2SBTA

A comparison of the three-dimensional structures of subtilisin bpn and subtilisin novo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
275
structure length
275
Chain Sequence
b'AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN NOVO
publication title A comparison of the three-dimensional structures of subtilisin BPN' and subtilisin novo.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
total genus 45
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1976-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sbtA00
1SBNE 4C3UA 5AMXA 2W2MA 1WVMA 4H6WA 1TM3E 2PWAA 4OMCA 1CNMA 5FAXA 1SUPA 2ZWPA 5ARCA 1SUBA 1Y3BE 2IY9A 1BE8A 1WSDA 1EA7A 3VTAA 3PTLA 4CFYA 1OYVA 1DUIA 1EGQA 1GNVA 3VYVA 4JP8A 2DUJA 2G4VA 5FBZA 3CNQS 3HJRA 1TM5E 3BX1A 4CFZA 3DE0X 3VV2A 4WOCA 1T1IA 1P7VA 2WV7A 1THMA 3QTLA 4DZTA 1C9NA 1C9MA 2ID4A 1AK9A 5JXIA 3UNXA 1Y3CE 4RYDA 5JXHA 1PFGA 1SIUA 3I2YX 5AVKA 1S01A 4H6VA 5FFNA 2Z58A 3SQOA 5ARDA 1WMDA 1UBNA 1SBIA 4OV6B 3DE5X 4WOBA 5JXJA 1SCJA 2WUVA 1VSBA 3AFGA 1DBIA 1Q5PA 3DE1X 2DQKA 3VHQA 1LW6E 1NLUA 3Q40A 2ST1A 1PJ8A 1AQNA 3LXUX 3QMPA 5B1EA 1C9JA 1SCAA 5AQEA 1Y4DE 5I9SA 4AKSA 1KDVA 1SIOA 3I37X 4KG7A 2Z2ZA 4LVNA 4I0WB 1GA6A 1V6CA 1YJBA 1SCNE 3DE3X 1TM1E 2Z30A 3DW3X 3PRKE 4HX2A 4ZOQI 2HPZA 4NE9A 1V5IA 2P4EA 3BPSA 1Y3FE 2X8JA 1TK2A 3LPDA 3DVRX 3ZXXA 3DE2X 2W2PA 3F7OA 1KDYA 2IXTA 1IC6A 3AJ8A 2WUWE 3WIVA 1S02A 1GA1A 3F49S 3DE4X 2X8JB 1GCIA 1AU9A 1GTG1 3WHIA 1AF4A 2Z2XA 1T1GA 4C3VA 3Q5GA 5AVJA 1SBTA 1Y3DE 2ZRQA 3EIFA 3SICE 1R64A 1TO1E 1YJAA 3GT3A 3LPAA 4ZARA 3QFHA 4HVLA 3VV3A 1HT3A 1Y34E 1SCDA 2PMWB 1BE6A 1TECE 5K7SA 1MPTA 4DWWA 3L1KA 3ZXYA 2ZWOA 3OSZA 1BFUA 1SUAA 1MEEA 1BJRE 3I30X 4KPGA 2SNIE 1KDZA 1SBHA 3CO0S 1GTL1 2WWTA 4FONA 3TECE 5SICE 1PTKA 1ZVJA 3DYBA 4H6XA 1C3LA 1SPBS 3P5BA 1Y9ZA 3TI9A 1AVTA 3VSBA 1T1EA 4K8RB 4J94A 1PEKE 2W2NA 1P7WA 2GKOA 1XF1A 2XRMA 5ARBA 3DVQX 1SELA 4YN3A 1Y48E 2DP4E 1SVNA 1SCBA 1YJCA 1NDUA 2PQ2A 3A3NA 1GT91 1S2NA 1ZVKA 2SECE 5JXGA 1WMEA 3EDYA 2HD4A 2SICE 3F7MA 1TM7E 3A3PA 5CW1A 4NMXB 2Z56A 1SBCA 1SUEA 4GI3A 4MZDA 3DDZX 1ST3A 4OMDA 1OT5A 1SUCA 1Y1KE 1OYOA 1GA4A 3DW1X 2W2QA 1TM4E 3WQBA 1BH6A 1AH2A 2XTJA 4CG0A 5B1DA 4M1ZA 3GCWA 4B5LA 2PKCA 1A2QA 2PWBA 1GTJ1 1GNSA 3AJ9A 1SIBE 1ST2A 1R0RE 3D9QX 2PYZA 3DVSX 3I34X 2Z2YA 1TO2E 1Y33E 3A3OA 2V8BA 3GCXA 2E1PA 3DE6X 2ID8A 5JMOA 1YU6A 1TMGE 1NDQA 1CSEE 3T41A 4AKTA 1KE1A 2W2OA 3D43A 4LVOA 1JEAA 3DWEX 3TI7A 3LPCA 4Z2AA 1P8JA 4BWGA 3EE6A 1KE2A 1AV7A 2Z57A 3WIUA 1SN7A 2B6NA 1WMFA 2QTWB 2TECE 4NE7A 1Y4AE 1IAVA 3BGOS 1SUDA 1R6VA 1SH7A 3GT4A 4KB5A 4DJ5X 2PRKA 3H42B 2SBTA 1BFKA 3DE7X
chains in the Genus database with same CATH superfamily
3FPGA 1CS0A 2COKA 2TSYB 2ZP1A 3GN1A 4LZLA 2O8BB 1SQSA 2X8BA 4DIEA 3JQBA 5DWDA 3TZ6A 4BLSA 3LWZA 4ZKEA 1JI3A 3OIDA 2BYTA 2HNBA 3ROZA 2HHLA 3ZCSA 1GG2A 1TAGA 4BB0A 4BNNA 3GY0A 1JDPA 1F7UA 2R8RA 1X3LA 2IEYA 3PE6A 4CKCA 1NE2A 2VJMB 3SWWA 5LLDA 1P0PA 2W6ZA 4IZOA 2I71A 4INAA 2BISA 3OHMA 4MAMA 4TWAA 5IK2A 2QRNA 1ZMRA 3EPKA 4N49A 2W7TA 3WSVA 1K6JA 3PE3A 3UXMA 3LL7A 5TIIA 1R6UA 2GCIA 1R7RA 4X54A 4C5BA 1TT5A 4HEQA 5CFLA 1B76A 1E2MA 5L3VA 1O96B 4IDPA 3WG9A 1SOAA 2PL1A 2B8TA 4CKCB 1DRJA 4MVWA 1USGA 4Q93A 2EIHA 2IW3A 5CB0A 2AE2A 5LQCA 1E61A 3BK2A 4B8ZA 1QG4A 3I2HA 5HRCA 4JBWA 3ZLBA 4H15A 2OWEA 2H4WA 1NQWA 1PNQA 5EEHA 4NXNB 2O8DA 1EVYA 1TGVA 2GUWA 4XSVA 1TPZA 3F71A 2LW7A 4DYHA 4DJEC 821PA 1N7HA 1OZAA 1LDEA 2NO0A 2PGIA 4G5GA 4PSVA 2PKEA 2B37A 2RI0A 2OUIA 4MEJA 4Y9DA 1KI6A 3C4QA 2A0WA 3D7KA 2QR5A 1N9GA 4HPXB 2CXHA 4CM4A 2B2CA 4X71A 3IFSA 2IYTA 1Z3CA 2ZPTX 4ZMRA 2HSZA 1JJFA 5LM3A 1W0KA 3VU1A 2XV1A 4MP8A 4FFVA 2JFFA 4XM2A 3T52A 4AS3A 1ZKDA 2O8DB 1YZFA 3SSOA 3HO8A 3N7TA 4OHFA 4LWQA 1RWOA 1V3UA 3CX7A 2UUAB 4F4HA 1T1IA 1RXCA 5EINA 4Q5IA 5FBWB 3P9NA 4CDMA 1J2EA 1U2ZA 1EWTA 3ZW8A 1XD8A 4FW9A 4BQFA 3LHKA 1KI6B 4YP1A 5C53B 2V45A 2IZ7A 3VHXA 4DLWA 1N9GB 4XCXA 2ID4A 4FFMA 1A96A 1HDIA 2ATEA 2DMRA 1G8FA 1PQWA 3NG1A 4E51A 3AM4A 2C7RA 1OZHA 4OBBA 1RHUA 4HJRA 4P3OA 3WR5A 5IVPA 3I39X 3UNXA 3QVSA 1PFGA 4BEVA 2GBGA 1JNYA 4EBBA 3NHSA 4OLFA 3GUUA 4WGFA 1ISRA 3S4YA 1XPOA 3A0UA 5HUHA 2FCAA 3WZMA 2X5JO 5CNMA 5D6OA 1ZICA 5HKLA 3TR6A 1CRPA 1V0JA 2FHPA 3VHXB 3JZAA 2ZUFA 3KVNA 3ZCUA 4N8DA 2ONKA 1VLJA 2R4QA 3D7LA 3PUVA 4JCOA 1XVLA 2ZB3A 4K8OA 3RV4A 5FWNA 2AQKA 1CUDA 1HE5A 1H2AS 1WZEA 3DYVA 1PR4A 3TSZA 4EUNA 3B7GA 3LU1A 5DMXA 4ARVA 4NPAA 4OQYA 4Y6RA 4MQLA 5G2OA 4F2HA 6PFKA 1OCEA 3LOQA 2YHUA 4LE2A 2GH1A 2FUEA 4HWOA 1UCFA 2SKCA 4WMLA 4RABA 3I9V1 3WJ1A 5B1HA 2CMHA 1M2VA 2DWQA 3D81A 3HCRA 4KR0A 1FVXA 1G5TA 1LTQA 3AFHA 3NU1A 3R7AA 2KPOA 2OFXA 3DG9A 2Z6QA 4OVKA 3OCVA 3TBKA 3BXHA 2FETA 3E84A 4GKAA 4CQJA 4F8EA 5HIIA 1ZN9A 3ZU5A 2H52A 1JAZA 3IA7A 5BRNA 1M6YA 4Y2TA 4MRNA 1T13A 2R7NA 3RU2A 1E7QA 3ENQA 1QLHA 1T5HX 4N5DA 4TKVA 4PAGA 3M2TA 4YAJA 1NLUA 4YX9A 1M2VB 3KUCA 2GRAA 5LFAA 4RNCA 5DJ5A 2AK2A 2PT9A 5IBQA 1XNQB 5AVUA 3ZVKA 4FEAA 2O48X 1JAHA 1GPKA 2I2AA 4DSZA 2GPAA 1K3FA 1P5ZB 1KI7A 3GJYA 4EYEA 3PHIA 2A9QA 3PC3A 1UPXA 1ZRSA 4IIVA 5HX7A 1MIOA 3ILYA 4HB4A 1JU3A 4TKVB 3D54D 