2SBTA

A comparison of the three-dimensional structures of subtilisin bpn and subtilisin novo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN NOVO
publication title A comparison of the three-dimensional structures of subtilisin BPN' and subtilisin novo.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
total genus 45
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1976-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sbtA00
1SUDA 1EA7A 4WOBA 3A3OA 3BPSA 3DE5X 1OYOA 4Z2AA 3TI9A 1Y3DE 3DE0X 1KE2A 2WWTA 3F7MA 2PRKA 2TECE 1KDZA 1PTKA 3QMPA 4H6VA 5SICE 3F7OA 1TO1E 1SBNE 2Z30A 2PYZA 2PWBA 4BWGA 5JXJA 3AJ8A 1SCJA 1KDVA 1Y3CE 1PJ8A 2SICE 1AQNA 2W2NA 1NDUA 3GCXA 3D43A 2ZWPA 1MEEA 1BFKA 3DE6X 5I9SA 1SBCA 1T1EA 4H6XA 4CFZA 1TECE 2W2MA 1R64A 1XF1A 5FFNA 4AKSA 2Z2YA 1NDQA 3WIUA 1TMGE 2SBTA 1IC6A 2ZWOA 1VSBA 2XTJA 4M1ZA 2G4VA 2WUVA 3DE2X 3LXUX 4MZDA 2IY9A 1YJBA 1WMEA 3VYVA 4ZARA 3WQBA 1IAVA 3DWEX 1Y3FE 2Z57A 4H6WA 1SN7A 1YJCA 1GNVA 2IXTA 4K8RB 1Y4DE 1SIUA 1Y48E 1C3LA 1SUEA 4NE9A 1ZVJA 1PEKE 1C9MA 4KB5A 1SBIA 3Q40A 1GA1A 3VV3A 1T1IA 1BFUA 1SCDA 2WV7A 1WMFA 4HVLA 2PKCA 1C9NA 1A2QA 3DW1X 4DZTA 4DJ5X 3GT4A 3QTLA 4CFYA 1DUIA 3LPDA 1BJRE 4OMCA 4J94A 3D9QX 1S01A 4KPGA 1GNSA 1AVTA 3VHQA 3H42B 2W2OA 4DWWA 3DE3X 5K7SA 3ZXYA 4NMXB 3A3PA 2ID4A 4GI3A 1GCIA 3BX1A 2DQKA 3CNQS 2B6NA 1SPBS 2Z2ZA 3QFHA 3WHIA 2HPZA 4LVOA 4I0WB 5AVKA 3GCWA 3LPAA 1SBTA 3DE4X 4B5LA 3VSBA 5CW1A 3TI7A 3F49S 1CNMA 1EGQA 1ST3A 2PMWB 5FAXA 3ZXXA 3BGOS 3I34X 1AH2A 1V6CA 1Q5PA 1YJAA 1TM3E 3P5BA 4JP8A 5JXHA 1SBHA 1ST2A 3L1KA 1WSDA 3DW3X 2GKOA 1TK2A 1SIBE 1WVMA 1Y9ZA 2W2PA 1Y34E 4CG0A 5JXGA 3DYBA 2E1PA 1SCAA 5AMXA 1SUPA 3EIFA 2DP4E 1R6VA 3WIVA 1LW6E 1Y1KE 2ZRQA 3PTLA 1TM4E 1THMA 3GT3A 1R0RE 3T41A 2P4EA 2ID8A 3EDYA 3DVQX 1AF4A 1GA4A 3VV2A 1WMDA 1P8JA 5ARBA 1C9JA 5JXIA 1GTJ1 3OSZA 1JEAA 3DVRX 3HJRA 2SECE 1KDYA 1TO2E 2DUJA 4ZOQI 1TM5E 4AKTA 1SUAA 5AVJA 5ARDA 2HD4A 1SCBA 1NLUA 2QTWB 4WOCA 2ST1A 3VTAA 1S2NA 1AV7A 1AK9A 1BE8A 1BE6A 3Q5GA 3DE7X 1TM7E 1SCNE 1SIOA 1T1GA 1V5IA 2Z2XA 1GA6A 5B1DA 3PRKE 3A3NA 3SQOA 1OT5A 4HX2A 1HT3A 3TECE 1S02A 3EE6A 4RYDA 5JMOA 3AJ9A 1KE1A 4OMDA 4C3VA 4C3UA 4FONA 1SELA 2Z58A 1ZVKA 1TM1E 1CSEE 5ARCA 1P7WA 4YN3A 2SNIE 2X8JB 3I30X 4KG7A 1SVNA 3AFGA 1MPTA 3SICE 2WUWE 3LPCA 2Z56A 2V8BA 1AU9A 5FBZA 1SUBA 1PFGA 5AQEA 1YU6A 1OYVA 3DE1X 1Y3BE 2X8JA 3I37X 2XRMA 1BH6A 1SH7A 4OV6B 3UNXA 4NE7A 3DDZX 3I2YX 1GTL1 1UBNA 3DVSX 1Y4AE 2W2QA 1Y33E 4LVNA 2PQ2A 1GT91 1GTG1 1DBIA 3CO0S 1SUCA 5B1EA 2PWAA 1P7VA
chains in the Genus database with same CATH superfamily
3HSKA 3EAFA 3N5CA 9ABPA 3WLJA 1CDEA 2CXSA 3E35A 4KDRA 4XWAA 3WLQA 4RGVA 1GPH1 2W2LD 2UXDB 1DKUA 1B73A 1SVUA 1G42A 1TJYA 4KBGA 3UK1A 3VR2A 4MICA 3WLSA 1PJBA 2P3LA 2PL1A 3MWGA 3WSWA 3N0VA 4DG8A 3H4VA 3IDZA 4OQZA 3IJ5A 4FNOA 1K6XA 3GPCA 2ET6A 3JQ9C 4ETWA 1KSGA 3DDUA 1LX7A 2OV4A 3AGPA 5TT0A 2CNBA 2YHIA 1EYZA 1NXSA 2EGUA 3STXA 4Y2QA 2QRGA 4HPXB 3X43A 2VWHA 5G4KB 1HX7A 2E87A 4NYJQ 2XWSA 1M74A 4QQKA 4QSHA 3RFVA 1QMGA 5JV5A 3KB8A 3CPHA 9GPBA 3GJSA 1VSVA 5LDHA 3BE8A 3C2QA 3VNVA 4O4JA 4ZEOA 2O1SA 3ZGXA 4TKMA 4Y0AA 2GCNA 1T1SA 4P8RA 3ZTWA 1E1RD 4LC1A 5L45A 2HW8A 3KEGA 3EPLA 1QC5B 4BN5A 2EKLA 1N2JA 1ZX1A 3ZHZA 4XYLA 2G5PA 2B2NA 2V7XA 3K53A 3S5JA 4B3GA 1UFRA 4L0DA 2BR3A 1U3CA 1ORRA 3F1KA 4YMWA 3GPLA 1T35A 1SKQA 4IEIA 4IDAA 3WNQA 3QWIA 3G8DA 2GK7A 3ROTA 1JWLA 2EOAA 2ZG6A 1LRJA 3C3AA 3I62A 5FHRA 4XARA 3UKOA 3M0EA 2V96A 4ARZA 2ECFA 3CTPA 4U2BA 5HGJA 1GKYA 2GO1A 2CCGA 2VFAA 4U0KA 4WBNA 1KO7A 4P0TA 2AEFA 4O3FA 5CCDA 4AZ3B 4UZSA 4TUYA 2LKCA 5BSGA 3D7SA 5ALDA 1CRPA 3TQTA 1VC2A 5F5LA 1L4GA 1JFTA 5EP1A 1MT3A 3R4VA 8MHTA 5ADWA 3IUEA 4IOMA 3CWQA 5JDIA 4K6HA 2MSKA 1LB1B 1T1JA 3JQRA 3QU7A 5T4BA 2OBNA 2F55A 3TW6A 3DO6A 2WVGA 1Z6TA 4LBWA 4WKGA 4EGCB 5HKOA 1NW7A 1OVGA 1XCPA 1RYFA 3CG4A 3PP8A 4LW8A 4PXAA 1OI2A 3WGKA 1AMUA 5BN3B 5G1PA 4H6XA 4QFBA 4B2IA 4DREA 2Z0MA 3K0AB 3OJLA 4I99A 4S24A 4JSYA 3NKLA 5DWDA 3TD6A 3FVQA 4RKYA 3X1MA 4DLXA 4KXVA 3FG9A 1UCFA 3KLMX 3ANNA 1FBTA 4R8MA 4BNIA 4K88A 2QMOA 3UJ3X 3VHXB 1A69A 2WM8A 1XZFA 4CF6A 4EJ2A 1N2CA 1Z6YA 2XUDA 3KVRA 1P62B 3MN1A 1VSBA 3QE3A 4CN9A 1WZIA 2F7SA 2D1TA 3OTHA 1YS4A 3SD7A 3UJNA 5IP5A 5JI3E 4DSNA 2PRYA 4QYTA 3ZLVA 3STYA 2H2WA 4PANA 1ZEJA 3CQ9A 4QX6A 1ODTC 2ZIFA 3KOUA 1WLYA 3CT4A 4FN5A 4RLFA 4D56A 2QVGA 4YWJA 1U1GA 1O4WA 1V9LA 2MIIA 3D2BA 1HRKA 3RRFA 5DHAA 4A15A 3LUHA 4DC9A 2OA0A 5IT4A 3B2QA 4TKVB 2HXSA 3JXEA 1NMXA 4XFJA 3RFXA 4CNBA 3BG5A 2CB9A 4RJKA 2I5PO 1IXYA 1D2NA 1O96A 1VB3A 4IH9A 4PZDA 5F73A 3K09A 1MFPA 2JIRA 3L7KA 4OHYA 1TCUA 3RFFA 3RIMA 2CFOA 2CXXA 2H85A 4NTZA 5IKPA 1UL1X 2R6HA 1Z6PA 3SHOA 3OWOA 1YKGA 2C9YA 4NONA 5JXWA 2HEGA 4L8WB 2PMDA 3RAPR 1ONNA 3U3XA 4Y6QA 5A4MS 3ADDA 1VKJA 3SBXA 4B8ZA 1HE1C 2J5KA 3IPRA 1MEJA 3RC1A 1C0IA 2H4FA 3U37A 3T99A 3OC6A 5IPFA 1NJSA 1OD6A 1B74A 2PL9A 1RHMA 1L4YA 2NZ2A 1QHYA 1X8LA 1YQEA 3GG2A 4DYVA 4EFDA 4QBTA 4Z86A 3EGVA 4I9NA 3FROA 4WGGA 3ZLJA 3GO4A 3Q40A 4DRXA 3HRKA 1POXA 2H1FA 1WDMA 1OFHA 5HA5A 5IM5A 2CBXA 4P35A 4QXOA 2OXTA 1YHYA 3UVEA 1SVLA 3ABZA 