2SBTA

A comparison of the three-dimensional structures of subtilisin bpn and subtilisin novo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the three-dimensional structures of subtilisin BPN' and subtilisin novo.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN NOVO
total genus 45
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1976-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sbtA00
3DVQX 3LPDA 2DP4E 1SBNE 1KDVA 3QTLA 3F49S 2Z56A 3SQOA 1TO2E 3DE2X 1GCIA 5FBZA 1PEKE 3VSBA 2W2OA 1SCAA 1THMA 1SBIA 1MEEA 3A3OA 1R6VA 1NDQA 3DE7X 3DYBA 1CNMA 1KDZA 3T41A 2X8JB 3GCWA 3TI9A 1TM4E 2SICE 3P5BA 3F7MA 1CSEE 2Z2XA 1R0RE 3GCXA 1BFUA 1YJCA 3EIFA 3CNQS 4AKTA 3ZXYA 1SUAA 1SUDA 3BPSA 1IAVA 1BE6A 1GT91 1WMDA 2E1PA 3PTLA 2WUVA 1ST2A 3L1KA 2WUWE 1P7WA 2HPZA 3SICE 1T1IA 1YJAA 3DE1X 3Q5GA 4KPGA 1ST3A 1SUBA 1SUPA 3WQBA 2W2MA 2Z2ZA 2PKCA 1KE2A 1P7VA 1IC6A 2XTJA 4JP8A 3D9QX 3OSZA 1V5IA 3DW3X 3QFHA 5AQEA 1C3LA 1Y3BE 1WVMA 1LW6E 2PWBA 1Y4AE 1SBTA 3AJ8A 1ZVJA 1SCJA 1OYOA 5JXJA 5JXIA 4GI3A 1DUIA 3TECE 1AH2A 3GT4A 3DE5X 4H6VA 2ZWOA 4ZOQI 5I9SA 1TECE 1Y34E 4BWGA 4C3VA 1A2QA 1TK2A 4DWWA 1WMEA 3LPCA 5AMXA 1S01A 1SIUA 1EA7A 2V8BA 1R64A 1OYVA 5ARBA 2HD4A 5K7SA 1TM7E 1GA4A 4CFYA 3WIVA 1SCBA 1HT3A 1SUEA 2Z30A 2X8JA 2Z2YA 2IXTA 3AFGA 1PFGA 1PJ8A 4RYDA 3PRKE 1TM1E 5FAXA 1OT5A 3HJRA 4MZDA 1BJRE 1TO1E 2PQ2A 2W2PA 4KG7A 3EDYA 1AQNA 1SN7A 2IY9A 1P8JA 3LPAA 3LXUX 3QMPA 4CFZA 1T1EA 2PWAA 3WHIA 1GNSA 1AVTA 1PTKA 1VSBA 1SVNA 1S02A 1EGQA 2P4EA 2SNIE 3BGOS 3CO0S 3I34X 4AKSA 4OMDA 1AU9A 1JEAA 1MPTA 4NE7A 1BH6A 2ID8A 3I2YX 3VHQA 1SIOA 3DDZX 1WMFA 3DW1X 3DE3X 3I37X 4J94A 4NMXB 2Z57A 1AK9A 2PYZA 5CW1A 3VYVA 4HVLA 2W2NA 3EE6A 3TI7A 4Z2AA 1GNVA 1Y33E 1KE1A 3I30X 1C9NA 2SBTA 2SECE 5AVJA 1Y3DE 5B1EA 4H6XA 1Y9ZA 4ZARA 3UNXA 5B1DA 1V6CA 1BFKA 1C9MA 4H6WA 3DE0X 3WIUA 1TMGE 1Y1KE 1XF1A 1WSDA 3BX1A 4B5LA 2DUJA 1Y48E 2DQKA 3DE4X 3H42B 2ST1A 1KDYA 1NDUA 2ZWPA 1BE8A 3D43A 5ARDA 1NLUA 1Y3CE 2WV7A 1SPBS 1S2NA 1GA6A 1YJBA 1ZVKA 1TM3E 4I0WB 4K8RB 2QTWB 4LVOA 3DE6X 3GT3A 4M1ZA 1DBIA 1SUCA 1TM5E 2G4VA 1GTG1 2PRKA 3A3NA 4OMCA 4DZTA 5JXGA 4FONA 2Z58A 5JMOA 1AV7A 1SIBE 2ID4A 1GA1A 1SBHA 1T1GA 1AF4A 2GKOA 2XRMA 3A3PA 1SBCA 4CG0A 4LVNA 1C9JA 2W2QA 2WWTA 1YU6A 1SELA 4DJ5X 3VV3A 3VTAA 2ZRQA 3DWEX 5JXHA 3ZXXA 1Y3FE 1GTJ1 3Q40A 4C3UA 3VV2A 4WOBA 1SH7A 4HX2A 1SCNE 4WOCA 1Q5PA 4YN3A 2PMWB 2TECE 3F7OA 3AJ9A 3DVSX 4KB5A 4NE9A 5ARCA 1Y4DE 5FFNA 1GTL1 5SICE 5AVKA 2B6NA 4OV6B 1SCDA 3DVRX 1UBNA
chains in the Genus database with same CATH superfamily
4KWCA 2GHTA 5KYUA 4NS4A 3I5XA 1WXDA 1Z63A 4RVGA 4QEDA 2QD1A 1C81A 3PQ5A 4MV1A 4N6GA 4YB8A 3VVLA 3CGWA 3E05A 4JDPA 2FF5A 3MCZA 1KDZA 2VK2A 4HT3B 1T5DX 3A6EA 4ZMSA 3QFSA 3DCJA 3MD0A 3N5KA 1SKUA 4V0NA 2D2IA 1TKRA 1G8YA 1L9XA 1U9CA 3EEFA 2BGRA 4GZLA 1S96A 1C4KA 2IV3A 2HRQA 1G6OA 2W11A 2Q4RA 3M81A 5I4IA 3OQ1A 3PIIA 1HDEA 5T4EA 4CI9A 1UXGA 5AVQA 4BBPA 5FV4A 4PLWA 5KNCD 4X85A 3VUFA 5E9AA 4ZRDA 4D0NA 4E2XA 2MTBA 4MTLA 3JS5A 2J41A 4E70A 1SUBA 4PAQA 4RVCA 3G7UA 2NO5A 4YDSA 2RK6A 4BNDA 1QHGA 4BU1A 3J7AC 2B3TA 4QBFA 5B37A 3OJ0A 1UWLA 2ACEA 4QQ8A 2ZRDA 5BSGA 1U1DA 4XEHA 5JJ5A 1UF9A 4AO6A 5EUCA 2OCDA 4FLMA 1Y7TA 2X7XA 1NUTA 3VPBA 4C7MA 3T3IA 1EM8A 1Z5ZA 2D0IA 4OCZA 1JIXA 1L8XA 1Z0KA 3UW1A 1D8AA 1NW4A 1OFHA 4JL8A 4EFDA 3UGQA 3H99A 1AOXA 2Y0EA 3OTWA 1SC6A 1T4CB 3HM9A 1C1DA 3ZCTA 2V7PA 4GPBA 4AY4A 3NHZA 4GWLA 1VKNA 4EFNA 4CF7A 1BMQA 2GZ3A 4HDAA 2OO7A 1JSXA 1QP4A 4WIAA 5TIIA 1R5JA 5JV5A 3AR8A 1C3JA 2OBNA 5K0BA 3KL2A 5IYZB 5LLDA 3T6KA 3V4VB 4RESA 1GARA 4WZAB 3T5PA 4WZ6A 3R5FA 2V7GA 1X7HA 3BFKA 3G2QA 4TKVA 3IAFA 1FZTA 1NQTA 3EB9A 4J94A 2COEA 4I99A 3HVRA 3TDNA 2BM8A 2C2WA 2FU5C 2MDTA 4PE5B 2FEKA 3K20A 3TOCA 4TROA 2ATIA 1PJBA 3EOZA 1IOZA 3EDCA 3JVVA 3E82A 3UT5A 2CMDA 1PR6A 1TLFA 1TQ2A 4CL2A 4DLRA 4RQBA 1CT9A 5IVDA 1E6MA 4V0SA 1CQWA 3SR0A 3V6MA 4IFBA 2ZI9A 4RELA 1WMSA 4INJA 3GUVA 3C4QA 3DJFA 4KGXA 4NZPA 5F52A 3WDKA 5CCXA 2IUFA 3NB0A 4WXYB 4UW9A 1YZKA 1M5RA 3E9DA 3I58A 1THZA 4BGEA 2X4IA 5JNVA 5HJ5A 3B1VA 2P5UA 1EGHA 3LE8A 4JWTA 1TCUA 4OHOA 2VWHA 4JWKA 3V8EA 3VH4A 2VPXA 1Q7GA 4OXKA 3ITKA 1NYTA 2EATA 1HORA 2HSWA 1A8HA 3E9RA 2FR0A 3GFOA 5AI9A 1NI3A 1JA1A 4WBSA 4B7ZA 2B8NA 2IYZA 3OE7A 3IV6A 3JTEA 2FJPA 1UPXA 5KSWB 1X7DA 2J5RA 4D3XA 2XYRA 3I9KA 1QQ7A 4P81A 4X7BA 4AF7A 2OMEA 1LDEA 4RTOA 2WWHA 2ZUUA 3HYCA 3L4BA 2O2DA 1CEEA 5CGZA 2RK4A 2PSFA 4NHOA 2HLPA 3GOHA 3UJ7A 2I8AA 4FGKA 1Y6FA 1I6KA 1X1CA 1XOIA 2AH5A 2YN2A 4FNGA 2DQYA 4RU1A 1JH8A 1OASA 1ULZA 5IAAA 5CM2Z 2Q2OA 5JYEA 1EUZA 1CS0A 4MRRA 3GG2A 3RANA 3GDWA 1RLJA 3HRHA 4TUYB 4LOJA 1U2GC 4BL5A 3MK31 3RUPA 3S0JA 1JHQA 5TX7A 2QXTA 5IJ0A 5JPIA 1QU3A 2VPYA 2C61A 4R51A 4WNCA 4EY4A 5EJ5A 1YVPA 4BATA 1KI8A 1E2LA 2I2AA 1RJWA 4LZOA 5BV0A 3AG5A 1Z4OA 1WNFA 2QTGA 4WK2B 3VU1A 4B3TB 1CUXA 1XRPA 2Q5FA 5C8VA 4W7IA 2WJVA 2BR4A 4F4JA 4R9VA 1PTJA 1BDJA 1U5CA 3PXXA 1ORHA 3H9EO 4Z0PA 5HF5A 4C4PA 4Q7KA 4EFMA 4EG4A 5BYBA 3PXCX 3CN9A 4D9JA 1M0TA 2HLHA 4NCIA 1CUUA 4C0JA 1L6RA 1L4YA 2AJ8A 1N0IA 4J90A 3DBLB 5HRAA 5J1SB 2QN1A 2R65A 3GEMA 4V0OA 