5KSWB 5LQJA 1Z36A 4IMRA 2OXCA 4LK2A 1OFUA 5BUSA 5FBVB 3RUDA 2Y76A 1DVRA 2VQEB 2LIVA 4P83A 3DHEA 4D9CA 2RHBA 4CXMA 3QJ5A 3R0XA 5K0BA 5JNRA 1L1EA 2X77A 3MS2A 2GKSA 2GNPA 4LX8A 4B6FA 2DBRA 5FWYA 5DLEA 4L0QA 3V42A 1MB0A 1XU7A 3QVTA 1HDYA 1ZM9A 3CISA 5AKKA 3PRKE 1MIOB 3WHLA 1KMCA 1WKBA 1SO8A 3I3SR 1D07A 1SFRA 2AX3A 1YB7A 3LC0A 3FNHA 1LRJA 1L7BA 3QFCA 1QE0A 1W47A 4JSYA 2YVLA 4ARBA 5KNCA 2PCLA 2TRSB 1HYBA 1YB1A 3BICA 3I6BA 3FMFA 3JSAA 2C00A 4DF3A 5P21A 4EZEA 2BFBA 5FWYB 2P2CA 4RDCA 2E5WA 2FX3A 2VRCA 4RVGA 4QX6A 4M99A 1QDEA 4GZMA 5I3CA 4WDQA 3WLQA 4WESA 4BMXA 1QFMA 5FNVF 1E9BA 1RQRA 1I7LA 2EWVA 2POCA 3GLUA 3HCFA 3JQAD 3N2YA 1T6ZA 4FW8A 4K0KB 2VNHA 2WIJA 3DZBA 4E31A 2DJIA 2V6GA 2VHXA 4PHCA 4QPDA 3BIWA 1KDYA 1E5XA 4I1YA 1GTVA 4KQXA 5EQFA 3KR0A 1JP7A 3HLTA 1IUOA 1PL0A 2WKWA 2PXCA 1FVFA 2BFBB 4TT8A 4Q19A 5HWSA 4ZQFA 3GUCA 4JJFA 2FR1A 5KTRA 1JIJA 2CLLB 1QYXA 4I36A 4MKHA 3ZD9A 3BTOA 3DBOB 1KYXA 2R6GA 5JSHA 4HDOB 1YR9A 3VR3A 2EP8A 2QT1A 4FQ5A 4I8IA 4J91A 4WESB 5FBQB 4B31A 2DU8A 3EH1A 4YT4A 1L5FA 3OQ1A 5KTSA 2XY4A 1UM8A 1Z8NA 3PYMA 3ROTA 4JXXA 2GCPA 1BH2A 4FYPA 3DDWA 4YVFA 4JLNA 1SBTA 1QIGA 2Q8QA 2WIGA 4TWZA 3FWHA 3L6UA 1MAUA 1A8QA 1ZD1A 4URYR 2X2EA 3TX2A 4CM3A 1XZEA 3OA2A 4LX0A 4S1NA 4QPJC 1II8A 3LOPA 3OBBA 2H59A 2GOYA 2IOQA 3IBSA 4JSRA 4JYBA 3IDFA 1ZYUA 2F90A 1E96A 3AR5A 1W46A 1I36A 3BULA 3EIXA 1K97A 3PKIA 3AEUA 4OBXA 4YRNA 3F6RA 4KXNA 1V26A 2JNWA 3DFUA 3N8IA 2HQ1A 1OX5A 3U09A 4QYIA 1JXMA 2HWUA 1KZ6A 4KK3A 1I13A 2QW1A 5FWXA 2VPPA 2PMWB 4LOLA 4M6WA 3T7KA 4AULA 5K8CA 2F1RA 4LV6A 4GXQA 1II8B 2GZAA 4EHNA 1FP6A 2AOVA 4KR7A 1XCBA 3ICOA 5J2UF 3LQFA 3NHAA 1B8VA 4XUEA 4RTNA 3GRZA 2C95A 3MT7A 4RM3A 1Z0AA 1ZIYA 5F3WB 3AEUB 1CUSA 1ZXLA 1J0EA 1MP0A 1WEHA 4MPRA 1VJRA 1IM5A 3KQQA 3TRJA 5AVWA 2CNNA 1U8ZA 1N1EA 2D5AA 3FB1A 3OO0A 4PHGA 4QYIB 5KAMA 3NT2A 4YEDA 1C3EA 3RF7A 4CF7A 5FWXB 3LQRA 2ANCA 2LUOA 4M6WB 4PYLA 3QNWA 4D82A 3PX2A 2J1LA 5BN3A 1W52X 4JL6A 1P1RA 2HPHA 4Q1BA 5HCNA 2DFDA 2V9PA 3ESAA 3K15A 2D0DA 2C7VA 2ODAA 3FM9A 3HK2A 3NOXA 4RD2A 2SNIE 3WNCA 3CF4A 3FUWA 4BMVA 4EPXA 4F4FA 5C4MA 1N36B 1XG5A 5F5LA 2O2GA 1AOXA 2J6IA 3HFJA 4L75A 5U1PA 5L4SA 5CEJA 2L18A 1DPGA 2X8WA 3OKFA 2CCGA 2PRYA 1KC3A 2FXIA 4XYEA 2PUCA 5BN3B 3Q8XB 3EODA 1ZVJA 2Y1FA 3UK7A 1ZGCA 2W70A 3ZIDA 4KUGA 5KWIA 2EJVA 2ZZNA 4G4IA 4QODA 2ZSJA 1OJLA 2YJ6A 4TKZA 1U2PA 4G56A 1YRLA 5HGJA 4D74A 9MHTA 4TWIA 5FT9A 2EFEB 3GV0A 3VYSB 3PFKA 5JCJD 4XPIA 3MQ4A 3JQ6A 3Q4GA 4LQDA 4MHTA 3DAFA 3IAAA 1PUXA 2FWBA 2XI4A 2H51A 4GWGA 2GJAA 3FNFA 4I4TA 2X4DA 3NNSA 3OCUA 3P9KA 4QHTA 1SG0A 2Y77A 4YRLA 2AEJA 4M9ZA 3LUHA 2QZZA 2XT9A 4EJ0A 1N6RA 4ETIA 3WFIA 2DH5A 3V97A 4LGYA 5L6MB 2R11A 4EB8A 5CVCA 4QZVA 2V1XA 3GMSA 4XPIB 3AHCA 4QXOA 4FGUA 2QQ5A 1Y7IA 4F91B 4I4TB 1GAJA 4KIFA 1U0SY 3V7FA 3U48A 3PKJA 3UHFA 4CUJA 1G5IA 1LXCA 2C5GA 1VDMA 4ES6A 1P9LA 3N53A 4AQDA 1RYNA 4ENRA 1DAEA 3VHLB 3FLEA 3C3KA 5KHAA 3ZDYB 2QPLA 1MRNA 3M4JA 4M87A 4N65A 4ZQEA 1FQOA 3WB9A 3FBGA 4O4LF 4OL0A 1TYAE 1DEKA 2B1JA 4JKOA 1E2KA 4OYRA 4GR5A 1F1JA 1NJGA 3EXHA 1QHXA 3I9MA 3MB8A 4US1R 5ESXA 3RSQA 1LQUA 4K9LA 2PXXA 3AR7A 4MQMA 4C6TA 2ATVA 2WF5A 4ZO6A 2OLEA 5FI0B 1ZL0A 3F6BX 1FFEA 3D5TA 4OU4A 2P0AA 4A7PA 4ZHQA 3CX4A 4FR2A 4BCDA 2ZYTX 3SJBA 1HQKA 4D9HA 3R2JA 3K9CA 4IX9A 4CF3A 1XR3A 3AEXA 4OMDA 4RPKA 4RPHA 4CNBA 2O2SA 2RC5A 2QJWA 1PR1A 1H6BA 3EXHB 3ZH2A 3C3YA 1J6UA 4C6TB 3FVTA 1KO5A 1NW6A 1WMSA 3WRYC 4DBZA 4YO8A 1UMDA 4FOLA 3STUA 1L4MA 3T0FA 4ZHQB 3HZOA 2HLPA 2WHRA 3HHEA 3VO9A 4A0SA 3FLAA 2X7JA 3AJEA 4JLDA 2RCYA 1FFSA 3P2EA 4CGYA 1CF4A 3DAHA 4J0GA 1N9ZA 1QB7A 2I55A 3SKVA 4MJ7A 2BFOA 1KVRA 4IIDA 4XM1A 2M6KA 2R6CA 2H4FA 2LXNA 4HO1X 1UMDB 3EUWA 3GYGA 3IBGA 4DRXA 5KJ6A 4YAEA 2ARKA 4ZCTA 4D46A 1OXBB 4EG1A 2BHLA 2Y71A 1NZDA 3KZOA 1NW8A 4FE7A 3C2QA 3S7ZA 1SKMA 3PLNA 5A9RA 3TVDA 4PG4A 1B23P 4P34A 3L7NA 3PHBE 3B1KA 2HCRA 2D0OB 3A31A 3TWOA 5I4BA 3BDAA 4YWJA 1NBAA 2J7PA 1KNQA 1XRNA 1U8AA 2HA2A 1FFXA 1R74A 3LYAA 3U7JA 4ZYYA 1V3QE 1RJWA 3ETCA 4E32A 3NOVA 1J09A 1R88A 3AHEA 4WZAE 4DRXB 4MDHA 2Z2YA 5KTYA 4JJIA 1CQIA 5C32A 2PT7A 5AKZA 2EKQA 1N2IA 1NJSA 4DUGD 2O6HA 1QGAA 1W4LA 2ZRPA 1JT2A 2JFGA 4MB0A 1RHQA 3F6YA 4I5GA 4A3SA 1FFXB 1Z4MA 3HU1A 1S4MA 3EEYA 1GQYA 4IQ4A 2A7XA 3GLHA 3SQXA 1XTBA 4PU0A 4WKGA 4B85A 4DMHA 2Q45A 1XBTA 3DNMA 4MYDA 1MV8A 1RYBA 1EHIA 1CQIB 1S9HA 4YDQA 3HJFA 1KVUA 2IP2A 1GDHA 3V1TC 1GRRA 3BTSA 1X0VA 4UM9D 4AZ0A 3WSTA 1XXHA 1RKXA 1IXYA 2R48A 4EPYA 3RRJA 3RS7A 1F51E 4ZJZA 4QFMA 4WN9B 4Q03A 5LCXA 1HTWA 2YIJA 2ZUSA 1CZLA 1MABA 3RV3A 3ZXUB 1URPA 1OHHA 1VQ1A 2OENG 4MPTA 1FFBA 3S27A 4BO6A 3A1FA 3A1NA 4EG8A 4AZ0B 5C5IA 1NKVA 1OB5A 5JV5A 5K8LA 4ZIRA 2H18A 4S1OA 3M1IA 2F3RA 4BNTA 2FFAA 1MF7A 3HA5A 4IV5A 1WVGA 4ZAFA 3EXG2 3LKDA 4PGGA 2I2WA 4M0PA 3WOVA 5DHRA 4HFNA 3TTYA 1MABB 3DT8A 4A9AA 2FSGA 3PGA1 1OV4A 3AP3A 5EUQB 5KSZA 1LPPA 1HPLA 2CXXA 4GUDA 1DC4A 3GAZA 2GK4A 3SDBA 4JOBA 4ZIRB 3ZDCA 1J56A 1H2FA 2R1VA 3QV2A 4QRDA 1E1YA 4MWEA 3A3KA 3UJBA 4EUFA 4HLUC 3FFXA 5KUTA 1WXQA 4YCNA 1ODKA 4G9BA 2GF0A 2QIOA 1XMIA 1REQA 2ZITA 1NSTA 1EFCA 3K2IA 1B6SA 3HDGA 3QU4A 2WM9B 3B6EA 1UPAA 4BFSA 