3HWX1 1UC4B 4H0NA 4O2AF 2YTZA 4H35A 5CH3A 4ZOLF 1HG1A 2FR1A 5DI9A 3OP4A 3KV3O 4ZYZA 2GWHA 3O9ZA 2HK8A 2IU3A 1JQEA 1U5AA 5HZHA 1HXHA 1YU9A 1JLLA 3DDWA 3H8SA 4BNDB 1Y6RA 4QUAA 2WLSA 5TC4A 4K9QA 1C9NA 5AO9A 2ZK7A 1PS9A 3U0BA 3WWYA 3WKDA 3SYKA 1YR1A 2FZWA 3RVOA 3B5EA 1IN5A 1M0TA 3LGSA 1XAJA 3VPBA 2WHYA 3FUXA 3LLMA 3QVWA 3RS9A 3RRBA 4D4LA 2GILA 2VRWA 4J1QA 5C4GB 3D4BA 1SOVA 2QT1A 2GA8A 4JOBA 3VR4H 3ZWVA 1OH7A 3BGWA 4UBIA 3M4ZA 3NUQA 4ER6A 2CGEA 4WNAA 3DPSA 3PQ6A 4L5AA 3TLGB 1AQLA 1XXHE 3U7HB 5IFKA 3ZWOA 3KSMA 5F7ZA 1HDZA 2KBFA 2ZBEA 5BNIA 3AR9A 4Y1GA 3IR6A 2B4YA 1MO6A 2HMAA 2XEXA 2R751 2B7LA 3DUFA 3UMSA 1G5TA 2C3MA 5DMHA 5THXA 3RVQA 3SC2A 4ATNA 3RQSA 1XRJA 1ZMRA 2DM6A 1GVHA 4BEWA 4ZDKA 4X1KB 1Z37A 3FFXA 3GEEA 1ONPA 3LXMA 1XHLA 4JUAA 1T24A 2XXAB 1NMQA 3K0CC 1N4DA 2Y0DA 5FUMA 2UUCB 1YOVB 1JG1A 3GMIA 1ESEA 4BX9A 1MG5A 1XJ0A 4RSGA 4B46A 1M75A 4HQLA 2IHUA 1QRTA 1YVPA 1YFLA 5B53A 2E2WA 2YJ4A 1CF9A 5FLYA 1B8UA 4DSOA 2RI1A 3BWVA 1T6ZA 2QG4A 1QTIA 4ZJYA 3FVRA 4TOIA 5I9MA 3K70D 1DRJA 3OCZA 2D4HA 3W2HA 4E4TA 3BX1A 2H7VA 2ZBFA 1I30A 3AUUA 3EIWA 4X0EA 5KOYA 4GI7A 2PJDA 1LW7A 1JSCA 3MOSA 4NP6A 1VDZA 2G9UA 3UJPA 4GZ6A 2AOVA 2A1TR 2IYWA 3FPFA 2DG2A 4MHOA 2CF6A 4EA8A 1B8NA 3FBTA 3T7DA 5A7GA 3UZUA 4C43A 2ASEA 2D00A 2G63A 2ZWMA 2YUTA 2IUUA 4LV6A 1HT1E 2BGTA 2VUTA 2NSYA 2WJIA 2ZYRA 4A26A 1ACLA 3A6PC 3A6EA 1XTIA 1PFKA 5D3MA 3SN6A 4AJIA 3AP2A 1CZNA 1LK5A 2BUAA 3RIGA 1RQRA 3OFVA 3FYCA 4OGWA 2HKIA 1L2TA 4AG6A 4AO7A 2A1UA 1WXHA 4JEUA 3H05A 2E37A 3CKLA 1QMPA 4RTPA 2UKDA 1JJ7A 4G5FA 1OE0A 1Q0RA 1W6UA 2OD2A 1ZSNA 3GNLA 4TLMB 1DAKA 1NUTA 1W1WA 1C29B 1ZXBA 4IDEA 3ANTA 4LBZA 4CM9D 1E9DA 3MSCA 3U40A 1WEHA 1U6JA 1P2SA 1E6KA 3PNKA 4B2LA 1I6KA 3ESYA 1OX4A 5CW1A 2GYYA 3GEIA 2ILTA 4YRDA 2ZSEA 3Q6NA 5CYFA 4MDFA 2O2GA 2ONZA 1CE8A 3PRYA 3SXUB 1J2TA 4LF8B 3H2KA 1DKMA 1W73A 2XNSA 4FFNA 4NAHA 3G7UA 3S29A 1QB7A 3L7CA 4MAMA 3OOEA 5ALOA 1PGNA 5K4AA 1RM4A 5DNAA 3ER8A 3GWZA 4TL8A 3EY9A 3ZVMA 1C50A 3A2KA 4PO3X 3FWYA 4WNIA 2E0IA 2O2HA 2YZMA 2I2WA 2XITA 3A0RB 3S8MA 5CIYA 2WMOB 1NR1A 4ITRC 4C5CA 3P4UA 2H31A 4C5BA 1R88A 4PZPA 4D82A 3SHQA 3V00A 4B2YA 2M32A 1QYCA 2BFFB 5FUWA 4RPCA 4DCSA 2AJTA 4FMDB 1E9CA 2ZXFA 5FAKA 1V1JA 3OAAD 1XZHA 5A9RA 1YHZA 3ABSB 4FE7A 4YJFB 4HZIA 3ZH2A 2XTZA 1ZOIA 5E7MA 3HV0A 4CF4A 5B7PA 5I7FA 1EFRD 5KSWB 3OPYI 2WAMA 1LBHA 2E1PA 4JEHA 3EZ2A 1V45E 3I3OA 4G67A 4E0BA 2MINA 1YB4A 3LO5A 3KAPA 3X3HA 2NW6A 1NXXA 1VMIA 3DR3A 1V2HE 2JCYA 3QOFA 4OAOA 3SK0A 2IXGA 3NORA 1LH0A 2BAGA 2IP4A 1F8XA 5ABPA 2GN8A 4NH0A 3N2GB 4KVZA 3S28A 5JYDA 5KYKA 2VS1A 2J07A 1H2WA 4UW9A 1UJ5A 3U16A 4FMBB 3PF9A 1SOMA 5I7RA 4V38A 2PUDA 2ZUEA 2QX9A 4TS9A 4G5YA 2VDPB 4XYEA 1TJ3A 2R00C 3F4BA 3UB4A 3SWWA 1FTWA 2ACVA 5HBGA 3VYWA 3GT3A 2CJWA 1PS8A 2Q5JA 1CW2B 1JDUA 3OLCX 3OO1A 4PLPA 3A1NA 2E5WA 1T2FA 5TS3A 1F8GA 1G8MA 3W9UA 1D4ZA 1GPBA 1SB9A 3DLAA 3E22B 3L4BA 4Y8VA 3RIHA 4B6PA 4U1RA 2ZB7A 3D2LA 2YV1A 3Q0IA 2VVTA 2FPIB 1I7PA 3O26A 2RG1A 2OO5A 3LWZA 1OTXA 1P8JA 3HN6A 4IUCS 3IUBA 5AW7A 2K7FA 3GGCA 1C8VB 4JHXA 3IJEB 4GFDA 3FZNA 3P2OA 1HE5A 1QF9A 3TJRA 2B8TA 3LU1A 5EXTA 3U19A 1DX4A 2TMGA 5C81A 2C7OA 1X1CA 3KQUA 5K0TA 2XUQA 1NVBA 2QAGA 4YQFA 3DL0A 4D3DA 4C0BA 1JIKA 2YOFA 4QICA 3NUGA 5BR4A 1IHUA 2W90A 3VR2D 3OWXA 3ZY3A 1ZU5A 1Z6XA 2HA5A 3WNZA 4ESHA 3V6LA 1WVIA 2JGRA 2UUBB 4PYNA 4DY6A 3EA0A 1G5IA 5K0JA 4ZHQB 3VPHA 4TWAA 4H0CA 1NJ2A 4IWNA 3GLIB 2IOYA 1DOHA 4CG2A 5CBPB 4J4TA 5AK5A 2G9VA 3JY6A 1CD5A 1UPUA 1R4NA 2BFDA 3WTBA 3VH2A 1AK9A 3BCSA 3DNMA 4NABA 2QZJA 3PITA 3U1TA 4ZZ1A 2MMGA 4K81B 1S9DA 2JEOA 1TF5A 2CLLB 2ZOSA 3HBNA 3Q5GA 1R6XA 4I4IA 1BOOA 3GXOA 4RVSA 3VXKA 2XODA 4Q3CA 1NBME 4PSAA 4HN2A 1GOTA 1UBCA 2WPDA 1KETA 4I5EA 3R2JA 1IVYA 1P6XA 2GPNA 4RH0A 2HR1A 1ZMOA 2PRJA 2CNKA 3LY9A 4WESB 5ALTA 2Z1MA 1XVTA 1Z6GA 4YJDA 1O95C 3GGGA 1ECPA 1H2XA 1HT3A 2A7QA 1O3YA 1ZI9A 2K2QB 3KJNA 4LCEA 1G291 1UZMA 4RXMA 3V1NA 3M8KA 2R62A 4C30A 1ZDMA 1A82A 3O4RA 1P7CA 3L4SO 3KIPA 4M53A 5E6UB 3SEQA 3T6KA 4YO8A 4BVHA 3U5ZB 1KE1A 2C0CA 3AG5A 1VBMA 1KFCB 5DM0A 4F60A 2VJOA 3OJXA 4C3UA 2BFBB 3WGOA 1JDTA 1FFXA 3CH4B 2OZEA 3N2KB 1QYRA 4JYAB 1KYIA 3V8BA 1W52X 1NYRA 4YK7A 5JQGA 3X1YA 4G0YA 1KF0A 4OH7A 4G86A 5CDUA 2FZLA 2CZGA 2XDQA 5DXJA 1KDRA 4UTRA 1QP7A 2Y1WA 4B48A 3VTFA 4PQFA 1BG6A 1UBEA 2RGAA 4PBSA 3PPYA 3I92A 4BP8A 5F9FA 4YAWA 3RYIA 3AEQA 4KG7A 1T9DA 3WFZA 3GLHE 3QYPA 1NXPA 2IOQA 1HTBA 1NVMB 2YWGA 2ZSJA 4AKHA 3DXXA 2XB4A 1MPTA 1XHEA 3VKVA 2WYHA 4LYHA 4KWTA 1LRKA 2X0DA 3WK7A 2N1MA 4G0NA 1N2OA 3KKPA 3K72B 5CIWA 4DV6B 1KGDA 2OO7A 3PK0A 2C95A 3LV8A 4GZLA 1Z7YA 3UT6A 3L06A 2XTMA 3JALA 2CLOB 1YR9A 1DAIA 2J9FB 3R3ZA 4IXWA 4AWXA 1PQ4A 4FDAA 1K68A 3FVTA 1N0WA 4K86A 1N2EA 2B6HA 5BNFA 5FBKA 3CUUA 4RZ3A 5LR6A 3AR3A 1BCSB 5FDFA 2I2XB 3I0NA 3WDLA 1BKDR 3SNHA 5JC8A 2BELA 2QMQA 4E11A 4W9RA 3CGGA 3SQDA 2ISQA 4ND3A 4DM4A 4MA0A 2Q4BA 1OX5A 4Y2HA 4LK2A 1VG8A 4XPIB 5DVZA 2GDJA 3BMCA 3DMRA 3BAZA 4LY6A 3ZW9A 4C0JA 1ENPA 3ZNOA 1I1NA 1ECBA 3CH6A 1DLIA 2A0FA 1J4AA 1JFRA 1IY9A 4EKDA 5EIBC 2ERCA 4J7CA 5AK0A 4WK0B 1UDWA 2BJWA 4NBVA 3H87A 4X1YB 1XKQA 2OQRA 4XX0A 