 3JSVA 3JSVB 2KQ7A 2INCC 4JLCA 3Q14C 4L2YA 4EEWA 5DCNA 3HVZA 2BKFA 4E3CA 1E5WA 2KTRA 2ZCBA 3DOWA 4OZBA 2BYFA 4W9CA 2BGFA 4OVUA 3DBLB 2JYTA 4WWOA 2G3QB 5DPWA 4M0WB 3RI7C 2O6VA 3QCAA 3ECIA 3KYDD 3L16A 1JCKB 5J18A 2INDC 1I4GA 2VZKD 2Y5PA 2FIFA 2JPHA 1QOBA 2KMAA 1FNWA 2DZMA 2K6DB 1RFKA 1ROEA 3CWIA 2DYOA 3MC9A 4MGZE 1H8CA 5E6NA 1ZP0B 2FIDA 1R7SA 2K25A 4GU2A 3CSFA 4K81A 3VH4B 1LXDA 1WMHA 1WMHB 3RUIB 3AEFB 2J0MA 1TS3A 3Q8EA 3VDZA 2D10A 2OEDA 1IUEA 1KRHA 2N7DA 1I4HA 3VHTC 4AWJA 4AJWA 3DHIC 4FJZA 2AL6A 2CJNA 2GBJA 4CHKA 2RPVA 3B2GA 1K53A 1GNUA 1EWCA 4XDDA 4H2AA 3C8YA 1V9JA 3A9JB 4M8NA 3QA8A 1IBXB 3CF6E 4ZHPA 4GDKB 4GDKA 2JXXA 3AEAB 2J0KA 5J17A 3ZNHB 4TV3A 5EE3A 5IAAC 1V5OA 3KVFB 4MEMA 1ZUD2 1OEYA 1XCQL 2BBCA 3OWEB 4GGQA 1SE2A 5D6JB 1WR6E 4LDTD 1TY2A 1L2NA 3A4SC 3LYYA 3EUB2 2EMTA 2ONQA 3ZNGC 3ZRFA 2FNJB 3AE7B 1GPXA 1D6EC 2R61A 3MJWA 3BK2A 2LGXA 5TR5A 4RGNA 4NNJB 3DBHB 4K7SA 2DHZA 5G5HA 1C76A 1KM7A 1CQVA 3AV8A 2K3UA 1RYJA 3PZDA 4MSMB 5KHQA 5CHWA 4US9A 2MWSB 2WXKA 2LVPA 2VH1A 4ZRPA 3AEEB 3VFKA 5I4DA 3SU8X 1QT9A 1ZXHA 1YJ1A 1OTRB 2L1AA 4LNKA 4ICVA 3L54A 3P42A 2MP2A 1C79A 2AL3A 3OLMD 2ZEQA 4PS3A 3KWVA 2G1EA 3MHZA 5FKAC 1MVKA 4DDID 4LTUA 4BBNF 3B0AA 4A20A 4YTPB 4FLHA 2KWUB 2YEPF 3PLVA 4ANXA 3ONSA 1WXVA 1T0QC 1JWMD 1HQRD 3R66C 2AWTA 2XEWA 4BBNC 1T5XD 2I1JA 2ZNVC 2JWUA 4HXDA 1WGKA 1FD6A 2ICIA 2AX5A 1I42A 1FPYA 1WWTA 3QC8B 4WJOA 2J4XA 4NJ6A 5LXIB 4A8XC 3X23A 4ASWC 2DX5B 1Q5WB 4WH4A 4E71A 2DENB 2ZVOA 1QKZA 4FADA 1V86A 1QOGA 2KDFB 1WH3A 3HHMA 3TUOA 3ZVVA 3QAQA 3C19A 5DPSA 2M0XA 3TEWA 2KMCA 3MFGA 3P4RB 2MJEA 2C60A 4HVBA 2LXAA 1TKEA 2IBIB 3MP9A 2R2OA 1R4NI 4A9AA 1C4CA 1P1AA 3APFA 3PHXB 5BMGA 2N7EA 4EOYA 1FCLA 1IYFA 1FM0D 4M02A 5IP4D 4I6LB 1WY8A 2FCQA 3V6EB 5FR3A 1L0YB 2WXJA 4E74A 1KOTA 3AE5B 1FRDA 2DYBA 3UIOB 5L95C 4KDIC 4X57B 1C4AA 4LNNA 2KFKA 4NAWA 1UBQA 2WWZA 2D3CA 1WYGA 3LB8C 1R4NB 2AQ3B 2DBYA 3RZFA 4EFOA 2FCNA 2D2QA 4YSXB 2V3SA 4URKA 1XEEA 3OG5A 4MH8A 3BYTB 3ZJVA 4TSSA 1V1PA 3NS8A 3QHTA 4FJVB 2M4NA 3NUHB 1FNUA 1XLPA 1A70A 2DYMA 1IGCA 2LEKA 1C78A 3QQ8B 4KZ0A 4ZDVA 4HROA 3DCGA 3DVGX 3RFZB 3N9YC 4JQWC 5JHAA 2WXRA 2I38A 1HTOA 1OEYJ 3NHEB 1WGDA 3V3XA 4TQ1A 3NJTA 4XZ4A 1C3TA 3M63B 2DNFA 2W54A 2NTTA 1E0ZA 4FXCA 4OW0A 2MBBB 1F77A 3ZQ4A 3NVZA 2MCNB 2C7NB 2PKOA 3NZSA 4AQ7A 2WXIA 1PQSA 3VH3B 4C00A 2MBEA 2WQYB 3L0WB 3P2BA 4BOZB 2WDRB 3RNBC 2MHJA 1PGBA 2PW9A 2L3ZA 3WAMA 1E8XA 4LCDE 3PLUA 1E7VA 2B3AA 3AE6B 5BMHA 4REZA 3PV1A 1QQRA 3WANA 3B9JA 4HEA1 3N1XC 1E10A 3AU5A 5GXGB 2KQ4X 2KN5A 3IFWB 1L6UA 4KIKB 2N9PC 2LMCA 5JZEB 2N9LA 2XNAC 1YQBA 4C7ZA 2MLBA 1XF5L 3W2DA 2MRPA 2NBWB 1RM6C 3U8ZA 3RYTA 2WU5B 1C9FA 4BFRA 1ZDVA 3HIZA 1D5MC 1WYWB 2V9HA 4XDCA 2BF8B 2PJHA 4A90A 3BZDB 2WLBA 3RULA 3I5JC 3N3KB 2JSVX 1L6VA 3H7PB 3QWZB 1T0YA 2MBOA 2KVRA 2RDGA 2KJHB 1E8WA 1XO3A 4BVUC 5TSSA 3EFUA 4KDLB 2GBNA 3R8BA 1KTKA 3TEZA 2X38A 4LJPB 3MC0B 2A4ZA 4GDLB 3W9CB 1YD8U 4MGKE 1FO4A 2KJ6A 4FBJB 3AEGB 2KVZA 3ZKJC 2IDYA 4P1BC 4RGOS 3ZUNA 3TMPB 3PTFC 2QIEB 5D7GA 2KLGA 3R7QA 2FBWB 1F9JA 3S2AA 2HDEA 1XT9B 2MA9B 3KW5B 3RN9C 3N1YC 3UQAA 2IO3B 2CHZA 3C0RB 4S0RA 3KWLA 2Z8LA 3AU4A 4HRSA 1QOFA 2H89B 5CHVC 4I6NB 2KDMA 2C5LC 1DOXA 2VH2A 1TS2A 3SFDB 3KLSX 3ZNZB 4XWWA 1NI3A 4IKGA 4HCPB 1XQQA 3KUZA 2RDBC 1IPGA 3T8MA 1JROA 3RCZA 3VTWA 2WP9B 3FC4A 4IG7B 2RSUA 2CJOA 2K0PA 3FILA 5LLIA 3EFCA 4AP4C 5L83A 2N4FA 3ZIMA 4K3BA 2JT4B 1QLBB 1PYWD 5T8IA 4KGTA 2IJ0A 2N1VA 2UWQA 3EECA 1FCCC 2BT6A 1VD2A 4MJSB 2BB6A 3N32A 1WR1A 1EO6A 4ZRKA 3MC8A 4LJOB 3PRPB 4KKIA 2DLBA 3R7RA 1SEBD 3A4RA 5AZHA 1E90A 2JWZA 3KH0A 3U52E 3IAM1 3ZJUA 3NOBA 4BKSD 3OJ3A 4WIPA 2PTLA 1N5WA 5D3IB 3AXCA 4ZRIA 2QMTA 2N9XA 2DWQA 2KK8A 2KTRB 1ZOYB 5EE0A 1OQRA 2BQQA 1J8CA 2ZPYA 3OJ4B 2KC2A 2KNBA 3QJZA 2QC8A 4P1CC 3TEXA 5BYSA 3U4EG 1WZ0A 4DHZB 1MG8A 2KQSA 3M62B 1S1QB 1WJNA 4B9KA 2O6VB 5HFYA 5C3JB 2PPHA 3V61A 3KUCB 3W5UB 3NVWA 1V2YA 1TZOA 2SAKA 2JXTA 3ETRA 1SB3C 1HXYD 3ZDMC 2KLCA 4UDUC 1ENFA 2BS4B 2KMMA 1DOYA 2CHWA 3W1SA 4CYEA 5KHOA 5HG2A 3DPDA 2W55A 4XX5A 2WXQA 1C1YB 1N5XA 2D5GA 2JZ3B 4DXFA 3P63A 3WAPA 1YN3A 4XGAB 2LFIA 2NTSA 4JGHB 3A33B 2EKIA 4NPNA 4C4VA 2KAJA 2IGHA 3O65B 3PRMB 3IXSA 5BMIA 1N62A 5HKHA 2V4IB 4HPLB 3DDCB 3GP7A 3RZWC 3Q8BA 5IO9A 2L0TA 3IT6B 2L7RA 3DBHI 3ZO5B 5DPTA 4HKZE 3MHSD 3KQ4A 1VLBA 2Z0EB 2GB1A 1AN8A 2KACA 2WXFA 4G0NB 3GZNB 3DWGC 4JIOU 3BK1A 4N6EB 3QARA 4ITKA 3VR8B 1YIWA 2LJ5A 2AQ2B 4MSQB 4G50A 1V81A 3AECB 2PVGC 2EKEC 3T3OA 1MHXA 3AH7A 3HM6X 5E6PA 2JVCA 2W82A 2IPKD 3NY5A 2QJLA 4K1RB 3X0WA 1SE4A 3A9KA 2PVOD 4OHJA 2GLSA 3IVFA 2MJDA 2NBVB 1JWUD 4A6QA 5MPOA 2LGDA 4EZLA 1L0XB 1NYRA 3VUWA 2JRIB 3VXWA 3ZTDA 4S17A 1XCTL 1WZ3A 3RNFC 1JMLA 2KX0A 4IWPA 4HJGE 2E6XA 3ZLZA 1CK1A 4XWTA 4K7WA 4EUTA 3NG0A 1WGGA 1XLOA 2MP2B 2OJRA 2PLPA 4ZYSA 2R2QA 2O2VB