1UXJA 3KJGA 2EQAA 3LP6A 3N05A 3THWA 4X84A 2H08A 1DRKA 2BBWA 4IKOA 4B80A 1JWAB 3GMTA 1X3SA 3CVVA 2R1VB 3DBLA 3G5MA 4LGCA 4NBKA 3ZY3A 4DIKA 1GIAA 3ABZA 1W36D 5ENVA 1CNMA 1Y5IA 1XKQA 4H7HA 4KL8S 1Q1AA 2GN2A 1BQ4A 3CUYA 3FRHA 2R9VA 1REQB 4H3HB 4KLZA 4ONEA 2ZWPA 4R16A 4DM4A 4U7TB 1G8PA 3O4VA 4BIMA 4HNUA 2ZRMA 2JI9A 5BVHA 2P3SA 1FNMA 3CWZA 4HGNA 4OGKA 4A1OA 4LNAA 4O4JA 2G0AA 2GI4A 1VL0A 1U3DA 5BN4A 3THWB 2AFHA 4PTLA 5GVSA 3DO5A 1D1TA 2DHCA 2IPXA 3DBLB 1E1MA 3IOMA 3MILA 3N8KA 2ETXA 2KQUA 4FFPA 2XD9A 4X66B 4UQOA 2PXHA 4FMDF 4GX5A 3V46A 4I50A 2BGKA 4AF6A 4DHEA 4AS1A 1F60A 1TTQB 5FPPA 1GQRA 1UXOA 3LIIA 4RGBA 4HDAA 3KLMX 3MGGA 5DM0A 1RXSA 5BVHB 1UP7A 5IM5A 1UJ5A 1ULZA 2P9JA 1KJNA 4YRGA 4X5OA 3PKZA 4KVFA 5BN4B 1X42A 2GO7A 2AFHB 4CIYA 2OP0A 3OJFA 3U3DA 1GZDA 4JUFA 5HZGA 3G49A 2NVBA 1MW8X 1N5MA 4WECA 3WI7A 4GZ3A 3LTNC 4I50B 1L4BA 3R3ZA 4AF8A 1YD7A 2PO7A 3NXSA 4IUDS 4ZN6A 2VQFB 1NBOA 2WJPA 4LNHA 4QGBA 4M0MA 3WLOA 4MOWA 4OX9B 4OAOA 2OHXA 5DHFA 2ECPA 4YRZA 1BA2A 1T36A 4JLAA 4CTNA 3IQXA 4CFZA 3K9QO 4DWJA 3O4HA 4IVRA 3IHTA 2JAUA 1PK8A 2VUUA 3R8CA 1P7VA 1TAUA 3JATB 5H3CA 1J1UA 4W99A 5EE1A 3RK4A 2VC2B 2PVPA 3F98A 4HRAA 1GGFA 1O94A 5CTAA 2VHTA 2HYIC 1CUUA 3EOBI 1JDUA 3IR7A 3RIYA 1UODA 4YROA 3K9FC 4DV0B 2J0UA 4HYQA 4JITA 4NU5A 2VRWA 1YZTA 3K53A 3P0RA 1T36B 3L43A 4ZCLA 5TV2A 3HH8A 1NHWA 1S0UA 1AS0A 4OA5A 4CIWA 1GRCA 1GUYA 1A82A 2E3JA 1Y5RA 2FZCA 3L7JA 1J70A 5CMLA 5B3JC 1LX7A 3ETEA 5EJ4A 4JEUA 1BS2A 4B0OA 2JW5A 4J6FA 5T3UA 1HK7A 2WE8A 4WDRA 3VVCA 3WNVA 2GEFA 1UR5A 3I2YX 3KLOA 3SD7A 2L69A 2ZOSA 3VM6A 3M8KA 3VSAA 1OH6A 2P68A 3PCTA 2GRUA 4A0FA 4H0FA 2J0UB 3B20A 4BB5A 4NZMA 3HP1A 3M33A 3O4JA 1NJ6A 1F0YA 1QHEA 3EWNA 5H3HA 1JLMA 2QIPA 3OFNA 4ZTUB 2CW5A 1BD3A 2W6JD 5EJFA 1OILA 4ZD6A 4AJHA 1W5BA 4CPDA 5BNZA 2QSUA 2JARA 2QRHA 2AN3A 4MGIR 3QXSA 1MJGA 2WKQA 2PT5A 3WP1B 2GD6A 1F12A 1XHFA 5L9AA 4JT9A 4MRRA 4Y0VA 4LTDA 4G37A 4EG5A 1KRWA 4J4TA 1OBFO 3LG2A 5JYBA 1O4VA 2ANBA 2COEA 3B2EA 2GD0A 3VQTA 1Y63A 4IWXA 1C0PA 2J3HA 3H4IA 4P58A 2HFKA 4PXAA 1KJYA 5B58T 4MW0A 1PHRA 3SG0A 2RKOA 1W0KD 3JARA 2WJ3A 3LGXA 1V5WA 5FB3A 5EMMA 2DECA 4F9FA 1RWQA 3EOAI 4NONA 4Q9NA 4E12A 2BCEA 4FC7A 5CT4A 3ZDFA 3RVOA 3OQ6A 3QJGA 3B6JA 1D2RA 3BWVA 1WZNA 4UUPA 1PZNA 1Q11A 3P26A 4NJEA 4NZOA 3VPFA 5BSGA 2M6SA 4CKWA 3ZHTA 1IIRA 1OE0A 4KQWA 3GYBA 4QEZA 3M4YA 1SVKA 2H4XA 1G8KA 2H2GA 3O93A 3L6CA 4C78A 5U4QA 2LNDA 3JARB 3PIRA 2JFYA 2Q3FA 2BH9A 1FZQA 3C3DA 4HBZA 1SOUA 1QF9A 4KQMA 1EP1B 1A9ZA 4R41A 2HU2A 5CB4A 2GUGA 4J03A 4NJEB 5IEJA 3MTGA 1K0FA 2HCTA 1PHPA 4CKWB 1QF6A 3LQ4A 1OROA 1XMVA 2IPOA 3L0BA 4Y1FA 5LWHA 2R25B 5AM0A 2NZUG 2ORWA 3ANLA 3U6BA 3WGIA 1CYDA 4MP6A 4L85A 5HIMA 1HLFA 4I0WB 4PLPA 4IYJA 3ZV4A 2O2DA 4N5NA 2DF8A 4CV2A 2CHUA 4P6VF 4B40A 5CB4B 2ZIGA 2P90A 1EGAA 3ABRB 1LQTA 1TRHA 3H17A 4R1NA 1VECA 5FL7A 3SVZA 4X1KA 3W4IA 2QJFA 3QPDA 4CETA 1CUAA 3OQHA 1IZYA 1K6EA 1P60A 2FWMX 2BELA 1NUTA 2PGAA 4OJQA 3BWDD 5BXQC 2OQ2A 2OVBA 1EQAA 3ME5A 4I6GA 4MA0A 4CNQA 4D9MA 5AM3A 2AN1A 3IV6A 2A84A 4INPA 4WINA 4HB0A 3NATA 3R3YA 1N2CB 1RYYA 2WJVA 1D1SA 3X2FA 4DHWA 3AHFA 4FN4A 1DXYA 2DCUA 1W8DA 1E2GA 2Q0XA 2QTFA 4Q4JA 4DA8A 4X1KB 4FMCF 2HK6A 4RWZA 4KI0A 1BD4A 1UXKA 1MHPA 2Z2JA 1PR2A 3TJRA 1NI4A 3I52A 4OHKA 4BO7A 2I7TA 2R4TA 4RSGA 5HRAA 3AIKA 3STTA 1EUCB 4QT4A 4JL8A 5DGIA 2DBYA 3FYCA 4DOMA 2L82A 2G82A 2JI8A 3BH7A 4M0KA 4RZ3A 1MJGM 3R74A 2WAMA 3WHIA 1RCUA 1O7JA 3N8HA 4JHLA 2BY4A 4B6OA 2WPDA 3W6NA 3MRXA 5JHGB 1NN5A 4F72A 1F14A 2GWHA 1Y1LA 1PG5A 1LLFA 2XJ9A 3HB9A 4BRZA 4QAJA 1Z6PA 2V7EA 3GGSA 1W5TA 2HWYA 1Z08A 3A3YA 1KYYA 4KUHA 5H83A 3PNQA 1CZRA 2NQ8A 5CH5A 3NHZA 5FP0A 1P5FA 3GG2A 4YUZA 1FFYA 2QXYA 3W5AA 4HNQA 1TX4B 2FZ5A 1LFDB 1ZH0A 3MWFA 4MW7A 4P35A 1CZOA 3DZIA 3RS5A 3ZNNA 1DDIA 5JROA 1NPDA 3TYXA 4O5AA 10MHA 3AY7A 3GLTA 3PL5A 1JZSA 4ZYVA 3NKFA 3DCJA 3TZLA 2O0KA 4GMXA 1XTSA 4QUJA 3WYCA 1EGVB 5BO5A 3T1OA 4AX8A 5KNCD 3BDVA 2A9KA 3ASVA 2G1JA 5C4IA 4JC5A 4NESA 5C80A 2A33A 5ES3A 5IHXA 4MUEA 5K7SA 1WO8A 4C7KA 1XRPA 3DZDA 4FILA 3K1ZA 5FTMA 5AVVA 3ER9A 2JH3A 3KDAA 1Y4SA 3FAKA 4B34A 1I6MA 1Q1ZA 2AE1A 2VJOA 3LFUA 4REOA 1M0WA 1ONSA 2DPYA 4A0GA 3A2KA 1QQBA 2NV2B 2GVZC 2SKEA 3MOGA 3CLSD 1WB6A 3F96A 3MVEA 5ED4A 2CNBA 2INGX 4E0BA 5CDSA 4TS9A 3WWCA 4OH1A 1BJRE 2C98A 3MFYA 4FYWA 3HKCA 4KACA 1VMDA 3WB1A 3CGGA 1MNQA 4RANA 3COYA 3VR3D 4FEYA 3Q72A 3I28A 4ZMBA 4MPPA 3K9HA 4JAVC 2CYAA 2Q4DA 2R6JA 3GI1A 1RJGA 3ADPA 3NKVA 4HVTA 3VO8A 2E48A 4TTSA 3G02A 2GYUA 4I4IA 4ZU1X 4K5QA 3TNDA 1H85A 2ZRCA 5BUCA 1BVHA 2XB4A 2FWJA 3A05A 2QTAA 3TECE 4QUDA 5JRZA 1MO3A 2V55B 1CR0A 1PTKA 1JA1A 1ZI9A 2FVYA 2OMEA 1T9BA 2MTBA 1WW2A 4DR7B 1Z25A 4H6XA 4YMLA 1IU9A 2D1QA 2I8AA 4LHWA 1J25A 3G2KA 5DPMA 4FCVA 4J7UA 2J3KA 1N6PA 4JGBA 4BC0A 4DMUB 3QA3E 4PTYA 2LCQA 5L7YA 4M0FA 3T3OA 1AVTA 5MF6A 2H1LA 4KIJA 4NBRA 1EDBA 4Q6BA 1U8TA 2HW8A 2IVFA 1Q0ZA 3QVMA 1LBHA 2C84A 1WXXA 3C6MA 4TMZA 1PEDA 4GE0A 4I4NA 4TXNA 3VPBA 2O0MA 2PUWA 1NYRA 3RSHA 1QU2A 3V9PA 2ZR8A 1XZ8A 3K4HA 3SXUA 1R5BA 4JQSA 1F3LA 2XRMA 3MW8A 2CXPA 3V4LA 2Q2OA 3FW1A 1WTCA 1XHEA 3KELA 4B6SA 1ZDMA 1R0ZA 3RU7A 1SVNA 3GFOA 