2JC3A 1G2PA 3IMGA 3DBLA 3FIJA 3ZYCA 3GLVA 1X3LA 2G8NA 3HV2A 2C61A 4G8JA 3T5TA 5LQNA 1V35A 5FBQB 4DXAA 1AKYA 1XDBA 1E7RA 4EQ6B 1G16A 4OQ4A 4AY6A 2I62A 4I46A 5JAIA 4NYMR 5CYGA 3AIKA 4OB6A 3G5MA 3LY7A 4E5SA 5K03A 4EARA 2V54A 4C2AA 5H8WA 5E1BA 5MF6A 3IAEA 3P4YA 4BN4A 3I39X 3MA0A 3OX4A 4TXMA 1KMNA 3UWOA 4CQLB 5HRUA 1D2HA 5FNZA 5IM4F 1U9JA 2WWTA 4MR8A 3TEFA 3OCXA 2OCAA 1ODCA 4BIIA 2NSHA 2O52A 3CPEA 1J25A 2N42A 2O14A 2WF6A 3EWIA 3H2HA 4JJ8A 4OHMA 4INAA 4HUQB 5EJ9A 1NMYA 1RQ2A 1FMFA 4P9NA 4K87A 2IX9A 4EEZA 3MBIA 2X42A 2NTYC 3B1KA 3KTOA 2Z30A 3EUAA 3NBMA 1U2GA 2VJCA 1DO2A 2ZIGA 3A10A 3UQYS 3C4JA 1XTSA 3PIDA 4R6WA 2Y0BA 3AF3A 1DMRA 1JG4A 2H63A 3LHFA 5EKXA 4ZAXA 5H81A 5CFMA 8ADHA 3OY7A 3I09A 2YYSA 1E3EA 3O8OB 1WUJS 4ZRMA 4KACA 1DIOB 4BATA 4NVRA 1CY2A 2QZSA 3JAWA 2J3QA 3MFYA 3OM9A 2R66A 5FR1A 5FIUA 3ZY2A 1ZBQA 1JFFB 4B2PA 3PSAA 2AZ4A 4B47A 4AP9A 1Z45A 2CCKA 4LDQA 4FGSA 4ZDWA 4CT4B 3NCHA 3GP3A 2GETA 1SBQA 2O2SA 3WLHA 4BKQA 1DADA 3FI0A 4LNUB 4XFKA 4B3IA 2CNDA 4G0ZA 3PBKA 2NO5A 1ZW6A 3ZE0B 4BP9A 4D6YA 4DWJA 3THXB 4G0WA 3R41A 1H6BA 4RCZA 4PG8A 1TZ2A 2XNDA 5G0WA 3WWZA 1KZ1A 3RSOA 4BQNA 2JS7A 4ZCRA 3BDVA 3U6BA 5FLEX 1Q1AA 5LQAA 4RTOA 2D1QA 4G1MB 1DUSA 3CEMA 1SK9A 3BFVA 4E08A 4AZ3A 1U7ZA 1PYDA 1W36D 3AY7A 1SEPA 2HQRA 5AM1A 3DD5A 3LI2A 4OK3A 5H3CA 1I0ZA 2PQ0A 2ZI6A 1C7RA 3ETHA 4LZOA 4O1IA 5JBQA 2Z6AA 2BP7B 1MIOA 4F2GA 1QVVA 4I4TB 4KYUA 3ZWAA 5DYGA 4B31A 4DEVA 2ZR7A 4FCCA 3TKLA 3B1YA 4ZVPA 2JFNA 3N87A 1NG9A 4M1ZA 2Q9BA 1VIYA 1XHFA 3LFHA 3QYAA 4DM7A 1S6YA 2J45A 3ZHUA 5C7OO 4KL8S 1T8PA 1N8SA 1WY5A 2C1ZA 4MIOA 1EVYA 1K92A 1P1JA 1Q0LA 1OFVA 2ZI5A 3O4JA 1VRCA 3NHAA 4JBGA 4KXWA 3AM1A 2PX3A 5LA6F 3HA5A 5KWVA 1E9RA 1RHUA 3ZJVA 3QVKA 4JT2A 3QE2A 1C9EA 4IYJA 1XDSA 4OI2A 5E6RB 2APJA 1DELA 2Q6KA 4MUBA 4NV0A 3AVWA 2Y0CA 2NO6A 1PX0A 2GM9A 1AKWA 1QGYA 1ZH4A 4X20A 5H83A 3D4PA 4GXRA 2AH5A 4EHNA 4XASA 4TGLA 2V9ZA 1N57A 3WL7A 1XLUA 1VSTA 1MABA 3TSWA 3HXKA 1UK8A 4RKRA 3NGLA 3CZRA 4XIFA 1Y48E 5M7EA 3S1AA 3A4TA 4I81A 4XTRA 3VHRA 4O4IB 2F3TA 5AKYA 3FCXA 1DP4A 3PA8A 2E18A 4X6UA 1QZ3A 1EINA 2ONCA 4MS4B 4RJJA 3TZBA 5JBNA 4Q9KA 5H3LA 1MX9A 3NAGA 2QUZA 2P9EA 4RL6A 1XCGB 5EP2A 4B3BA 1E0KA 3LUAA 4DTIA 1NQTA 2FWJA 2JGDA 1L4UA 2JANA 1DQZA 4QYXA 1LF5A 3FJ1A 3I9OA 1BFUA 4MPJA 2ZBGA 1JXAA 3H9GA 3NWJA 4NJEA 4YAEA 2CVQA 3ICCA 5B37A 1T0HB 2PX8A 4IHJF 3RTGA 1TT5B 5LM3A 2P27A 1V5WA 2NLOA 4GX5A 1ECJA 3D6NB 5CTAA 1KZHA 3N3BC 4G23A 3SC4A 2X9VA 4ZHSA 3MGCA 3LA6A 1AB6A 6YASA 4OQYA 4DIMA 1IZ8A 1USVA 2VZLA 3FJYA 4ZI2A 3CJQA 3QMWA 4UASA 4DPLA 4NMWA 1XF9A 2QTVA 1P8AA 1VJDA 4J43A 3BIFA 1IQ0A 3ZLTA 4DZTA 4MQLA 3ROZA 4CL3A 3CM0A 3U31A 2HDNB 2KB0A 1DG9A 4O59O 1ZHHA 1TYCA 1WB5A 1CEYA 3RVLA 1ZXLA 2V55B 1N34B 1B3BA 1H23A 1H0KA 1ENZA 2UZ0A 4MS3B 2HA6A 5LSAA 3B89A 4XJTA 2HCRA 3BJRA 2HXGA 3D2AA 3GBVA 5CDYA 4YR7A 1RP7A 1T2NA 3WNCA 4IMRA 4J0HA 4ENTA 3NETA 3AESB 2Q2WA 3E9DA 4QTZA 4RSRA 3EOAI 1JDBB 4U7PB 3VISA 1BMQA 1DIHA 3VMFA 2HJHA 3M9WA 4OH1A 1JHZA 2Z6QA 4GYJA 4AJOA 5K3EA 2EATA 2Q8PA 3QVLA 4ZZ0A 1JFVA 3G7SA 3SC3A 1GPNA 3L0ZA 3WKBA 4KK4A 3DF9A 4UAGA 4P7GA 2OBYA 4MCJA 3VNBA 5LUBA 5KYWB 1LVUA 4L9WA 3UUEA 1VP9A 3KOOA 2QRVB 3CZQA 4R84A 3TLGA 1DQRA 3L4KA 4J2TA 4ZEMA 2RGXA 2C3YA 1VG9B 4DR5B 1O6GA 3F5MA 4HAIA 3W1WA 1VZ3A 2GBIA 2CKDA 1GCIA 2OUKA 2FN9A 4TYYA 5CDSA 1NU8A 3IPYA 1ULSA 2GNOA 4IICA 4BNKA 1VE3A 1UM8A 2ZT6A 3HVKA 2HMYB 1Z0ZA 4C4AA 1MP0A 4N48A 1EM8A 2IEGA 5A4IS 3KJGA 1SPBS 3IP9A 2OPBA 3F7NA 4Z53A 4QGAA 4DCCA 4IIJF 2Q6VA 4KHZA 1RJGA 3SX0A 3HLYA 2DYKA 3EQ8A 3HUDA 3P2JA 3S2YA 1PI3A 3OQ6A 5C8VA 1HUQA 1N1GA 2JJ2D 4ZQBA 1LCIA 1Z83A 1XYYA 4LVOA 3HSSA 2CZQA 3HBLA 1RWMA 1I9GA 2IUTA 3O4GA 3Q9SA 1OZAA 4J7XA 2EIXA 1BDBA 3W5IA 3T0FA 1ISPA 1AGXA 1VMDA 1G8HA 2ZJ2A 1HORA 3EIQA 4EJSB 5GADl 1OU0A 3EIUA 3PQ8A 1I7QB 4DCMA 2FMUA 3LDAA 3O8CA 3H65A 3PC2A 3JS5A 4K6OA 4BNNA 3KB1A 1TKAA 1VXOA 4OLFA 3OQMA 1W4LA 2WEKA 4IJMA 3ZEIA 1H0SA 2XAUA 1WSBA 3W7VA 4MUHA 5JWOA 1NURA 2B82A 2MOKA 3CX7A 2H2HA 2YCBA 2QRZA 4RTQA 2O5CA 2AMFA 1YS1X 3MBKA 4IDFA 1GNQA 1XMQB 2IYYA 1FYDA 2QW1A 4H1HA 2GBPA 1OKKD 4F4CA 3D8SA 3BGOS 4QBHA 1GLGA 2I7VA 1X42A 3DS8A 4YJHB 4EDHA 4QPDA 1CFZA 3AO0B 4HMQA 2LE0A 3PNPA 2KWIA 4CLOB 4DVGA 4N7RA 4Z3DA 4W6QA 3KD2A 3VI4B 2ODEA 5DTQA 5FJJA 10MHA 1VJCA 4PZLA 4AZTA 1Y89A 3SIRA 1ZJ5A 4IDNA 1AQYA 3ZR4B 1ZIYA 3WB1A 2PKQP 1G6KA 3K1AB 2A33A 1KFJB 3GRAA 3OLWA 1P7PA 2VP6A 3PX3A 2W2XA 4XYGA 1GUYA 5FB3A 2YYZA 4XQ9A 2ZSFA 4Y6SA 5LQCA 2VJMA 1KPGA 2AOXA 2G1AA 5G41A 1RBYA 3IXMA 1YB5A 1VRWA 4PU0A 3FBGA 4YX9A 2W4QA 3ZHXA 4DLKA 1OV4A 1EP3B 1GP2A 4XIGS 5JOQA 4FGWA 3UWPA 3O83A 4YV0A 3U56A 1F51E 3WGVA 1PSDA 3AR6A 3GFGA 3Q2IA 1MPXA 2AOWA 2P0YA 3WGQA 3WMRA 2P2ZA 3CPJB 4JLOA 3IEMA 1GTSA 4GBJA 3L7AA 4UXJA 1GPKA 1TJ5A 4Y2VA 4KPEC 1JJAA 1U9YA 2C20A 2PZ8A 4I1VA 1W5SA 4NBWA 5EGSA 2NZYA 1B43A 1H0RA 2C2HA 2AMYA 2QUBA 1XEXA 4GBMA 4BCCA 2GBLA 1E2DA 3V80A 3QJGA 1HE4A 1YULA 1ZWLA 3M83A 4EZEA 3HNOA 4RJ2A 2AEMA 2IHNA 5G2OA 3GFOA 2GZMA 2QPLA 4EX6A 2P0AA 3WGLA 2H6EA 1ORWA 2VK2A 5KX5F 1CR6A 1DGQA 1BWPA 3M6UA 4AMVA 5IAOA 4P4SA 1M6WA 4W7HA 2VH5R 2IGBA 3NNNA 