2SBTA

A comparison of the three-dimensional structures of subtilisin bpn and subtilisin novo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the three-dimensional structures of subtilisin BPN' and subtilisin novo.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN NOVO
total genus 45
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1976-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sbtA00
5ARBA 1YJAA 2ST1A 2G4VA 3DVQX 3VV2A 1Y9ZA 3WQBA 4DWWA 2Z57A 1S2NA 2P4EA 2HPZA 4B5LA 2SBTA 1GNVA 1UBNA 2PYZA 1TM1E 3BGOS 1GA1A 2QTWB 1SUEA 1P7VA 3ZXXA 4C3UA 1Y4DE 1ST3A 1SBIA 2ID4A 3F7OA 1VSBA 2PMWB 1GT91 4OV6B 1SUBA 3TI7A 3F7MA 3CNQS 1AK9A 1Y3DE 5AQEA 5ARDA 1C3LA 1JEAA 1MEEA 1AU9A 4WOBA 1SH7A 5AVKA 1Y1KE 3DWEX 3TECE 1Q5PA 4KPGA 3DDZX 2SICE 1NDUA 1ST2A 1S01A 1SCJA 2IXTA 3I37X 1DUIA 4C3VA 1TO1E 1T1GA 2PKCA 5I9SA 2W2NA 3ZXYA 3OSZA 3Q5GA 4DZTA 2GKOA 4NE9A 1TM3E 1KDZA 1BJRE 1Y34E 1GTL1 5B1DA 1CNMA 1YJCA 5SICE 1EA7A 4OMCA 1MPTA 4M1ZA 1SPBS 1YJBA 1SCAA 1R0RE 1V6CA 2DQKA 2SNIE 2W2PA 1SVNA 5B1EA 2Z2YA 4H6VA 1PFGA 1WMDA 3WHIA 1CSEE 2DUJA 3DE2X 4DJ5X 3AJ8A 1KDYA 1S02A 2WWTA 3DE5X 1Y4AE 2SECE 3DW3X 3GCWA 1Y3BE 3I34X 3WIUA 4JP8A 1C9MA 1P7WA 1IAVA 3DE1X 3GT3A 3DE0X 5AMXA 2ID8A 4KB5A 3QFHA 3DE4X 1KDVA 4FONA 1BE6A 4CG0A 3AJ9A 1AH2A 4BWGA 3EIFA 3A3NA 3LXUX 1WSDA 4CFZA 1PEKE 1T1EA 3PRKE 1SIBE 4H6WA 1KE1A 1AQNA 4K8RB 2Z30A 3DVRX 1AVTA 1SCBA 1SELA 1SUAA 2PQ2A 5FAXA 3DYBA 2PWBA 1ZVJA 3D43A 1SBHA 1SCDA 1GTJ1 1TM5E 2WUWE 3P5BA 1ZVKA 2W2MA 4LVNA 3F49S 1R64A 5JMOA 3D9QX 4HX2A 1IC6A 1OT5A 4LVOA 3BX1A 3EE6A 1LW6E 1SIUA 3QMPA 1A2QA 1PTKA 2Z2XA 3UNXA 3QTLA 2X8JA 3TI9A 1BFUA 3LPAA 3DVSX 1Y48E 1C9JA 1GCIA 1SBCA 1TM7E 2ZWOA 4GI3A 3SICE 1EGQA 5JXJA 1T1IA 2XRMA 4ZOQI 4NMXB 1SUPA 4YN3A 4NE7A 3DE7X 2V8BA 3DE3X 1TO2E 2PRKA 1P8JA 2Z56A 4KG7A 5JXGA 3A3PA 3T41A 3I2YX 1R6VA 1BE8A 4J94A 1OYVA 