3HPQA 3JASB 3RVLA 1OC4A 5JD5A 1PWXA 2FAXA 2VRNA 1NDUA 5DIZA 5TDHA 4O8ZA 1KETA 3DEAA 3LW8A 5K4HA 3SXUB 3T1QA 2N0SA 2J0VA 3HBFA 4KUEA 1YACA 2NNLD 4QO7A 1SNYA 4OI4A 4ZOLA 3QVVA 4RPGA 4GC5A 3L4BC 3KYDB 5DB4A 3GJSA 4ZO7A 1JVNA 5AO9A 2PH3A 5EE0A 3ZW9A 9ABPA 3T3EA 2CLKB 1XTPA 3DMRA 5EKSA 1WF3A 4W9NA 1KJ8A 1TD9A 3PLAE 3ISJA 3MT0A 3HU2A 4KE8A 1TMOA 2ZVDA 1YJXA 1L5HA 2N42A 2V4ZA 4B82A 3KD3A 2NXJA 2QAJA 3DQZA 1EP3B 1U63A 1Y8ZA 3S81A 2F4NA 3NBYC 2JD1A 4EHDA 4XWGA 4ZOLB 3VAAA 4JVLA 3WK5A 5D8DA 5IBPA 4IHJA 1AGNA 1QXSA 1DCKA 4GI2A 4PZYA 4N1AA 3SEFA 1JJ7A 3L2OB 4UFPA 1WY5A 3UFXA 2YDXA 1VE1A 3ONEA 2JAOA 4LDRA 4BPBA 4FINA 3G8BA 4C08A 1VJ0A 2OB2A 2JAQA 2FPIA 1H1LA 3NTQA 4P36A 3WJ7A 1WABA 5DRYA 3KKNA 2C5BA 2IQ5A 4ND2A 3SS8A 3D6MA 3FZGA 5KAPA 1BH6A 4MMZB 1FYXA 2XZTA 3IILA 3PFBA 3WGLA 4N41A 4MK4A 4ND1A 1XTJA 1Y8QB 1XZCA 2BFCA 3FNGA 2Y68A 1Z2DA 3UFXB 2QD4A 3ENKA 2XODA 5BURA 3CLTD 3DEZA 2UUPA 2WU0A 3EPLA 1FYWA 2HRDA 1VE6A 1Y9JA 1H1LB 2FPIB 3GVIA 3MELA 4MUHA 4US2R 3QKWA 3F0TA 3DM9B 1EBFA 1SIBE 2VAPA 3HWRA 1YXMA 2JBWA 4H18A 1Y1PA 4XSHA 1G16A 3O91A 2FWNA 1EVIA 1U9YA 3I23A 5AVSA 2C0CA 1R8QA 1WKCA 1GUBA 1J99A 2AR7A 2BFCB 2O5VA 3I5AA 3T7TA 4EEXA 3EGVA 3N2IA 5AJWA 4EF4A 4UU8A 5COQA 4TX1A 5DI3A 3MNFA 2NV0A 3OZAA 4KMRA 5F2OA 4OQ4A 5BR4A 5LN1A 1Z5UA 1QHIA 2EG5A 3C87A 4QGSA 3OE7A 1TQHA 5T8KC 1GFZA 1NVAA 3TPCA 5AUOB 4TTTS 4C04A 4LZOA 1T9DA 2JLBA 2WUFA 1IG3A 1X74A 1JB9A 1V48A 4IJWA 4M7RA 4ZRMA 5EP4A 5LBTA 4KAJA 4IRUB 1W5EA 2JEZA 4EYSA 5I5GA 1ISSA 2EFJA 2Y2VA 3L40A 4YK7A 5HZKA 1T4CA 2FPKA 5IH7A 4I55A 1IFXA 1ILEA 4LGVA 1YZ3A 3N07A 5B37A 1ZC3A 3D8RA 1NWHA 1VBKA 2LCFA 4INJA 1KE1A 5LKRA 1HE3A 4P5EA 1RZRA 4OGGA 1XT6A 1IYZA 1NUPA 1CUZA 2V7GA 4BQQA 3HYNA 2G9UA 2I87A 2OSBA 1XA4A 2Y05A 3HVJA 1Z0SA 3M6UA 3RTEA 2C7OA 4LXYA 1VXOA 4ZC8A 2C5HA 1NYLA 4V0RA 3RODA 1T4CB 1X7WA 1RZVA 1SXJA 2CNKA 2PPVA 3DMGA 1I3KA 4I55B 2NVOA 2OZPA 3BEDA 5TC4A 3WK6A 3I5UA 1OFUX 1SKAA 2GD1O 1QYCA 2Z57A 3UJ3X 1M1YE 5LOVA 4HXEB 4REMA 3FE2A 2FW8A 4M9RA 2Y6UA 5JEDA 1OUMA 3S68A 3V00A 3RE1A 1DARA 3PFIA 1TLLA 4IOMA 4WXHA 1EE2A 1M6VA 3HKDA 3ITDA 2B0JA 2RHGB 3GGCA 3K0CC 2B0CA 3OJ0A 4HFMA 4NE7A 3RRMA 2J7PD 3L0ZA 3W6PA 1USUA 1HV8A 5I8PA 1A9YA 1X7WB 1SXJB 1AKRA 5LZ8A 3ABSB 4HWKA 1SUDA 4YR7A 4RTJA 1R6VA 3SJ7A 5LOVB 3TB4A 3LT4A 3A1TA 1AZWA 1A8UA 4ARSA 1XZMA 2Y6VA 4QM7A 3UWKA 4JR0A 2EC5A 4WZBE 1F9AA 3HV0A 3HKDB 1M6VB 2RGXA 3FYHA 3QX7A 5CLIA 4O0LA 2GNOA 4XUDA 3A2MA 3CQ9A 3PR1A 3TLXA 4X20A 4YRTA 4CMIA 2CXOA 4PG5A 1WSBA 4RKYA 1LJUA 1YB4A 5AW1A 3GNTA 2WAXA 1A7JA 4QYWA 5CT9A 1LPBB 1AO3A 5D51S 5CK4A 1RI5A 3QYAA 4NCKA 1KPGA 5E9WA 3ZX5A 5BORA 4V1CI 4RTRA 1S8OA 5EHNA 1KBZA 2HJWA 4Y1EA 3OE1A 4NTZA 2Y9MB 3DHNA 1TQ8A 1YJQA 3ILSA 2RGBA 3H87A 5K3CA 4EYKA 5EIHA 5LYYA 2ZYUX 1DWOA 4X20B 2BGUA 2NO6A 4CMIB 1CQXA 1NRIA 3PQ6A 4UZFA 3HCNA 3WLPA 1Z8HA 3PDJA 1E4VA 2PSJA 3M1YA 3UHOA 3C5VA 1SUBA 2F1OA 3K0HA 5J59A 4RD1A 2IPLA 3JQPA 2DR0A 2A8YA 5DYIA 2QUBA 1OHHD 4EEZA 1P44A 2WRZA 3ICWA 4ZT4A 5BSUA 4KJZA 1M2JA 1GZSA 5GP1A 2PWZA 1NX6A 4ML3A 2FMTA 4I4CA 1XC7A 4A1FA 2A94A 5M3BA 3ESDA 1CG6A 3U4CA 3UAXA 3WGNA 1AUPA 3VZBA 3FVVA 1U7XA 4OLAA 5LXTF 4YBRA 3B5JA 4PPQA 2WF8A 1RYEA 3FF4A 1AMUA 4NVRA 1PSWA 1RPZA 2AC7A 3JYOA 1AJEA 2CMGA 4QDOA 3VR4H 4DLAA 4JD5A 4EK9A 1CBUA 5I3ZA 5B2ZA 4OSPA 1C14A 1Y9DA 1MTOA 3TF5A 1AKVA 2O23A 2X2OA 3FCUB 2AB0A 1IZ8A 3K96A 2I5PO 4DSOA 4EY4A 5KCZA 1JFRA 2DT5A 3KXPA 3LSYA 1QGZA 2EHJA 2QD2A 2VAWA 2QYTA 3DOEA 1AKEA 3EDQA 1YR1A 4ZKDA 2GN6A 5TE9A 3ZE0B 3P0FA 4CE6A 1EWYA 1LK5A 3WMXA 1CE8A 4B47A 3SYTA 1G21A 3OIWA 3F5QA 2ACVA 3STWA 3BVPA 2Z9CA 4PQRA 3B1FA 3GUZA 5A5DA 3X44A 1PV1A 1V3VA 5FO1A 5K2OA 1N57A 2WP8J 3K5WA 4KO1S 1W25A 3I8SA 1QE5A 1RRMA 4BCCA 5BW4A 1CJMA 3NDJA 4RD3A 4C4SA 3TH5A 1SPXA 1CY0A 2PS1A 4OQZA 5FNZA 5JISA 5JYCA 3MCAA 3B82A 1CE8B 1ZSNA 2C2XA 3O3CA 1G21B 1X1EA 3KEQA 4KBGA 4JI0B 4RYDA 4BNGA 3ELUA 4WE3A 4XA8A 3PEWA 2JLVA 1ZK1A 2NAPA 3ROQA 4K05A 3WWDA 1R2QA 1K1EA 3QKIA 3CZ9A 4JT4A 1YB6A 3SS7X 5BWBA 1O6BA 2P9EA 3W9BA 4IDAA 1G5QA 2FQQA 4IIJA 2IHYA 4UZEA 1S01A 2CSUA 1J39A 5AJUA 1N7JA 5FL3A 1DHTA 4PLTA 4B79A 4X6YA 3L8HA 4DREA 1CNFA 4FE4A 1ZNXA 1OWPA 3DJFA 1QK3A 2ZAIA 1IN8A 2JLSA 1IWPB 3SJZA 3U56A 2FFBA 2GBPA 3PQFA 4M86A 5EJEA 1GFWA 2V7BA 1O54A 1V4VA 2GK7A 4IIJB 4WGGA 3CKLA 3PEVA 1JHPA 2OR3A 1XQ9A 4AO8A 1UOQA 2F3SA 2Q2QA 3C4VA 4I3FA 4J7CA 4ARUA 1KTIA 4WD3A 3RFCA 2BMVA 3M9XA 1X7GA 2GZ1A 4AJ1A 3ECAA 2B69A 2IP1A 2WA2A 1CIJA 3EBLA 4M0CA 1GG5A 3RUAA 5ALOA 1E3TA 4YJKA 3G2NA 4GPBA 1M75A 1HETA 4U9UA 1DBSA 4R9VA 3CR3C 2ZZMA 1U9CA 4HEHA 5KX5F 1WIWA 4NPCA 1C4KA 1O94D 2VDNB 1YR3A 1HM5A 1IBSA 3PX3A 4TL8A 3UAZA 3QVOA 1HZZC 2H2AA 4N9WA 4ON9A 4UCFA 3OM1A 4XFKA 4YUXA 5IFKA 1VIAA 3HL0A 4O59O 4IF4A 3V1KA 2MSCB 2YINC 4LY3A 2YC2C 5TS2A 3V34A 2ZROA 5DTQA 2NXCA 2Z6VA 2CJYA 1PT8A 3MMSA 1MZVA 2VQSA 2X0DA 3ZY2A 1J8DA 1N6NA 4UAJA 1DKQA 4IJVA 1QH1A 1P2BA 2GCOA 3I61A 1NVVR 3ABIA 2BH2A 3ZWPA 3MXTA 3R6DA 4FI3C 2PZ8A 5C8VA 2FSHA 3D0OA 3ETDA 3P2IA 5EYPA 4LSGA 1ORHA 3OFND 4E4TA 1ZD5A 4ETMA 1YZVA 2XMZA 2B8EA 5CGZA 5AW8A 2RH5A 2H48A 3UWOA 2FW0A 4ME6A 3QWAA 3IP1A 1QH1B 