3OOYA 3MYYA 1WB4A 2NT4A 1EFLA 2VP4A 5BY2A 2VG8A 3WWZA 4K86A 3A4LA 4RLFA 3VU8A 3A2NA 4JFAA 2IS6A 3QFFA 4U7FA 5BNIA 2XF8A 3CNHA 1REQA 4MI9A 1YASA 1YS9A 3VKVA 2BJVA 2R8RA 2P35A 2HREA 4DT1A 2AGVA 1Z39A 2XA1A 3NHSA 3P1JA 3EH1A 4HH3C 4JUBA 1H05A 4UJ3A 1Y9JA 4K2AA 3WLNA 4WXHA 4FD2A 1KPGA 1JUDA 1KU6A 2XSZA 4W1PA 1U0GA 1UXOA 4FYHA 4NBLA 4B76A 4LQDA 1OX4A 4KQ2A 3T06B 1AE1A 3DFZA 2AFVA 1NBHA 2FPGB 3F5SA 4GX0A 4QOIA 3U7IA 5CJPA 2PH3A 1EGQA 1C4WA 1Z0UA 4PSAA 4R01A 3IVMA 4DZZA 1VM6A 4E0BA 5CFNA 1C7RA 1E9AA 1MC8A 1YZYA 3IBGA 4IOKA 4JLBA 4R8VA 1KFKB 4PYJA 5KZMB 5REQA 5JMTA 1OIVA 3V7WA 4ND8B 1VE6A 4F1JA 1BCSA 5EQDA 1Z4QA 1VHLA 3AERB 4FZRA 4NJMA 2P0EA 1E0SA 4Q01A 1T3LA 2A1TR 1SVOA 5C5IA 3ZI0A 1WVIA 1J8YF 4HX9A 3VJLA 3AB3A 2G9NA 1JR6A 1P0MA 2BZ1A 4NCNA 5ILOA 2HA6A 4BB0A 1Z45A 3DKRA 2HCBA 1SOMA 3P9PA 2QLMA 3LF1A 2XB6A 3QWIA 1ONNA 1SB9A 1Q7EA 3TEJA 1UOOA 4DQDA 1GRCA 1N6KA 4J0QA 2ZYDA 4CQLB 4DVGA 5MN6A 1H94A 3HA5A 3O4FA 1TQ6A 3VU0A 2FEMA 2G1AA 2HDHA 3H11A 5BSMA 4XDZA 5EPOA 1RYNA 1GY8A 2WWGA 3CZRA 3L4BC 4ND2A 2IYXA 2P9QA 2VYCA 3BD7A 4ZDWA 4CKWB 5DB4A 4G8CA 4Q4JB 1T0IA 1MV5A 3L0ZA 3BXFA 4ECAA 1B8PA 5LPNA 2FYTA 4XFKA 2XDQB 4KO8A 1OFVA 3WGOA 1C0KA 5DW3A 2XAAA 3BMOB 2P6OA 3P0RA 3OE4A 1P19A 1NN0A 5BYKA 4H17A 1YC5A 4RHUA 4C03A 1QJCA 1RPTA 4U3JB 3UCEA 1DWQA 4KPYA 2BISA 3GQBB 4JT8A 1VBNA 4OXYA 3ONVA 4NU5A 3F7OA 2GN0A 4OU5A 3DPIA 2P8SA 2LPMA 3EWAA 3P27A 3HSYA 3QKRB 4M8KA 4PRKA 1JHXA 1DNPA 1K6JA 3QUQA 4RCYA 5AKHA 2A58A 3FOWA 3SX2A 5IXSA 3QPWA 1TXGA 3EIEA 3IAUA 3ABRB 3KT3A 4JC8A 2VT3A 3P5BA 3FZGA 5CNIA 5AHKA 1Y7LA 5CGQB 1W0CA 1BG6A 3OAAA 4DRYA 4ZZ3A 1IHUA 2Y2UA 1ZEJA 2FW9A 1BEEA 1QQ6A 3H6KA 1FRNA 4L4UA 3SSNA 1W30A 1QAOA 4FDVA 3IA7A 2WTEA 4DA7A 2HR1A 2QQGA 1GNQA 1T1IA 1Y1RA 2J67A 4HZUB 4PPGA 5ALXA 3VC7A 4AIRA 2XNKA 2ZR7A 2V4UA 2CWWA 3KJHA 2DWUA 1Q7CA 2I3BA 3QMMA 4KYVA 1HKHA 3O94A 4DSOA 1J70A 4TKVB 4ND1A 5E4JA 4JYZA 1A50B 1P9NA 3CNOA 1OYOA 3ONEA 4ALMA 2NQ2C 5FNVB 2WYWA 4LZAA 2HYIC 1A9YA 3TIIA 1YRWA 4REMA 4E88A 2ZUDA 2NZVG 1THTA 1EVZA 3CKYA 4FEYA 5AM5A 2RB4A 4HQOA 3ZWOA 5KYYA 1DO8A 2ARKA 1EDZA 4O1HA 4PQYA 5EESA 1H42A 2ZTHA 4TQAA 3N87A 4YTEA 3TN7A 2IDZA 1E7WA 4WFJA 4XXHA 2G1UA 4QGAA 3HKCB 1PCXA 2NU6A 5FNVF 2RIPA 3RPEA 1TUEA 4HJRA 3O38A 2I3ZA 4FQ5A 4GBGA 1HLFA 4KE8A 4IDCA 4Q15A 1OYYA 2KLBA 2BEKA 4IGFA 2DR3A 1KHHA 3N0VA 4A2CA 2GJSA 1LRJA 3VTFA 1ZCZA 1T1EA 4B7XA 3LOPA 4G56A 3NUGA 5TT1A 1M1XB 4NQRA 4R16A 4CTJA 3WLTA 1RQ2A 3AZOA 1NF3A 1Z0ZA 2GPJA 5AUPB 2J46A 3AEYA 3KVRA 4I1IA 4KIGA 3SM9A 3MSXA 2WD7A 3OZRA 3HCEA 4ND5A 4J16A 1E6KA 1LU9A 4M86A 4ZC1A 3SXPA 2PKEA 1E2EA 1ISPA 1XDUA 3IAEA 5DBFA 4NLLA 4BAGA 1Z62A 1B76A 4KBFA 1GFSA 1LC0A 2X4LA 1ZD1A 3FYCA 2JKZA 3WK5A 1N4AA 4M55A 1SXQA 3T0GA 2Q3BA 4NONA 4BWYA 1U2ZA 1PJRA 1TZCA 2MT9A 3KQYA 1V3QE 1W5AA 2GD1O 5B6PA 2J9GA 2G77B 4YJHA 3UF0A 3AHGA 2JA1A 3N86A 1NL3A 2CXPA 4YS6A 1QP0A 1SURA 3LDUA 4KR3A 4IYRA 1V26A 1QYVA 4URYR 4CHTA 1C9YA 3KT6A 4EVRA 1U2DA 2QN7A 4BMXA 2EDAA 1XDZA 5KQMA 2N3ZA 3QWBA 4M1ZA 5CT4A 1ADYA 2ZAIA 5EFZA 4P38A 5A4FS 4JIMA 3W5CA 4ND6A 3FBWA 2YXNA 4PZEA 3H2ZA 2GS9A 2CB9A 1LSJA 3TM4A 1H1LB 1EUCA 3W78A 5ELXA 1RIIA 3UY4A 4RTRA 2WJJA 1ADGA 2E4WA 1HPLA 2IOFK 2MINB 3L49A 1W1WA 3MCUA 1Q5PA 4OLFA 3ITDA 3FNBA 5ALNA 1EX9A 1JNXX 4BVLA 3JD1A 3RYIB 4RULA 2XMRA 1G18A 3N07A 3DHNA 5GZ1A 1OB2A 2PJRA 2XCUA 4EJFA 4M1MA 4GM4A 4YJHB 4F7DA 4KN6A 3O4HA 5EFOA 4F71A 1OIXA 3TKAA 1MOZA 3K4QA 3GARA 4V0LA 5F51A 2C2GA 3A1NA 5CP8A 3RG8A 3RK4A 1F8XA 1L5FA 3H5RA 2XIQA 3A32A 3ELWA 4F9EA 2GHQA 1NWHA 1NQXA 3GI1A 4RF3A 3RRMA 4DARA 1NJSA 1K92A 1ONPA 2PUDA 5HVNA 2QZJA 2FZ5A 3FTDA 2FXIA 4W9NC 3WYEA 2D6FA 2WD7B 3X1MA 4OH1A 4BASA 3OUTA 1XDBA 2RAFA 5JC8A 1AB6A 1J8DA 2RDMA 4LDRA 3T1HB 1SHZA 1T5BA 2ZKIA 3VYRB 3OQVA 2BFFB 3RUDA 1O94C 1U80A 2YYYA 4V38A 1U7HA 2WU8A 3BSWA 1NVFA 1VCMA 3HL0A 1JLMA 2VK8A 1IVYA 1OWPA 4ARSA 2EZTA 5D6OA 3K9GA 4LMPA 3KALA 1O3YA 5JBIA 4JYBA 1UJNA 1ESEA 2IH4A 3QE4A 1TNDA 2LWIA 1GIAA 1U8XX 2JA2A 1RXEA 2FCAA 2P69A 2OA0A 1A72A 3ILSA 1CR2A 1NJ8A 2DFDA 3FVQA 4GPTA 3UZUA 3JYPA 3UMFA 4BFYA 4INAA 1MX5A 1RWMA 3C8HA 4EDHA 3U9SA 4E5UA 4LF7B 3EC2A 4GM0A 4KXVA 3ETNA 5C0OE 3UENA 2X40A 2NSDA 2VTDA 2B30A 1E1KA 2ZBGA 1U28A 3GFPA 3NTOA 1I30A 3LXUX 4IAOA 1TVCA 4YUXA 2O8BA 1CRPA 3N2EA 1E9DA 3K8ZA 1X42A 3HMKA 2MSKA 2NU7B 2JJYA 3QGMA 3I6ZA 4I5EA 1BXGA 4REOA 2BGWA 3PV0A 2OSBA 3M3PA 1XRRA 3K0SA 2CDCA 3ZKWA 3UATA 1Y33E 2C4UA 3D4BA 2ENUA 3L92A 3AETB 2HZBA 3G7SA 1U2DC 1HH4A 4UBIA 2ES4A 3TLGB 5B4TA 5D84A 1HEIA 1OWNA 4V03A 2I6UA 4O2BB 5K51A 1ZIDA 2BM0A 2I2BA 3LNTA 4X60A 2CUNA 3JRNA 3N2ZB 4BNYA 1WXHA 2QX9A 3GIWA 3LUHA 3PPVA 1XDDA 3DDOA 4MTCA 1E1QD 1VP3A 5JNTA 1BS1A 4Q48A 3ZE8A 2BY4A 3CSDA 1IQPA 4UCXA 2IJGX 2C4TA 5IVHA 2GK4A 3QKWA 4I4LA 2PZJA 2B99A 2ZIVB 3OG9A 4XQGA 3WZMA 4LNUA 3WOHA 4MP3A 1ZGAA 4UMVA 4BFCA 3VO1A 4CIWA 1EWVA 1NE2A 1F0NA 1RM0A 1XV5A 3OLXA 4TWJA 4ZJYA 2DXIA 2JLWA 3PFWO 5E1MA 2WFLB 4OHCA 3GP5A 4P08A 1AKQA 2BFDB 4I50B 5KOJA 1QANA 2GSDA 3E22B 5CVEA 4ACAA 4AZ0B 2O7NA 2OV1A 2XNCA 3S2IA 2BDTA 4ESEA 1Q3HA 1CVIA 5JDCC 4DZRA 1SELA 5AKIA 3EZFA 1TIPA 