1FOEB 3G2KA 1P2GA 3GA7A 2VNJA 4LZWA 4P33A 5CTJA 5F51A 1DBPA 1LPPA 2GZRA 2IIBA 1R37A 2NIPA 3FUWA 1JEQB 3FMGA 4G1BA 2HMUA 1D1SA 3W8NA 1L6RA 1YBMA 3NXKA 4N40A 1JZQA 2JJYA 4MVJA 5HTOA 1OWPA 2NPIA 1IBCA 2QW0X 4BMXA 1YA6A 2FXVA 2HCTA 4RYLA 1MN6A 2P79A 3ND9A 2AYZA 4EYQA 4N0PA 4NYJR 1EXVA 4N39A 2QUIA 3CEJA 3HZOA 4P98A 2IIVA 4FPXA 5B1SA 2NUAB 4QTXA 5AVJA 4ERNA 2PE5A 4EX7A 5EIAA 2IGTA 3G8YA 1ZKDA 1OMOA 4RXTA 1IQRA 4B71A 2C2KA 2ST1A 3UGKA 4MRSA 4OEHA 4PAOA 1F6DA 5EJFA 4MLDA 3J80A 3ZNQA 5J5VA 2WJHA 1QK3A 4RL4A 4MCHA 3CV3A 1ZGAA 1O9HA 1I4EB 1Y5IA 2OTCA 3EVTA 1P73A 2XWJI 4KWIA 2C4NA 2JI4A 1J99A 4X8OA 3WL8A 4CV3A 5DCUA 2Y27A 3MRSA 2XSZA 3TS1A 1C1YA 1W44A 2FWRA 3DE7X 2GCOB 3I2FA 5EGNA 2WOJA 4D4MA 3VKGA 4AC9A 3KPYA 1JDPA 4UHKA 4C7VA 1QH8B 2NAPA 5LUAA 1XMOB 3QU9A 2B3DA 3ZKAA 3WISA 4HEJA 3ZW7A 2EAUA 3PRKE 1X1BA 4FFWA 4YP9A 1DJQA 5KB3A 5JCOC 3NVAA 5FKJA 1J2UA 2OKCA 4JYZA 3C74A 3AFHA 2HA3A 3S5UA 4J0CA 2PGDA 4RPGA 5H70A 2FE4A 2H57A 3HJUA 1CYDA 2D5BA 3I04A 3OQIB 2R87A 4NICA 4WFJA 3EE6A 1FDWA 2FY8A 1LKZA 2ZJYA 3THWB 3OX1A 1N5RA 1E7QA 3NHJA 4YBZA 5JAHA 3GNTA 4H7DA 2XUOA 4HAYA 2VYND 4X95A 4QM6A 1GQ2A 3I5XA 1AQIA 1SUIA 3G2NA 2B34A 3HEAA 3NVMB 4GVXA 5FNVF 5FUYA 4B40A 1M34A 1DIAA 2QR5A 3TW0A 4BQSA 3CNNA 4EQZA 3A9WA 1MHTA 3KKNA 3UWSA 2CNNA 4DR6B 3DQZA 1M6YA 2V8OA 2HQ1A 2G1PA 1GL3A 3D6UA 4MV4A 4WESA 5AI4A 1Z9BA 3WVNA 3MHPA 1N7IA 2VRCD 4U6SA 3JTMA 2DCMA 2QGNA 3N7TA 4IGEA 4UTOA 5BV1A 1A5BB 2XNDD 4N8EA 4OGKA 2ODWA 3IBCA 2V7QD 3NRBA 4RVUA 5CGZA 3T15A 2VK4A 3I30X 3EXIB 3OEEA 5FL7D 2FWPA 2VQDA 2WU1A 3H5AA 2F9MA 2JFQA 2WIKA 3O3MB 3ZI7A 2DX7A 2BFBA 1H8EA 2A5LA 5BN4B 4C88A 1CJVC 2JCBA 2O9JA 1ADJA 3I5MA 4O8CA 3AFMA 3MCVA 4TS4A 1U3UA 3W7BA 5ALLA 1RXYA 4M76B 4F5WA 4F2WA 5J2TF 3ZGZA 2ANCA 3WYDA 3HBMA 2CSXA 1M1YA 2NUBA 4MGZR 1SUBA 2WZDA 3O8NA 5TMBA 1M8PA 4IDDA 4QUBA 5C7YA 3ICVA 1DQYA 2OYSA 5BOSA 5IS2A 1D2GA 2HY7A 4AKIA 3JVIA 1P2TA 4HQ6A 3T3DA 1UBLS 1W5BA 3Q8LA 1SH7A 5JH7B 4KMSA 5EZ5A 3QKUA 3WTCA 4ABTA 4D9NA 2HDHA 1EFCA 2L69A 3BBPA 3DGFC 5CURA 3RJ5A 1A7AA 1XD2B 4EG1A 2P9ZA 3M1IA 1ONBA 1U31A 4MK4A 4CTNA 5EXEA 4Q03A 2BMWA 4XQGA 2DFPA 2OR3A 4TPKA 2XWPA 2OHFA 3LIPA 2LDBA 2Z5GA 2DZDA 1NPYA 1ZNZA 7REQB 3TVYA 4LDRA 3ECSA 3PR3A 2JCVA 1KY3A 3F6RA 2QJWA 2YXPX 3COYA 3PEFA 1JVSA 2SKEA 3KS9A 3M1LA 3S40A 4BVAA 4XOUA 4F8JA 4JYBA 2ZS9A 4M9RA 3QHQA 4E2ZA 2HRCA 3I1JA 3KP1A 3P19A 4XVRA 3U9SA 3ETCA 3DD1A 2Q3MA 4BHTA 1W85A 3JZIA 3K1TA 4ZVOA 1UADA 2ZYTX 1WAMA 2ZB2A 3BULA 4G5GA 4LVCA 1XDDA 4DLAA 2WKSA 5ESWA 4JLPA 4RUKA 4GZMA 4PSCA 1YB6A 3FDZA 2PH3A 4NY1A 4IJ5A 4N3AA 5TIIA 1BN6A 1K3FA 3GGJA 2P77A 1OFUX 2W6PA 4CEJB 4ZZ3A 1A4XA 4F86A 2PR7A 3FTEA 1NAHA 5P21A 3CNLA 1QANA 4HZUB 1V11B 4IVNA 4C6TB 1MUUA 3E9CA 1C7IA 2QV7A 3CR8A 4XE5A 4C7OB 3ZD6A 3HNPA 4NATA 1D0VA 2ZIEA 3MRXA 2H1OA 1M8KA 3K9BA 3LCJA 4JJ4A 3G2MA 1YNOA 2ZI9A 2I1WA 4GWLA 2F1IA 1V3UA 1W2HA 4LRQA 1GXSB 2HPVA 4TT8A 2WC1A 2WM2A 2PRKA 2V7UA 4C6SA 3GCZA 1UOPA 4EQ6A 1YCGA 4MWGA 4I6GA 5KOJA 5HK9A 1YZLA 3T1NA 3QHAA 1OCEA 4MQ4A 4BNFA 3HJGA 1L3IA 4NEGA 1WU8A 1VCHA 1RXWA 1OH8A 2H4WA 4YFYA 1G9TA 4INJA 3QPBA 2JLZA 3GZNB 2Z2KA 2Q2OA 1XO1A 2XRYA 1I2AA 3DWFA 1Y7LA 1HETA 5LP6A 3UK7A 4AROA 4JV5B 5KJ6A 1SQFA 1JEOA 1VFPA 1DV1A 1QHEA 4Z0HO 3CX8A 4EPYA 1EWYA 1KTIA 2FW1A 1G3MA 2W71A 3H0EA 1CTQA 4A36A 5D87A 4HDKA 1CIJA 2YY7A 1AQNA 3PJFA 1P9OA 3DOUA 1C81A 1EGMB 1O97C 3ES9A 1WQ4A 4HUQA 2ERYA 2VPPA 1JP7A 4F7WA 2INGX 2QD5A 3RD5A 1AV6A 3HVJA 2VBGA 4R41A 4FW9A 2FKAA 3BGDA 3ZD7A 2EW2A 3LQRA 1UXOA 3ESQA 1SBCA 3ICPA 1F12A 2X0KA 2H07A 1TAHA 1ULHA 5FJIA 2M6LA 3MMSA 4N6OA 4CFZA 2YW2A 4HNAA 3VKUA 2PM8A 3CURA 3Q15C 4B6QA 5DDIP 3CVJA 1QG2A 5AJUA 3QFFA 3M4XA 3WL5A 1F2DA 3A11A 4FFBB 2TS1A 4GPD1 5IMSA 1E3WA 1RNLA 5EXPA 3LTNC 2X22A 1W1UA 3EGOA 1E63A 5AVVA 4M9QA 4X1OA 3S0JA 1TB4A 2ZWOA 3UV3A 2WJ3A 1WMBA 3IOBA 2D54A 4B6JA 1NJGA 4PV7A 3PCTA 2V9CA 3B53X 2YVLA 1XNHA 2HLNA 2EZTA 1JAYA 1VCMA 1RZVA 3HCFA 2M6RA 1USWA 4X84A 3TL6A 4BNGA 4CG3A 5A62A 4RK5A 2WZBA 3OEYA 2XAAA 3GARA 5D3KA 3QSYA 2ILVA 3UPUA 4O25A 4BLVA 1Z38A 4NCHA 2AQIA 2HV8A 4QUJA 3ADOA 1N6LA 4PO1A 4W5OA 2HJVA 2UVPB 3C6XA 2X1VA 4L4RA 3DWEX 3IQGX 1RC0A 3H1AA 2H9YA 2JIZA 1PGQA 5EPUA 2HC9A 3KTAB 3OKFA 1WHSB 3HYCA 3BYZA 5ICFA 3BOSA 2PX4A 4CE6A 5I7UA 2Z57A 3VX3A 4BY9E 4MRPA 3G2IA 1SN7A 2FW6A 1EM6A 2CHQA 5IX8A 1DJOA 1DBVO 1T3TA 5DTRA 4CUKA 1RQXA 4DB4A 1OSNA 4KEAA 1RBMA 3GGPA 4ON9A 3ZV7A 1R5NA 3BHIA 2O2XA 5AOBA 4FWIB 3M2PA 4RKFA 3LKBA 5T3YA 4OL9A 2C7RA 2DY1A 1SQ0A 2AFIE 2PZKA 1JR3A 5TMEA 1EZ1A 3UA4A 1CJBA 3OEWA 4EY7A 1JIVA 1G20B 3PXBA 4O4LB 3E3NA 2Q9CA 1ZGHA 3R3SA 2ZUCA 5E6RA 2CXTA 2XB8A 1FP2A 3FTFA 1D5WA 2CXOA 4WEOA 5K6AC 5T67A 2H2GA 3NWOA 1J7JA 3JASA 3JQ7B 4JB0A 3ZCTA 4Q34A 1UKEA 5ICEA 3QKWA 4UU0A 4J16A 5IT5A 1CUEA 2AD5A 3EPPA 5DM2A 4MHTA 1JA1A 4MUAA 3CZ9A 1T2VA 4ZPXA 3CF0A 3PHBE 4MVJP 3ZC3A 1I5EA 5ICGA 5ILGA 1MH9A 3I6ZA 1KK3A 3BXHA 4PIMA 3LW7A 1Z08A 3REQA 3MZ0A 5CCXA 3ETLA 4QYIA 1AGYA 3EQ7A 5AM2A 3Q3CA 1NOIA 1QGAA 3QX3A 3UENA 1GT6A 3VBEA 1ADFA 4AD8A 1VLMA 3KDPA 3SR0A 3VVCA 2Q5EA 3CZCA 2EG9A 4L15A 5A4KA 2XEDA 3SG0A 4NS1A 2QG6A 