chains in the Genus database with same CATH topology
1XLPA 2Y3AA 4LLGM 1A70A 2DYMA 4OVZA 1IGCA 2LEKA 2I2YA 1J7CA 3H8HA 1C78A 1DYQA 4L23A 1B1ZA 4HROA 1F0ZA 1PDXA 2QSDA 3RFZB 4M0WA 3TSSA 3VRBB 3N9YC 3P4SB 1BMLC 2WXRA 1TS5A 3HRDD 2QEJC 2I38A 4RF0A 1I4RA 1YN5A 3AE4B 3V3XA 4TQ1A 4J3OD 4C7YA 1YJJA 3NVYA 1KF6B 3J9CA 1SF0A 1D5ZC 1I4XA 4N58A 2W54A 5LNK1 1YN4A 2NTTA 1JALA 1E0ZA 4FXCA 3O13A 4OW0A 2INPE 2LGIA 2QILA 1F77A 3ZQ4A 1TYGB 2G9HD 1PGXA 1JWBD 1K52A 1RWSA 2H88B 3NVZA 2KWDA 3BWUD 2PKOA 3AB5A 4AQ7A 1TKYA 4KGSA 1NENB 2MEKA 4KX6B 1AYFA 1JRPA 4P16A 2NMQA 2WXLA 3URYA 1MHHE 1E6EB 4PT5A 1HZ6A 2WXIA 5C2TB 1XLNA 1J7AA 1SBBB 1ESFA 1P7FA 1N63A 2INNE 3L4PA 4MACA 3AM9A 2WQYB 2JZPA 2K22A 4JWUC 5FK9C 2WDRB 1DOIA 4IDIA 2CU3A 1PGBA 2AQ1B 2PW9A 1L0VB 1V1OA 4EE2A 4LK0M 4OZAA 1FEHA 2W3RA 5G5GA 4C56C 1FFVA 1HEZE 2TSSA 1HZ5A 4ARCA 1KFYB 1JW9D 4JWSC 3AE6B 5BMHA 1WXQA 3E56A 5H92C 3SEBA 2J42A 3MJ5A 3U2SC 4REZA 1EM7A 1QQRA 1GAQB 3U7ZA 4YXDB 3B9JA 4HEA1 1E10A 1T3QA 2ACZB 2FUG1 2WU2B 1NEKB 3NS1A 5GXGB 4ZRQA 2KQ4X 1IBXA 2RDHA 1KH0A 3SR6A 3BVMA 1SXTA 2BS2B 2BTEA 1JWAD 1L6UA 4RFBA 2N7JA 5H8YE 2V3NA 4JPSA 5JXVA 2LMCA 1I4QA 2N9LA 2XNAC 1I7HA 1EU4A 2JX5A 3Q8FA 4NZLB 4C7ZA 4CQNA 1V8CA 1WSPA 1XF5L 3VR9B 3W2DA 4RGMA 2Q5WD 1RM6C 2KN4A 4L1BA 4RF1A 2PMVA 2M0AA 2WU5B 1C9FA 1ZDVA 2L83A 1D5MC 1CJEA 5HI1A 4NAWB 3SFEB 4A55A 4AS1A 3BVGA 1ET6A 2W3SA 3DWMA 3PZ7A 4XDCA 1P7EA 4B0EA 1VZ7A 1ZXIA 2JQRB 5E6JA 4A90A 1FIQA 2WLBA 2IGDA 2WXNA 3BZDB 2WXHA 1KLGD 1YJIA 2ZW0A 2JSVX 2LJIA 4GLSC 2GRIA 3AEBB 1E7PB 1SSNA 1L6VA 4L2YA 3IT4B 1C77A 4YSZB 3R2TA 3HVZA 3HUIA 1V1PB 2RDGA 1XO3A 2BS3B 5TSSA 1E9MA 1VR9A 3R8BA 1KTKA 4OZBA 3TEZA 2X38A 3MC0B 2JYTA 1F2RI 3BVZA 4GDLB 3P4PB 3W9CB 4WQMA 3AE1B 1STEA 1FO4A 2ZW1A 3NRZA 3EA6A 3AEGB 1SIJA 2IDYA 4RGOS 4DXGA 4YWGG 3W5VB 1JCKB 1EWYC 2QIEB 1VDVA 3AE2B 5D7GA 3VRAB 1I4GA 3EGRA 2FBWB 2VZKD 2WXOA 2Y5PA 4YTNB 1WRIA 1N60A 2JYEA 3R2IA 2HDEA 2PIAA 1QOBA 4N59A 1FNWA 2J53A 2ON8A 2VZKB 1RFKA 1ROEA 3Q8AA 3CWIA 2DYOA 1LO5D 2N0SB 2V3PA 4HKQA 1ZP0B 1R7SA 1YMHE 3KWLA 1FMAD 2Z8LA 4HRSA 1QOFA 2H89B 2WXPA 5HHDG 2FE8A 1UWMA 1VJKA 3AEFB 1TS3A 3Q8EA 2SEBD 1EU3A 2OEDA 3GB1A 1IUEA 1KRHA 1L4ZB 2KDMA 1I4HA 1VRAB 4MT5A 1ZDXA 4Q2JA 1DOXA 4YTMB 1JQ4A 2MJ3A 3AEDB 2CJNA 1TS2A 3SFDB 3KLSX 4XWWA 1NI3A 2LUMA 1ACCA 2RPVA 3B2GA 1K53A 4IKGA 3CIRB 1JWSD 1EWCA 4XDDA 4TQ0A 2RMMA 5AUKA 4H2AA 3C8YA 2WXGA 1JROA 1IBXB 4RNAA 2WP9B 3BIID 3FC4A 4GDKB 4RCOA 2J52A 3V05A 4ZHPA 1D4BA 2CJOA 2K0PA 3FILA 1GOZA 3AEAB 1MI0A 3P1MA 1PFDA 5EE3A 1VZ6A 1ET9A 3NZ3A 1IGDA 1QLBB 1ZUD2 1XCQL 2BBCA 3OWEB 1PYWD 2JU6X 2MH7A 3ZYYX 5T8IA 4KGTA 1SE2A 3B2FA 1PUTA 2IJ0A 3PO0A 3AE8B 2BYTA 1FCCC 4WURA 2BT6A 3RPFC 1TY2A 4KKJA 4O1NA 3Q8CA 4R3DA 4JX1C 3NVVA 2BB6A 3LYYA 3EUB2 1AWDA 1FRRA 2ONQA 4KKIA 4JE3B 2DLBA 3AE7B 1Y56A 1GPXA 1D6EC 1SEBD 1OQQA 2R61A 3BK2A 5EE9A 2EELA 3IAS1 3U52E 3IAM1 1UNSA 4RGNA 3ZJUA 4IOIE 4WIPA 1V97A 5G5HA 2OHFA 2PTLA 1C76A 1GB1A 1N5WA 5D3IB 1CQVA 3AV8A 4DQOC 2K3UA 1RYJA 2QMTA 2DWQA 2K9XA 5EE0A 1ZOYB 1B9RA 3AN1A 1OQRA 2V0GA 1XXGA 3AE3B 4US9A 2WNMA 2WXKA 4ZRPA 3FAHA 1TY0A 3TEXA 1TJEA 1TKGA 3T3NA 5BYSA 3AEEB 3U4EG 2M56B 5I4DA 1QT9A 1ZXHA 1T6BX 4RGTA 4USAA 3AE9B 1N61A 5EE1A 2L1AA 2B76B 3P42A 3VQIA 4ARIA 5HFYA 5C3JB 1VZ8A 1C79A 5AUIA 4P6VF 1FXAA 4MM3B 2WS3B 1K51A 3NVWA 3W5UB 1MPEA 3Q69A 3KWVA 1TZOA 2SAKA 2JXTA 3ETRA 1SB3C 2WDQB 1HXYD 3I9V1 2G1EA 1KLUD 3MHZA 5FKAC 1MVKA 1FXIA 4UDUC 1ENFA 2BS4B 1K50A 2KMMA 1M4VA 1SJHD 4LTUA 1DGJA 1DOYA 4D2KA 3W1SA 3BYYB 1L5PA 4WAFA 3PZ8A 1HA5A 5HG2A 4YTPB 2W55A 2WXQA 2YEPF 5D3DA 3AMZA 1N5XA 1FNVA 2D5GA 2L52A 