4A8JB 1SXJA 3E35A 3DLBA 2CSXA 5DLEA 4WSOA 1UMCA 2ZBDA 1H6BA 2ID9A 2Z3VA 5DM4A 5HE8A 2WP8J 421PA 4OP3A 3ZHZA 1RDFA 2ROQA 1MHTA 2PXCA 2C4WA 2L19A 5E7JA 5C9ZA 1V47A 2RHLA 3HCCA 2GN2A 4FDLA 4IZHA 5BQ5A 1F12A 2ACVA 4MQEA 4TL7A 3SQOA 5IULC 1T9CA 3KEOA 2JJ1D 1H6CA 3FYUC 2XGOA 5JR3A 2ZWMA 1PJ4A 3Q11A 4U4AA 3FTFA 5CLIA 4RZHA 2ZROA 3PQ2A 4N5NA 4RUKA 3ELYA 1DTWA 3H1GA 3OOSA 2JW5A 5EPEA 2WVGA 3E3NA 5C37A 4ZCTA 5IWCA 2ODTX 1DPFA 1SUDA 1ULSA 2RGNA 4BTEA 5K6TA 3O9MA 2ZT7A 3YASA 3OFVA 2H11A 4KIFA 3WLSA 1ORVA 3ZTYA 1U9JA 3G0CA 2BL4A 2QM8A 1ZX1A 3EZ2A 5IYZF 2O2SA 4R2IA 1PW5A 3STYA 4FFVA 4S1WA 2G7MC 4J7AA 3UMRA 3WL7A 2VNIA 2ZAOA 4L16A 3WYFA 3QI2A 4HPXB 3KWMA 3UK2A 3CWQA 2EERA 2IEIA 3NAZA 4F72A 5JJCA 4Q05A 3MCVA 2HJHA 3H0KA 3BJEA 1SU4A 2QQ0A 3WLFA 2JFHA 2I34A 3HB0A 1J7JA 4OBWA 5DISB 1LCIA 1QCYA 3W2IA 2A2ZA 5JWOA 3F1KA 1JU4A 1CP3A 1QYIA 3EFOA 3ZK9A 5F5LA 1UZUA 4O4HB 4TX1A 1ISRA 1XCOA 4L0DA 4B8ZA 2H1RA 3LO8A 4BB5A 4CNBA 3JYLA 4DABA 4AG5A 2DECA 4UZSA 1YR9A 3X44A 4GE3A 2FRXA 4Z8XA 2A3NA 1RWOA 1JSLA 4RQUA 4KOAA 1YCDA 1CZLA 5J3JA 1YRQA 4Q1FA 3K1JA 4ZEMA 5EMMA 1CZKA 4PONA 5FPTA 3ZIAD 4C20A 4ZI7B 5IKXA 1NFFA 3EJ6A 1CQJB 4R83A 5KWVA 3CBGA 4MSUA 2LUOA 2ZCVA 3BGVA 1BH6A 4TQ9A 4X8MA 4YRNA 2QAJA 4YP6A 2O0KA 4GQAA 3TH5A 1C4XA 5IEBA 5DXFA 4OAPA 3EZYA 2QMUA 4L7QA 2I87A 2ZTSA 5FWYA 4R40A 4PC6A 4MA4A 3U0BA 1DG3A 5B12A 2SBTA 3IBCA 3DP7A 5IM5A 2YJGA 2DC1A 3A6ZA 4H6XA 3W9YA 4X6XA 4YYZA 5BMVF 1N9GA 3OCJA 4HAVA 4C5BA 1TX4B 3TSCA 1HOTA 3KE8A 4TMVA 2FJUA 3NBYC 1PS8A 2WTXA 4WOPA 3U3ZA 2EWVA 4XSGA 5THXA 3FDZB 4K40A 3WL5A 1VKJA 2YMPA 2PKQP 4Y2PA 3MRVA 3OEWA 1JXOA 2EKBA 3PX3A 3FOZA 2P4QA 3WGUA 4LZJA 4A0GA 1KYVA 1NASA 2C1ZA 4EKDA 3ESZA 3BRWA 3ZHOA 4E46A 3R3JA 5LKRA 4JLOA 4OG2A 1ZM3A 2AC4A 1LS1A 2QUHA 1GQFA 4NMLA 2DBQA 4IIVA 1X1AA 2OBFA 4MHSA 3GNQA 1KXJA 1JZQA 2H5JA 1K7EB 4QODA 5L3VA 1J2RA 1W1IA 1ZU5A 4I1SA 3TCNA 5JSQA 3GG9A 1H0HA 3CYFA 4HC4A 4QYIA 5AI4A 3RYHB 3G02A 5B6IA 4U2EA 3QKTA 3HDYA 2CV0A 3GBSA 2NV2B 1TFRA 2X4GA 1WXGA 2CUTA 5CLQA 4LWZA 3KJGA 4B5KA 1VB5A 3EZGA 4MWTA 3RTBA 1N33B 3D0KA 5HFAA 2BHRA 2FXVA 3RAGA 3AEKA 4F5YA 3CINA 5IC6A 2NU9B 5JANA 5JZVA 2O1SA 3M9LA 2W2XA 5AT1A 3F71A 3GVIA 1SVKA 1IJKA 3LL4A 4WV3A 4ZODA 1JT2A 1M73E 1PJ3A 2PX8A 1ODTC 1OXTA 2VH2A 3OEYA 3TLEA 5B1YA 3U1TA 3BK2A 3ZE1B 2UUCB 3KAJA 2M6LA 5TR9A 2C9BA 1IRIA 3VR6H 4B3GA 4WZAA 4C06A 3TL2A 1F7VA 5JJIA 3AINA 3IO5A 2B36A 2C7BA 2E89A 3THWA 1NRWA 3CUVA 4QDKA 3MFYA 5FAXA 5FLYA 3QX8A 1OI7A 4JVNA 1LSUA 3G6KA 3PRJA 3SBOA 5A2GA 4YP9A 4XYLA 3KLOA 1DL5A 1KVTA 1Q77A 2R4UA 2ZCUA 3EDRA 4Z9YA 3NGLA 3P94A 2VKQA 4H6VA 4XWWA 1B93A 5DF1A 4ZOQI 1EP3B 1NIJA 3MM4A 3HXPA 5K8CA 3BMQA 1I32A 4KQXA 3IQIX 4EQ6B 1FSZA 2GFQA 3FWYA 1X9GA 3CXUA 3EXG1 3NAQA 2F1JA 3O4VA 2HN9A 4S1VA 5D85A 3PBKA 3L6DA 1ZJYA 1HEYA 1MC5A 1QIKA 1SUEA 2Z98A 3E9NA 4BLRA 5JAOA 1AXGA 1E9RA 3AVQA 2RD2A 3RU3A 4RYDA 4EK9A 1N1MA 3HUEA 5AW1A 5HIAA 3ZQJA 2RAPA 4K9KA 1EWQA 2D4HA 3DMRA 1X19A 4R1TA 4O6VA 4XDHA 5EWMB 2UVDA 1YIAA 4RTJA 5AW0A 2IE0A 2I03A 4CG2A 1IN5A 1Z6PA 1NVVQ 1A96A 1X80B 3WIDA 3KQQA 4KYIB 2UZ4A 4L2IA 4TSKA 4FPXA 5GAJA 3HZHA 2RHHA 4D5EA 3OETA 2JGFA 1YZFA 4JJ8A 1SBZA 3S5UA 5IDVA 4KPUB 2HWWA 1Z5OA 1RRVA 3LXMA 4PQFA 1TMGE 4J1TA 3TL6A 2GZ1A 3BRWD 4NP6A 4R8LA 5CB4A 4UAVA 4XR9A 3BQ9A 3RUAA 1P31A 3AHDA 3R0XA 7AT1A 4I36A 4QTUB 3DUFA 1D1TA 1LDBA 1M2WA 4B35A 4AJJA 4MWDA 1ML4A 4MKIA 1MKYA 1RI5A 3BWVA 3O3CA 3THSA 4YV0A 1SGWA 1XU9A 5HW0A 2O8CA 1TM3E 2YQ4A 3D5EA 1IN8A 3R5SA 1C41A 2JJMA 1M1YA 1Z2PX 1EP1B 4S1NA 3CLTD 4YJ2A 1T36A 1X7WB 3OT1B 2BBWA 4CV0A 4ASUA 3AOEA 2JHCA 3EPPA 4RV9A 3DG9A 3R3UA 5IS2A 5K3CA 3QU7A 2G36A 1XMPA 4E33A 2IA5A 2XUAA 3FOAA 1H22A 2C3OA 2QUJA 3C6ZA 2YV4A 3CQ9A 3NANA 4GP7A 4YCCA 4JENA 3P52A 2J0UB 4P3OA 4OMUA 4JOBA 1ZONA 2JIRA 3I4FA 3AF0A 3IDSA 3OX2A 1IOLA 1ZXLA 4MLCA 1CDDA 3EDMA 1EFHA 3HNPA 3IAAA 3NH6A 4JOCA 5FBZA 5P21A 2B1QA 3EQ9A 4G1FA 4KDEA 1Y9EA 4EY7A 4LBWA 2V6BA 3DXYA 3R7WA 3J81k 3D8HA 1MEEA 2CLFB 1NDQA 1ZN8A 3B53X 3H2YA 2IU3A 2PGDA 1PLKA 2SICE 4LZLA 3MF4A 3VOBA 3OPXA 3RTDA 1E92A 1W88B 1ZN7A 2IOYA 3EF1A 3OLWA 3SYLA 4ED9A 3M6WA 3PC6A 5AW3A 2CCKA 3C6XA 5BMOA 1EBBA 1YRYE 2FPIA 1Z18A 2BFEA 2ZXFA 3GDOA 5HP4A 5EA2A 3GLKA 3D6UA 4FEEA 5EE1A 3KB1A 5BQPA 1K9SA 1JR2A 4JC5A 2P3SA 1SUPA 1AKMA 4BXOA 1C14A 3FPBA 4F5ZA 5BN4B 4JYAB 5TDHA 1Q20A 2ZVQX 1P33A 4IICA 3WRYA 4JEHA 3ERCA 4JP8A 1CY6A 2H4YA 1E1LA 2MHCA 1WVMA 2V7UA 4DOMA 2C9MA 1FDOA 1X7YB 2CUKA 2FUEA 2VSYA 3B7GA 3L5KA 4IM7A 5D00A 2WKPA 5B53A 1V0JA 1XTSA 3QYFA 3W4KA 4A2QA 4DCCA 3D8SA 4J4BA 4BLWA 4YCLA 2NSHA 1PO7A 4POOA 4BNZA 3RC8A 1UZMA 2B98A 2QRUA 3IS3A 1ISIA 2ZBUA 4QUHA 3PSAA 5DU2A 2R48A 3T3HA 3F67A 2D1RA 3B5IA 1EDBA 4YROA 3IRVA 3V1MA 1A9PA 2XXAB 4RS3A 4H6PA 5FKJA 3R0JA 1OFGA 4S1OA 2HQ1A 4MWZA 3ZU6A 5D2CA 3ZU5A 2X22A 4BJ3A 1UDAA 2WJ4A 3WB1A 1D5WA 2ZXEA 2BFEB 3M2PA 2OSVA 2QTHA 2OGTA 3M5WA 3A1SA 3A8TA 3TAXA 3BBPA 2EFDB 4OH7A 1Z5UA 4JN6B 5B7QA 2XE7A 4FFOA 1NTRA 4UTZA 2X2EA 3SJCA 1OXSC 4B75A 5A6SA 1IBSA 4DBVO 3I45A 4FWTA 5K2OA 5E95A 4UHKA 5KNBD 4G6ZA 1ZM4A 2GUWA 2FFQA 4BQNA 1EHIA 2FZ4A 1ZIPA 2JGEA 3HA3A 