2GCOB 4PN7A 4AJKA 3TSAA 1DG1G 1FP2A 2JRCA 2C59A 4XLZA 3C3PA 5B53A 1OA1A 2HIHA 2ZPUA 3G2HA 3SIPA 5KWSA 1I0LA 1UL1X 4RK1A 5EYPB 3F3YA 2YMPA 5EIAA 3SYMA 4UBKA 1VBFA 1WU7A 2OZEA 2O06A 4FPXA 1FNNA 1E7WA 1B4DA 3UJNA 1XZQA 1KGSA 3NORA 4RXMA 5ULLA 2EP5A 3C1OA 3Q5EA 2J6HA 4NZNA 3S8EA 1WSAA 3PU6A 1ECGA 5ES4B 2GXAA 5J1TB 3R40A 3DE2X 2MR5A 5HFNA 1J2YA 3ZGNA 2NU8A 4ER3A 5SZHB 1T15A 4NLLA 3FFTA 3UCEA 4YPFA 5CXXA 2Q5EA 4OHXA 4L1KA 4WADA 5DBHX 2QZSA 1I1NA 3VZRA 2HHHB 2M32A 3EVFA 1I5OA 4M8IA 3PVSA 3GVHA 3CLRD 3HDQA 3MAAC 4Z4IA 1DWPA 2Z2XA 2P35A 4EGFA 1Z39A 3AHGA 5I6DA 4PNZA 4MUFA 2MYPA 3DMHA 4MW6A 5A5FA 5TQ0A 3Q5GA 4PLZA 3M0EA 2NU8B 3RJZA 2HSWA 2Z6AA 2GA9A 4IL5A 3D8UA 1C7QA 3RU3A 5EJ9A 1NNSA 3EIOA 3LQ1A 2FN4A 4X00A 3D1VA 1NNI1 3Q3CA 3MUFA 4HYEA 4PLCA 2VTDA 4N40A 4D8XA 3N0VA 3O9VA 2JAHA 1RJFA 2PBRA 4RKRA 1SEVA 1WU8A 2Z1NA 4A27A 4EKGA 3CURA 1JJIA 1D8TA 3KOMA 1E1NA 2NYUA 5TQ0B 1AQ6A 4ARAA 1RP1A 2QN7A 1X2EA 2ODPA 2XITA 2Q5JA 5GVRA 3TZKA 2H31A 1ESNA 5FL7D 1OZGA 1L5YA 1A88A 1Y34E 3OJLA 1LK7A 1QFZA 1H2HA 2X9NA 2HBRA 3TTTA 4DUZB 2A9RA 1AO0A 1O77A 3KJHA 1G8SA 4Y2PA 3PQ5A 3L4SO 2IOHA 5KU7A 4YJHA 1EVLA 4BAZA 1PGNA 1ML4A 2M1XA 3F3KA 4PYJA 2UZAA 1HF3A 2XIQA 5LQSA 5M7EA 4Q3KA 3GH3A 1HLPA 1DCFA 3M9LA 4RK6A 1CR2A 1T2EA 3FAZA 3DDHA 2RK3A 3EBOA 3WSWA 4IDBA 3VI3B 1RD4A 4Q16A 4RY0A 1R10A 1O6GA 1KZGB 1BOOA 4YJHB 3RSCA 1R9NA 1CR1A 3O84A 4YCMA 1M1NA 4MO2A 2C57A 3DFIA 5J5CA 5BN1A 5K05A 4K7JA 2CXNA 1FS4A 4WLNA 2XHEA 5BV7A 3ANYB 5SYMA 5EWLA 4FMPA 2WPDD 2ZYAA 2XADA 3IMFA 3OIGA 2ZIVB 3L77A 3TMYA 5FX2A 1HX7A 3LLCA 1HSOA 2IUYA 2XNSA 1RYHA 2PUJA 3WYFA 4Z4GA 1EVQA 2AI1A 3HJHA 3E4CA 4R05A 4L3WA 3RLIA 1PEAA 3PGXA 1NATA 3E27A 3DLIA 3EGEA 1E5LA 4BB9A 1AA9A 1M1NB 3EF3A 1Z0DA 1NOIA 3ZWWA 3H3JA 4IZIA 1XU4A 3A1UA 4OIMA 1ULHA 1VL6A 2O8FA 1WDTA 1KJIA 1KSGA 4EPTA 1M76A 2UAGA 3P5BA 5D1HA 3QE9Y 3ADDA 5DXAA 2DLCX 3Q7SA 3KR1A 3H7IA 2MYNA 1YZGA 2XOKA 3DOCA 3DZCA 4H7EA 3KSRA 1KAMA 1PEKE 1TYCA 2RAPA 3E3AA 3LHIA 2VQ6A 3HZHA 1H2BA 3G6KA 3IOYA 3NBAA 4I19A 4CBVA 1NLZA 1XF1A 3QUQA 4PLWA 1OD6A 1HNWB 3FMVA 4DMCA 4U3JA 1SHJA 3KYCA 3EAFA 5FPYA 3T3MB 4DZZA 3TFOA 4M0DA 2O8FB 5E95A 5JBNA 2HA3A 1OLOA 2O19A 2BL4A 3GT0A 1MJ5A 1ENYA 3JX9A 3NAGA 1E2PA 3AIMA 1JBQA 1RJDA 1KZ9A 5LP6A 1R50A 1YL5A 2E4WA 3PENA 1TEZA 1P2SA 2CF5A 3E35A 3BAZA 4GGOA 3OQNA 3DHVA 3H6KA 4R2JA 2C8JA 2MSKA 3PUWA 3S55A 3OZWA 1LA2A 4JVOA 4K6KA 5IF9A 3KYCB 4QDJA 3PC8C 1NBME 2QRKA 5JSYA 3V1UA 2G7ZA 3UMRA 4PZEA 4RF5A 2KBFA 1XN4A 2W6CX 4BY9E 8LDHA 2QPOA 1KHTA 3F9IA 3NHMA 3UFBA 2CLCX 3U1BA 5KC9A 2CFCA 2WT8A 4H27A 4RY9A 5LP6B 4R3NA 2HD4A 2ZQYA 3C39A 1VOTA 3W90A 2VP4A 4R0VA 1LGYA 4JB0A 2W6IA 1NQTA 3PITA 4DMLA 2D1TA 1XQ6A 1T9GS 1UJCA 1CHNA 4F0JA 2HMUA 2GPBA 4GXRA 4B2IA 4D2IA 1SUEA 3E9RA 5FYDA 1KYIA 5TMEA 5JCPA 4DWVA 1H6AA 1E9EA 1ANKA 1XRQA 3DDZX 3KQPA 3P9SA 4PV7A 1LDGA 3QFTA 1AD2A 3UMCA 1RADA 2OG1A 2OQRA 4WUTA 3T7AA 4HH3C 1E32A 1NULA 1ABEA 3D59A 2ZTHA 3RRNA 1Q2XA 1TEXA 1KQGA 3I5YA 2ZSIA 3FPAA 2HF8A 4C06A 2PU5A 4OKIA 2C3MA 1OXMA 2YS6A 4BZPA 3K7EA 4L4YA 3GWGA 2WABA 4G0PA 4J2HA 1EFPA 2PBLA 3CN9A 4OXIA 5AR1A 3VKFA 1J9GA 2F9FA 3HCPA 1G19A 2HDHA 1KDOA 1KEUA 3O8LA 3GCWA 4NZZA 4YONB 3OPYI 3VUFA 1SVIA 1VLHA 2OBLA 4FIZA 1JQ3A 1V16A 4MV8A 5L6LB 1E4EA 5EWJA 1OW3B 3WDKA 2R0QC 1G3QA 2BWJA 5C1IA 1DZIA 4UVEA 3SLGA 1VI5A 2TMDA 3RAGA 3I73A 3KB6A 3THOA 4K3UA 1T3LA 3TXXA 4E09A 2PN1A 2ZBRA 2XMDA 1W1WA 1NF2A 4EKEA 4MJLA 1AMOA 1JG3A 1V47A 3D6HA 5C2JB 2IHNA 1W2GA 2IU6A 1V16B 3KEOA 3NAMA 5EWJB 4C76A 2PL5A 4Q18A 3QIAA 3O7WA 1JU4A 4EG7A 5TLSA 3E9QA 5H4HA 4BJ1A 3OZEA 3ER8A 1Y33E 1XQYA 4BV3A 1U0BB 3IP7A 3GCXA 3HVHA 2PTHA 2ZYDA 3RH0A 1NFFA 1PZEA 1UAYA 1ODJA 1B1AA 5A4IS 3JWGA 2A5FA 2PD6A 3NHYA 4EG6A 2QLMA 4AP6A 1PNOA 4YMVA 3W9SA 1CEEA 1Z0ZA 3L0DA 4JZYA 3WNBA 3IC5A 3VPAA 5B6IA 3PS9A 4TTPA 2Z9DA 2Q2WA 2CVPA 3LYHA 4NNJA 2C2MA 3HBMA 4ND7A 1ZFNA 2B7BA 3VRHA 4PR3A 2RGUA 4NFHA 4YMSA 3G0GA 4Q1FA 5CUQA 2FN3A 2D5CA 3LF1A 1II9A 4JFRA 1OWLA 3T9DA 3ZYCA 2EG9A 3INNA 3Q10A 4Y30A 1PS0A 1SOVA 1R15A 2ZKLA 3ZCXA 1T0IA 2C4MA 2WSMA 4AS2A 2YWXA 3G9XA 1JKXA 1W49A 2OCYC 3E03A 2PJZA 1V11A 2VLIA 3S99A 1ZA2A 5LL6P 3IJRA 3KZVA 4IGIA 4ALNA 2PKYX 3EUEA 4CV0A 2RHWA 4R6WA 5E7QA 1JVSA 4L9WA 2JKZA 1XL0A 3KXKA 2FB9A 3Q6MA 4ZVTA 4BNUA 5BW6B 5I8WA 2BFEA 1D0IA 3K1JA 4IGAA 4JLBA 3ZE6A 3OPYA 3CB2A 2Z4TA 2OHHA 5FFFA 4ZV7A 1KKMA 2JLUA 5CD1A 4EENA 3NH9A 5H9WA 1HE8B 1V11B 4C0XA 3KQUA 4U6SA 1AURA 1YQEA 4L0CA 5EIBD 3QX3A 1U4SA 1QIFA 4DXHA 1M8JA 2ZJBA 3N2GA 1ZAYA 1SU7A 4YP7A 5BPHA 2XYRA 1E69A 4OQLA 2ZKIA 2ECFA 3ADKA 4XPZA 1ZMXA 1PGPA 2BVNA 1FJHA 3OPYB 1NVFA 4ZCPA 3AYXB 3OE7D 3ZQUA 3KR9A 3GGOA 1SHZA 2Q3EA 4G26A 1C7RA 4MIKA 1U94A 4P31A 1C50A 4YS6A 4EUHA 1VI6A 1YVDA 3EIQA 2CDNA 1S7CA 4X3PA 3H42B 1BZYA 3QBVA 5EZ6B 4YYEA 5J3JA 2IYZA 3GA5A 3DE7X 4XOUA 5IHPA 3AB8A 2GF2A 3T9BA 3NALA 2A0YA 1BWPA 3P2OA 4BQEA 4KV9A 5E1BA 1KPIA 5ALRA 2FMHA 1TM3E 2JFPA 2DPGA 1GU0A 1A4UA 1WVIA 1RZRD 1XD2A 3AVWA 2GXQA 3VGPA 5DHUA 4C6SA 2WWRA 3FDXA 1WZUA 1IPFA 2YHBA 4PICA 4HPWA 1YVEI 3ID6C 3MYRA 3OOJA 4HDRA 1QOQB 1IZ0A 2ZI6A 5ALQA 2BLNA 5K51A 2BRUA 1H2ZA 1SXJD 