3P63A 4KGRA 4DXFA 1YN3A 2E3TA 4C80A 2LFIA 2NTSA 5BYRA 2BW2A 3UI3A 2EKIA 1JWMD 3TEYA 1HQRD 4XE0A 3LXFA 4TMAB 2KAJA 2IGHA 5BMIA 1T5XD 3IXSA 1Q10A 2GI9A 5BYQA 2JWUA 1N62A 2BB5A 2V4IB 1ZPSA 1WGKA 1FD6A 2ICIA 2AX5A 3ZJTA 2K5PA 1WWTA 4ZHOA 3GP7A 3I57A 2J4XA 4A8XC 3Q8BA 2LHEA 1J7BA 4WH4A 3GS2A 1AW7A 1NVID 4WWMA 1BUIC 3E9SA 1QKZA 1NYQA 3IT6B 1OFFA 3FILB 1QOGA 2IGGA 4HKZE 2Y5CA 1BXTA 3TUOA 3KQ4A 1VLBA 4B0MA 2GB1A 1AN8A 2KACA 2N9KA 2WXMA 2WXFA 3TEWA 1FFUA 2XN9C 3DWGC 3MFGA 3P4RB 3BK1A 2MJEA 1SJED 4US8A 1TKEA 4N6EB 3MP9A 4ITKA 3VR8B 4A9AA 1UWXA 1C4CA 2AQ2B 1TS4A 1ZE3D 1UGJA 3AECB 2PVGC 5BMGA 3T3OA 1SE3A 1MHXA 1FCLA 3AH7A 1FM0D 1XLQA 3WCQA 1YQ4B 2W82A 2L32A 2IPKD 3ZGZA 2QJLA 1QOAA 1SE4A 2M19A 2PVOD 4OHJA 5FR3A 1L0YB 2WXJA 2MJDA 1PGAA 3AE5B 1FRDA 2YEPB 4NJCA 1JWUD 4A6QA 1C4AA 5MPOA 1L0XB 1NYRA 2LHDA 4YSYB 1WYGA 3LB8C 1UUPA 1L4DB 2AQ3B 4OZCA 2HTME 2DBYA 1F2RC 1XCTL 1D5XC 1QF6A 1QILA 1YQ3B 4YSXB 1JMLA 4HJGE 2E6XA 2WDVB 1YNTE 1CK1A 3P4QB 1GB4A 4XWTA 4ZOHC 1XEEA 4MH8A 3BYTB 3ZJVA 4TSSA 1CZPA 3ABVB 3HVDA 4NAMA 1V1PA 1XLOA 4RH6A 2PLPA 4ZYSA 4YT0B 1I4PA 1C4PA 3NUHB 1FNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C78 A;  1SSN A;  1C77 A;  1C76 A;  1C79 A;  1BUI C;  2SAK A; 
#chains in the Genus database with same CATH topology
 2L00 B;  2DAJ A;  4LLG M;  4WWN A;  2KX3 A;  2FAZ A;  3UIP B;  1DYQ A;  4L23 A;  1F0Z A;  2KO3 A;  2QSD A;  3TSS A;  3P4S B;  1BML C;  3HRD D;  2QEJ C;  2XK5 A;  3QX1 A;  1I4R A;  2Z59 B;  1YJJ A;  4LNF A;  1I4X A;  1ZGU B;  1JAL A;  2KFJ A;  4EZK A;  1Y8R C;  3K9O B;  1HE8 A;  1TKY A;  4DDG D;  1NEN B;  4P16 A;  4KX6 B;  1AYF A;  3VUX A;  1E6E B;  1HZ6 A;  2G45 B;  1R4M I;  1OGW A;  2D07 B;  2INN E;  3H1U A;  2CHX A;  3NZU A;  4JWU C;  1DOI A;  2AQ1 B;  1L0V B;  2ZVN A;  4LK0 M;  4OZA A;  1FEH A;  2W3R A;  4C56 C;  2TSS A;  1HZ5 A;  4ARC A;  1KFY B;  5C23 A;  1RLF A;  4IM0 A;  2RD0 A;  3VUY A;  3E56 A;  5H92 C;  1GAQ B;  4YXD B;  3DHH C;  4ICU A;  2K39 A;  4IUM B;  3V60 A;  2ACZ B;  5IN7 A;  4ZRQ A;  1NDD A;  1KH0 A;  3BVM A;  3IG3 A;  4MGY E;  4FUL A;  1R4M B;  2BTE A;  3KYC D;  4PS8 A;  1I4Q A;  1I7H A;  1LQB A;  1UEL A;  2KWV B;  2K8C A;  3K9P B;  1WSP A;  3VR9 B;  4GSW A;  4RGM A;  4LNO A;  2NR2 A;  1EF5 A;  4L1B A;  2CR5 A;  2HE7 A;  2PMV A;  2M0A A;  4GMV A;  4W9L A;  1CJE A;  5HI1 A;  2KFK B;  4NAW B;  4TUU A;  3VVW B;  4PS7 A;  2BVC A;  1P7E A;  5E6J A;  1ZXI A;  3UGB B;  1U4A A;  2WXH A;  3R3M A;  2LJI A;  4GLS C;  3AEB B;  1SSN A;  1C77 A;  3Q6B A;  3R2T A;  3HUI A;  1P98 A;  1V1P B;  4W9F A;  4MDK E;  4BKS A;  4BOS C;  1N6Z A;  2BS3 B;  1E9M A;  4HK2 A;  3EHV A;  1X1M A;  2L0F A;  3GOE A;  3U7D A;  1F2R I;  3BVZ A;  3P4P B;  4WQM A;  3AE1 B;  1STE A;  2ZW1 A;  2LRU A;  2RR9 A;  4MM3 A;  1TT5 B;  3W5V B;  1GC7 A;  1F52 A;  3RNC C;  3U30 A;  1EWY C;  1WF9 A;  4IM3 A;  3VRA B;  3EGR A;  3TL5 A;  4YTN B;  2GOW A;  2K8H A;  4DHJ B;  4N59 A;  5EDS A;  5D94 A;  2VZK B;  3Q8A A;  2NVU I;  4N9F 4;  1LO5 D;  1WFY A;  4HKQ A;  4W9E A;  1WIA A;  3ZTC A;  2VRR B;  2PE6 B;  1UWM A;  2SEB D;  4Q2J A;  1VRA B;  1JQ4 A;  2MJ3 A;  2RPQ A;  3RNG C;  2IO2 B;  1JWS D;  1TBE A;  2RMM A;  5IA7 A;  1TTN A;  3ZXV A;  2KYW A;  2WXG A;  2O2V A;  2KT7 A;  1GUA B;  3BII D;  2LRW A;  2D3G A;  3Q3J A;  3V05 A;  1GOZ A;  3P1M A;  3I63 C;  4WJN A;  1VZ6 A;  2IO1 B;  3NZ3 A;  2L76 A;  2A5U A;  2MH7 A;  3ZYY X;  2QCZ A;  3Q3M C;  4DWF A;  1PUT A;  1ZKH A;  3AE8 B;  1NI2 A;  2BYT A;  1TGZ B;  3RPF C;  3SHQ A;  4KKJ A;  1WGR A;  4O1N A;  3Q8C A;  4R3D A;  4JX1 C;  1SGH A;  3NVV A;  1FRR A;  4LDT B;  1H4R A;  3Q3O C;  4JE3 B;  1OQQ A;  2EEL A;  1WJ6 A;  4IOI E;  4GIV A;  1V97 A;  2GMI C;  3RT3 B;  2OHF A;  5CTR C;  4DQO C;  5CHF A;  4BZA A;  4NY0 A;  1UF0 A;  2K9X A;  3AN1 A;  1XXG A;  4A3O A;  2WNM A;  3FAH A;  3T3N A;  2M56 B;  1T6B X;  4RGT A;  4USA A;  3AE9 B;  4IWQ A;  1WJ4 A;  3PRZ A;  5EE1 A;  1AAR A;  2BWE S;  3VQI A;  1WGY A;  4DHZ E;  1UZX B;  2UYZ B;  4P6V F;  1K51 A;  1HTQ A;  1WM2 A;  2KKC A;  3Q69 A;  3TCA A;  4NQL B;  2NBU A;  5AEK B;  2IO0 B;  3I9V 1;  1UBI A;  1FXI A;  1JRU A;  1K50 