1Q1GA 4TVSA 3LCMA 5TPZD 3W0LB 5IXSA 3ACBA 1LXCA 1NKTA 3GDHA 2A84A 3IKJA 4NCKA 4ZVKA 1GM5A 4ARAA 2QIPA 2QMUA 4B1FA 2GLUA 1E94E 1BTOA 1NBIA 1XDUA 1H2YA 4OXQA 4HNTA 1BJRE 3TNYA 2NU9A 3WLEA 1BQEA 1EFVA 1F8UA 1TT5A 3NYIA 4HDMB 3TCXB 1RJWA 1RKQA 1QHXA 4UUOA 4DCPA 2YRXA 5G0VA 1A4UA 1AF7A 4AF6A 2Y1DA 2DHEA 4BNUA 1P60A 1ZH6A 3HMKA 1OFIA 1NXVA 3KOYA 4FNMA 4I8IA 1HURA 3ODGA 3S2ZA 5HRCA 5K0FA 2G4CA 2VBCA 2GHRA 3UHPA 2W2OA 4R7GA 4BAUA 1XIVA 3N70A 4B5KA 3D1VA 4BRWA 1DZ3A 3QW2A 1Y63A 3R23A 1JXMA 1W47A 5AJXA 1WO8A 1UEJA 3H1BA 3RS4A 2CCJA 3RREA 3QBEA 3P94A 1DINA 1COWA 4TKUA 1OT3A 2A0KA 2GN2A 2Y9MB 2X2OA 4IF4A 1XLWA 2EZ8A 1KEVA 4BWYA 3G2HA 3R6LA 4I4LA 2WIFA 3QLEA 3DTVB 4FGUA 4TL7A 3O1JC 3SCZA 3OLYA 4HATA 1NM5C 1WX1A 2B61A 5C4MA 3P9QA 3L8HA 3EXHA 4IWYA 4Z1MA 2BRUC 1L8LA 4FC7A 3P32A 4ZU1X 4D25A 1KHHA 4N5LA 2Y93A 1CJCA 4PQEA 1ZP6A 4U5QA 3M4YA 4K6KA 4NWIA 3E03A 2YJ3A 4OREX 3C15C 1BA3A 5I8ZA 4JI1B 4D46A 1LNQA 3DWGA 4E7PA 5KYWA 4QOIA 3F67A 3GPBA 3CHYA 4NIMA 2VQEB 1IOLA 5BMVB 1CY6A 4WAUA 2V6JA 3C16C 1PG2A 4GZ3A 4B8WA 3N76A 1ZH2A 1FNSA 1TF2A 5I7HA 5BSWA 4BRZA 3JWPA 1PZHA 1NASA 3PHLA 3RHZA 2HIGA 2HJGA 4MKIA 2R1UA 1OILA 5JR3A 2ZYHA 4ZI7F 2R1VB 3VO9A 2YWFA 3KBOA 4X8HA 1HMPA 4KOAA 1M6NA 3A2LA 1WV0A 3QNUA 4MR9A 4QBFA 5KYGA 1T2EA 1PWXA 2ZYWX 2ZANA 1GCUA 1P61B 3PGA1 3VSBA 3IOYA 1CS4C 3U48A 2WHXA 3WWDA 4YDHB 3ZU3A 1FL9A 1YD7A 3F49S 5CEEA 1E7WA 2HT6A 1A7KA 4EA7A 1BXRB 2WK1A 5K2OA 4G5OA 4GRAA 2GWRA 3R0ZA 2FSPA 3QF7A 3I6BA 4A6XA 1NN0A 2I67A 2P0EA 4CDMA 4YRSA 3UAGA 4Z3KA 2PSSA 1WXDA 3PUXA 1NRWA 5GONA 2PSFA 3V9PA 4E07A 1DWQA 1YJAA 4QNRA 1T9AA 4WK4B 1CUHA 1T26A 2XHZA 4LJ9A 3B1WA 4I4CA 1HTTA 3FBWA 2CMGA 5HM8A 4V0NA 4WZBE 3FHTA 1AKRA 3ERCA 1BDIA 1VL5A 2Q1TA 5BSVA 5C0OE 1G7TA 2PKQO 3IMFA 3RYCB 5AI8A 3VUEA 3VZSA 4LQCA 5F5XA 4IO0A 1J0CA 4MA5A 4L8GA 4HG2A 3OLQA 4CMAA 5KC8A 3UB3A 5T41A 4E5MA 3KWJA 4GVLA 2ZTHA 1FUYB 3O75A 4BZQA 1LTQA 1IJBA 3F3SA 2DCUA 2Z8ZA 5IC6A 1VPWA 4D79A 1WJGA 2R4UA 4MYSA 2DFKB 3AOEA 5E7JA 4MJLA 1JAHA 4I55A 2X23A 3QLTA 3TXAA 5ED4A 4RFLA 1B15A 4YP1A 4D8XA 2F8LA 3TQIA 4JC0A 4UQOA 1QZUA 4Q24A 3IMKA 1ES9A 1SJ9A 1JQDA 1T5SA 1OA0A 4KXMA 1IZYA 3MJCA 2QJFA 4TZ0A 4CTJA 4GO1A 3DZ8A 1UBKS 4TS1A 1N2SA 1UQRA 2P2NA 3CPSA 1PUXA 1KS2A 2QYSA 1R0RE 2ZJ6A 3E18A 3JV7A 4QXAA 1KBQA 4N9QA 4DQVA 1UOEA 4EG8A 1UBJS 4YRFA 1V1MB 2QS9A 2HYDA 1GILA 1H1LA 4K46A 2ODQA 1IRIA 1PQPA 4CDGA 5CFNA 1V7ZA 3PDIA 3GH3A 3C3PA 2TMDA 4EEXA 2BSAA 2OD9A 2QL7A 3I05A 3M3DA 5JISA 4YV1A 4HYEA 1JLHA 4CCWA 1V9SA 3TB4A 1OFGA 3N6XA 1FP7A 1RD4A 1WXQA 2NZUG 3UAXA 5BORA 4Q9JA 3LQ2A 3AVVA 3D0QA 4LOAA 2C7QA 3RS8A 2VATA 2IH5A 1HE2A 2A9RA 4NXNB 3QG1A 4GYYA 4QEZA 1SCKA 3GJ0A 4ID3A 5ILOA 4QPJC 3Q1LA 2XGJA 2HRQA 3GRPA 5H4HA 3G1WA 4PNPA 1V95A 1Q16A 1Q2XA 4YDQA 3NM5A 2QZ9A 3BBLA 4LZPA 4YRQA 1LS1A 3OIUA 2BI8A 1IDOA 4PINA 4WL0A 3F5FA 5AM0A 4Z2YA 3AVYA 1NLUA 4ES6A 5IASA 3DEIA 3G23A 4FOTA 2QNRA 3ENWA 4HGNA 1QG4A 1GAQA 1ATIA 2ECKA 4TM8A 1G18A 2DHQA 2QRKA 3LOQA 4Z4HA 3AR7A 1HA3A 2IDKA 3R0XA 4O08A 5LQJA 2Z98A 1OXMA 2GOYA 2HGSA 4DDMA 3SE7A 4Z4CA 3FYUA 4EJ6A 4H17A 2Y2VA 3N8HA 4NDNE 4L95C 3A1TA 5IC5A 1Z63A 3BN3A 1GARA 3N58A 1UJ4A 2C4TA 2WWRA 3ORRA 1EFUA 3PGKA 2P4QA 4OQPA 4MMYB 1WCXA 3T7JA 3WHKA 4CXMA 2YY6A 1A5SB 4PQGA 5IT9A 4REOA 2NYAA 5GTDA 5AM4A 4ISBA 2WFLB 4HQRA 3R5KA 3CR7A 5FF9A 4M4SA 3UWKA 4ZYYA 1FU7A 1Q17A 2DHRA 2Z83A 5TR9A 4TLDA 4AY5A 2IZ6A 3EXFA 2YWBA 4GMXA 2WB2A 2JLXA 1S02A 3S7TA 1O5OA 3E05A 4LKRA 4C89A 3B70A 4CF7A 1Z39A 2VTEA 4XEUA 1UIRA 1I4OA 5EUMA 4LRUA 5SZKB 1Z7EA 3LRXA 4JVMA 4EOGA 3HO1A 3A6FA 2WSYB 1KQ3A 3IAXA 4UHFA 1NBAA 4RE6A 1TUEA 2VSFA 4H7HA 5GMOA 3SKVA 3HCPA 4ZAYA 3ENVA 4DMKA 3PE6A 3BXEA 1ZI8A 3KKLA 4ZGGA 1ZZGA 2VRBA 2XKJE 3PC6A 1G60A 4LZNA 2ZJ0A 2PZFA 2IHTA 3HN2A 1RXCA 2DLDA 4RVGA 1FFCA 5ICSA 1W46A 3FMFA 3QX7A 3OQIA 1J1ZA 1GZ4A 1M0WA 1BVYF 1T9GR 2BFAA 2LCIA 3PNMA 2QE7D 3DAFA 2J3KA 4FFOA 1DBSA 3EDOA 3ND5A 3PGJA 2WWVD 2ZJ5A 4HMPA 5KWEA 3JD4A 2CZCA 1ZNWA 5IAAA 3B7WA 1CUXA 3TQRA 4BLSA 1IM8A 1PT9A 3BD8A 4M36A 4H7JA 4DIUA 1H3EA 3QFRA 4I8XA 3SZOA 1Y80A 1THZA 4B33A 1P1HA 2VLBA 2V4MA 2QTMA 1Q2UA 5JDIC 1PX2A 1VTKA 2ZJFA 1HFKA 2ZW9A 5IKOA 2VYVA 2XV1A 4LMPA 4MA4A 5JMTA 3EZLA 2W83A 1WP4A 2P5YA 5CNJA 4BFVA 2I8CA 1XKLA 4UU7A 4GZ5A 5IAGA 2GYVA 3ZCVA 2ZRIA 2P69A 4ZJPA 4B81A 3I2YX 1DPFA 4IDHA 1P4HA 2R7LA 1WBJB 1Z7GA 1LSUA 3IHTA 3GU3A 3MB8A 4B80A 7YASA 1SCUB 1Y4AE 5TX7A 3A26A 1W59A 2PKXA 4UCFA 2CE2X 5GGYA 3T0IA 3TZEA 3UGQA 3WBBA 3ZX4A 4IQ8A 2WQZA 4FTWA 2R8RA 1CUBA 3GP8A 5B12A 4ZT3A 2XGGA 1ZK0A 5CA0F 4JBNA 3A9SA 1GRRA 4F5EA 1TVKB 3D64A 4ZO9A 5DTIA 1H6DA 3I0ZA 3OF5A 4XW2A 5AUNB 2HLDA 2H5LA 4E31A 5AVYA 5JH7A 1P31A 4XRGA 4G37A 1YBFA 2BKVA 3WHLA 3RYFA 1CUYA 3HFJA 1VMAA 3NZEA 4D9KA 1XD2A 5D5HA 1ZJWA 2VJLA 6ABPA 4Z9AA 3AUFA 4C1NA 5HDQA 5BNWA 3DEZA 3LAWA 1P5RA 2GZ2A 3LCRA 5KTTA 1J8YF 5KVCA 4M1SA 1BDMA 3UTCA 3I8OA 3OT4A 5K0LA 3RLFA 1XQ6A 5LXTA 2ZSBA 1CF4A 4WLOA 1OZ0A 1IVSA 1C0KA 1YT5A 3OZGA 3K09C 1KVRA 4V1CB 5T8KA 3H1PA 2ID9A 1Q3KA 1ZITA 5A05A 1Y8RB 1HE8B 5CB4F 4MWCA 3TF5A 2ZSDA 1BMFA 1WR8A 3F97A 3TI9A 1OAOA 3L7IA 1ZJ6A 1ZCJA 