3QA3E 4TN5A 1ZH2A 1VCOA 3RS5A 3EG9A 3G88A 5IKEA 2XEXA 4LX0A 1CUCA 3P5SA 3W1WA 3AM4A 3UGKA 2JGIA 3MT9A 3STWA 3GAFA 4BMCA 2G88A 4HRAA 4PGAA 5EMNA 2YIMA 4II2A 5J47A 1T2VA 3HDHA 2DPHA 2ZREA 4UKDA 2BWJA 1JN0A 4OIFA 3KKKA 3RCBA 1JKXA 1KDPA 2QX8A 1KFCB 3TKYA 4WHMA 4C4ZA 3IH5A 1CUHA 2R1TB 3AILA 3JTMA 1GV0A 1NJFA 5E9WA 2CL0X 4GI7A 4J03A 2IPMA 1UJ4A 2AF4C 2V0GA 4NK5A 3A3NA 3U3DA 1J00A 3L6EA 2IXDA 4AWBA 1IN6A 2DYKA 3GLIB 1YSCA 5D51S 5E8JA 5IC4A 1AHIA 3ZY4A 3RH0A 2OZLB 4D5GA 1JA9A 2G04A 5DHTA 4EA7A 4MB6A 3FWPA 3WLOA 3JQGB 3VDRA 4B4VA 2D06A 3P9XA 3Q40A 5ILQA 3ZU2A 4QUJA 4HUQA 3MLAA 3KK0A 4BMNA 2CMGA 1TRHA 2YS7A 1SH7A 4I6GA 4WOCA 3ZS9A 3L18A 4NPAA 1HZZC 1M10A 2WYHA 4NE9A 2AI3A 1OE0A 2RH4A 1EFCA 2W6MA 4FC7A 4MS1B 3HBMA 1YZLA 3HYTA 1KI7A 2C5HA 4LWQA 2FVYA 5TV2A 4LY9A 4MR8A 3U2QA 4E4TA 1NBME 2GHIA 2VC2B 5K8VA 4TLAA 1WDWB 1L7RA 4DJJA 4QYIB 4FYPA 1G21E 1VMAA 4QFCA 1H3NA 3EWNA 5T7BA 4YALA 3OA2A 5A0VA 2HA4A 2Y1DA 5BOSB 1JMKC 3SQNA 5DEOA 3QXJA 2PAFA 4IVNA 3D0RA 3M9WA 4K26A 4EPVA 5GTDA 1A7JA 1GOTA 1XQVA 1WUIS 2FWMX 2K2WA 1BYIA 1NJ2A 3CLHA 3N76A 2WWFA 1FMJA 4H0CA 1NATA 2MSNA 4LJ8A 4N8EA 5EAIA 3RFXA 4B82A 1Z4NA 1WETA 1RP7A 1TKAA 5KSOA 4DB2A 4GI5A 3W8RA 1KVRA 3FR7A 3LKVA 3PF9A 3D3NA 5AVUA 1OLSB 2Q6TA 3O4RA 1B7GO 1DLIA 4ES6A 2WYUA 3FGNA 5BSRA 1QGAA 4W82A 2GWHA 2H63A 1J22A 2O52A 4K9OA 2YWDA 4N3GA 4ZAFA 1NBEA 3DHEA 4QKQA 5JZMA 3U4HA 4DUGA 4GI3A 2O8FB 1N2IA 3FNGA 1BA3A 3IQHX 1MRNA 3A9CA 2ZYWX 1VLLA 2VEDA 3QHPA 5DTMA 1F4LA 3B36A 3DEAA 4JYMA 1IUPA 1C3XA 3WB0A 4DB4A 4MV4A 5EP1A 4YAGA 3TLJA 2WKWA 1OBOA 1ZINA 1QS0B 3F5MA 2PEYA 4US0R 2C8LA 1W4LA 2IP1A 4CL3A 3ABZA 3IJ5A 5K8UA 4MR9A 4LCJA 3H2SA 3IKMB 2JFXA 3JVIA 1CJSA 1A2BA 1MPXA 4HLCA 4KQ9A 1LBTA 2PWAA 4FMBB 5C8YA 2HWYA 1P7YA 2FSVC 4PRYA 3EPHA 4B6JA 5IXJA 3O8BA 1H8ED 1UT6A 4LJ6A 1OWLA 1CZHA 2AR7A 3MAAC 4TTIA 1X70A 4A26A 3ENZA 4CKCB 2VJPA 4WNYA 3UBTA 1NZJA 5AOCA 3S1LA 2P2SA 4N48A 4ZANA 3VR0A 2ZUWA 1QYXA 4UAGA 5TB5A 3H2KA 5BN5B 2P2ZA 2PGAA 2HF2A 1Z7YA 1FYXA 1L4GA 2A9QA 2IEZA 4CETA 1NR7A 1L5KA 4WCDA 1L5GB 4D8WA 2CXOA 3GJYA 3Q3HA 3Q2IA 4CMEA 4EGFA 2XZPA 3RVDA 1G0NA 4MKGA 3BRQA 5IJ9A 1CXZA 4QX6A 1I01A 4UEQA 1H8HD 2ASVA 3DMTA 5I8WA 1XPOA 2NO4A 4JQSA 4ZT4A 1UAAA 3AF3A 4DSZA 1WCIA 3U4IA 1L4BA 4W5QA 5LJLA 2B5WA 4IEFB 4D8YA 4MGYR 1Y1QA 1X1RA 2J9XB 3HJCA 3OTHA 4GOJA 1JQ3A 1LBIA 4GBMA 4RJKA 3MTIA 1TADA 1TM5E 4YAUA 1FLNA 3JQCA 1NQUA 5H02A 1CPYA 1KEEA 4NZOA 1D0VA 2QJOA 2VP9A 4BKPA 2W42A 4C7XA 1VLVA 2ORED 3OLCX 3CJTA 4QU9A 2WJHA 1BX1A 1CJTC 1APBA 2GK3A 1CHNA 1D1QA 4NKRA 2J4CA 3AR7A 2X86A 4Q00A 1O03A 2F9MA 2NWQA 4EGQA 1GPWB 4CBVA 1FY2A 3OE7D 3T95A 3K9NA 4A6DA 1A4IA 4OA5A 4BBAA 2GBLC 1ISJA 4RTLA 1JG3A 3DVRX 721PA 4BNKA 4GH5A 4B73A 1BTOA 1P0IA 4XGKA 3HO1A 2IHBA 4I1PA 1IBKB 1HE2A 2ECKA 2VSOA 2YVQA 1XA3A 1CNFA 3VBEA 3GN1A 1SBIA 4HFNA 2BFFA 4JT2A 3DM5A 4HNTA 5EZYB 3REFA 3DEYX 4PINA 3AIIA 3AHJA 4PWYA 3HWRA 4QBGB 5JCOC 3JU3A 3FDXA 1UXKA 3K0FA 3PTLA 4L0QA 1XVAA 2ACKA 1JDZA 1VXRA 4MV9A 3ETJA 1GAWA 2GYUA 3LT0A 5JFGA 1M1NB 1YMVA 3SJAA 2VRWA 2ENWA 3I39X 3TS1A 2WA1A 1PJ2A 3DH0A 3GHHA 3RFVA 2EKDA 2GTPA 3PJDA 4D9BA 4ZN6A 1LX6A 4G26A 4B6QA 4G97A 1EQ2A 2GCGA 1QIJA 1YXMA 2AOXA 3HDQA 4MPJA 4NEGA 2ABWA 1NIPA 4HDNB 3PD0A 4O2BF 4Y6GB 5ALWA 2OD7A 4YRSA 1Y8CA 3GT4A 4RENA 2O0HA 2YYZA 3PNVA 4WCFA 4MJLA 4HP8A 1K6EA 1TW3A 2QGZA 5JWHA 1VJ1A 3VI4B 4QUBA 5ARBA 5CAEB 3IAS6 4JUDX 1XD8A 2OORA 4P6VF 5I5EA 5IUNC 8GPBA 5DRYA 1ZA2A 4NNJA 1A5ZA 2PGLA 3KU1A 4IMRA 4I2VA 4OPMA 3ZV4A 5GWXA 3KSMA 1F8FA 4RJLA 3HJRA 3USZA 3L43A 2JAHA 2O2YA 3V3TA 1BDIA 3CX8A 1KVSA 3ASVA 3AUFA 3DZ8A 4HTAA 4RORA 1L7QA 1LWNA 2YV3A 2V9CA 1EVIA 1PV1A 3S40A 1NV9A 1PNTA 1TT7A 5HGJA 2ZUBA 4D02A 3DT6A 2J7PD 2JDIA 3EMVA 5KTTA 1KMCA 1H2YA 3H6HA 4NG4A 4MQEB 3KLBA 2CFOA 4HUQB 3EVEA 2CL6X 1W0KD 3MGKA 2F64A 3TLZA 3GPCA 3T61A 2BSXA 2IHJA 5SYNA 4A5SA 4E3WA 4DNQA 5J40A 2EFYA 4DXHA 1VKHA 3CE6A 3CURA 4E94A 5ISMA 3EXAA 1T3ZA 5BYAA 3ADOA 2PUJA 2WY2D 7REQA 4HQLA 3B82A 4M1OA 4QLAA 2EQAA 4V02A 1V4VA 4V0QA 5FDFA 4GZ3A 4JP5A 3ZHSA 2FE1A 4EB6B 1RYHA 5TEVA 2NYVA 4CEJB 1F9EA 4RY0A 1EWRA 2TYSB 3NM6B 1XB2A 1V2GA 3AJEA 4K6OA 1B41A 1HZJA 4M7OA 4D79A 4TZ6A 1F8GA 1NFRA 3EUFA 3KDSE 1L7DA 5LWQA 3FFWA 1XCPA 4WGGA 2GNPA 5FPHA 1XEWY 4DVJA 5JC1A 1U3VA 2PIDA 2ZUVA 4GUAA 2Q3LA 2RKBA 2QP3A 3W77A 3X2SA 2W98A 1TKCA 4GMDA 4MB0A 4MQ5A 4OQ4A 2O8DB 3OQPA 2V6IA 3PP8A 5TRTA 1EZ4A 4C22A 4RKQA 2Q9UA 3GV0A 3ZYCA 2I7TA 3FF4A 1E89A 3A36A 4EJ6A 4J2HA 1TQ8A 3L79A 4YDRA 3UQYS 1VTKA 3QLUC 3LNCA 2J6HA 3KXKA 4BZPA 1UM9B 5TQ0A 3ZBPA 5AQEA 1UBNA 3HXLA 2Q5JA 2JJ2A 1TCCA 3ZDFA 4R2HA 4Z53A 4FX2A 3KQMA 4AZVA 1BQ3A 1PWEA 3AT1A 4XWTA 2F4NA 5FAKA 1KMHB 4XX0B 4ZGGA 2JFQA 4WN3A 4XM2A 1QIEA 4ND4A 2H3HA 4L3OA 5AK6A 1GGEA 2Q7OE 1W4CA 4QL3A 2AZ4A 2NXEA 1HOXA 1OFIA 4MV3A 3FFXA 5H9WA 3ROXA 1P2GA 2D4AA 5T3YA 3BORA 1BVRA 4A8JA 3BS4A 4KC0A 3C8DA 2VZLA 3S7ZA 2OFWA 2C4MA 4EQZA 4MPDA 4YRKA 5L4LA 3AB8A 3QFCA 2PVPA 4D0SA 4OU4A 1PYDA 3OIUA 4AS2A 2D00A 1J7KA 4BWVA 1G3MA 2XCIA 5HCUA 4TXJA 4N6OA 1W4ZA 2FEWB 2XRYA 2YASA 3B5EA 3QHAA 3R6GA 1XZ8A 2WT9A 5K3AA 3GCZA 4FSHA 