A;  1M4V A;  3MTN B;  5JH5 C;  3BYY B;  3VTU A;  2YVC A;  5D3D A;  3AMZ A;  4KGR A;  2LVQ A;  2HD5 B;  4NJ7 A;  5IOI A;  3ZDT A;  4C80 A;  4F1S A;  2LI5 A;  5AZF A;  3ZNI D;  5G2N A;  1BT0 A;  3PSE B;  3TEY A;  3LXF A;  2JY6 A;  1SE9 A;  5BYQ A;  2PE9 A;  2BB5 A;  4B95 A;  2K5P A;  4ZHO A;  3IBE A;  5LXH A;  3ALB A;  3I57 A;  2KTF A;  2LHE A;  4WJQ A;  1J7B A;  4KSL C;  3T9L A;  1S3S G;  2JUO A;  2ZZP B;  1AW7 A;  2KDE B;  4K7U A;  1NVI D;  4WWM A;  1BUI C;  2NPT A;  2NPT B;  3E9S A;  1ISN A;  3FIL B;  3WA0 A;  1GC6 A;  1WJU A;  2IGG A;  2LZ6 A;  5C1Z A;  2Y5C A;  3QK0 A;  2D11 A;  1BXT A;  4W9D A;  2N9K A;  2WXM A;  1FFU A;  1SJE D;  1V49 A;  2K6Q A;  1TIF A;  3KUD B;  1UWX A;  1YOV B;  4XYC A;  1TS4 A;  1NBF C;  3D32 A;  4MGI E;  3LDZ E;  3WCQ A;  1YQ4 B;  4HPP A;  3DBR I;  4ZRJ A;  1QOA A;  1UD7 A;  2M19 A;  2KAN A;  3APD A;  1T0R C;  2LWP A;  2ZNV B;  1LM8 B;  1WXS A;  2ZPN A;  1PGA A;  4TKN A;  1MFW A;  2JF5 A;  2YEP B;  4NJC A;  1CMX B;  2HTH A;  1WE6 A;  4M8M A;  3FKY A;  2LHD A;  3PGE A;  2GBK A;  1YX5 B;  2HTM E;  4II2 B;  2ZJD A;  2KXJ A;  1F2R C;  3WAL A;  1WX9 A;  2WDT B;  1QIL A;  1YQ3 B;  3V62 A;  3RNE C;  2FUH B;  1GB4 A;  3P4Q B;  2REX A;  3TIX A;  3ML9 A;  1CZP A;  3DBR B;  4RH6 A;  2C7H A;  4YT0 B;  4MH0 E;  3RMK C;  1C4P A;  2Y3A A;  3PT2 B;  4DXA B;  2GBM A;  4OVZ A;  2YLM A;  2I2Y A;  4FA6 A;  2IYD B;  1Q1O A;  3H8H A;  1B1Z A;  2M17 A;  1PDX A;  4M0W A;  1Z2M A;  3CST A;  3B1L X;  2CU1 A;  4RF0 A;  1SIF A;  4DHJ D;  2DZI A;  1YN5 A;  3AE4 B;  4KZC A;  2GBR A;  3Q3N C;  2LGS A;  4J3O D;  4C7Y A;  2V1Y A;  3NVY A;  3J9C A;  3H9D A;  4N58 A;  5LNK 1;  4C4V B;  3O13 A;  2LGI A;  1QZE A;  3GZN I;  2QIL A;  2G9H D;  2LAS A;  1F1H A;  4QAY A;  3BWU D;  2D3B A;  2RGF A;  3AB5 A;  1EUV B;  1T0S C;  4KGS A;  4AOF A;  2MEK A;  1JRP A;  1MHH E;  1XLN A;  1E8Y A;  2XBB C;  1SBB B;  2CKH B;  1N63 A;  3L4P A;  4MAC A;  2MW5 A;  2C7M B;  2LD9 A;  2K22 A;  4IDI A;  3WIM A;  2CU3 A;  4EE2 A;  5G5G A;  4NQK E;  3Q2A C;  2DAF A;  4JWS C;  2X8X X;  1WXQ A;  3RD2 A;  3SEB A;  3MJ5 A;  3U2S C;  3U7Z A;  2FCM A;  3Q3F A;  3NS1 A;  3A9J A;  1IBX A;  1M94 A;  2RDH A;  2L8J A;  3SR6 A;  3I3T B;  2BS2 B;  3DVN U;  1JWA D;  4RFB A;  1LFD A;  2V3N A;  2WX0 A;  4JPS A;  2KJR A;  5JXV A;  2JX5 A;  3Q8F A;  1V8C A;  1WX8 A;  3L17 A;  4EKU A;  1V80 A;  3H7S A;  3A9K B;  1Q0W B;  2MBQ A;  3DBS A;  3DQV A;  3SFE B;  4AS1 A;  2LUE A;  1ET6 A;  2W3S A;  3DWM A;  4JL9 A;  3PZ7 A;  4B0E A;  2WYQ A;  1FIQ A;  2IGD A;  2WXN A;  2ZW0 A;  2GRI A;  1E7P B;  4ACF A;  3IT4 B;  4YSZ B;  2JZZ A;  2WHI A;  1VR9 A;  3UF8 A;  2IY0 B;  3PVL A;  4IWO A;  4GXB A;  3NRZ A;  4I6P A;  4HJK A;  1P0R A;  3EA6 A;  2Y5B B;  2XK5 B;  3TBL D;  3UIN B;  1SIJ A;  4DXG A;  4F8C B;  4YWG G;  4W9G A;  4GB9 A;  1VDV A;  3AE2 B;  2WXO A;  4EZJ A;  1RAX A;  3N30 A;  1WRI A;  1N60 A;  2JYE A;  3R2I A;  2QDF A;  2PIA A;  4GOC A;  4PYZ A;  2J53 A;  2ON8 A;  3DVG Y;  5E6O A;  2N0S B;  2V3P A;  4CO7 A;  4DBG A;  4DK5 A;  1YMH E;  1FMA D;  1P3Q U;  1XD3 B;  2WXP A;  5HHD G;  2FE8 A;  1VJK A;  3AI5 A;  5CX3 A;  1EU3 A;  1WX7 A;  3GB1 A;  2KDB A;  1L4Z B;  4MT5 A;  1ZDX A;  2KD0 A;  1WM3 A;  4YTM B;  1MJD A;  3AED B;  2EMS A;  1J0G A;  2LUM A;  3APC A;  1ACC A;  3CIR B;  4TQ0 A;  4RM9 A;  5AUK A;  3L08 A;  4ANU A;  1KLV A;  4RNA A;  1GJZ A;  1D4B A;  4RCO A;  2J52 A;  2I1K A;  1MI0 A;  3TJP A;  1PFD A;  2OOB B;  1ET9 A;  4PYU A;  5AZG A;  1IGD A;  2JU6 X;  4M01 A;  2MBH A;  3B2F A;  3PO0 A;  4W9H A;  4WUR A;  2AEH A;  2MSE D;  3W1S C;  2BYV E;  1L7Y A;  3AUL A;  1MG4 A;  1LGR A;  1AWD A;  1WXA A;  4HDO A;  4KVG B;  3W1Y A;  3QIJ A;  3GE8 C;  3JVZ X;  1Y56 A;  5EE9 A;  4A3P A;  3IAS 1;  1UNS A;  5G55 A;  1V5T A;  4W9J A;  2J0J A;  4II3 B;  1WE7 A;  4F7Z A;  1GB1 A;  2BYE A;  2D3A A;  2IZV B;  1B9R A;  2V0G A;  3AE3 B;  4G11 A;  2HJ8 A;  1TY0 A;  2O6V D;  1TJE A;  1TKG A;  3RNA C;  2FCS A;  2NCN A;  2G4S A;  4HPM B;  4RM8 A;  4WQO B;  1N61 A;  1K8R B;  1RFA A;  2NS5 A;  4RMA A;  3DHG C;  4WJP A;  4YL8 A;  3VAW A;  2B76 B;  4FN2 A;  4ARI A;  1VZ8 A;  