5BYJA 3AIOA 4DJJA 4DGSA 1Q91A 3C5VA 4KC0A 2PXHA 1WDWB 3QE0A 3K05A 4I19A 1UMKA 3EGDB 4BMPB 4MUXA 2FUKA 2QN9A 2VT7A 4XIIA 4F1WA 1ZM7A 2IXEA 4B7AA 3KALA 1L5NA 3FUVA 1RXEA 4L75A 4M9UA 2HNKA 4EUEA 2E5LB 1QE0A 4WBXC 1STOA 3C87A 1SD2A 1R0BA 1RZRD 4KAFA 4MKXA 3TBFA 1PJQA 1DS6A 3C7KA 2XA1A 3P2MA 4G2NA 1MX3A 1CFJA 3EIXA 4H3KB 5BRNA 2MJLA 4LFCB 3Q72A 2DBYA 3O4VA 1B93A 3O3NB 2J3IA 3L82B 2AG5A 4MP6A 2PCJA 3GMDA 2CL5A 1YI1A 2B99A 2IZ5A 3KB6A 4IZHA 2B92A 1MQ8B 3L9WA 1MLDA 5IW8A 5KI6A 1G8PA 1WXWA 2YIDA 2A94A 2BVNA 3PNVA 2F6RA 4TTQA 2O7RA 3MWJA 1MAUA 3LO8A 1L3BA 3MTIA 1DX6A 2CLIB 2VI5A 3B2NA 4K40A 3N8IA 4QLAA 4WJLA 3UGJA 5JS6A 1KU6A 3K5WA 5G4LA 1QK5A 5AVOA 1COWD 2YVKA 1Z06A 3IQZA 3CIOA 4XUGB 1K6EA 2WZQA 3DL2A 1YDHA 3CSDA 2RHRA 4BEVA 4OU4A 3KQHA 4L6IA 3TQOA 3PE4A 1HZZC 3T3NA 2G9NA 3T3HA 3R3UA 2Q2NA 3EEFA 3MCUA 3MWDA 2E4VA 1Z35A 1NULA 3OOHA 1QPGA 1WUYA 3BCHA 2PMCA 3CH7A 4W7SA 5FWDA 2HSZA 4WXEA 5HNKA 1NMEA 2RHCA 1FQKA 4KIFA 4NESA 3WIUA 1TMGE 1NNSA 2HSEA 4QYSA 4XYMA 5CHEA 5LOVF 2VH2A 2FW9A 3S8YA 1KC3A 3DQQA 4J8PA 3IS3A 4K6FA 5F12A 4PCAA 5BT9A 4FM9A 1V7PC 4ER7A 3RSFA 2V3CC 4YROA 1JDVA 2QDKA 4ZC1A 2FMTA 3BXXA 3PKZA 1IHYA 3UFXB 3KJQA 1CUUA 4ALLA 4HB0A 4M9SA 4L74A 3T06B 4O3MA 4JX9A 1RE0A 3IV7A 1TL7C 1U04A 1D7AA 2OSBA 3OQVA 4JUCA 3VJLA 3KK0A 2CHUA 2IHZA 1XDGA 3EG9B 5ALKA 5GAJA 1ISJA 4FQ8A 3L77A 2LTAA 3ZDAA 4L8LA 2XLCA 2WF7A 3RGWS 4HXFB 4EHAA 1TOAA 1E3IA 3ESXA 5SZIA 5CITA 3WSTA 1W36C 4WCFA 3STHA 3HKBB 2GRUA 1X14A 2YN4A 3MWYW 3Q5EA 1O03A 4H77A 3EFBA 2IU0A 4XJSA 5TLSA 4E5VA 3PUWA 2AXNA 3O1IC 5K1ZA 1WZNA 5K3BA 2O8DA 1CF2O 4FFSA 1KEEB 3DQPA 3JQBA 1Z34A 2Q6OA 4S0XA 4F91B 2A2ZA 3R9IA 5EP3A 3TZLA 1V47A 3HZHA 2YZKA 1SXJC 4FOOA 5CEFA 2XYPA 3DLPX 4M87A 3MMPA 2UVPA 3IPAA 4MAAA 5F98A 4LYYA 3HL0A 3N28A 4AJ2A 2JHAA 5L9AA 3BK2A 3D02A 1XTBA 1CR4A 1NE7A 3LX8A 2WSMA 3UH1A 2QTFA 2FQWA 1YL5A 1PT6A 2B25A 4HDRB 4LOJA 5DT2A 3D1LA 1E6UA 3OVMA 1AQJA 2JD1A 1Y8ZA 5TEVA 2QSJA 3S1LA 3ZW8A 1XGKA 1T8SA 2GAFA 4U8HA 4HLQB 4CEIB 5CT8A 3P71T 4F45A 1QUEA 2JAQA 2RGDA 5T6BA 2R5FA 5JLJA 2HCBA 3CXUA 3LC1O 5LZ4A 1BHO1 3JQQA 3T5AA 1B6RA 1J1IA 4LY0A 4M89A 3U9TA 2WTUA 3JD3A 3BH0A 5C18A 4WWHA 2RJ3A 1ILEA 4U63A 2H08A 1F5SA 1DRWA 3T4UA 4YECA 3HJBA 1HRDA 1I6WA 1TVCA 4WNCA 1FJXA 1F14A 1KMQA 1WXXA 4D0NA 2XUZA 4IJKA 4KNWA 1SVIA 3H83A 5ALNA 3G0DA 4MWTA 2BLLA 2C2YA 2XUHA 2JLSA 4BFYA 4OFWA 4ZOAA 1KJQA 2JG3A 3QTLA 3GRKA 1OJLA 1TMOA 1K3UB 1RAGA 2YUIA 4K3UA 1Z5WA 2VK1A 3U81A 3D9QX 5KJCA 4ENUA 1ESCA 4K3VA 1NE2A 2XA2A 4W9NA 2IBMA 3H4TA 3B12A 4YP0A 1N36B 4LA4A 2R3SA 4YRIA 5L7YA 3U44A 3ZE1B 2Q3LA 1DKLA 1R66A 2R6FA 5IJ9B 3TR6A 1Z18A 4LN1A 1F2UA 1JILA 3CRVA 1UMBB 3U7EB 5KTRA 1TZCA 4AIRA 4P4LA 2WJPA 4HNHA 1X8JA 4F3CA 1R3DA 3ADBA 3LT2A 3F3KA 4Y0VA 4OJQA 4DQLA 3C7DB 4UC0A 1US8B 2H4XA 4MR7A 1DIRA 1E0DA 5P8WA 3K32A 4QTTB 1QTNA 2ATVA 4PQRA 3ZU2A 3AT1A 4H7EA 4F3TA 4BX3A 1N5IA 5FBHA 2BGWA 2Q0SA 4M1MA 1XROA 4YV2A 3K9LA 3OZRA 1NNI1 4DUYB 2C8JA 3GBPA 3NOVA 4YMIA 2C3PA 3E48A 3ZH9B 2WSBA 4GIBA 4ISCA 1KRWA 3TUIC 5JLAA 2FN8A 1JA0A 5AH0A 5E9AA 5AK3A 3L4BC 4CM5A 2YDYA 2EFCB 4DV2B 3RRJA 4CMKA 5FOXA 2DERA 2CBZA 1YZQA 2ONKA 1N78A 2VJAA 3DT6A 2ZI7A 3RR2A 4F9EA 3KDSE 4YXWD 1YUBA 1YVUA 3QFHA 4BWFB 2AHOA 4BTVA 2BGJA 2VXOA 1K7SN 4JC4A 1NVAA 2CLEB 3PGXA 5FORA 4ALKA 5IUNC 2QAGC 2QIOA 5IBRA 4CYMA 2HJWA 1VHJA 3LPAA 3H9JA 3EW9A 4EKYA 3FH0A 2XWQA 3C5WP 2ZKLA 4BGVA 5E7IA 1QQ6A 4MWDA 4XRRA 2C1XA 4KK3A 3WGUA 1L5GB 5KWJA 1FS6A 3F8TA 3GLFB 1B76A 1DEHA 4D0SA 3OCYA 2R4TA 2ROQA 1M2OA 1TMKA 3OOWA 5I47A 5F3DA 2XZOA 5BMVA 2VEOA 4Z49A 3AG6A 3IH5A 1T43A 2VAPA 4JY7A 1SOUA 1HFWA 1K27A 3HO8A 4U00A 3ZDYB 5ULLA 4D9FA 1Z5ZA 4HLDA 3W5BA 1R6TA 1EXWA 4LKOA 5SY4A 4BUJA 4ETIA 5EJ8A 4RF5A 2Z08A 1KI7A 1TW2A 1BHSA 3G88A 1B14A 4MVJH 4OAPA 4P4UA 3QKIA 1D4OA 1QR6A 1ESDA 2GH1A 3LBNA 4LDAA 5EJ6A 1PV4A 1Y6ZA 4CKEB 3WK9A 3FRHA 4EY3A 2FRVA 3UJ8A 3P2EA 2HFKA 5HG0A 3L1HA 3W5HA 4DMGA 3OJOA 4W1SA 4W1RA 2V4ZA 3O21A 3TKAA 2Y05A 2YH2A 3KZOA 4C7KA 5B6JA 4NH4A 5SZHB 3ZVNA 3G79A 4FYVA 4QO7A 5BSEA 4LF5B 2AXQA 2OSVA 4PSDA 2VHWA 3RJZA 5CAEA 1E3MA 5C8YB 1M1NB 3MNFA 4WOJA 4L3OA 5AKEA 5K0ZA 4I66A 4N3CA 4R2JA 5CVVA 5AUQA 2H18A 4RHCA 5KJEA 3V4SA 4DS3A 5JXGA 3H5TA 4GLLA 2D1YA 2IP2A 3OM0A 1P2FA 1ZJZA 1P1RA 1ZMBA 2Y1FA 4TTSA 5D6OA 2Y1LA 2Q7OE 2RE8A 3A8TA 1JHDA 2PBFA 1THGA 2OAP1 4ZAWA 3TX6A 1W0KA 1SVSA 3RSHA 3W4KA 3ZCRA 2I6TA 2YXBA 4G81A 4Y6LA 1WCWA 2DU8A 4R2HA 2DP4E 1QSGA 3JYNA 3T1HB 5K8JB 4OLBA 1CK4A 2CMHA 2ICAA 1OV6A 4FBGA 3VKWA 5LMNB 2C8VA 4E51A 4PGGA 4P34A 3B78A 3K20A 2GVDC 5BW5A 2MDTA 1PFVA 1VIMA 3IDAA 5DNUA 5K3SA 1ZIPA 1AK1A 2QX4A 2C4MA 2HBZA 3AJDA 3C5HA 1M7BA 5IVPA 4DV7B 3VGPA 3CX3A 5KNCD 1XVVA 2CD7A 5LWHA 3MELA 3OD5A 2QSZA 2QM0A 4TTVA 3ZDXB 4EUSA 3ANMA 4K05A 2DETA 1QH9A 1V37A 1PG0A 3NRCA 5C3UA 1DO0A 1H3NA 3R6DA 2GK4A 2LDXA 1L7NA 1RRKA 3DVLA 1EGHA 3LPLA 3QKRB 4AX8A 5FO0A 2CXUA 3PDWA 4PWYA 1RKXA 2OHJA 2HLDD 3T9BA 1BJTA 2OHGA 4LOIA 4NRDA 3VH1A 5A3JA 3INYA 3KHUA 3A6GA 3L7OA 3ET4A 3D7KA 1N5LA 2YS7A 5TQJA 1B0AA 1LNSA 4HSEA 3HKDB 5IF9A 1C0EA 4RD6A 3UW1A 4EGJA 1C9YA 1MOQA 4GBGA 4MYCA 1KDYA 