1JAIA 2EJUA 4Q1VA 2PIAA 2NU8A 3QFTA 5CB4F 5KQRA 2VOJA 2IHYA 5LL6P 1ORIA 2BFWA 4MKRA 4MCJA 2VSNA 1J9GA 1KSHA 3TTVA 3VR5A 2W37A 4YLEA 3IKTA 4QTYA 3B70A 3CU5A 3FWHA 4JR2A 5JS6A 1N8KA 3CRNA 1COWA 3GQBA 4JI1B 4IHJA 2RGYA 3UAGA 5HJ7A 2X42A 1EA7A 4X41A 2QRKA 3VA7A 3RVNA 1G2QA 4G0YA 4DMMA 3K3PA 1D2AA 3ZIAA 4EYQA 4Z51A 3T9AA 3WSVA 4GEKA 4LF8B 2I62A 3N8KA 4A92A 3C5VA 1E6WA 3I9V6 2E87A 5CUQA 1ZOIA 3I3SR 4AW9A 4UCFA 2DJIA 3G7NA 4Q7LA 2UUBB 2HSDA 3JQ9A 3F5FA 4DRXA 4KQWA 3ML1A 2P4EA 3N28A 3NETA 1CUDA 2NP7A 2CBZA 1PJZA 4F84A 1O9BA 1JEYA 1SUSA 5D01A 5LN1A 3BWYA 4J1QA 1UOEA 4A8PA 2PZLA 5CA0F 2ILTA 2VDLB 1QPBA 2G7ZA 2H5IA 2MSCB 5HX7A 3UUEA 5TARA 5M29A 2PXAA 4JAVC 2QM7A 3CX6A 3UT6A 1Z6ZA 2QTVA 1E3WB 1K8ZB 3HCPA 1DOAA 2IYFA 3HJFA 2C2BA 3EZLA 1T6NA 2KW5A 4BFZA 3GNSA 3CH4B 1QKKA 3OT5A 3I6QA 4D82A 1PQYA 2HCJB 4JJ6A 3DTNA 1YOBA 2O2XA 4RDHA 1X2BA 3VMMA 4D0GA 1GLGA 1CUSA 1U8CB 1YFKA 1GPNA 2IOQA 2WZQA 3D4LA 3IP8A 1DOHA 4PYNA 5DW0A 4ZYLA 2EBUA 1EUDB 5DMXA 5HKBA 3PGVA 3CKMA 5FP0A 2FF7A 4HTFA 4N3NA 1AF4A 3R74A 5F4BA 1R66A 1HT0A 2PZAA 3JQFA 4Q02A 4C01A 4MYDA 2JI8A 1YDWA 1N0UA 3NNNA 5K0LA 5CH5A 1GILA 4XM0A 4GF5A 1XLTA 1Y3FE 1EJ2A 1F20A 3A31A 4C3UA 2WG0A 2FSFA 4PWZA 1ODKA 3CSSA 5KYXB 1ZUD1 1CFJA 3DDHA 4Q82A 5DP1A 5FYDA 5IT5A 1GP2A 3W1VA 1N3LA 5JCJD 4JX9A 1F51E 1OX6A 4QPCA 1H6DA 3COVA 1Q16A 1ZUWA 3A2MA 4L74A 4PLYA 2OB1A 4YRJA 2ZB7A 4QWWA 2GQ0A 4RK7A 2O2EA 3VKFA 1GG9A 1THMA 3LVQE 4U2BA 4ZQGA 4E4RA 2EQBA 5EHXA 1EESA 4PFQA 1XI2A 1ZW1A 3Q6IA 1MORA 5KX5F 2RGNC 3AEZA 3GFSA 2CNNA 2XAUA 3T9EA 3I9OA 4QHSA 4NXNB 1ACLA 3P2IA 1NGSA 5I7RA 1OZGA 4KRXA 5JXWA 4N3CA 1VKRA 1EA5A 1GO2A 2CSUA 2X5NA 1VJ5A 5IN4A 5K6AC 2B0CA 1ORDA 2OXIA 3ABOB 3HJNA 2GZDA 1QHEA 4MMZB 4QYTA 1RI4A 3ROTA 3HXKA 3ZV5A 4F3YA 2W6CX 3T5CA 5DTEA 2R6GA 2GA8A 5LWHA 4MVJG 2PNJA 1ETHA 5FBLB 4CGYA 1R1DA 2VXBA 3JQBA 4I3HA 3O8DA 1P4AA 3RVOA 2XI4A 4J49A 4DNFA 3UWPA 3S2SA 4GWKA 1ONBA 3FUCA 3TZHA 1PZHA 3B20A 2DFNA 3EIWA 2FW0A 4FUQA 1DRKA 4CR8A 1DKMA 1QWSA 2LXNA 5E6SB 2EFCB 5BSTA 1FXSA 4OGWA 2WM3A 1D5CA 3EGWA 1EM6A 1YIOA 3O6VA 1WXXA 2OO5A 4LXXA 4FGSA 3DF9A 1FNMA 1PGPA 3NALA 4KMMA 4NSNA 3L8CA 4ZEWA 2VATA 3WYAA 4Z49A 1HNZB 3HB9A 2E2WA 4WH0A 4K6MA 4RD6A 4IDOA 1ND5A 3HZZA 4DV4B 5J5VA 1SR8A 4E7OA 4PBSA 1ZWLA 2GMWA 1DZ3A 1VLMA 4Z4QA 1Z16A 1CWUA 1GD1O 3PDWA 4MO2A 2C2OA 3R0QA 3KHKA 5KKCA 1AJEA 1JWAB 2V54A 4AP9A 5HXAA 1UAGA 2ZYHA 1NPTO 1YK0A 1NY6A 4P34A 2IPLA 1M8JA 4WA8A 2W4IA 4KYTA 3ZCSA 1SVMA 3OA0A 5WRFA 4HFMA 4DA6A 1FSFA 4KO1S 2FB9A 5KTPA 6REQB 3MWEA 3IR5A 3QWHA 5FBQB 4UTPA 1P5RA 1PDWA 2C9CA 3FUUA 3O8QA 4UHFA 3WMXA 3BSSA 3V4LA 5UKDA 4F9TA 1WXIA 4KO2S 2C94A 2JCXA 1TUIA 3L40A 5T4BA 4EJSC 2Y9MB 2F4VB 4K6HA 5JMPA 3A06A 1VIAA 1DAMA 1U0TA 1FFHA 4LYJA 3TSZA 4JA2A 4PEVA 4UDNA 1GQQA 2GN1A 3QOYA 1YVRA 3D2LA 5I9BA 2BJHA 3BREA 1KMIY 5HKKA 4OL9A 2FP3A 1FU7A 3IPYA 2ONYA 3PPWA 5HBRA 1Q84A 3CUKA 3IKVA 1Z7GA 2RGUA 4G5SA 2HI0A 4L8FA 4B3BA 3H11B 1QFZA 2OHHA 4KYUA 1BMFA 1TK3A 3R8XA 1JDPA 2BJWA 3EGIA 1GTZA 5F1YA 1EG7A 4UQOA 3AJ9A 4XLLA 1N2CA 3S1AB 3CIOA 1SCIA 1RWPA 3OE1A 5LUAA 2OBLA 3RKSA 1RVDA 3A37A 5ICFA 2VJNA 1Z73A 1PK7A 3R3WA 3CUEF 4CDGA 1UAYA 2R7LA 3JQBC 4JEIA 1WRBA 2TRSB 3UB2A 5ICEA 1U3FA 3BFXA 3GFVA 4R6XA 4UBNA 4CG3A 3BMNB 2B4YA 1H2AS 1WTAA 1D2HA 5GV8A 3WLMA 1RVV1 3FOEC 3DYVA 5JCPA 3AJRA 1FFXA 1QIGA 4HXEB 4WNAB 5JQGA 4RV5A 1P8AA 3EFOB 5AM2A 821PA 3D6VA 3B3JA 1E0KA 4GICA 1ULTA 1F2VA 1ES9A 1NKTA 4RADA 1PTJC 3RODA 4IOJA 1EVQA 1DRVA 3FLEA 2CVFA 1HFWA 1ACJA 1BVYF 4G4GA 4YACA 5ITVA 4ZT3A 3FPEA 5JXIA 3GVXA 2WC1A 4UXIA 3CIFA 1L4NA 2WKSA 1C7JA 1E4EB 4M0MA 1S6YA 3NEAA 1VHDA 4DQVA 5KYTA 1CY2A 4MQ6A 4Y2SA 3NC1C 4J0JA 4BP8A 3QVTA 4ZVSA 1RSZA 5C51B 3ZJ4A 2HD4A 1AN9A 2EW1A 4WK0B 4WOKA 1B3BA 4I14A 3AUJB 2F9LA 2ZS9A 5TPWB 1RI2A 3B13B 1K5GA 4MQFA 3V9PA 3FKSD 4Q3BA 5EMHA 3Q9UA 3RK1A 3ZZNA 2AFIE 3WISA 3WV4A 2B20A 3C14C 4GD3Q 2BKLA 2G25A 3ZZUA 3KAQA 1IY0A 4R9RA 3AERA 3KZNA 3WWEA 4MMXB 5DSZA 4NBVA 4DV2B 3INRA 3N8IA 5EWJA 2TMYA 3LQRA 1OBFO 3O9VA 3HPQA 3OQHA 3WVNA 4BCBA 2FEAA 3RFTA 3T7AA 2DHDA 2DY1A 3IUQA 2VPQA 3VNBA 4HFRA 3TNDA 4C14A 4JLDA 3TOXA 3U09A 1Q74A 4BVHA 5BR8B 2EF1A 1RKQA 1J6UA 3NM5A 2HJVA 4UARA 3DHYA 3HJAA 4BKUA 2XV1A 4M1WA 3PNMA 1ZBQA 5TGTA 3ORQA 3T4UA 3TIVA 5FTLA 3H4VA 4Q16A 3NFYA 4FI3F 4RSHA 4MHTA 2QP9X 2R44A 3F6SA 4H35A 4NMWA 4Y9UA 1FJGB 2O2JA 2AXPA 1V35A 1KBOA 3HKDA 1RRKA 4PLHA 5IX8A 2JEYA 1XRJA 1QKIA 3V8NA 1K63A 3OZIA 4JLNA 3ZI4A 4G2TA 4FMPA 5GJWC 2EZ8A 3BL5A 1PV2A 4RWEA 5A2QA 2D7CA 4YPVA 2VHTA 3OPMA 1Z3CA 3AVVA 1A8QA 3U5TA 1GTG1 1DAGA 2E4ZA 3BH7A 3O4JA 5K3SA 2JH9A 3BGWA 4UOQA 3W5DA 3MG9A 1SIBE 1YVEI 4Q6WA 5LA6B 1ZD2P 4P98A 2HEIA 2LGJA 3H1FA 1D09A 1BXKA 4UEJA 3PNBA 2NTNA 5KWJA 3WKEA 2VDUE 1WUJS 5KCZA 5T41A 2C9YA 3ZVNA 2SHKA 1ZXBA 4LYGA 2W70A 3AEUB 4X93A 1FMCA 4Z7NB 3UT5B 2ZZMA 1BWPA 1GFIA 2ZVJA 1RWNA 1CU1A 4Z4EA 3ZH2A 4CM8A 1ZI9A 2HO5A 2P77A 2QTLA 2QN3A 3SDBA 4Z3DA 4C2UA 2OCKA 3JZFA 3QTLA 1QPGA 1DQPA 1UDRA 1AUVA 3FHJA 1WXWA 2O3SA 2PPVA 5CA1A 2AX3A 1H8HA 3N2GB 3ICCA 1I2ZA 3R8FA 4BTVA 3ZW9A 3FPLA 2BM9A 2ZXUA 4W9RA 1SKAA 4RPJA 1U9IC 