5AUI A;  1FXA A;  4MM3 B;  2WS3 B;  1MPE A;  1RRB A;  2WDQ B;  3LJ3 A;  1KLU D;  3L10 B;  2DZJ A;  1SJH D;  1DGJ A;  4D2K A;  2KOX A;  2ZCC A;  1L5P A;  2KHW B;  4WAF A;  3PZ8 A;  1HA5 A;  1G6J A;  1FNV A;  2L52 A;  5JHB A;  4BAX A;  2E3T A;  4FHJ A;  5BYR A;  2ASQ A;  1J19 A;  2BW2 A;  3UI3 A;  1KJT A;  2MQJ A;  4XE0 A;  2K1F A;  4TMA B;  1Q10 A;  2GI9 A;  2WX1 A;  3HM3 A;  1ZPS A;  1I35 A;  3ZJT A;  4ANV A;  4B6W A;  2BKR B;  3GS2 A;  4IW0 A;  1E8Z A;  2LXC A;  1NYQ A;  1OFF A;  3ENE A;  4MEL A;  3M3J A;  4B0M A;  2XN9 C;  4LNI A;  4US8 A;  4OVV A;  1P9D U;  1WRD B;  2M1M A;  1ZE3 D;  1UGJ A;  5IKC M;  4ZYN A;  3ZXR A;  1SE3 A;  4KIK A;  1XLQ A;  2L32 A;  5FR6 A;  3ZGZ A;  3V6C B;  3PS6 A;  4G3X B;  2JRH A;  2LVO A;  3ZRC A;  1UGM A;  2DZK A;  2C9W B;  2KC1 A;  3JW0 X;  5GMV A;  3ML8 A;  4YSY B;  2LGY A;  4GN1 A;  1YX6 B;  1UUP A;  1L4D B;  4OZC A;  2BWF A;  4P7I A;  1D5X C;  1QF6 A;  3H6N A;  3SDL C;  4FJY A;  2WDV B;  1YNT E;  2M8S A;  3H7P A;  3M95 A;  4PK1 A;  4ZOH C;  3ABV B;  3HVD A;  4NAM A;  1WI0 A;  1I4P A;  4HLE A;  1J7C A;  3UQB A;  4W9I A;  1Z5S B;  4K3C A;  1EF1 A;  1GG3 A;  4AJY B;  1ZW7 A;  2L05 A;  4GDL A;  2V4L A;  3VTV A;  3VRB B;  4FHK A;  1TS5 A;  3OAW A;  3JYU A;  3BY4 B;  1KF6 B;  2CS4 A;  2OJW A;  1SF0 A;  5J2R A;  1D5Z C;  2AYO B;  4ANW A;  1YN4 A;  3L13 A;  2INP E;  3EC8 A;  1TYG B;  2H88 B;  1PGX A;  1JWB D;  1K52 A;  1RWS A;  1WGH A;  2J7Q B;  4M00 A;  1D3Z A;  2KWD A;  4IC7 B;  3N20 C;  1V6E A;  2NMQ A;  3N1Z C;  2WXL A;  3URY A;  3GE3 C;  4PT5 A;  5C2T B;  3ZW3 A;  2G4D B;  1J7A A;  1ESF A;  1P7F A;  2HJ1 A;  2PEA A;  4XC2 A;  3AM9 A;  2JZP A;  3A1Q A;  2IY1 B;  3A1Q B;  3PPA A;  5FK9 C;  2MX2 A;  1V1O A;  1UH6 A;  5DPR A;  1FXT B;  1FFV A;  1HEZ E;  3CMM B;  4J6I A;  1JW9 D;  1VCB A;  3BIN A;  2J42 A;  1EM7 A;  2WGS A;  4W9K A;  2KZR A;  3PRE A;  4HCN B;  3SD5 A;  4AUQ C;  4BKT A;  1T3Q A;  1IP9 A;  2FUG 1;  2WU2 B;  1NEK B;  5BO4 B;  5D2M B;  2BPS A;  2KWC A;  3B08 A;  4HDQ A;  1SXT A;  4HWI B;  2N7J A;  5H8Y E;  3IHP C;  4IM2 A;  2N9E B;  4WAA A;  1EU4 A;  4NZL B;  4CQN A;  1E7U A;  1OQY A;  4WWP A;  2N1W A;  2Q5W D;  4KV2 A;  2KN4 A;  1A5R A;  1TZ1 A;  4RF1 A;  3DVN V;  2UU7 A;  3DBL I;  4MJS A;  4KSK C;  3WAO A;  2L83 A;  2KDI A;  2K8B A;  4BKG A;  4A55 A;  1WXM A;  3BVG A;  2W9N A;  2QHO A;  1VZ7 A;  2JQR B;  3HK0 A;  3PHW B;  2Z0D B;  1KLG D;  1YJI A;  3JSV A;  3JSV B;  2KQ7 A;  2INC C;  4JLC A;  3Q14 C;  4L2Y A;  4EEW A;  5DCN A;  3HVZ A;  2BKF A;  4E3C A;  1E5W A;  2KTR A;  2ZCB A;  3DOW A;  4OZB A;  2BYF A;  4W9C A;  2BGF A;  4OVU A;  3DBL B;  2JYT A;  4WWO A;  2G3Q B;  5DPW A;  4M0W B;  3RI7 C;  2O6V A;  3QCA A;  3ECI A;  3KYD D;  3L16 A;  1JCK B;  5J18 A;  2IND C;  1I4G A;  2VZK D;  2Y5P A;  2FIF A;  2JPH A;  1QOB A;  2KMA A;  1FNW A;  2DZM A;  2K6D B;  1RFK A;  1ROE A;  3CWI A;  2DYO A;  3MC9 A;  4MGZ E;  1H8C A;  5E6N A;  1ZP0 B;  2FID A;  1R7S A;  2K25 A;  4GU2 A;  3CSF A;  4K81 A;  3VH4 B;  1LXD A;  1WMH A;  1WMH B;  3RUI B;  3AEF B;  2J0M A;  1TS3 A;  3Q8E A;  3VDZ A;  2D10 A;  2OED A;  1IUE A;  1KRH A;  2N7D A;  1I4H A;  3VHT C;  4AWJ A;  4AJW A;  3DHI C;  4FJZ A;  2AL6 A;  2CJN A;  2GBJ A;  4CHK A;  2RPV A;  3B2G A;  1K53 A;  1GNU A;  1EWC A;  4XDD A;  4H2A A;  3C8Y A;  1V9J A;  3A9J B;  4M8N A;  3QA8 A;  1IBX B;  3CF6 E;  4ZHP A;  4GDK B;  4GDK A;  2JXX A;  3AEA B;  2J0K A;  5J17 A;  3ZNH B;  4TV3 A;  5EE3 A;  5IAA C;  1V5O A;  3KVF B;  4MEM A;  1ZUD 2;  1OEY A;  1XCQ L;  2BBC A;  3OWE B;  4GGQ A;  1SE2 A;  5D6J B;  1WR6 E;  4LDT D;  1TY2 A;  1L2N A;  3A4S C;  3LYY A;  3EUB 2;  2EMT A;  2ONQ A;  3ZNG C;  3ZRF A;  2FNJ B;  3AE7 B;  1GPX A;  1D6E C;  2R61 A;  3MJW A;  3BK2 A;  2LGX A;  5TR5 A;  4RGN A;  4NNJ B;  3DBH B;  4K7S A;  2DHZ A;  5G5H A;  1C76 A;  1KM7 A;  1CQV A;  3AV8 A;  2K3U A;  1RYJ A;  3PZD A;  4MSM B;  5KHQ A;  5CHW A;  4US9 A;  2MWS B;  2WXK A;  2LVP A;  2VH1 A;  4ZRP A;  3AEE B;  3VFK A;  5I4D A;  3SU8 X;  1QT9 A;  1ZXH A;  1YJ1 A;  1OTR B;  2L1A A;  4LNK A;  4ICV A;  3L54 A;  3P42 A;  2MP2 A;  1C79 A;  2AL3 A;  3OLM D;  