1BFKA 1SBTA 4Z2AA 4ZARA 1KE2A 1NLUA 2XTJA 3DW1X 2IY9A 1Y33E 2PWAA 4AKSA 3L1KA 1Y3FE 1SIOA 2W2OA 1GNSA 1YU6A 2WUVA 3VYVA 1GA6A 3WIVA 1SCNE 2ZRQA 3BPSA 3PTLA 5CW1A 1GTG1 1V5IA 2HD4A 4AKTA 2X8JB 4HVLA 5JXHA 1TM4E 1WMEA 4RYDA 2ZWPA 3A3OA 1PJ8A 1C9NA 1BH6A 3Q40A 4CFYA 2WV7A 3GCXA 1Y3CE 1SUDA 4I0WB 5ARCA 1TK2A 3VV3A 3HJRA 1WMFA 4WOCA 3VTAA 1GA4A 4MZDA 5AVJA 2Z58A 1AF4A 3EDYA 1DBIA 2E1PA 3VSBA 3SQOA 1TMGE 1HT3A 3CO0S 1AV7A 3AFGA 3GT4A 4OMDA 4H6XA 5FFNA 1SN7A 2TECE 1SBNE 3LPCA 3LPDA 3I30X 1SUCA 5FBZA 3VHQA 1THMA 3H42B 2DP4E 1TECE 1WVMA 5JXIA 1XF1A 2W2QA 2B6NA 1NDQA 2Z2ZA 5K7SA 1OYOA 3DE6X
chains in the Genus database with same CATH superfamily
4QARA 4KIJA 4RK7A 2BJHA 1ZDMA 3FM9A 3NEAA 5KDLA 2IOHA 3WDLA 4GKJB 4G1FA 1AKTA 4QG7A 3C7CB 4JI5B 1NR5A 3FZGA 5JYBA 5DNWA 1MGPA 3H5IA 2ZRKA 4XTCS 1E1LA 1FU8A 3AW8A 4PFKA 2GVZC 1C3LA 5T6MA 3CVYA 2HLHA 3BICA 3G23A 1KH2A 1T25A 2VCYA 3I6BA 4DC1A 3OZ7A 1ZR4A 1B73A 3BM5A 2HIAA 5K05A 1LDGA 8ATCA 2C5GA 2E55A 1ZMRA 4OFXA 1CQIA 1VE9A 1EDZA 3L9WA 3KU1A 4BNMA 4N7RA 4OQPA 4B3MB 5BYAA 4D56A 2DUMA 2FTKE 4RLSA 1TZJA 3UMFA 1VL0A 4FCTA 1ZS9A 1K2WA 3NEJA 4WBNF 3LBYA 1R0RE 1B1AA 4FOSA 2JFQA 4F2GA 1KPIA 3T38A 2ZI3A 1HDOA 1CSEE 3LVQE 2WWTA 4HH1A 4TMTA 3KVOA 4DJAA 5TPWB 3CLUC 4QJ3A 3L0ZA 2XCLA 2ZXFA 3BGDA 4F6CA 2EJWA 1ADJA 2FA9A 2DKNA 3Q5DA 1RHRA 5HMLA 1GKUB 2CJFA 2QUIA 1AA6A 1OLUB 2ACEA 5ELXA 1E9BA 2CNWD 2QP3A 3C3WA 4LXIA 5JFGA 3HFSA 4F6RA 5JSFA 1Q7BA 4CEHB 1BCSA 3VHXA 3D1JA 2IXAA 4Q5IA 4FE7A 2WP0A 4C88A 1YB4A 1KY4A 4I1OA 2OHFA 3V7WA 1Q1QA 1I1OA 4C6HA 4F3CA 3N07A 3PHHA 3QHQA 3QJYA 1Z35A 4FDAA 1EK1A 1EK6A 1WQ1R 1YBAA 4FU0A 1HX7A 1OFUA 3V4ZA 2E82A 1IEQA 2QMUA 1Z0FA 1ZD4A 3W9YA 2WQ7A 5HP4A 4FWIB 3UWOA 4ENTA 3WMFA 3VUEA 4KQCA 5AJXA 4QDUA 5FA6A 3VNSA 3GDWA 3G8AA 5EWJB 4DKXA 3FFTA 3FUTA 3EVGA 4HT3B 1XJ5A 2NUPA 3BWDD 2PYDA 1U2PA 3VHRA 3GYBA 1R6VA 2JAXA 