1JT9A 2HKIA 3UOAB 2Q1TA 4FDTA 3S7TA 4KOEC 4ZI7A 3E9QA 1K98A 2OD9A 4Y2GA 1GM5A 4FE3A 1WQ4A 3FYDA 1P5JA 1ZY2A 3AY0A 3D59A 3MMXA 4YJFA 3H83A 1CC1S 2HHCA 1NDHA 4K87A 3ZZ1A 3UHFA 4AWXA 2Z6VA 2YWJA 5J2UF 5IT0A 5E2AA 4H7FA 3CT6A 4QTXA 4ZD6A 1U63A 1U11A 3G2NA 4MHOA 3VR1A 1OLUA 2R8PA 2AXEA 4CV2A 5JAHA 4QC2A 3PE4A 1NP3A 3L4JA 5FHQA 2FPPA 3ER6A 4LE1A 1E0AA 4MW0A 5H83A 3NHFA 2ZYIA 4NYJR 8ATCA 1QP7A 4U63A 4Y6RA 4BWGA 3GRUA 1FRQA 2DKOA 3DMDA 4IH4A 1ZESA 2O3TA 1LPMA 4D74A 1OILA 2PV7A 4MK4A 4YP5A 2XB2A 1BX0A 1I33A 2I6QA 2NACA 2ZYTX 2B3DA 3B2QA 2OFOA 3EVCA 4HRVA 3LW8A 4PO9A 5FTMA 3HA7A 5SY6A 4G0UA 4CKZA 1TIBA 1YR3A 1TLLA 1J24A 1OYWA 2P27A 5JVDA 3DL4A 3SYRA 4AQYB 2K7ZA 2HTEA 3TXAA 2WM8A 4N49A 3ZXUB 4ZPJA 7MDHA 2DULA 3CLSD 5IJAA 1IVNA 3GAMA 3BE5A 4V0MA 3TTTA 2JH3A 1K5HA 2IVFA 4A0FA 4W5HA 4YIKA 3PQCA 5HKAA 2QSZA 1KO7A 2I54A 2WDPA 1DARA 2NSYA 1YBAA 3NYRA 2ALJA 4QRIA 1A2OA 3N8HA 1NN3A 4GOND 4UTNA 3DFKA 4J07A 4M6WB 1Y3DE 1DV1A 1E5XA 1H1LA 4GNRA 3CH5A 4H4CA 1KK3A 2FK7A 2ZUSA 3LVFO 4I55A 2B7CA 3OFND 3X1DA 4F56A 2GYWA 3TPCA 2VK1A 1P2UA 2G5TA 3FMOB 3M9XA 3N53A 4QGBA 3SQWA 5KI6A 4G01B 3OZEA 2XKJE 4G2NA 2B21A 4OK5A 3T7SA 3AV0B 1Y4SA 2DFKB 2GF9A 3R6TA 5HF6A 3G89A 4E1VA 5EZ5A 1V9LA 5GOZA 4CKEA 3QENA 1VG9B 3B1JA 1TYBE 1MJNA 3EGDA 5IKPA 2ZETA 4BX9A 3WICA 5CW2A 2EG9A 1KEZA 2IZ7A 3GMSA 4U8HA 4WCFC 3LBFA 3OPVA 1QM5A 1T29A 2QIPA 1LNSA 2Q0SA 4QDJA 2V97A 4KKXB 4N6NA 3L4KA 1GSOA 4DIOA 3GYGA 4F3NA 4M54A 4V1CB 4R54A 3RV4A 5HG0A 3CUTA 2M6KA 3PGMA 1DMRA 2QUIA 4R7ZA 3B38A 1I3LA 3I5MA 3GCGA 4YJGA 1TOAA 3QU5A 4NU6A 1MMFB 4IJ5A 4HB2A 2Q2QA 1XRSB 4R1LA 2HDOA 1QV6A 3TNFA 4EGJA 1OZHA 4MW6A 1U0FA 2X4DA 3DKKA 4QOSA 2ZSFA 1Q14A 2J9RA 3HADA 1FFEA 3KJXA 3U5ZB 1LNQA 1H8EA 1M2OA 2VHXA 2VKTA 1NA5A 3Q9NA 3TGLA 3NNSA 5KHAA 4KQJA 1DLJA 2JLQA 3F3MA 3NAMA 2JC3A 5E2BA 5LDGA 3GLTA 3RASA 4YMGA 1F5SA 3FNFA 5K0NA 2G0AA 2AXNA 1SOAA 4NYIQ 3TX6A 2SCUB 4BV2A 3N05A 1GPBA 1DAIA 1PZXA 2PG3A 3AY3A 4BFTA 1DC7A 3D3WA 5FA5A 5TNXA 4DL9A 3SEQA 1KVUA 4BX8A 1ZAKA 3MOSA 4MVJF 1JB1A 4WASA 1L2TA 3ANXA 3C74A 2P5SA 2QR2A 2AN3A 4GXQA 4OQEA 3G5TA 4PHHA 1S3FA 4UVEA 2D1YA 2A84A 5TXGA 4CF6A 4R4JA 1JH9A 2C8VA 2CNWA 1JF8A 5B30A 4TTSA 3DAFA 1T5SA 3JQPA 3H1AA 4L02A 3QELB 4Y1RA 2PMDA 4BE4A 3S6JA 3HNOA 5MFZA 1ORTA 3AX6A 1A7KA 4HVAA 2GARA 1M2EA 4HDOB 3UJ6A 2B1JA 2QE7D 3N2YA 3MQ4A 2NUTB 5HIIA 5TGZA 2DTDA 4PYMA 1FVHA 4YRGA 2XOXA 1SHTX 2AYYA 5L4SA 2HADA 3OQ6A 1RJFA 4N9QA 4PYRA 1XZQA 1UPBA 2WF7A 3KJQA 4IRXA 1PZFA 3WNZA 1JU3A 1RAEA 2Q7XA 3LA8A 5C7YA 2Q5CA 3GVHA 4FD3A 4V2UA 5K2MA 5EZ6B 5KDLA 4FHZA 1TM1E 1V39A 5TVGA 1AQ6A 4FLEA 3NDRA 5JCJA 3UKJA 4YNBA 4PTZA 1GDTA 1I9GA 3LPAA 4DCGA 1L7EA 3CHYA 3Q9SA 4FI3C 1OU0A 4ZO7A 5EP4A 2OYCA 5K0ZA 5L7TA 1AMNA 3CZQA 4WXEA 3TXYA 2J7KA 4AQDA 2AW3A 1WAMA 2O3UA 3WJ1A 4JLSA 1GXSA 2VWPA 3CG4A 3AQIA 3B1KA 4K6CA 3U1VA 4RIEA 1I3OA 4DJEC 1X1TA 4B3CA 3I4LA 1QO7A 1AKUA 1Q1EA 2F43A 4RF2A 4YY3B 2XMSA 4X00A 2WU0A 1BDBA 1N36B 4MRPA 2X8AA 1KQOA 3VNQA 3A4MA 1SXJE 3NCTA 4LC1A 1OROA 3ZLBA 1CD5A 3MWDA 1AIPA 4H3VA 2CMKA 4PG7A 3NZEA 4MEJA 3BMOA 5BN5A 3IBSA 1ZH8A 4FP9A 4HS4A 2ZIXA 4KIUA 1GSAA 1KC3A 1TMYA 4ZA2A 5I7AA 4I8IA 3KUUA 3FCXA 1ZGGA 1NF8A 4B1FA 2BZSA 4FR0A 3W5VA 2XUPA 4TKUB 4XJTA 1ZM7A 4FZJA 3T3GA 4FNOA 1YR6A 4MYUA 2DVMA 3C3MA 1OAOC 1KSJA 3ESQA 4MUYA 1H0SA 3DL0A 5JMWA 1DXOA 2VDJA 3PKJA 1WZIA 2PRKA 4IDNA 4LV8B 2FR8C 2ZYGA 5IW8A 2BTQA 4P7JA 1KK1A 5L6MB 1B74A 1QYDA 2JCBA 3A11A 4IZOA 1EFKA 2GEKA 2EJVA 4Q3EA 4BZWA 3OY7A 2CHQA 1GVHA 3BAFA 3DZIA 4B6PA 1HNWB 1VL8A 1ESZA 1V37A 3HV2A 2YY6A 3NHKA 1EX6A 1Z3IX 2FN8A 1NBWB 1W2WB 1NHWA 3D3JA 3D4OA 4MDHA 3UMGA 4PZLA 1PSWA 3UWOA 3OCCA 1GKUB 2XZTA 4UQPA 3OZGA 4G8BA 4P3KA 2XZOA 5JXJA 2WVAA 4A82A 1P62B 3X1JA 4I9GA 1A8IA 1VYUA 2WP0A 2WLTA 3PS9A 2HF9A 2PBFA 3KD3A 1Y5MA 4UAUA 4DYDA 2J59A 2PV0A 3LSTA 3K5PA 1SCAA 3OAAD 3P0JA 2XQFA 5GONB 2ORIA 2FPGA 3SZ3A 4HJXA 3ZGVA 5I51A 2GEJA 5GMOA 4B7CA 4ZQCB 3SN6A 1M1NA 2A0YA 2P9YA 3EOBI 2HPHA 2Q5HA 5F2KA 3UUFA 1IM5A 4B6SA 3GLIE 3TKLA 3M6UA 2EV9A 3DEZA 2Q41A 2VR1A 2DPXA 2DX7A 4D3SA 2OECA 2ZU6A 4KIWA 4L15A 3EQ8A 2O06A 2BGJA 1ZL0A 1NVXQ 2IEDA 3QWAA 4AMBA 5KNDD 1V3VA 3C3EA 2IC5A 3TJMA 1JHMA 1WL8A 3KHUA 4HNAB 1WABA 3L82B 1BWQA 3DW3X 5I7HA 5AUQA 1DBRA 1DBSA 2OV8A 2PUGA 1ILWA 1IJEA 1D0IA 4XSVA 4M36A 3TINA 4L75A 3LZ6A 4L78A 4YECA 3GL9A 4EL0A 2XUKA 3ESBA 1XO1A 3E9YA 5EYPA 6Q21A 4C4TA 2WU4A 3AR4A 4YJDA 1EHCA 4FQ8A 2YMLA 1E0JA 1TEXA 4Q9KA 2ZI4A 1E1CB 1QH1A 1F3OA 2Z30A 3SD7A 3VTZA 5KTKA 4ZMBA 2GOYA 1CR6A 1PK8A 5L40A 2ZJ0A 1OT5A 3TQSA 3MWGA 1UL1X 2AXQA 4L8GA 3C3DA 2P1DA 5IJ0B 1FDSA 2D8MA 4MQBA 2HTFA 3MBOA 1OJ7A 2PBLA 3E2IA 2FDXA 3H13A 3A6FA 1XQ1A 3DC2A 1R10A 5F2NA 4M0DA 1N5JA 1HMPA 3LOUA 4KGZA 2B61A 2Z8ZA 1DDOA 3U7HB 1RJGA 4G9GA 1KEVA 3MT0A 2XZDA 1RABA 3PDJA 3ZU4A 3D2AA 4WN9A 1R50A 4CU5A 4O0MA 1Q15A 3TF5A 1Q0PA 4DSAA 3R9XA 5H1YA 4FMCF 4JLVA 5F73A 3BE8A 1XNGA 1PI3A 3G8BA 2KPOA 4MQ4A 1ULUA 3OESA 3FPJA 2BGTA 4B6FA 2QN6A 1E4OA 3KYDB 1X1BA 1ZSVA 4ZXPA 2D2FA 3FUVA 3VR2A 1U2GA 4ISBA 4II7A 2DUJA 1OZFA 3II6X 3TD6A 1A7AA 2R4QA 1FQKA 3DP9A 3LKDA 1P61B 4N1AA 4PX9A 