2V65A 3DUFA 1S3IA 4L4RA 3V80A 2HC9A 2JHAA 4M60A 4GKBA 1RIFA 1JE0A 1WBJB 2XGSA 4GOJA 3TDMA 4TRMA 2PX2A 5K8TA 1NJ1A 3AONB 1XD2B 2V7TA 1QO7A 4ID3A 1O5TA 4QC2A 4JI5B 3ACBA 1QR6A 4BLWA 1P6UA 2HHCA 2ZBUA 1L5KA 5DF1A 4B4OA 4KE6A 4B0PA 1U1DA 4HDRB 1MEJA 4X44A 5DM60 4BVLA 1ODTC 2N9UA 4ZCMA 2YXLA 4FUTA 1XKTA 3MSCA 1VM6A 2QG4A 3DUFB 1DC6A 2ZTUA 1PJBA 4PYRA 3PHGA 3NOOA 5IC5A 5DYGA 2JF0A 3I12A 1YS2X 1N5IA 3MF4A 3KQHA 1W36C 1OKKA 4FT2A 2C3PA 1AKWA 2JFUA 4A91A 2FU5C 2H5JA 1GUDA 4I5IA 3T8YA 1UJ4A 4FU0A 4ZAVA 2YVAA 1NMEA 3ZVLA 1GGMA 5KQPA 3AVXA 1KSHA 2D4HA 3IJ5A 4PHHA 1T5OA 3KHTA 3UWMA 1CY1A 3WDMA 2PANA 1IQ0A 3FH0A 3Q3VA 3EMKA 2XXJA 3T4EA 1L8OA 4E22A 1JDSA 1O1YA 1VYHA 2ZBPA 2P65A 3KU1A 3GEBA 4LISA 2OZVA 2ON6A 4WOCA 3C8ZA 3U9SA 3WO0A 4AMBA 3RQSA 2EWWA 2BFNA 3EHDA 1Q12A 1UDRA 2MSEB 3KQSA 2QKYA 2QNBA 1A69A 1KBOA 2YIDA 3FDJA 4BUJA 2XCLA 1GKUB 2HEGA 1HC7A 3CKMA 3NJ4A 1AK9A 4J2TA 3SHQA 1U0FA 3WTCA 5JXIA 3AEQA 1NBHA 4NBSA 1IUKA 1M2KA 2E21A 2H85A 2X3FA 2ZSHA 4LC0A 4S3MA 4K1XA 1JALA 5U4XA 4IGKA 1U2DC 2HH9A 4Y6QA 4BATA 1TCCA 4HB2A 3QM1A 1KRHA 1Z38A 4QWMA 3P9QA 3GB9A 2JIOA 1R9JA 4MDFA 4X6LA 1UAGA 1Z18A 2FK8A 5TXGA 5MFZA 1YGPA 3RR2A 1K92A 3VC7A 1N6HA 2PEZA 3DZHA 1XDUA 3LC7O 4LYHA 5SY6A 3U4AA 1GL7A 3P4UA 2R7LA 2VPZA 3KKLA 2OCLA 4RDIA 3AEQB 2FQ1A 1L0BA 3SQOA 5AW3A 4MR9A 2FZLA 1MBZA 3WYEA 2JEYA 3R7SA 1A5ZA 3BWMA 3DB1A 3BERA 3CH6A 4J0DA 4ZANA 4ZI2A 5ECYA 1MOPA 1UAAA 2EU8A 5AKYA 3LX4A 5GM2A 2QLBA 3ROMA 4KFCA 2V5VA 1GRVA 3CPSA 1MVLA 5G3ZA 5TMBA 3HXLA 4O2LA 3ZQKA 2WFZA 4TV8B 3R9XA 2YJ5A 5ERGB 1B73A 3WZLA 4RXTA 4MR9B 1DSSG 4ADSG 2ODEA 4KTTE 2X7XA 1NTRA 1PS8A 2PO5A 3JQ7A 3M7IA 2P4QA 5TARA 1XMPA 4AWBA 4CTOA 2WSYB 5H8WA 3RVBA 4A8PA 3TQOA 3OZDA 1IEQA 1GSOA 2P2SA 3VDRA 2PUHA 4KMMA 3R9XB 4Z4QA 1L4YA 4NNPA 1NOJA 4EX7A 1HYEA 1OLXA 4LOAA 5JJLA 3DO8A 3EVCA 3URMA 3WXMA 1BMFA 3B3FA 3B3AA 3JQ7B 3EEOA 2GR9A 5K0SA 4RHTA 2I91A 3TPFA 1PFQA 3TXYA 4EF5A 3PFFA 1EFVB 4J16A 3U1TA 3R3HA 2O7SA 3MA0A 1GKKA 2IFTA 1RC1A 1ZBDA 1C1DA 4L8WB 2O8NA 1OLXB 1IY0A 1RXUA 2RDMA 3OPMA 4PRKA 2PNJA 3Q3IA 2CL7X 1D2MA 4QL3A 5ALHA 4OI1A 2VHEA 3UIEA 3KWFA 3T5AA 1A4IA 1J2RA 1G9XA 5DNDA 3SHWA 5KO2A 1HQYE 4WN3A 5CLLA 3R77A 4NFYA 3R8XA 4EB3A 1QX4A 1BXKA 2QN9A 3T6KA 1GPWB 4U7GA 4ZYUA 3KEGA 2P2GA 3F67A 1EIWA 1KDRA 3ESYA 4KFSA 5CH8A 1XWFA 1C1DB 1Q1QA 1BVYF 2FQWA 3QLVA 2XXAA 5FFMA 4DLKA 2V5UA 4EOGA 5ADWA 1YZNA 4FYVA 1T0PA 2BF7A 2Z0MA 5CYGA 9LDTA 1B42A 2FF7A 2IUSA 4UE6A 3G8AA 5KNBH 3EVAA 5EP3A 4F6CA 4HQKA 1KO8A 5JFTA 1JFLA 1Q0HA 2QQFA 3SFVA 1QWOA 3QUTA 3TLGA 5ABPA 3UJPA 3DDNA 4F12A 3HEBA 4ND4A 2YQ5A 2ZQ5A 4ABTA 4D0LB 2Y1OA 2DHDA 2YY5A 2PKRA 3AJ8A 3R09A 4CLXA 2WUWE 4DIUA 5EIFA 2VWPA 4M8SA 5AVOA 1NF9A 2VI5A 3MWDA 3S28A 5ICGA 3NIDB 4ZEOA 1N34B 2XTNA 1T1JA 4YRFA 3NJ8A 3MT9A 1WWKA 3T4XA 2BN4A 3LO5A 3WICA 3GLFE 5EIOA 4LAFA 3TLGB 2LP4Y 1AQIA 3IUPA 3LA8A 4R7GA 5KJ1A 4XOIA 4A23A 4AJ9A 3RO7A 5BV1A 1H1DA 1WXIA 4S0XA 4OXYA 3HJBA 4K46A 2HADA 2XD4A 1UQUA 1H4QA 3IIJA 1T0HB 3MWDB 3PE4A 2PZGA 5EC8A 3F97A 2R7AA 4PS1A 4D5EA 3SICE 3C6BA 2X6TA 4NX2A 4QBHA 3ENWA 1JLHA 2RJ3A 2IYNA 2VPQA 1QUFA 5FUXA 1JDVA 3PT5A 4M98A 3ZC3A 3DP7A 3ED5A 1G42A 2DZDA 3LYLA 3O8OA 2BDUA 2IEBA 3X3HA 3ZD6A 1HDXA 3FCSB 2FWAA 2ZVJA 3O31A 2AJLI 4MRAA 3VA7A 4HN2A 5HBRA 3DZJA 1JIKA 1JHXA 3VV3A 5EQDA 1JDBB 1XELA 1QYVA 4IIFA 4MCHA 1QUEA 2IT1A 1ODCA 2V3WA 1K06A 2D74A 1UQTA 1GVHA 2WE7A 3KUUA 3JQRA 4TMTA 4DLLA 5JANA 3O8OB 2ZATA 4UEOA 4LDQA 4N0QA 3R5XA 1L4FA 2C4NA 3R9KA 1WPRA 1TCBA 5EHQA 1QS0A 1BMTA 1Z62A 5A0TA 1L7EA 3GHHA 4RF3A 1QU3A 5E8JA 4FFRA 3DFZA 5H80A 5TQVA 2X41A 3TN7A 4DC0A 4P08A 4Q9JA 5EE9A 1L4NA 3QXXA 2JGLA 4JVNA 2V3VA 4NARA 2GN9A 2GKGA 4Z8YA 5BXYA 5LD2B 4PNPA 4W8OA 1Y6GA 5IDVA 1XEWY 3I0ZA 4QDZA 3DDCA 4Y7CA 2P62A 4JJKA 3MC1A 1G59A 1G5HA 2AG8A 2H92A 2Q2NA 5T6MA 3KQYA 1QS0B 2D62A 4CI0B 4D56A 3SZMA 1U9IA 4X8OA 3CO0S 1E6LA 2NSYA 2WWTA 3WGHA 2GZDA 1PDVA 1U3CA 1MX5A 4PFQA 4CHTA 2ZU6A 1ADYA 4S2EA 5IBCA 5KOIA 1L8XA 3IUNA 1O97D 4IIYA 1FDIA 1PFVA 4QBFA 3GUHA 1OVGA 2AJDA 1HURA 3UT5A 3WGVA 5B30A 4C87A 2JA1A 3T7EA 4LVUA 4L74A 4H1UA 5IDWA 1W7AA 1XDBA 1NW3A 4HCJA 5EXTA 4XVCA 2AA3A 5HF9A 2IS1A 1Z2PX 4DM3A 4D8WA 4FDVA 1Y9ZA 2BKUA 4G4JA 4Q7JB 3S0JA 5I7SA 2YZGA 3IVGA 1NKTA 5E6RA 4UTNA 1P18A 5TT0A 1ZLYA 3VSBA 4AZWA 4C7VA 5CXSA 1FSFA 2PIDA 2MINA 1LVUA 4W6QA 3WKEA 1MU0A 5TMPA 1SG6A 4KJXA 3UT5B 2XWJI 2Z2IA 3CZCA 4WBNA 3IMEA 5GMOA 3DTVA 1E59A 4RVUA 2P2DA 4IWYA 2W2TA 3L4EA 5F5XA 1EXDA 2AS0A 4IXWA 1GU7A 2WM3A 3V2IA 1YA4A 3EQZA 3GELA 2A9FA 2DQZA 3E8XA 4OGLA 3ZV3A 4BLQA 2UXCB 2CLFB 3HJGA 3L93A 5E6RB 4MRVA 3IPXA 3CWQA 3E70C 1SCBA 2GASA 2QVZX 3RIHA 3RC1A 2PMCA 1OV6A 2IPAB 4OHOA 3VGJA 4AUNA 4WBNB 5KNDH 3L0SA 3DTVB 2IXDA 2ZB7A 2W93A 3OTGA 4UDOA 5HTKA 2C5FA 2G5GX 4R3UC 3F9RA 4ZRDA 2R751 4W7HA 1Q6YA 2VSXA 4B09A 2PUVA 4GMKA 3C7DB 4KIGA 4G25A 3DLHA 3VZPA 1UH5A 2CJPA 2JIZA 3CPHA 4JLSA 4RD4A 2Y1XA 2DT8A 3LF2A 3IR6A 3BXXA 2BGNA 4B3TB 4CR7A 4LZPA 2J4FA 4IZ6A 3B70A 3LV8A 1FDOA 3KJFA 5HS6A 1NM5A 4I46A 2GPNA 1PAUA 2X1LA 3I64A 3LCUA 4W7SA 5L3QA 2OAP1 2XNDA 3VH2A 4MARA 3HS3A 1A9OA 4FDUA 4OA8A 7REQA 1VZ2A 2JFWA 