1J0AA 3N7AA 1C41A 3OZSA 3LS2A 2ZU6A 1BX3A 1UFVA 1W5FA 2VSNA 5BN5B 2C4WA 4Y2RA 4BB9A 3DQQA 1U3TA 4FHEA 4BCBA 1V4VA 4AJKA 5F3WB 3D2CA 4S05A 1LSOA 1K8ZB 1NX9A 1OZ0A 2G0NA 4FMPA 4XYEA 2YICA 4QYSA 1NNSA 4UMEA 4NYJQ 1YD7A 4O4JA 3RVLA 5GJWC 3T1NA 2OZEA 1C9NA 1HEUA 1MNAA 1GITA 1TNDA 1W9MA 4HKTA 4MAAA 4NPCA 3A9SA 4U6SA 4C14A 4OXKA 3P8ZA 4GC9A 2NWQA 4ILEA 3SE7A 3LDUA 5B2ZA 5KJ1A 1F4PA 4IZ6A 1G66A 4D3FA 3DPIA 1OYYA 1NNLA 1W0KA 2A92A 2AZ4A 3LKZA 4UPVA 2M1ZA 4EGFA 4EG3A 4MP3A 4F9FA 1EVJA 2E48A 4QOHA 4MXDA 5EXDA 5L4LA 2UVPB 1J90A 2IW1A 4Q7LA 4ZKEA 1ZOOA 4QREA 5JO0A 1YO6A 1FDRA 1S2GA 2VP6A 4WN9B 4CVNA 1P44A 2PMCA 3MCAA 3WO1A 2VWHA 2GBLC 1C2TA 1J21A 2VHZA 1QQ6A 4OFWA 3V4OA 2ZRCA 3WJ1A 3LO8A 4MA4A 1MP0A 3TKLA 4TV9B 5LFAA 2H0RA 3F0TA 2IIVA 3D7SA 1BGXT 2FW0A 2PMWB 5A6SB 5IC5A 1EU1A 2OQVA 5L8VA 1EHCA 4I99A 1GYQA 4M8SA 3KYCA 1SQGA 1Y3DE 2OGUA 4OM7A 4QOSA 4ER6A 4QTYA 1ZGAA 3ZHXA 5JZMA 4JLWA 3ENZA 2CLCX 5EKUA 1JAIA 5CHEA 4YCLA 5L6LB 4KAJA 3B13B 4X71A 5IJ0B 1GTSA 2HSDA 2LIVA 4P36A 3TLXA 1L3CA 4XWWA 4E07A 4QUIA 2RAVA 2DHQA 3QKRB 4CTOA 3MM4A 2QW8A 4UVEA 5EEHA 1H0SA 1PCXA 3WKEA 1CUGA 2J0EA 1O3YA 4CIWA 5JDCA 3N2GA 4IS2A 3E8XA 1XR3A 5J3JA 4MVJM 2E87A 3PNMA 4J7XA 3G5MA 1A5TA 3RS8A 2X5KO 1HEYA 4NKRA 1D5CA 1SXJC 4PV7A 1PDVA 4EF6A 1AG9A 2HDOA 1G9SA 4AMBA 4EJ6A 3SSAA 5C5CA 4BX0A 4C2BA 1U8FO 3UMGA 5IW8A 1PN3A 2XGGA 4NFYA 3QFSA 3ZV3A 2MTBA 3BRWA 2G5PA 1TUBA 2QL6A 3E9YA 4N8DA 3ETNA 2GZ2A 2PX3A 4Y2GA 4OA5A 2HJHA 4UM8B 5BV2P 4CEIA 1GP2A 2OBXA 1FP2A 1ESDA 3P9RA 1G8KA 1YZTA 2O57A 1XCPA 2JJ1D 4WERA 2HUNA 3IMGA 3BXZA 3EG9A 1G8AA 1DL5A 2RGDA 3HB4X 5HRCA 2YWGA 2C29D 3R0VA 2PL9A 1PJ3A 3A2NA 3VDRA 2Z2XA 4LXXA 3T7KA 1TCBA 1WZCA 2WJJA 5E9JA 3RSGA 3HJAA 3U7QB 4PX3A 4QC2A 3V7YA 4K88A 1I0ZA 5H5JA 2H8KA 4EW3A 4EYQA 1J6UA 2VDLB 1VIVA 1ZGZA 2H4WA 1CZOA 2XUJA 3GT7A 2Q3LA 1KERA 4TWBA 1GN9A 2GJSA 3N7UA 2FFRA 4I5GA 