2ZEQ A;  4PS3 A;  3KWV A;  2G1E A;  3MHZ A;  5FKA C;  1MVK A;  4DDI D;  4LTU A;  4BBN F;  3B0A A;  4A20 A;  4YTP B;  4FLH A;  2KWU B;  2YEP F;  3PLV A;  4ANX A;  3ONS A;  1WXV A;  1T0Q C;  1JWM D;  1HQR D;  3R66 C;  2AWT A;  2XEW A;  4BBN C;  1T5X D;  2I1J A;  2ZNV C;  2JWU A;  4HXD A;  1WGK A;  1FD6 A;  2ICI A;  2AX5 A;  1I42 A;  1FPY A;  1WWT A;  3QC8 B;  4WJO A;  2J4X A;  4NJ6 A;  5LXI B;  4A8X C;  3X23 A;  4ASW C;  2DX5 B;  1Q5W B;  4WH4 A;  4E71 A;  2DEN B;  2ZVO A;  1QKZ A;  4FAD A;  1V86 A;  1QOG A;  2KDF B;  1WH3 A;  3HHM A;  3TUO A;  3ZVV A;  3QAQ A;  3C19 A;  5DPS A;  2M0X A;  3TEW A;  2KMC A;  3MFG A;  3P4R B;  2MJE A;  2C60 A;  4HVB A;  2LXA A;  1TKE A;  2IBI B;  3MP9 A;  2R2O A;  1R4N I;  4A9A A;  1C4C A;  1P1A A;  3APF A;  3PHX B;  5BMG A;  2N7E A;  4EOY A;  1FCL A;  1IYF A;  1FM0 D;  4M02 A;  5IP4 D;  4I6L B;  1WY8 A;  2FCQ A;  3V6E B;  5FR3 A;  1L0Y B;  2WXJ A;  4E74 A;  1KOT A;  3AE5 B;  1FRD A;  2DYB A;  3UIO B;  5L95 C;  4KDI C;  4X57 B;  1C4A A;  4LNN A;  2KFK A;  4NAW A;  1UBQ A;  2WWZ A;  2D3C A;  1WYG A;  3LB8 C;  1R4N B;  2AQ3 B;  2DBY A;  3RZF A;  4EFO A;  2FCN A;  2D2Q A;  4YSX B;  2V3S A;  4URK A;  1XEE A;  3OG5 A;  4MH8 A;  3BYT B;  3ZJV A;  4TSS A;  1V1P A;  3NS8 A;  3QHT A;  4FJV B;  2M4N A;  3NUH B;  1FNU A;  1XLP A;  1A70 A;  2DYM A;  1IGC A;  2LEK A;  1C78 A;  3QQ8 B;  4KZ0 A;  4ZDV A;  4HRO A;  3DCG A;  3DVG X;  3RFZ B;  3N9Y C;  4JQW C;  5JHA A;  2WXR A;  2I38 A;  1HTO A;  1OEY J;  3NHE B;  1WGD A;  3V3X A;  4TQ1 A;  3NJT A;  4XZ4 A;  1C3T A;  3M63 B;  2DNF A;  2W54 A;  2NTT A;  1E0Z A;  4FXC A;  4OW0 A;  2MBB B;  1F77 A;  3ZQ4 A;  3NVZ A;  2MCN B;  2C7N B;  2PKO A;  3NZS A;  4AQ7 A;  2WXI A;  1PQS A;  3VH3 B;  4C00 A;  2MBE A;  2WQY B;  3L0W B;  3P2B A;  4BOZ B;  2WDR B;  3RNB C;  2MHJ A;  1PGB A;  2PW9 A;  2L3Z A;  3WAM A;  1E8X A;  4LCD E;  3PLU A;  1E7V A;  2B3A A;  3AE6 B;  5BMH A;  4REZ A;  3PV1 A;  1QQR A;  3WAN A;  3B9J A;  4HEA 1;  3N1X C;  1E10 A;  3AU5 A;  5GXG B;  2KQ4 X;  2KN5 A;  3IFW B;  1L6U A;  4KIK B;  2N9P C;  2LMC A;  5JZE B;  2N9L A;  2XNA C;  1YQB A;  4C7Z A;  2MLB A;  1XF5 L;  3W2D A;  2MRP A;  2NBW B;  1RM6 C;  3U8Z A;  3RYT A;  2WU5 B;  1C9F A;  4BFR A;  1ZDV A;  3HIZ A;  1D5M C;  1WYW B;  2V9H A;  4XDC A;  2BF8 B;  2PJH A;  4A90 A;  3BZD B;  2WLB A;  3RUL A;  3I5J C;  3N3K B;  2JSV X;  1L6V A;  3H7P B;  3QWZ B;  1T0Y A;  2MBO A;  2KVR A;  2RDG A;  2KJH B;  1E8W A;  1XO3 A;  4BVU C;  5TSS A;  3EFU A;  4KDL B;  2GBN A;  3R8B A;  1KTK A;  3TEZ A;  2X38 A;  4LJP B;  3MC0 B;  2A4Z A;  4GDL B;  3W9C B;  1YD8 U;  4MGK E;  1FO4 A;  2KJ6 A;  4FBJ B;  3AEG B;  2KVZ A;  3ZKJ C;  2IDY A;  4P1B C;  4RGO S;  3ZUN A;  3TMP B;  3PTF C;  2QIE B;  5D7G A;  2KLG A;  3R7Q A;  2FBW B;  1F9J A;  3S2A A;  2HDE A;  1XT9 B;  2MA9 B;  3KW5 B;  3RN9 C;  3N1Y C;  3UQA A;  2IO3 B;  2CHZ A;  3C0R B;  4S0R A;  3KWL A;  2Z8L A;  3AU4 A;  4HRS A;  1QOF A;  2H89 B;  5CHV C;  4I6N B;  2KDM A;  2C5L C;  1DOX A;  2VH2 A;  1TS2 A;  3SFD B;  3KLS X;  3ZNZ B;  4XWW A;  1NI3 A;  4IKG A;  4HCP B;  1XQQ A;  3KUZ A;  2RDB C;  1IPG A;  3T8M A;  1JRO A;  3RCZ A;  3VTW A;  2WP9 B;  3FC4 A;  4IG7 B;  2RSU A;  2CJO A;  2K0P A;  3FIL A;  5LLI A;  3EFC A;  4AP4 C;  5L83 A;  2N4F A;  3ZIM A;  4K3B A;  2JT4 B;  1QLB B;  1PYW D;  5T8I A;  4KGT A;  2IJ0 A;  2N1V A;  2UWQ A;  3EEC A;  1FCC C;  2BT6 A;  1VD2 A;  4MJS B;  2BB6 A;  3N32 A;  1WR1 A;  1EO6 A;  4ZRK A;  3MC8 A;  4LJO B;  3PRP B;  4KKI A;  2DLB A;  3R7R A;  1SEB D;  3A4R A;  5AZH A;  1E90 A;  2JWZ A;  3KH0 A;  3U52 E;  3IAM 1;  3ZJU A;  3NOB A;  4BKS D;  3OJ3 A;  4WIP A;  2PTL A;  1N5W A;  5D3I B;  3AXC A;  4ZRI A;  2QMT A;  2N9X A;  2DWQ A;  2KK8 A;  2KTR B;  1ZOY B;  5EE0 A;  1OQR A;  2BQQ A;  1J8C A;  2ZPY A;  3OJ4 B;  2KC2 A;  2KNB A;  3QJZ A;  2QC8 A;  4P1C C;  3TEX A;  5BYS A;  3U4E G;  1WZ0 A;  4DHZ B;  1MG8 A;  2KQS A;  3M62 B;  1S1Q B;  1WJN A;  4B9K A;  2O6V B;  5HFY A;  5C3J B;  2PPH A;  3V61 A;  3KUC B;  3W5U B;  3NVW A;  1V2Y A;  1TZO A;  2SAK A;  2JXT A;  3ETR A;  1SB3 C;  1HXY D;  3ZDM C;  2KLC A;  4UDU C;  