3ZVRA 1KXZA 1WD7A 3HE3A 1ODIA 1NKSA 3DOFA 2TMGA 3AR4A 4H35A 4K0RA 4YCJA 3RDPA 3YASA 4UVHA 3IUJA 2OO5C 1RLJA 4U2GA 2CNWA 2XOKD 3W7BA 3ZDQA 1JYEA 1LEHA 1ZH2A 3OLXA 4RJJA 2VVTA 4HVAA 4NAHA 4TS3A 5L3QB 4YRPA 1U80A 2Y0CA 2BUCA 1U4OA 4BVHA 4KQGA 3WQBA 3UV3A 2F8TA 1H0KA 1S6YA 4N6NA 4U2DA 2V58A 2XTJA 5CJ2A 7REQB 3LCJA 1MC1A 1FMJA 2ZAMA 1Z15A 1Y1SA 1E20A 2QMQA 4PW0A 1EUZA 1AB5A 3UMVA 3PXCX 1QLWA 3K09A 4ESEA 1I1QB 3NHJA 5EPUA 2PUTA 1L5SA 5FOWA 4N0DA 4DCMA 1GR0A 1Z6AA 2PSHA 1D6SA 1VMIA 4TZKA 4CCAA 3MHTA 1Z2AA 4Q4HA 3WKCA 2QN1A 2QV7A 4NABA 4BV2A 1UXGA 2CKDA 3A27A 4GOMD 5E7MA 5CFMA 4RW0A 1P1FA 4JI4B 3GDGA 2C1XA 1YVUA 2DWOA 3NHWA 4JEIA 2WSSA 3SYNA 3BJEA 3RYIA 2VUSA 3D9QX 4FJ0A 4RAOA 1QCCA 4FWTA 1NG1A 3HBJA 3N0XA 3CFYA 1RACA 2HBQA 3CW9A 2QNIA 3PPXA 4AUKA 4N48A 1ZIXA 1Y5NA 2G1AA 4HH0A 1W4BA 4Q4HB 4ROTA 2W6ID 2BCGY 1M83A 3NC4A 2V8BA 3P7MA 3FPEA 3RFXA 4RCVA 1J2JA 3SEAA 3TLBA 2YWHA 5JW6A 3W4KA 4C7OA 4HUQB 2JKVA 2L0XA 2YZKA 3IP8A 4X8HA 3RYIB 4UVDA 1KZYC 3P4YA 1DPFA 4HUJA 5A0VA 4J07A 4JLOA 1G6HA 2WLTA 5AVRA 1MD9A 3CV3A 1V25A 1XLTA 1P91A 3HXKA 2XUGA 2IYQA 4ZK6A 4P0TA 2WVGA 4Q05A 2EL7A 2IOYA 3VR4A 4KGDA 4JKIA 2YC4C 4CM8A 1S7GA 5AI9A 2HNAA 4Z7NB 3T5TA 1P5JA 2BMJA 2VT7A 1BNCA 2P67A 3L84A 3R7DA 4AXXA 5LNK6 3IE0A 4U02A 1CUWA 3X1XA 1EP9A 1RRVA 3A4MA 1KEPA 4YR9A 4B3BA 1AZTA 4IVQA 4E2ZA 2B2NA 1IONA 4DV6B 1P7CA 1FFWA 4NK4A 1U90A 4EHFA 3KAPA 1V3TA 5CRIA 1SCIA 4YAKA 4JLMA 1MA0A 3TK1A 3D0RA 3ZHUA 1ZQ9A 3JV7A 2PFKA 2RJNA 3GLGE 3VU0A 3AERA 4I66A 3G9TA 1BHO1 1JA9A 1RAAA 2C7PA 4TSFA 1AV7A 3EFBA 1NVVQ 3E15A 2OD7A 4DCUA 4W5WA 4LKRA 3S1AA 1GCAA 2XZOA 4G84A 1JQKA 3VVBA 5BYAA 4YFVA 2WHEA 2RONA 2XUAA 4LMRA 5IKOA 3H5IA 4F11A 1V4NA 2OGSA 4NEHB 3OPQA 5HDBB 4REQA 4LTMA 2ZI5A 3Q6NA 1L4LA 3PJEA 1U2EA 4OMFG 5KYTA 4LJ8A 2V7QA 4HP8A 4KB5A 1DFIA 3ANXA 3RKSA 3S1AB 1U8CB 5C7YA 5CDFE 2VT2A 1ZC4A 5JNVA 4JQCA 3LLMA 3RSGA 2HIAA 2I2BA 4PQGA 5JI2E 4DJ5X 2PR7A 4BMNA 1BKYA 2FA9A 2HIGA 1NUAA 2G28A 5ELLA 3UV6A 1KK3A 4GBED 3UJCA 2DSTA 3AR8A 5HMMA 5CNJA 3JYPA 3WBBA 1QP0A 4L8FA 3GRRA 3TLZA 4EKIA 3EEBA 4RFSB 4C3UA 5IW8A 3ZN2A 4REQB 1R6TA 4GYWA 1N2ZA 1N33B 1OI2A 5CHYA 2WIFA 1GZ6A 2KS6A 5IVDA 3T0GA 4IFBA 1XZBA 5KDLA 5GGYA 2FJUA 1A1SA 3OCZA 3LK7A 1B2RA 1KYZA 3KU4A 4PWZA 4F3RA 1R00A 3FHJA 1LRKA 1EZ1A 4X61A 4TMFA 4TN5A 3QKTA 3W5VA 3B1XA 1YF3A 2OLJA 4JYMA 2GF9A 4YRMA 2FSVA 3EVBA 1F7VA 1RP7A 4FD2A 2FSSA 1OC2A 4JUAA 2G9VA 3O8NA 1RRKA 2IY9A 2WM2A 3C15C 3PXDA 4KQHA 4O4JF 4RA6B 1UJ6A 1ZA1A 1N5OX 3KUKA 1OWOA 4NEQA 4YQYA 1KP9A 1V9SA 1WSDA 3CG4A 3F8TA 3LUCA 5TPZA 3RS9A 4TLCA 3AVQA 5ALSA 4FJ2A 1MXFA 4Z9BA 5IAJA 1WW3A 3DGFC 3P1JA 2TMYA 3BZBA 4Y3UA 1XEXB 1UZNA 2BM9A 1PO7A 3PTLA 4V39A 1UKCA 3VOTA 3VPCA 3DMFA 4OM7A 1I8TA 3CUEF 2OMKA 2P9FA 4PGMA 4TOIA 1Z0UA 3MCWA 4LEIA 5HKKD 5A9SA 1UEJA 4YRAA 5JQWA 4K6HA 3BD7A 1MPXA 2FOXA 2QI9C 2RGNC 4OOEA 5I9MA 3TD2A 3VPDA 2KX7A 1VHLA 4ZO8A 1T5BA 5AESA 2PXAA 3EJWA 1F6BA 2XQJA 4ASUA 2H1SA 2FPPA 3IAM6 2R00C 2KLHA 1HL3A 4GPD1 4I8XA 3LL4A 5FNVB 1PVVA 2PLFA 1VKHA 3D6FA 4NY1A 3M3HA 2Z08A 2CJFA 5GPBA 1BSVA 3DEIA 3L5KA 2QAGA 3RHFA 1W0CA 3TTXA 1XDSA 3PTAA 2JJ8A 2ERYA 5AKGA 1GO2A 2AKYA 2B9VA 3UW3A 3DE0X 3ZKAA 4QKQA 2GEBA 3QW4B 3SHVA 4CR6A 3KVYA 3OZXA 5CNIA 3BN3A 3R75A 4Z5XA 5GZ3A 5E2BA 2FPPB 3PEYA 4IMJB 1YI1A 5DN6A 1N4DA 2AN5A 1CQWA 2JK0A 3DWFA 4BGDA 5CCXA 5G1OA 1BWSA 3LVRE 2AQHA 2GZ2A 3A4VA 2G6BA 1G2PA 2ORYA 3VZCA 4ZK2A 4RIEA 4WQMA 4KAFA 4RA9A 1ZWLA 4EKYA 1KK0A 2IZOA 1A72A 1EFTA 1RWXA 1YDMA 2UU9B 1V43A 3W7AA 4DCCA 3IAS6 3MCUA 4JX9A 5CBPA 1ORTA 4TVOA 4TYWA 1NP6A 4W4TA 4WACA 3UHPA 3ET4A 5GADl 3ZLVA 2ZRGA 3F7NA 5A4KA 3GPCA 3IKTA 2IY7A 2Q9UA 5DWVA 5I9BA 1DWUA 3U7FB 4MUKA 3I0NA 5DBGA 2X5OA 4H2DA 3EY4A 2Z58A 3EMVA 2REQA 1KZ7B 4G8BA 3F1LA 4LPSA 1J0DA 3UYKA 1E2BA 1E2NA 3FHLA 2AZ4A 1X7YB 1P74A 3ITNA 2XSZA 3IXQA 2I6TA 4BE7B 1GT6A 5CBPB 4UXJA 3FVQA 3KX2A 3P9YA 1MR3F 5BV0A 1UBNA 1WM1A 5EP2A 1T8SA 1OKKD 4N5MA 4QUKA 1Y6ZA 2I4LA 2YXEA 5TJHA 1ACJA 2Q4BA 3BE6A 3AM1A 1SCJA 3TRHA 1VHWA 2D59A 2REQB 4JHXA 3TAXA 1QQ7A 1SQ0A 3MHPA 3OOWA 2H3HA 4ZA2A 3CF4G 4D4JA 3ICQB 1ZGAA 3VZQA 3AEYA 3FSJX 4B4KA 5A3VA 4WVLA 4XDZA 3WLLA 3LXMA 4RQTA 1G18A 1XKXA 2FE1A 3LGSA 2FVXA 4HYTA 2FG6C 5IN4A 2QT9A 1A77A 4BO0A 7GPBA 1BN6A 4PIPA 5JAPA 1AN9A 4MRSA 3EZ9A 4FHEA 3B1VA 4K86A 3RC3A 3MBOA 5E3JA 5EPEA 3FYUC 5IDYA 1KEEB 2CN1A 1I3OA 1PX0A 4MWZA 1P1KA 3DZFA 3R0QA 4FX2A 3AEZA 1PVOA 3QMPA 3M5DA 3EEFA 3DD5A 3PQ2A 4NS4A 2D1RA 3DO6A 1DJLA 4AJJA 5B12A 1SVWA 1JLKA 2GS9A 1YHYA 2WDPA 4G97A 2JPDA 1JLSA 1Y4DE 3AOGA 5EE5B 1XHLA 4MULA 1N92A 3H99A 4U7JA 5L45A 4ZEXA 4HDMA 5KIAA 3I37X 2CDBA 2J09A 6ABPA 1NDHA 4YAUA 2C2KA 4AJ2A 1A7KA 3ZJYA 2ISCA 2GFIA 2X9LA 4DR5B 1MOQA 4LJKA 3OQBA 5HNKA 1NQOA 1OBVA 4KYTA 5EGNA 3DJYA 5CW2A 1O95A 1HZJA 1R0CA 2D0PB 2VEOA 1RM3A 3H7AA 4IXTA 4P4UA 4RJ2A 4WOKA 3HWWA 4F4DA 3AMVA 3ZV5A 2HPZA 4YRSA 1SM4A 1KYQA 2QOEA 4QOJA 3FSGA 4ZYXA 2DFTA 1N8KA 2CVOA 2IQIA 2RFLA 3SZUA 3WHKA 3JQEA 1F17A 1T5IA 1WHTB 1ZH4A 3C97A 2FPLA 3FG9A 1E1RA 2EJBA 1DNPA 4B4DA 2YNMC 3QVKA 2CDAA 4RCZA 2CYCA 2C97A 3F2VA 3LWNA 2X1MA 3ORRA 4URHA 3RRZA 1TVKA 1Q3HA 5DULA 4G0WA 