1U28A 1XQ1A 4J2HA 3O9MA 4QRDA 4F8EA 3AINA 3DOJA 1B1CA 3PLNA 4ZD6A 1S2GA 3W6PA 1PG5A 2OO3A 4D0LB 1L8OA 3GRCA 4XOIA 3UJCA 2QTWB 4BB6A 2PZAA 1UXKA 1V71A 3TLEA 3BQMB 4Z7OB 1F1JA 4GHWA 3CUYA 1CEEA 3B3GA 4G01B 2Y9PB 1EFAA 1GDDA 3FZYA 2XQIA 3QY9A 3AHDA 1H5QA 4YYEA 3FCSB 5CU7A 1NVFA 3NHMA 4UQLA 5LD2B 1OXXK 1CZKA 4QBGB 1RAFA 3VRHA 1BEZA 2JK0A 5SYAA 1TMYA 1EFTA 2LNDA 4NK5A 1QB8A 3UBMA 2A58A 1SMKA 1DXHA 1VCOA 2V7VA 2C82A 4L0CA 2D7DA 3RRYA 1YTLA 2PSEA 2HZBA 3GEGA 4N01A 4NMMA 4TYMA 4OATA 3CT6A 1MGOA 3MJ4A 5K45A 3PYMA 4WQMA 2PRSA 3OSUA 4HVAA 2JVKA 3E2IA 2WPNA 5DK6A 5IYZF 2DR3A 4X7RA 3GRFA 1R6BX 2V59A 4RTNA 4CVNA 1EKXA 2N47A 5A71A 1OR8A 4OMDA 3S2FA 2WYOA 2BOVA 1J97A 3NIBA 3I2IA 5ECYA 2HU7A 3F4KA 4CIBA 4YP6A 1QFMA 1J8QA 2O7QA 3JQEA 1JR6A 1GN9A 3WAKA 1JPJA 1PR6A 5C51B 3L6DA 4PTZA 4BE9A 5IUJC 2ANBA 3D3JA 3H5VA 1M6VA 3DJFA 3GDGA 3E9EA 4DJDC 4IX1A 4PLTA 1RDFA 2J0UB 1V1RA 2QLFA 1AQUA 4E88A 4UNQA 3DLCA 4KXQA 4YH1A 4DDTA 4RHYA 3ASVA 4WV3A 2BEVA 1IHDA 3OZCA 3NUZA 2W2KB 4NBUA 3EBLA 4YN3A 5L4LA 2BGRA 2CSUA 4RZXA 3SDZA 1YTUA 3RVMA 1BDHA 1UC9A 3LOUA 2ASVA 3IHWA 1U2GC 3W8EA 5JVDB 3K16A 1W88B 3ISTA 2CLMB 4Q3LA 1KMHB 3PPXA 4GR9A 2UUAB 3R3VA 4CI9A 3AKCA 4MUMA 1U0NA 3TW8B 3E8SA 1E62A 1JHAA 4TV9B 2QLLA 2IIPA 2ZSIA 3REOA 3PKIA 4XX1A 2IUYA 3T94A 1SXQA 2BN4A 3A4YA 3G9ZA 3HABA 4Q7EA 2W6QA 1RXSA 3UBTA 3LXRA 1YDEA 4U6QA 4NEHB 2Q3EA 3OPQA 3Q7EA 1YVEI 4FJ2A 3VH4A 4RF3A 3L02A 3ZOZA 2V7GA 2W2TA 3BB4A 1UXJA 3LHIA 3FPKA 3R5FA 2NADA 4MYHA 4DMMA 1TIBA 1Z29A 2I6GA 1IOVA 3C1AA 4OXKA 1OUMA 5EWJA 5B3KA 5HKBA 3O8DA 1YQUA 1B4DA 2FMHA 1HK7A 4NE7A 2VQ6A 2ZTVA 5LCXA 3GJRA 4MB2A 4PZUA 3K8QA 4RHXA 2OAGA 3NRJA 3QF4B 4CV1A 3WFIA 5KKCA 2O8FB 3ZPXA 2XB9A 3AETB 4G89A 4HS9A 4J76A 2WR8A 3EC1A 1R18A 4WECA 1GGEA 3N3AC 4FOLA 1EE2A 4EF4A 1EFPB 1Y33E 4ZRDA 1M1ZA 2O8CA 2IP1A 3TRJA 3RUPA 4YAUA 3KV1A 4KZPA 2I9PA 2C5AA 4TL6A 1KJNA 4QLBA 2PH5A 1GTG1 5A9SA 2O4CA 4DR4B 1UKZA 3PD7A 3VR3A 2Q07A 1FCJA 3D8TA 1RXIA 2HJSA 2QQEA 4P3NA 3KD3A 1AXGA 4E4YA 2G06A 5KQMA 2HREA 5ELMA 4M1KA 3OEHA 4OBBA 1MOPA 2WVAA 5DE3A 5JAZA 4Z4IA 2AZXA 1N2IA 1EK0A 4A5SA 1WW3A 3PENA 1P75A 1EWRA 1M2JA 1H1TA 3A3OA 4F8YA 3MXTA 1RC8A 4ASUA 2FFHA 1R9JA 3KYDB 4HGYA 1AKQA 1C1XB 1EVJA 1GRVA 1EJBA 1QVAA 4QDUA 4R3NA 1KOJA 5T6MA 2BGUA 5KYYA 8LDHA 5IJXA 2FETA 4YXFA 1I3OA 4RPIA 4IGFA 4ZXFA 4D4IA 4GICA 1TVKA 4M1WA 4OVKA 1AUOA 3HYLA 3WICA 1LDNA 4C4SA 1VYUA 5E4YA 3A4MA 3CVYA 3D7RA 2CT8A 2NUTB 3B6ZA 4Z0TA 1LFDB 2GJ8A 4ZVQA 3ZI0A 1YZKA 5AK4A 3FCCA 3EASA 2H2AA 1PR5A 1K8RA 2AF4C 3CLSC 4HH0A 2M1ZA 1GG5A 1LTKA 1O5TA 1OY1A 4V02A 5KREA 3TM5A 1S2OA 1ODLA 3RJTA 4W1QA 2PUCA 4CKBB 3SVTA 1M0EA 1PT5A 2PUBA 3ND8A 2WNSA 1YI8A 5AHKA 5SICE 3F7OA 3LL4A 3PXUA 1U3VA 2X2PA 1E1MA 1MG0A 2C84A 3G13A 4OI1A 4FB5A 3TFOA 3A28A 1VCNA 4Q3DA 4Q4JB 1QGZA 2M2IA 4D41A 1MHPA 4IAOA 5LMZA 1NJ1A 2PZJA 4G63A 2JATA 5F5NA 3UKJA 4A0FA 2RJOA 3GPDG 3GXBA 1PJRA 3Q3VA 4NCJA 4XJXA 4MGEA 4O8ZA 5ERYA 3DKIA 1CP2A 4NAVA 3H5IA 3D7MA 4KUHA 3EGDA 3CE6A 4KWEA 2W6IA 3AM3A 3GDWA 4P31A 3WIOA 2AQHA 1I9CA 4XD7A 3OY2A 3T5GA 2HA7A 3N1UA 4JQCA 2I54A 3EQ2A 3PI6A 3MQ2A 3THRA 3BHMA 1EJ2A 3K96A 3NOOA 5CB6A 2D13A 3KL2A 4Z8XA 1LPOA 1WS6A 2A5DA 2OCXA 3KEFA 4KR9A 3ZDZB 1CQIA 5BURA 2SCUA 1K5HA 2M6SA 1NSYA 4HQOA 1G8AA 3AERB 5I9SA 5K4HA 3SMQA 1VSQA 3HTXA 1VIAA 4U3JB 1W93A 1G21E 3C48A 4O2BA 1NRIA 4PW0A 4IWXA 3JZFA 2WW8A 3P0RA 3P9XA 3I9FA 4F46A 1JEJA 1R64A 4LCJA 4JUDX 2ZYVX 1JVNA 3IP3A 1XRSB 5ENVA 3LFUA 1WTCA 3COPA 1NY6A 4DAOA 2VF7A 1VYTA 4UMEA 1YFJA 3A6KA 3RC8A 2CNLA 2C88A 2J59A 4D9GA 2Z8XA 2WHPA 2WM3A 4C4YA 2A9JA 1KJ8A 2GXSA 4RE5A 5FD8A 4QATA 1R0SA 1VLLA 5DNWA 3SFTA 1FDOA 1ENYA 4IHQA 5DP2A 3GJ6A 1Y5LA 2G4VA 5C7LO 3KEMA 2IPNA 721PA 1JIIA 4HYYA 1V4VA 4CR8A 4MZDA 3SIWA 1JMKC 1Z5NA 2BKUA 2COKA 4PO9A 2PLRA 2D0DA 1J9ZA 2N46A 3P8ZA 1FLVA 4PM4A 2PV7A 5F21A 2GZHA 3ZHYA 4AG5A 4D80A 4BMVA 2C2MA 2WKWA 1ZD1A 5H16A 2C4KA 1FFYA 3EQZA 4BO1A 2XCTB 4DPKA 2AOUB 4DSZA 3I72A 5CA1A 3W6NA 1W29A 1YR7A 2W6MA 3HWRA 1FK8A 4H6WA 4G56A 4P0PB 1R50A 1UKBA 3GROA 4IMJB 1Y7HA 4TVKA 1XYVA 3QKSA 1Q0HA 2ODBA 5DU2A 5BN1A 2GTIA 4BX8A 4H1TA 3ZI4A 4Z54A 1NIPA 4PIVA 1WNTA 2IY7A 1GADO 2I2DA 2V65A 1L5QA 2JGNA 1TZJA 2QG9A 2D5AA 2ZRNA 2FP4B 1THTA 4D2IA 2PEYA 1H6AA 5KYXA 2OYRA 3P7MA 4OU5A 2Q5IA 4PPQA 2PIDA 3UJBA 1AK2A 3WBFA 1R5BA 4EO4A 1P9RA 4QWMA 2NG1A 1ZH8A 2PZMA 3M7IA 4GQIA 4I9UA 4OXXA 1SU6A 1TU3A 2LZ0A 4LZAA 4QGBA 1ETHA 1M76A 1OXVA 3TYXA 3ZHOA 4IW3B 2O8EB 1NQWA 2R44A 3PDJA 3ZZUA 3NBZC 1JKJA 3H97A 3ORSA 3FVVA 1NV9A 2DPHA 3OT5A 4X1IA 2BFPA 5EJ2A 5AW2A 5JSZB 3PTAA 4KVGA 3R09A 4EG4A 4E6PA 1XEWY 4IIDA 4FHEA 1XWIA 3QBVA 1USUA 1L4HA 1VPEA 1SXIA 3FWNA 4TMZA 3ZGVA 4NJOA 3MGAA 2ZSKA 5EJGA 2ORWA 1GY8A 2QB5A 3FPHA 5F64A 1W0KD 4CJXA 4JAVC 3G9UA 2GPTA 3DW1X 3VUFA 2G36A 4WK2B 3UC9A 2JRLA 2YWEA 4YJ2B 5COQA 3KT0A 2NU8B 5A5DA 4Q18A 4L07A 4HDRA 4MPRA 3IR5A 2Q0QA 4CMHA 2KW5A 4Q3EA 3HJHA 1VOTA 2XVMA 2JLYA 2QN7A 4MW2A 1BGWA 3L6EA 2GAAA 2ZJ3A 3H1TA 2B5WA 3PQ5A 4ACBA 5K5EA 1FP4B 3RQIA 2VJKA 1AB5A 1MB3A 1N6RA 4DWVA 2OT3B 5A3QA 1RWVA 3UUGA 1HV8A 4HYTA 3TH5A 1Y42X 4A0HA 4ZU3A 4BQQA 2C3UA 