5AW9A 3RVSA 1KAQA 2Z6AA 1NLUA 4FCWA 5BQOA 3UCXA 1NBMA 5CDFA 4BFVA 1W35A 2GSWA 1KY5A 4EF5A 2E85A 3KHSA 5SV2A 3K9FC 1JHVA 3TZLA 4BNXA 2WE7A 3KKOA 4MZXA 4LFAB 1Y3HA 4TVBA 4K46A 4P7KA 4X63A 4K6GA 2V7BA 1QGUA 3MTDA 5KSPA 1GRNA 1Q57A 2BW0A 1D8TA 5BSKA 3IVAA 2R68A 3QQPA 3QOFA 2ZIUB 2BBTA 2QG4A 1C2TA 1N6PA 3EC7A 2Y76A 4IUBS 4KVFA 4DREA 5K09A 1DSSG 2E3JA 2ZB8A 1LPOA 3Q7EA 2PMWB 1QF9A 4YMWA 4I4CA 3A7EA 3T15A 1R4ZA 1MR3F 3R24A 3NHMA 1VDMA 1Q0HA 5ALYA 1LX7A 1FRFS 1II8B 1DAHA 1Z4PX 5IVIA 3WYDA 5U9CA 4DV0B 3H5NA 1V5GA 3DQPA 4PFJA 1TJ5A 5HUHA 3T4EA 4QU5A 1DAPA 3ODPA 2IS4A 1V25A 2I1QA 2JLCA 2OG2A 2ZRJA 3DR3A 3EF3A 4HUJA 4OAQA 1MX3A 4WZBA 3V1YA 1XGKA 1SOVA 4I9FA 5LMUB 3RJMA 1DKLA 5IM4F 1KERA 4FYIA 1DAFA 1RYMA 2VUSA 4B9EA 5CFPA 3SLKA 1LGYA 4J91A 1N7GA 4ZT2A 2VHEA 4EHFA 1UKAA 3JY6A 5HGXA 4M83A 4AKHA 3MXOA 3HEMA 4JBIA 2MR6A 6AT1A 3OPQA 4K9SA 3AVOA 4Q24A 4HPJB 2WTUA 1D4AA 1GWNA 3H8JA 1CLEA 4ER0A 2QN2A 1RKUA 4E3ZA 4X8OA 3GT0A 5GPBA 4PSKA 3LF2A 1PR1A 3MWKA 3B6KA 4XVRA 3TX2A 4C0LA 4F8JA 5A7FA 9GPBA 5LKAA 1G8PA 1CUZA 4PHGA 2GYYA 4TZTA 3GH3A 4AY5A 1G3RA 3LPMA 3FJOA 5AVSA 1QHIA 2VNAA 2ZR8A 2FX3A 2FSUA 1V6SA 2I80A 2R6DA 3JZMA 4JT4A 2R62A 3JPYA 3WJ2A 4EG6A 3D2BA 3WHLA 2OHOA 3DQQA 1Y98A 4RIIA 2I2WA 1WCV1 5DNEA 3S27A 2W6ZA 4NJEB 2IUEA 3OEEA 3IQWA 1SUIA 1GR1A 2M6SA 3I62A 2NM0A 2I5PO 4M99A 5ESXA 4F6RA 4MVWA 4WPGA 3BHMA 3LC0A 2YL2A 3K0CA 5B2FA 2JIBA 2FW1A 3I64A 3FYTA 2IITA 3FG9A 1V3UA 3KT0A 3TRJA 5HUQA 4ENQA 1W7AA 2WPDD 5JSKA 2G5GX 1YHNA 3WV5A 2I6GA 3GEBA 2AZDA 2GN6A 3H1BA 3TOVA 4MP6A 3NORA 5D3MB 4CIYA 2RBGA 2QZPA 5CCDA 1D04A 1A9XB 2R8BA 3FDFA 1TA0A 3PWTA 2O8FA 3I9LA 4KQEA 1N5OX 1FPQA 1K6XA 3UH1A 5FWAA 4H7KA 2QY9A 4OQZA 2R6AA 2O14A 3GA7A 2KBFA 3Q5DA 3UNXA 5A02A 1HGXA 2Q8PA 1JYEA 2O5RA 3HVHA 3C48A 1C3EA 1PJQA 2LW7A 3PU6A 3JATA 2YIVX 1MFPA 3R5KA 4H1VA 4PZCA 3TQOA 5JXGA 3U13A 1X77A 3KVNA 3WWOA 4D9FA 3G5UA 5KC9A 1WZNA 2JFPA 4JVOA 5T5QA 4EPWA 2J9FA 4E7PA 4U02A 2M98A 4Y6PA 3ZOKA 4EVSA 4H0NA 4ZZIA 4XD7A 3DV2A 1VMEA 2D62A 3CR8A 3H05A 4EAAA 2DCMA 1T8SA 2PMBA 7ADHA 1YACA 2XUHA 1JG2A 1NU6A 2I71A 5EVCA 4ERNA 1DX4A 1MEOA 1BCRB 1S9HA 5EL0A 3PWSA 4NU8X 5DLQC 5FQOA 4BB9A 4CLEA 5ICSA 5KS2A 1P4RA 1YWGO 3VYUB 2UU9B 4N9WA 4OO3A 1ATZA 4P7GA 3H2JA 2KBEA 3LHDA 2DJ5A 4WZZA 4Z0NA 3VXKA 4DV1B 3BMQB 2Y71A 3M89A 4NCAA 1CUAA 2X6QA 3EA0A 3PPYA 2PWYA 3IHLA 3ND7A 3OTQA 4TLEA 5HQJA 4DILA 4Q7EA 4PG5A 1EWKA 4YMVA 1X7YA 1ISFA 2VS1A 4P5PA 5A71A 4PR3A 2D5AA 2XVXA 3OKAA 3DEHA 4MYTA 5H9VA 2RC5A 4MB2A 4LF4B 2YYSA 1T2AA 3I6MA 2VT2A 3B1WA 3I8SA 1ECGA 3BTUA 3LYAA 3UJ9A 3K4HA 3S44A 4CTNA 4Q3CA 4S24A 5A1TA 4HH4A 1PL7A 2H59A 4XUCA 4H7EA 4HV4A 2E1PA 4TTQA 3ZWDA 5CNJA 5EIBD 4H1WA 4TM7A 3L1KA 3P2MA 1CUYA 1PD1A 1XEXB 4RKWA 1PD0A 4MWSA 2CXRA 1JMVA 1SQ0A 4FVTA 4FIDA 1XCJA 2ZJOA 2RHOA 1G98A 4HZGA 4IILA 1XN4A 4OGKA 5CPBA 3QP9A 2QQ5A 4MS4B 1Q22A 2Y27A 1MTOA 1T8YA 1TPZA 2Z2IA 4RGBA 4S0XA 1XPUA 5EMKA 2WZBA 2YHSA 4RC9A 1QORA 3WRYC 5FXMA 4G0WA 2OHXA 2HGZA 2Q46A 1ZI6A 3UH0A 3L6CA 3S68A 2R1ZA 1Q11A 1NPYA 1PYGA 2OK7A 3F46A 2K4MA 4HLQB 1ESCA 2WKRA 3H8SA 4Q03A 2PX3A 1T0JB 5JAQA 3ROFA 3I92A 2RKOA 2Z2KA 4PSVA 1I4EB 2FPLA 5HOQA 3KQKA 1IXZA 4LJRA 1XNQB 5C1DA 1P9LA 4FC6A 1RM3A 3BKWA 3GGOA 5HCNA 1WSAA 4ALKA 1A5TA 4CMAA 4ZJUA 3AWDA 1M9NA 2EGUA 3R5HA 4KR2A 1NX6A 1II9A 2I1VB 2IYNA 2X58A 3OPNA 4JH0A 1UH5A 1CZNA 4RKFA 3TXXA 4R1QA 3L8YA 3CISA 5IZCC 3X43A 1A1VA 4DUZB 2O8CB 3ZWQA 2WNIA 1YCGA 3DVAB 1E8NA 3WLRA 1M0WA 4P82A 4BNHA 4EHDA 1GFZA 3LKBA 1RNLA 1JEAA 3VGJA 1TGYA 2ZTUA 2OM6A 1SIOA 2R5FA 3IFSA 1FYDA 1JHPA 4IXDA 1QB7A 1TTPB 2X8WA 1IBLB 4M76B 2QN8A 3TCKA 5K3EA 2BD0A 3F97A 4HATA 1SXJD 2FHPA 5IDYA 5FOTA 4AYXA 3EDOA 3QJ5A 1MH1A 2ZT6A 3KC2A 4MCIA 3Q3IA 4TWRA 2BTQB 1XZJA 2VYVA 3C1OA 1PQ4A 1C4OA 2AL7A 3P9QA 3QE3A 1FMLA 1WF6A 2ZRIA 4LHWA 4XYMA 5FWYB 2WD9A 5KHOC 4QFDA 2CDBA 3P2YA 1WSDA 1XYYA 5PNTA 1PL8A 1LKZA 2I2DA 4JEUA 3BQNB 4F5EA 3OQOA 1VQ1A 2FQQA 3MJDA 3NV7A 4G8DA 5IBRA 1EYZA 1H4VB 2GZMA 3AVYA 1OSNA 4C4SA 4LBZA 4M8IA 1RWBA 4TPKA 2HSJA 4ZCIA 3QYPA 3RJ9A 2JI7A 2FN4A 4AO7A 2V9PA 1L4LA 4HNAA 5BNWA 4GX1A 5AJHA 4OJQA 5CCEA 1C7IA 4I50F 4DLUA 3IIKA 4H08A 5BXQC 2VHJA 1TU3A 5JATA 4K9NA 3QPBA 3TG2A 4HLDA 2MU1A 2JGDB 2YY5A 3VDMA 1OD6A 4WKOA 1A9ZA 3QEMB 1P1HA 2HU7A 1MAVA 4C4OA 1JLRA 1QKJA 2Q2NA 3IVXA 2ZSEA 2IYQA 3KZOA 3OH8A 1GXSB 4P80A 2FVXA 4YP7A 2R7MA 1E1QA 5JJLA 3MBIA 1JDNA 1GR0A 1F1JA 3CNEA 4DY6A 3L9XA 4EB8A 3K70C 2XCQA 3RLIA 3HK2A 1BQEA 5A9TA 1TZMA 3LPDA 1KDVA 1IWOA 1VGRA 1AHNA 4PNHA 5ALRA 2F67A 5DM1A 2JIPA 4Y8VA 4FK8A 5DTRA 4FFWA 4M37A 2PMKA 1II8A 2ODAA 3B9PA 1CKEA 2XCLA 3UMJA 2O7VA 4YJ3F 5A0TA 1RXUA 2OHJA 2W4MA 1FFSA 4H31A 1KKLA 4RJIA 2HRDA 4FJ0A 2AZTA 2BSAA 1RIFA 1Z7WA 1XK7A 3E4DA 2QMYA 4GM1A 3WY9A 2OOSA 1RKBA 3AEKB 3BQMB 5J1TB 3PEUA 2QKYA 4LFCB 3UTCA 4DUYB 2B92A 3QELA 4Y1RB 1XAJA 5K0SA 1BC5A 3DMGA 2I3DA 1JXAA 3KQVA 4X66B 1QFXA 3O9ZA 1NLFA 1FP4B 1IEQA 4ID9A 4R69A 1TB4A 1T3HA 3EXFB 4DDKA 5C46F 5K1ZA 4XUEA 1N4DA 1PRYA 4RL6A 5AICA 5EJ6A 3RYHA 5AKGA 5DDIP 5JEDA 1HWYA 4DSTA 5K4GA 1YE5A 2J0EA 4WRRA 4QSHA 4HKTA 2BI4A 1AK2A 4M8LA 4FHGA 