2XEDA 3CNEA 3JQCA 1QVAA 3C1UA 1XDDA 1QGDA 5K0GA 4BXOA 1M1YB 2G5PA 2YZNA 3EIEA 1ZK0A 3FDFA 4TLDA 3V4OA 1NXSA 3QP9A 2V3CC 2ABWA 1Q1BA 3A4YA 2HU7A 5B2EA 4B3FX 3M9WA 2QTZA 3VSCA 4QE3A 3EXG1 4WY5A 4A0HA 3MINA 1H5UA 2I54A 4O4LB 1UM9A 5TGDA 5I47A 5IYZB 4IKEA 4HV4A 3KS9A 1TVKB 1CEYA 2HEIA 3MWEA 4PLVA 1FLAA 1BMFD 4ALMA 1ESZA 2X15A 1YQUA 2JGNA 3FGOA 3RYCA 4H9GA 1QDUA 4NICA 5BV2P 5EMHA 3GBSA 3WGKA 1MQAA 1OSNA 4A8JC 1PDOA 5E4YA 3ZGVA 5DNVA 2CL6X 3OP4A 1QK4A 4QSMA 3WX0A 2JIQA 1M6HA 4HR7A 2CCJA 1IEXA 3MINB 1NNUA 4EW1A 5JDCC 1AM4D 4O0MA 5C8YA 4PVCA 2ZRQA 2ZXEA 1POXA 4F97A 2XTMA 1DRWA 2UYQA 5JXWA 1R64A 3QBDA 3MWEB 4HEJA 1L5MA 4BBAA 1JKMA 2JFVA 4XQ0A 2GJ9A 4I81A 3D64A 3RYCB 3QVLA 5K8IA 1VE5A 4ZARA 2CHGA 1OA0A 3L07A 1VZ3A 1XP5A 2KYRA 4PYIA 1QPBA 4HVLA 2NU9A 1G41A 3OOHA 2D2XA 1KU0A 4HWGA 3FB4A 4W9MC 1X14A 1RLTA 2GLTA 4IGFA 3CLRC 2AV6A 5C8YB 3NTXA 4R51A 3H1FA 1DBVO 1BDHA 6NULA 3ZVMA 3T12A 1BRMA 3VVLA 5D2CA 4DWWA 4ZJYA 3UJ8A 4QYTA 2GTHA 1P45A 2NTVA 3IUQA 1RWKA 4WXRA 3E7FA 3IAXA 2NU9B 1ZRNA 3ZVNA 4YUYA 2HRBA 5ENZA 4UM5A 3WMGA 1UKYA 3V6LA 4C4TA 3DP9A 4NHEA 3JQQA 1SUAA 3CRW1 3JWIA 2IUEA 3T99A 4O3FA 2Q1XA 5FBRB 4YGXB 1ODLA 1QDLB 2PFGA 4AZTA 1U7TA 4KC0A 2YFHA 3KOYA 4D9JA 4L9RA 3P20A 2C2GA 3V1MA 1NVMB 4P82A 3LGAA 1JMVA 3RJ5A 4R54A 4MV7A 1MJFA 2QTRA 2OK7A 3D6NB 4PFJA 4U2CA 4XUCA 1EKXA 2ZI9A 2CHQA 2E85A 3PWKA 3VZDA 1KMIY 2VIIA 3IVRA 4XEUA 3FLBA 3MUOA 1KIAA 2J5QA 4YASA 1KY3A 5TF4A 3TRIA 1U3UA 3WQSB 4C1NA 4BKUA 4B3GA 4JBYA 4D3XA 3HJNA 1V7PC 3CZ5A 1IMOA 4QSHA 4DNPA 3GBPA 2YXNA 3BBPA 2H1HA 5BP7A 3I6ZA 3M5WA 2RGRA 2RJOA 4RV5A 1B14A 3NTRA 3E2IA 4GPAA 4GZ6A 1IBRA 4X63A 2R6HA 4D9GA 1WW8A 1HNZB 4B8WA 3E58A 1Q1GA 1KNXA 1R0XA 4G89A 3DCYA 4Z2YA 4G1UC 4X64B 5LQMA 1FXWF 1CJBA 3BH6A 3EUFA 3DAGA 3QLJA 2G9QA 4HDCA 4FFLA 4BNWA 2NXEA 1XFAA 3IHWA 4NZ9A 2IV3A 2GKOA 1RI2A 2WTAA 3IR5A 2XKBA 1T6YA 4OATA 1G9TA 4GU5A 1U0OC 1E1LA 1GNTA 2J48A 3D8BA 1O5OA 1LC3A 1YA8A 2QTBA 2Y4OA 3QF4B 2H5LA 3HB0A 3ILHA 1T6XA 4Q3LA 2XWBF 4X97A 1OX4A 2FZ4A 3NIWA 2HA7A 3CVJA 1E3LA 2F8SA 3CLVA 5ISMA 2R84A 3CJTA 3LKVA 4JZKA 4QUHA 2OHGA 3FUVA 3CB4A 2DP4E 1XCMA 1K8RA 1NW5A 1GZHB 4L8LA 3EXFA 4LZWA 1IVSA 6CHYA 3PHJA 3PI7A 4NMMA 1VLZA 3RHSA 4WKBA 2FDRA 3QOXA 3RS0A 3SX0A 4BQPA 4HYYA 1JKIA 3GLFB 1VPTA 4ZOLF 3WKAA 3CUUA 2WM8A 1OX4B 4MS4B 1MENA 2MSDB 1L5LA 2SECE 4HEA1 1R5JA 1ISPA 3LZDA 3IAM1 5JXGA 3UK6A 3U4QA 1AK1A 1IDN1 1VJGA 3H6HA 4KXUA 1H3EA 4IPTA 3IESA 4F2DA 3EXFB 2ATXA 4JJ6A 4K6GA 4UUQA 4ZEWA 1QM5A 3A3PA 3FD8A 3WGTA 5EMNA 4BO4A 3NETA 3JWPA 4PO1A 3OQIA 2V7WA 5KKNB 4LPKA 1ZD4A 4PSCA 4WLEA 3A26A 1BAPA 1N5JA 1VE7A 3QVGA 4G2TA 1L9XA 2BE7A 3H2KA 3NX4A 2PVCA 1XVIA 2HNKA 1G20A 2LWIA 2P1DA 1GUAA 3HUDA 3HVIA 2XYPA 3AUUA 3MTEA 4IHJF 4Q3NA 4A2PA 3C45A 4BKMA 4AYXA 1JX6A 1PF7E 5FR1A 2G71A 5JE8A 3D8NA 4YNBA 1SZJG 5CG2A 5IF3A 1AKUA 1W29A 1XI2A 4UAGA 3REQB 2ZBFA 4WLOA 4GL4A 3UXHA 2YVKA 4FN5A 3TZBA 4K3VA 3R9IA 4F60A 1HKUA 4FYJA 5IASA 3FPFA 3OQIB 4IRMA 4II3A 4R1LA 3LIPA 4QT0A 4OPMA 3UOGA 5AUPB 1B16A 1NGSA 1R0YA 2I6XA 1N2EA 4KXQA 4M7PA 2JJYA 3TL3A 5F23A 5AK4A 4RX1A 1G20B 1HGXA 2ODBA 1QHHA 2ZANA 5LUBA 3KIPA 1HDEA 1LZKA 4F45A 4Z53A 3A9UA 3GD7A 4LHXA 2EFCB 4OQEA 2HWKA 1ADJA 1EM8A 1J97A 2PX5A 3DFMA 3O2QB 1UFQA 2XTAA 1CUJA 4G07A 5JS1A 1UOPA 1GNSA 2LVBA 2W11A 4UM7A 2BGIA 1ZMTA 4LG1A 4MR7A 3WGZA 4BOYA 4IX1A 2HGSA 5HCIA 3FWYA 3I2IA 3O6VA 4C0BA 4R7ZA 1RHRA 1YHZA 1TK9A 4KN9S 1B74A 1B0ZA 5AKEA 5BYBA 3G85A 3IDOA 3WZ2A 2I76A 3ZW7A 4QTTB 3FI9A 5B4VA 4MO9A 3HXMA 4QUEA 4TZ6A 4HBGA 1N3IA 1EM8B 2OEPA 4YJGA 2PYZA 4BYMA 2QTCA 2Q3BA 2QTMA 2JIZD 5JD6A 3EIHA 2AN9A 1Z47A 4JC8A 4MR7B 1NY5A 1YWGO 2MOKA 2W2KA 2DEUA 2PMDA 1QJCA 1AIPA 3NLLA 3EHEA 4RC9A 8OHMA 4Q37A 1P0QA 2IPNA 2Y27A 3HM2A 3EN0A 5JPDA 2A58A 1RQGA 2XNDD 3CX3A 3DE6X 2P3OA 2HF9A 3K6RA 2F8LA 2ECQA 5JMOA 5BQ3A 3OFVA 5BVGA 3ZWOA 3FUXA 2SHKA 2UVQA 1NDQA 4KH1A 3TZHA 3AX6A 4K9PA 2HHAA 2H4JA 2W2OA 2ODNA 1BG6A 2CUKA 1YTLA 1NXOA 4G0UA 5AI4A 1ZM7A 1E6EA 1U6JA 3ONWA 3TI7A 3L92A 2PS3A 1P8JA 4F4IA 1DIRA 4AJNA 2CWDA 2FMFA 5FTKA 4TYNA 2IZZA 4LRQA 3T15A 5BVGB 2WWYA 3I6MA 5CDYA 2JL1A 3LFTA 1QH8A 2OXRA 5HKBA 2YL2A 1EE1A 3PP8A 3T61A 4Y6GB 3EZNA 2QSZA 5LOVF 1YMQA 4ENPA 4TTAA 2AMYA 2I6FA 1JPNA 3LZ6A 4EAQA 1WMFA 4N47A 1D2AA 5C4GB 1WZ2A 5A71A 3ZZ0A 3T3IA 1SZPA 3HYCA 3NVMB 1ETUA 4YLEA 5CFQA 2DLNA 1VLVA 1GGJA 2JD2A 3DFFA 3DKVA 1S8FA 2ZJ0A 2WSSD 5EWMA 1H8EA 3N75A 1DFHA 4UJ3A 3RGWS 3U4DA 3U9TA 4CQMA 5AKIA 3TG8A 4AYWA 2X6RA 1NXVA 2OM6A 1QH8B 3K92A 3OUZA 4QHYA 4E2WA 3PIDA 1F8UA 3C7AA 2F4VB 4BQNA 3MWJA 3OAAA 3MS7A 4E5MA 4QJ3A 1FUYB 4FHDA 4PZDA 2WEKA 5EZYA 1MFZA 1XXLA 5H81A 1IHUA 2P4UA 4URFA 5D3KA 3I9NA 1ZCFA 1GWNA 1QTQA 1HTBA 4OXKA 1I4OA 1LTHR 2VHVA 3WL5A 4CQMB 5JALA 5AP9A 1BFKA 1N25A 3NBUA 2J4DA 2A9PA 2OBYA 4YDRA 2HUNA 4KXMA 4Z54A 3EQ6A 1ZNZA 3MJ4A 1W44A 1W4ZA 1IM2A 3BZWA 4L5IA 3HU3A 5CM8B 5LJIA 1BQ3A 2IRWA 4I6EA 4DEVA 3VR4D 2WTBA 1N77A 3AESB 3BWCA 4HH1A 3ZWMA 2XAAA 3NBQA 3V8BA 4BBJA 4Y18A 2OTCA 5EZYB 3M70A 4D9NA 4XXHA 5F51A 1Z33A 4Y6PA 1OIVA 4COOA 1ZUWA 4C21A 5EIBC 1Y6RA 2Z5VA 3MRTA 4RELA 4GOKA 4GYKA 3FOFC 5L51A 3C3MA 5JPIA