1R3UA 2QQFA 4N7MA 2OXIA 2WTXA 1JT9A 1FYWA 4AN4A 3FCYA 1ZD5A 2RAFA 2GPYA 2OB2A 2OGUA 2VOEA 3FSEA 4EK9A 1XZMA 4MW6A 1GU0A 1ATZA 5AKZA 3BD6A 1MRSA 2VSYA 2QR3A 1HR0B 2A3NA 2JFVA 2LBPA 1QKIA 4A4DA 3TGPA 4MH0R 4PC7A 4F3RA 3P9ZA 4Q82A 2XYRA 3LT1A 4YC7A 3ZXYA 1JH8A 1X0XA 3MF4A 4HDOB 4BRUA 4F04A 4U5XA 5HZMA 4D4JA 1OC2A 3WSVA 2A86A 5DHRA 3G6KA 3HEMA 3QG5A 2FRXA 4EDFA 1VJTA 4Q7LA 4R0VA 2ZB8A 3LK7A 3BQ9A 2N0SA 4HYQA 2GBLC 3RW9A 3V7NA 1WVGA 2WJJA 5I6DA 1ZISA 3C8ZA 1MKYA 3WLRA 3BA6A 2R47A 3FGPA 4WN3A 5HQ3B 1HYQA 1YMVA 2QT0A 2QORA 3L0CA 1QFXA 4R0NA 2CNOA 4P84A 4AIIA 5HXAA 2FSVA 4A2QA 2JJ1D 1SQ5A 2Z5VA 3A2MA 3WGZA 4AYTA 4FHZA 3EEYA 1K66A 1F9AA 1TVMA 2J32A 2ZYIA 3CEPB 1YQWA 1ARZA 1WABA 4BU0A 5KQRA 5CVDA 1P4JA 3C3DA 3HB9A 1Y1TA 4BFCA 2VSOA 4KR2A 4YQZA 2JHFA 4UM9D 4ZQCB 5F3RA 3SQLA 4GLBA 2B8WA 4DC0A 4KH1A 2GZ3A 3J7TA 3GCWA 3I2GA 4QREA 3HXQA 5E4JA 4B09A 5CLGA 3WV5A 3Q0EA 4BV3A 1IU9A 4OBXA 1UJCA 1NSFA 4YJGA 2X19A 3QOWA 5BSUA 2KMLA 3T4XA 2P6MA 1BWRA 2O0KA 4FILA 4YACA 1JMYA 1MZVA 3TSOA 2YHSA 2ZTSA 2HSJA 5FPPA 3QIVA 3DOCA 1EG2A 2AHRA 4MDHA 3KQVA 3MMZA 1QHHB 4PFQA 4MSUA 3RBVA 2VSXA 1PVVA 5ECWA 2R5NA 3BMOA 2KLHA 1GYRA 2BISA 1EVQA 1UC5B 4QUHA 4AK9A 5TGDA 5FADA 1II8A 1N5DA 4JJIA 4K9SA 4CLRB 1HDGO 3ZOKA 1R7RA 2YHUA 3IT1A 4N5MA 4YA6A 4EW6A 4WFKA 1JWAB 3HSYA 3L6OO 4ENRA 4C21A 2J7PA 2VP0A 4IO1A 3SSNA 2J4CA 3R7NA 3RHFA 4N0EA 3P5BA 3CBQA 2J0QA 1JG3A 4DF3A 2PGLA 3V2GA 2VSQA 2FFQA 2NNLD 4UVIA 1UMDB 3VPGA 1C1DA 1AQ6A 2BMEA 4XLLA 1F4LA 2MSDB 2AMLA 1SIBE 2CL6X 2VJPA 3QSGA 4IQFA 4KZKA 1CLUA 2JZOA 1NL3A 1DXQA 3KYIB 3RB8A 3AEUA 3FI9A 3SOZA 2B5VA 1WVMA 1GCGA 1YBHA 3HU2A 2PR2A 4JDUA 3TIFA 4UTVA 1F5NA 1T9GS 1Y9ZA 2OBLA 1NT2A 3ELWA 2CEAA 1CERA 1GQRA 3KQPA 1D1QA 3CNBA 3M89A 3CLUD 3ORQA 2AC4A 4O5AA 5K3AA 3VDMA 4UUAA 3RU9A 1VE5A 1ISMA 2DAPA 1QHFA 1H2BA 2MYNA 4TYWA 3RBZA 1DJNA 3TTXA 1I3CA 1PBTA 3EARA 4EIWA 1X1QA 1QV6A 3L46A 4LYFA 1Q19A 3CLRD 4J0JA 1QR2A 4US0R 2H1RA 2Z4RA 4HLUA 4C7XA 1X1RA 2J6IA 1JU3A 3DZGA 4HUJA 4ROTA 5LJIA 3U4QB 1OH6A 4KO4S 3MJVA 1Y1KE 3JARA 1GG8A 3GFRA 1D0SA 2YZ2A 1PJZA 1U90A 1GQSA 1U3WA 2FW0A 4FD2A 5B55A 2DJIA 3I45A 5MGBA 2J9RA 3GNSA 1AKTA 1UBGA 3DMFA 1Z2DA 2P6UA 3NHFA 4RFVA 4PY2A 2XZTA 1RQGA 4YVFA 5D6NA 3SIPA 2KLBA 4DTCA 1KY4A 2V6MA 4TWJA 3RVSA 1XRLA 3DBVO 2B8EA 3HY3A 1PK8A 2JLCA 3D0KA 1FQWA 5EE0A 1FX1A 4WD3A 1GTVA 2HMTA 3NG1A 1KO4A 1V16A 5EJ5A 1HNZB 4FHCA 3L84A 1G8SA 1GA4A 1NZJA 2YWHA 4I14A 3DM9B 4BASA 5GJBA 5AHWA 3V4VB 4BEJA 3GZ4A 2YWDA 2JEYA 3R7AA 1VKHA 3I64A 4WCDA 3VR3D 1JDZA 1UZAA 3NC0C 2WP8J 4R8SA 4OGFA 4B4OA 5JUWA 5GY7A 2H06A 1LVGA 4RETA 4LOKA 4XSGA 5FTLA 3OEHD 4JT8A 1TA0A 1ULBA 2ZBVA 1GV0A 1PLJA 5F76A 4BO3A 4NCIA 4A10A 3PHJA 3U6KA 4RK6A 2RCNA 4MB0A 1H2EA 3H1EA 1GCOA 4P5DA 3G8BA 4TMYA 1CHDA 1XZPA 1NUAA 4MMZB 2GESA 2FCAA 4OBEA 2I3AA 1KKUA 3FYDA 1Q0UA 5K01A 1EK5A 4MLZA 1SCQA 2F43B 1L4FA 1UP7A 3CS3A 2DXIA 4J4BA 4P3YA 2PVSA 2QJRA 3VTAA 3KNZA 4LJLA 3ED1A 1E18A 3HDQA 4KJXA 4A6EA 2MWMA 3FNGA 3PXDA 3NTXA 3PWSA 3DKVA 4KR7A 2Q6IA 1NIJA 2IVFA 5J58A 1NC3A 3MTEA 4WZAB 1V9CA 1Z12A 3EVDA 2O4UX 3ENQA 1E3TA 1AO3A 1LSJA 1SCNE 1AZSC 2I65A 2JI6A 4RVNA 2XE7A 4I5DA 4LISA 1LA2A 2YBDA 3MJTA 1LEHA 3SJCA 2J6BA 3W77A 1KPIA 1WXGA 4FS3A 1I6MA 3LF1A 1PFYA 4MITA 4JI5B 3UA3A 4M99A 3JQ6A 1X7YB 4MW9A 2WYWA 2FE1A 3I9JA 2Y4NA 4UE3S 5GV7A 3HZZA 2QTLA 3EXEA 4KQHA 1X7WA 4DBLC 4N6NA 1UDAA 4P54A 3IP6A 5I4BA 3DB2A 2PS1A 3IUQA 1BYUA 4ALIA 1XRNA 1G5QA 3LT5A 1EX1A 4KQ1A 1XTPA 4OHBA 3SMVA 1FVFA 1IXSB 2DFDA 2FMXA 3PUKA 3PZBA 4KQ2A 1E58A 1CRQA 2IOFK 2W6ID 3QLUA 5BXYA 2K2WA 4MAFA 4ILEA 3RIEA 3VR1A 3EIOA 4LRXA 1C8KA 3K73O 4BGUA 1Q7RA 2A30A 1QZXA 2OGTA 1VBFA 3AVTA 1MX1A 4RDIA 5CLLA 3NATA 4D45A 3TZ6A 4LQDA 3G9QA 4OUDA 1TA9A 4JZYA 2MSWA 4NBKA 1I7NA 4CIYA 4E2FA 4I50B 3O82A 2B21A 4IIBA 3QEBZ 2BFCB 4EP1A 5JNLA 2HOQA 1XRPA 3FYHA 3TMYA 4E5YA 4G65A 4F9FA 4BCDA 1IZ9A 2X9LA 2D3TA 4FFMA 2H5IA 2NTNA 3LPCA 3ZHRA 1JI3A 1NQVA 1KI2A 2OORA 1LWNA 2B83A 1CY7A 2V74B 3RFTA 2J0UA 5E4FA 4PYOA 3HUFA 4B3CA 2BL4A 1N9GB 4P5PA 2X15A 4URXR 1G38A 3FY4A 3GD7A 3DM5A 2GJ4A 3E5NA 3PT9A 5AQEA 5DNYB 2W2KA 1ACMA 3F5QA 4AP6A 3KXLA 1DAHA 5AD1A 2JFPA 5JVDA 4XTCS 5FV7A 1M10A 3LT0A 1A8SA 3NNDA 5AW5A 2A9FA 3UEOA 2A59A 2UYGA 3UNXA 5AVXA 2WUFA 4DG5A 5I3ZA 3RS0A 4DLLA 4EEKA 3BMNA 4YLEA 3S81A 1GLNA 3GRUA 4TVBA 3ZZ1A 1QG0A 3CUWA 3PDHA 3DVSX 4EHDA 5TQVA 1FJ2A 4UJ3A 5IAJA 3FIUA 5ESRA 4BNMA 1XQVA 3AUJB 3KR2A 2BFEA 4FIDA 6NULA 3KFXA 3W8RA 4H3SA 4HTFA 1KVSA 4Q4AA 2OFFA 3H6GA 4YMLA 4JLJA 1X9HA 3KXIA 4RY9A 5EERA 1A7JA 1TUBB 3HGTA 4BOYA 1CVIA 3EAGA 3D8HA 4O1HA 1QYVA 1R8SA 2QV0A 4FVTA 2QX6A 2O2ZA 3BWDD 2OCDA 2QE6A 3Q12A 4QT0A 2I66A 4RIGA 1ESMA 3AI3A 4TV8F 3CUTA 4HOYA 4L4ZA 1PSZA 4C4TA 4GKKB 2ADFA 5DT9A 4AYWA 4JUIA 3B1VA 2E9SA 1KI8A 1SK8A 3AETA 2B8JA 2OV1A 2NXWA 3QZUA 4J49A 4YJ3A 4MRRA 2Z3VA 2F62A 4NG4A 2IZ7A 3EEIA 3JQGA 1EFPA 2Q49A 4BFUA 4EA9A 3ROQA 2J87A 4ND7A 1M2EA 1IN4A 3JQCA 3ER9A 2RK3A 1JXQA 4WFIA 4C7BA 4RACA 5CLFA 4UU8A 3HCAA 1XZIA 3BIXA 4YBRA 5H80A 4BFXA 1YL7A 2BR5A 3DR5A 5K0SA 3AWDA 2EBUA 2G76A 3HKEB 1YAJA 3DE0X 2EFGA 1EK1A 5E9JA 3SX4A