5CM8B 2ZJ7A 1G20B 1MT3A 1TI7A 4NOLA 5DBEX 1WPRA 2ZIXB 2MR5A 3GDGA 1WCYA 4LGYA 4E5YA 4JI4B 5DWQA 1EVKA 4W99A 5HQTA 3HBNA 4GVXA 4Z4CA 4YT2A 5D7NA 1GTVA 1Z07A 2BH2A 4WMLA 1UP4A 4G1MB 1MHPA 1YI8A 2GCEA 2QD3A 2X1HA 3A6LA 1JMYA 3PZBA 5HF8A 4FGUA 1ZICA 4JZYA 1DAEA 1Q1AA 3CJRA 2F43B 4LDPA 3U19A 3AHCA 4ESOA 4LJLA 4PPQA 3EARA 1IEXA 4M21A 3FDZA 5GVSA 3LYUA 1WY5A 1VL2A 2H2WA 2ODEA 3D8RA 3QVJA 3UJ3X 4K3VA 5E3IA 4JJGA 4XWGA 2PYZA 5AKEA 1XRNA 1RZRA 3ZEIA 1PNRA 3LFTA 4JC0A 3FPSA 1JIJA 4FKMA 4XOIA 1Y89A 4HG2A 4M9CA 4NR0A 5AVJA 1AZLA 5B1EA 3R9WA 2WUGA 3CJQA 3CLRD 4YLGA 4ZYZA 3TW6A 1TT5A 4RV4A 1OBCA 1XMQB 1G7RA 1T2DA 3FMPB 2H8KA 4FJ2A 1JLLB 4NV3A 4FSDA 5MGBA 5CHYA 4QJ5A 1RCUA 3ADKA 1ZC3A 4X6YA 1KIFA 2OV3A 4I55F 1HV8A 3FYUA 4AY6A 1CUIA 9LDBA 4K88A 2XTAA 3QF7A 2J07A 2W00A 4WKPA 3TIXB 2BHTA 1LJUA 5E2IA 4BFWA 3ZCUA 5KQSA 4M7PA 1VYHA 1KFEB 2OP1A 2ESRA 2CF5A 1YQGA 3C7CB 3KPVA 4AZ3A 4TLBA 5EC8A 1YS1X 2JLXA 1U6JA 3I05A 3SSOA 4FS8A 1W85A 1N2HA 1XTPA 1UFQA 2GEFA 4G0MA 5ALUA 1T8WA 2G4VA 1RBZA 2VNHA 3HUUA 4L5JA 4M9SA 4QAQA 4R3NA 1VJDA 4XFJA 4DZTA 2F3RA 2FH5B 1PLJA 2Y0DA 3KXIA 3MWDB 5JS2A 3U17A 3ZLTA 1XL0A 3WGHA 4DIFA 5I9IA 3DULA 2F17A 4POAA 4TMKA 3GWGA 1UWKA 4L5YA 5THQA 1OWMA 5BYJA 4N47A 2ZM5A 2C98A 1U3DA 2FP4A 1NYQA 1Y1PA 2AI1A 3VSDA 4GDFA 4WKBA 4NX2A 3EYAA 1OKKD 4EOGA 2WPDA 1V1JA 1S2MA 1ZUIA 2J0VA 3FSEA 1EQAA 5TF4A 1MAUA 2C29D 3G1WA 1I7NA 4AX4A 4DMFA 1PZMA 4WXPA 1EQUA 4IFTA 3AZPA 3OU2A 2B1RA 3NPAA 3FB4A 4NZ9A 1OVMA 1MDBA 5AKZA 1Y1LA 2DMRA 1XWIA 3MMSA 4R9NA 3UQZA 1Z56C 5BW8A 2XR1A 4ZCQA 3BOSA 3OEED 4EYOA 2PUVA 4LNUB 3UAZA 2DT5A 2G5CA 3H9JA 4HPWA 2OZKA 4B47A 3U7QA 1W5FA 1OMOA 3EIFA 1XXHE 1W34A 3FRIA 1RPZA 1RHJA 4ZDKA 1JWBB 3QV1A 2OKCA 2E4XA 5F12A 1N2XA 1JVSA 1W96A 1Z74A 1P29A 1WKCA 3C5EA 4NZNA 2C3UA 3AP2A 2UZ0A 2W0SA 4HNHA 4KPGA 4TRMA 4UDOA 4CUZA 4IF6A 1PL0A 4WX2B 2IHVA 1G8HA 2H2DA 4Q19A 1EG2A 4YJ3A 5MDHA 4AB1A 4AFNA 1OOEA 1H4QA 3PFHA 4BQPA 3H84A 3OM8A 5B1SA 5JSYA 2XE4A 1NNUA 2XY4A 4HWKA 3KR0A 4C4AA 4DR3B 2WU1A 1C50A 1FC0A 3HVJA 1Y5RA 1J2TA 5NLLA 1KJWA 4HDRA 1HKUA 4EPTA 1PGQA 3M4ZA 1DXHA 1U2PA 1EUCB 2NU7A 2PLNA 4TKUA 3ZQ6A 3QXGA 4BMZA 4DM7A 5BQ3A 5K3BA 1ZOLA 1EGVB 3PQ8A 1LK0A 2QORA 4K8OA 1N6LA 2VJYA 1ODFA 3MJFA 4RA9B 3TTWA 2H08A 4HHEA 1F6DA 1R7RA 4IJMA 4ZI3A 5JASA 4B2PA 5AO9A 2GLXA 3BDAA 1I6WA 1TD9A 1N1DA 5G41A 3BGIA 1KDRA 4AUNA 1RJ9A 1JV2B 3JQ6A 3KZCA 1B0UA 4Z0HO 1JLKA 3WHPA 4JV5B 4HI0E 4C05A 1HNNA 1UEIA 2IY9A 2QPTA 2QVYX 3L8FA 3VU9B 4AMUA 1BSVA 5GZ6A 5ALOA 1CJMA 2IY8A 4IG9A 3ZEAA 3FYHA 5B4VA 1KJ8A 2EJBA 5F9FA 3KQPA 4OUKX 5H7XA 3OJWA 2WF6A 3NVDA 5FA6A 1PE0A 3H7IA 1GYPA 3BXGA 3WBFA 3ZHTA 4C89A 1INLA 3F47A 4I4TF 3KEGA 2VTEA 4PXAA 3FBTA 4FOLA 5DYNA 3VPSA 4K05A 4KXWA 2YH2A 2R00C 5HNKA 4TV8B 3AP3A 4R8MA 3BSFA 4HVCA 5LMNB 1PT8A 3G9QA 2VYFA 2GI4A 4P1ZA 1TAUA 1FTNA 5CVVA 1BWRA 2XXJA 2WHYA 5FWXA 3OIGA 5CX1B 2MIIA 3D31A 4Q6BA 2YZNA 3NQ41 1AKVA 4EGSA 5KWSA 3RSSA 4B5LA 4EX6A 2H1HA 4OP2A 3CLUD 5HIKA 4A5OA 3KTFA 3N58A 1DEKA 3N2IA 3D43A 2RONA 1BE8A 4DV7B 5AK3A 1J06A 3TAHA 2VJDA 2B4AA 1L5SA 3KKMA 3M2TA 2GRJA 1V8OA 5D5HA 3T12A 1XVTA 1VGVA 1WZUA 1CP2A 2FKAA 1N2CE 5HF9A 1DKRA 3LTEA 1IY8A 1S8AA 1AV7A 2J3KA 3KV3O 3D6NB 2JFBA 2G0NA 2GKOA 2XRMA 3OU7A 4FLFA 4GOLD 3RVPA 4U6NA 1TF5A 1SIWA 5CJ2A 4Q1EA 4S2UA 2IZ6A 3L0DA 3WKBA 2BE7A 2YOHA 4M9ZA 4L50A 1YZGA 3RQIA 4GR5A 3UB3A 5IXYA 4YCDA 3TB6A 3AKEA 1F9AA 1ENPA 1AZWA 1N3YA 3EGCA 4O4JA 1T0PA 4RHFA 1NULA 3DA8A 3GGJA 1SCNE 1XZGA 1BIFA 3H5TA 1R0SA 3PR1A 3Q15C 2P40A 2Q49A 3VR6D 3RRBA 4J4HA 1D9XA 3OWHA 1P5FA 2B83A 1BWSA 2HGSA 2X0JA 3IXQA 4FFNA 5FOXA 3UAOA 2C2KA 3LX8A 1U5AA 3T7RA 4ID3A 1RHRA 3DBRB 5AJVB 2ODWA 4E5VA 5KOJB 2W2OA 4QXPA 5LQSA 2J3HA 3ZE9A 4YCSA 3BK1A 5JDCA 1AB5A 2HHJA 3PVCA 2GA9A 4TS1A 4EI2A 1G7SA 1SD1A 3O75A 1RWKA 2YZKA 1K8XB 4JVLA 1FLVA 3ESCA 4KFTA 4WUTA 1ULAA 2QNBA 1DHRA 2YXBA 3ZKAA 3LLMA 3AEUA 2NZWA 1AHHA 2VYVD 2FUNB 1MJHA 1SKBA 4XCQA 4RANA 3GD7A 2DBRA 3LWNA 4WLEA 2W8BA 3VHXA 1KAHA 1E9VA 1O54A 2CF6A 2QMHA 3FAZA 4HAWA 1QR2A 4L4XA 3NHJA 4M0LA 1OVGA 1XJCA 2I67A 4O2RA 2AVDA 1ESDA 1FB5A 1KS9A 1Y3IA 1YB7A 1WDTA 2D1QA 2C4NA 3EFHA 3LC7O 4Q3LA 2PO7A 3V8PA 1NMYA 2OGWA 3M49A 4EO9A 1XZEA 4YIHA 3A9RA 3D7MA 4CVNA 1NI5A 1SBTA 5C8ZA 3PUWA 2O07A 4KE6A 3JQAB 4PCLA 1T8UA 3B3GA 2FGKA 1IBMB 1M6VA 2UYOA 4O4LF 2UUAB 1TECE 1DCFA 2E21A 2ZI6A 4P4GA 4DRZA 1S2LA 2D3TA 3PXDA 3CUSA 2HFKA 1SHKA 4C3OB 4PLVA 3E3LA 1OPXA 2VBIA 1KQFA 3T7CA 2BRUA 3HGQA 2O8BB 1KL7A 1O6BA 3ABSB 3B2EA 3ZV6A 4A1OA 1U5BA 2F7SA 1GQOA 1P72A 4Z8YA 4GLOA 4MWBA 5SYMA 2P3OA 3LUAA 5K6AA 4GO1A 4I55B 3HYSA 1FTGA 3IP6A 3HLYA 1RZRD 5C7LO 1I1HA 4Q4LA 5EG5A 1CCWA 4ZRMA 1KI3A 2GFIA 4C6TB 3IXMA 1K08A 4E30A 2FRDC 3S4YA 3KOWA 4RXTA 2ZAGA 1RBMA 5J59A 2VNJA 5AXBA 5EXPA 3ROGA 4B81A 1KMQA 3RVMA 1P4GA 4Q1CA 5IHXA 1GGFA 5ITSA 4BGIA 1V96A 1ZZGA 2JZOA 2KE5A 3MTGA 3DT8A 1TYCA 4G0PA 3C3KA 3RFCA 1R00A 5JVDB 1Z88A 1UKEA 3PXAA 4LECA 1SCQA 5GADl 1AD2A 5TEWA 2BKAA 3IO3A 2P5TB 3E23A 2G9ZA 3QUBA 1DXQA 3CRQA 4L9WA 4M1QA 4EELA 2XW6A 4K9QA 2CFSA 3W3AA 5HHTA 1DADA 2WUEA 3H42B 4JNKA 4UTOA 1XD9A 1NDUA 4R2JA 5FOUA