1ENF A;  2BS4 B;  2KMM A;  1DOY A;  2CHW A;  3W1S A;  4CYE A;  5KHO A;  5HG2 A;  3DPD A;  2W55 A;  4XX5 A;  2WXQ A;  1C1Y B;  1N5X A;  2D5G A;  2JZ3 B;  4DXF A;  3P63 A;  3WAP A;  1YN3 A;  4XGA B;  2LFI A;  2NTS A;  4JGH B;  3A33 B;  2EKI A;  4NPN A;  4C4V A;  2KAJ A;  2IGH A;  3O65 B;  3PRM B;  3IXS A;  5BMI A;  1N62 A;  5HKH A;  2V4I B;  4HPL B;  3DDC B;  3GP7 A;  3RZW C;  3Q8B A;  5IO9 A;  2L0T A;  3IT6 B;  2L7R A;  3DBH I;  3ZO5 B;  5DPT A;  4HKZ E;  3MHS D;  3KQ4 A;  1VLB A;  2Z0E B;  2GB1 A;  1AN8 A;  2KAC A;  2WXF A;  4G0N B;  3GZN B;  3DWG C;  4JIO U;  3BK1 A;  4N6E B;  3QAR A;  4ITK A;  3VR8 B;  1YIW A;  2LJ5 A;  2AQ2 B;  4MSQ B;  4G50 A;  1V81 A;  3AEC B;  2PVG C;  2EKE C;  3T3O A;  1MHX A;  3AH7 A;  3HM6 X;  5E6P A;  2JVC A;  2W82 A;  2IPK D;  3NY5 A;  2QJL A;  4K1R B;  3X0W A;  1SE4 A;  3A9K A;  2PVO D;  4OHJ A;  2GLS A;  3IVF A;  2MJD A;  2NBV B;  1JWU D;  4A6Q A;  5MPO A;  2LGD A;  4EZL A;  1L0X B;  1NYR A;  3VUW A;  2JRI B;  3VXW A;  3ZTD A;  4S17 A;  1XCT L;  1WZ3 A;  3RNF C;  1JML A;  2KX0 A;  4IWP A;  4HJG E;  2E6X A;  3ZLZ A;  1CK1 A;  4XWT A;  4K7W A;  4EUT A;  3NG0 A;  1WGG A;  1XLO A;  2MP2 B;  2OJR A;  2PLP A;  4ZYS A;  2R2Q A;  2O2V B; 
#chains in the Genus database with same CATH homology
 1XLP A;  2Y3A A;  4LLG M;  1A70 A;  2DYM A;  4OVZ A;  1IGC A;  2LEK A;  2I2Y A;  1J7C A;  3H8H A;  1C78 A;  1DYQ A;  4L23 A;  1B1Z A;  4HRO A;  1F0Z A;  1PDX A;  2QSD A;  3RFZ B;  4M0W A;  3TSS A;  3VRB B;  3N9Y C;  3P4S B;  1BML C;  2WXR A;  1TS5 A;  3HRD D;  2QEJ C;  2I38 A;  4RF0 A;  1I4R A;  1YN5 A;  3AE4 B;  3V3X A;  4TQ1 A;  4J3O D;  4C7Y A;  1YJJ A;  3NVY A;  1KF6 B;  3J9C A;  1SF0 A;  1D5Z C;  1I4X A;  4N58 A;  2W54 A;  5LNK 1;  1YN4 A;  2NTT A;  1JAL A;  1E0Z A;  4FXC A;  3O13 A;  4OW0 A;  2INP E;  2LGI A;  2QIL A;  1F77 A;  3ZQ4 A;  1TYG B;  2G9H D;  1PGX A;  1JWB D;  1K52 A;  1RWS A;  2H88 B;  3NVZ A;  2KWD A;  3BWU D;  2PKO A;  3AB5 A;  4AQ7 A;  1TKY A;  4KGS A;  1NEN B;  2MEK A;  4KX6 B;  1AYF A;  1JRP A;  4P16 A;  2NMQ A;  2WXL A;  3URY A;  1MHH E;  1E6E B;  4PT5 A;  1HZ6 A;  2WXI A;  5C2T B;  1XLN A;  1J7A A;  1SBB B;  1ESF A;  1P7F A;  1N63 A;  2INN E;  3L4P A;  4MAC A;  3AM9 A;  2WQY B;  2JZP A;  2K22 A;  4JWU C;  5FK9 C;  2WDR B;  1DOI A;  4IDI A;  2CU3 A;  1PGB A;  2AQ1 B;  2PW9 A;  1L0V B;  1V1O A;  4EE2 A;  4LK0 M;  4OZA A;  1FEH A;  2W3R A;  5G5G A;  4C56 C;  1FFV A;  1HEZ E;  2TSS A;  1HZ5 A;  4ARC A;  1KFY B;  1JW9 D;  4JWS C;  3AE6 B;  5BMH A;  1WXQ A;  3E56 A;  5H92 C;  3SEB A;  2J42 A;  3MJ5 A;  3U2S C;  4REZ A;  1EM7 A;  1QQR A;  1GAQ B;  3U7Z A;  4YXD B;  3B9J A;  4HEA 1;  1E10 A;  1T3Q A;  2ACZ B;  2FUG 1;  2WU2 B;  1NEK B;  3NS1 A;  5GXG B;  4ZRQ A;  2KQ4 X;  1IBX A;  2RDH A;  1KH0 A;  3SR6 A;  3BVM A;  1SXT A;  2BS2 B;  2BTE A;  1JWA D;  1L6U A;  4RFB A;  2N7J A;  5H8Y E;  2V3N A;  4JPS A;  5JXV A;  2LMC A;  1I4Q A;  2N9L A;  2XNA C;  1I7H A;  1EU4 A;  2JX5 A;  3Q8F A;  4NZL B;  4C7Z A;  4CQN A;  1V8C A;  1WSP A;  1XF5 L;  3VR9 B;  3W2D A;  4RGM A;  2Q5W D;  1RM6 C;  2KN4 A;  4L1B A;  4RF1 A;  2PMV A;  2M0A A;  2WU5 B;  1C9F A;  1ZDV A;  2L83 A;  1D5M C;  1CJE A;  5HI1 A;  4NAW B;  3SFE B;  4A55 A;  4AS1 A;  3BVG A;  1ET6 A;  2W3S A;  3DWM A;  3PZ7 A;  4XDC A;  1P7E A;  4B0E A;  1VZ7 A;  1ZXI A;  2JQR B;  5E6J A;  4A90 A;  1FIQ A;  2WLB A;  2IGD A;  2WXN A;  3BZD B;  2WXH A;  1KLG D;  1YJI A;  2ZW0 A;  2JSV X;  2LJI A;  4GLS C;  2GRI A;  3AEB B;  1E7P B;  1SSN A;  1L6V A;  4L2Y A;  3IT4 B;  1C77 A;  4YSZ B;  3R2T A;  3HVZ A;  3HUI A;  1V1P B;  2RDG A;  1XO3 A;  2BS3 B;  5TSS A;  1E9M A;  1VR9 A;  3R8B A;  1KTK A;  4OZB A;  3TEZ A;  2X38 A;  3MC0 B;  2JYT A;  1F2R I;  3BVZ A;  4GDL B;  3P4P B;  3W9C B;  4WQM A;  3AE1 B;  1STE A;  1FO4 A;  2ZW1 A;  3NRZ A;  3EA6 A;  3AEG B;  1SIJ A;  2IDY A;  4RGO S;  4DXG A;  4YWG G;  3W5V B;  1JCK B;  1EWY C;  2QIE B;  1VDV A;  3AE2 B;  5D7G A;  3VRA B;  1I4G A;  3EGR A;  2FBW B;  2VZK D;  2WXO A;  2Y5P A;  4YTN B;  1WRI A;  1N60 A;  2JYE A;  3R2I A;  2HDE A;  2PIA A;  1QOB A;  4N59 A;  1FNW A;  2J53 A;  2ON8 A;  2VZK B;  1RFK A;  1ROE A;  3Q8A A;  3CWI A;  2DYO A;  1LO5 D;  2N0S B;  2V3P A;  4HKQ A;  1ZP0 B;  1R7S A;  1YMH E;  3KWL A;  1FMA D;  2Z8L A;  4HRS A;  1QOF A;  2H89 B;  2WXP A;  5HHD G;  2FE8 A;  1UWM A;  1VJK A;  3AEF B;  1TS3 A;  3Q8E A;  2SEB D;  1EU3 A;  2OED A;  3GB1 A;  1IUE A;  1KRH A;  1L4Z B;  2KDM A;  1I4H A;  1VRA B;  4MT5 A;  1ZDX A;  4Q2J A;  1DOX A;  4YTM B;  1JQ4 A;  2MJ3 A;  3AED B;  2CJN A;  1TS2 A;  3SFD B;  3KLS X;  4XWW A;  1NI3 A;  2LUM A;  1ACC A;  2RPV A;  3B2G A;  1K53 A;  4IKG A;  3CIR B;  1JWS D;  1EWC A;  4XDD A;  4TQ0 A;  2RMM A;  5AUK A;  4H2A A;  3C8Y A;  2WXG A;  1JRO A;  1IBX B;  4RNA A;  2WP9 B;  3BII D;  3FC4 A;  4GDK B;  4RCO A;  2J52 A;  3V05 A;  4ZHP A;  1D4B A;  2CJO A;  2K0P A;  3FIL A;  1GOZ A;  3AEA B;  1MI0 A;  3P1M A;  1PFD A;  5EE3 A;  1VZ6 A;  1ET9 A;  3NZ3 A;  1IGD A;  1QLB B;  1ZUD 2;  1XCQ L;  2BBC A;  3OWE B;  1PYW D;  2JU6 X;  2MH7 A;  3ZYY X;  5T8I A;  4KGT A;  1SE2 A;  3B2F A;  1PUT A;  2IJ0 A;  3PO0 A;  3AE8 B;  2BYT A;  1FCC C;  4WUR A;  2BT6 A;  3RPF C;  1TY2 A;  4KKJ A;  4O1N A;  3Q8C A;  4R3D A;  4JX1 C;  3NVV A;  2BB6 A;  3LYY A;  3EUB 2;  1AWD A;  1FRR A;  2ONQ A;  4KKI A;  4JE3 B;  2DLB A;  3AE7 B;  1Y56 A;  1GPX A;  1D6E C;  1SEB D;  1OQQ A;  2R61 A;  3BK2 A;  5EE9 A;  2EEL A;  3IAS 1;  3U52 E;  3IAM 1;  1UNS A;  4RGN A;  3ZJU A;  4IOI E;  4WIP A;  1V97 A;  5G5H A;  2OHF A;  2PTL A;  1C76 A;  1GB1 A;  1N5W A;  5D3I B;  1CQV A;  3AV8 A;  4DQO C;  2K3U A;  1RYJ A;  2QMT A;  2DWQ A;  2K9X A;  5EE0 A;  1ZOY B;  1B9R A;  3AN1 A;  1OQR A;  2V0G A;  1XXG A;  3AE3 B;  4US9 A;  2WNM A;  2WXK A;  4ZRP A;  3FAH A;  1TY0 A;  3TEX A;  1TJE A;  1TKG A;  3T3N A;  5BYS A;  3AEE B;  3U4E G;  2M56 B;  5I4D A;  1QT9 A;  1ZXH A;  1T6B X;  4RGT A;  4USA A;  3AE9 B;  1N61 A;  5EE1 A;  2L1A A;  2B76 B;  3P42 A;  3VQI A;  4ARI A;  5HFY A;  5C3J B;  1VZ8 A;  1C79 A;  5AUI A;  4P6V F;  1FXA A;  4MM3 B;  2WS3 B;  1K51 A;  3NVW A;  3W5U B;  1MPE A;  3Q69 A;  3KWV A;  1TZO A;  2SAK A;  2JXT A;  3ETR A;  1SB3 C;  2WDQ B;  1HXY D;  3I9V 1;  2G1E A;  1KLU D;  3MHZ A;  5FKA C;  1MVK A;  1FXI A;  4UDU C;  1ENF A;  2BS4 B;  1K50 A;  2KMM A;  1M4V A;  1SJH D;  4LTU A;  1DGJ A;  1DOY A;  4D2K A;  3W1S A;  3BYY B;  1L5P A;  4WAF A;  3PZ8 A;  1HA5 A;  5HG2 A;  4YTP B;  2W55 A;  2WXQ A;  2YEP F;  5D3D A;  3AMZ A;  1N5X A;  1FNV A;  2D5G A;  2L52 A;  3P63 A;  4KGR A;  4DXF A;  1YN3 A;  2E3T A;  4C80 A;  2LFI A;  2NTS A;  5BYR A;  2BW2 A;  3UI3 A;  2EKI A;  1JWM D;  3TEY A;  1HQR D;  4XE0 A;  3LXF A;  4TMA B;  2KAJ A;  2IGH A;  5BMI A;  1T5X D;  3IXS A;  1Q10 A;  2GI9 A;  5BYQ A;  2JWU A;  1N62 A;  2BB5 A;  2V4I B;  1ZPS A;  1WGK A;  1FD6 A;  2ICI A;  2AX5 A;  3ZJT A;  2K5P A;  1WWT A;  4ZHO A;  3GP7 A;  3I57 A;  2J4X A;  4A8X C;  3Q8B A;  2LHE A;  1J7B A;  4WH4 A;  3GS2 A;  1AW7 A;  1NVI D;  4WWM A;  1BUI C;  3E9S A;  1QKZ A;  1NYQ A;  3IT6 B;  1OFF A;  3FIL B;  1QOG A;  2IGG A;  4HKZ E;  2Y5C A;  1BXT A;  3TUO A;  3KQ4 A;  1VLB A;  4B0M A;  2GB1 A;  1AN8 A;  2KAC A;  2N9K A;  2WXM A;  2WXF A;  3TEW A;  1FFU A;  2XN9 C;  3DWG C;  3MFG A;  3P4R B;  3BK1 A;  2MJE A;  1SJE D;  4US8 A;  1TKE A;  4N6E B;  3MP9 A;  4ITK A;  3VR8 B;  4A9A A;  1UWX A;  1C4C A;  2AQ2 B;  1TS4 A;  1ZE3 D;  1UGJ A;  3AEC B;  2PVG C;  5BMG A;  3T3O A;  1SE3 A;  1MHX A;  1FCL A;  3AH7 A;  1FM0 D;  1XLQ A;  3WCQ A;  1YQ4 B;  2W82 A;  2L32 A;  2IPK D;  3ZGZ A;  2QJL A;  1QOA A;  1SE4 A;  2M19 A;  2PVO D;  4OHJ A;  5FR3 A;  1L0Y B;  2WXJ A;  2MJD A;  1PGA A;  3AE5 B;  1FRD A;  2YEP B;  4NJC A;  1JWU D;  4A6Q A;  1C4A A;  5MPO A;  1L0X B;  1NYR A;  2LHD A;  4YSY B;  1WYG A;  3LB8 C;  1UUP A;  1L4D B;  2AQ3 B;  4OZC A;  2HTM E;  2DBY A;  1F2R C;  1XCT L;  1D5X C;  1QF6 A;  1QIL A;  1YQ3 B;  4YSX B;  1JML A;  4HJG E;  2E6X A;  2WDV B;  1YNT E;  1CK1 A;  3P4Q B;  1GB4 A;  4XWT A;  4ZOH C;  1XEE A;  4MH8 A;  3BYT B;  3ZJV A;  4TSS A;  1CZP A;  3ABV B;  3HVD A;  4NAM A;  1V1P A;  1XLO A;  4RH6 A;  2PLP A;  4ZYS A;  4YT0 B;  1I4P A;  1C4P A;  3NUH B;  1FNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...