5FLXA 5ALPA 4DEYA 4FFLA 3I2YX 3WK7A 1ISJA 4Q1VA 3R7BA 3WYEA 1E2BA 5JYDA 2V6FA 4M60A 2ZRGA 3DLAA 4TYNA 3L8ZA 3A1NA 4LFCB 4D8XA 3HCEA 1KJJA 2QPTA 4XYBA 4JL6A 4CM6A 3ZVMA 1UZLA 3ZGNA 3HN7A 1AUOA 3T4PA 2VP0A 1DOAA 1P0MA 5IT5A 1URPA 1J8VA 2P65A 3II6X 5IARA 4KMMA 3VYWA 2BSQA 4JEHA 3S0JA 4ITUA 4N39A 4B8WA 1JS1X 1ONOA 3ABQB 3FR8A 2JEYA 1EIZA 4BHTA 3UA3A 1C50A 5L45A 1T1JA 4MICA 4GI2A 1TU3A 4TWRA 4R1QA 4IIBA 5AVTA 1KFBB 2WP8J 3DL7A 4ON9A 2VAPA 4U9HS 5D5QA 2IGTA 5AVOA 4AZTA 4QLBA 4YJHB 2ZB3A 4JVLA 4ND7A 4B3HA 3WG9A 3LBAA 5DHQA 1SU4A 1C8BA 3KBBA 5HJ5A 1N5OX 2WKQA 3LXRA 3B6JA 4M0DA 4EEXA 2WK1A 3K94A 3R3SA 1TA9A 3O9ZA 2ATEA 4LY6A 1AXRA 2V7QA 4OO3A 1GGHA 1SG9A 3FHJA 1RPTA 3HFGA 4WQMA 2GHRA 3R9KA 3D3QA 4UJ3A 2POCA 1NC3A 1MT3A 3LYUA 3OLCX 3R8CA 2RH8A 3JQ8A 4CN9A 1FTGA 2EFGA 1ULZA 4C3UA 1G8YA 1EP2B 1SVOA 1DG3A 3R5HA 4QQKA 4CI9A 2WD7B 1BXRB 1G2QA 1GT91 2C9DA 3EMDA 4OJQA 4IWNA 3TI7A 1K7YA 2G3YA 3QUTA 4EYGA 1H9AA 2BFFA 1GM5A 1JDPA 5GV7A 4NMLA 4OHOA 1G64A 3NVMB 3SIWA 3VKUA 4I1SA 1BKYA 3ZLBA 4LRUA 5HQJA 3HYNA 3Q3CA 4F2PA 1N6LA 5JCOA 4KFCA 3LF2A 1RKVA 1V9SA 3OTIA 4DIMA 1XCJA 5A1TA 2Q6LA 3FLAA 4R0MA 3U61B 1ECFA 2NTJA 4WJZA 4MQBA 4YJ3A 3FZYA 4CM5A 4YRQA 5F78A 5CFLA 2H5LA 2ORWA 1DUSA 5ALFA 4K6HA 1EFRA 1GV1A 1PEAA 2FYTA 2SNIE 3ESCA 3E1KA 4FFPA 5CD9A 2AHRA 2E21A 5CCBA 3MQFA 1NQOA 2EGUA 3ZDEA 4R2MA 2DPMA 3WYCA 1IE3A 5IYZF 3C1OA 1P7ZA 4S2UA 1WXIA 4OHZA 1JKJB 2AOUB 4MDEA 3GLGA 4HEA6 2F2TA 2W58A 5EZQA 3C8MA 1P5JA 1OPXA 3WLKX 5IF9A 2JIDA 2O54A 5COQA 4I66A 1XDBA 2FB9A 4QTTB 3JQGB 1QX3A 3EF0A 4X3OA 4B71A 4B84A 3ZXIA 3N9IA 1BO6A 1QDLB 3EXAA 4HLNA 1U3DA 3HCRA 2GCOA 3EXFA 4N3CA 4PW0A 2IOYA 2JJ8A 1CHDA 4B3CA 1P5FA 2A94A 3UC9A 1NQTA 3O3MB 2GCEA 4LVOA 2GTIA 2GYWA 1RZRA 1OHHA 1PK9A 1IY0A 3EF3A 3FPKA 1J33A 3AOEA 4DG8A 1T0JB 2XUPA 3ZGZA 3QZUA 5EFOA 1PGJA 1F20A 1OX5A 2ZIZA 4DMHA 2OV8A 1P1BA 5AVYA 5CXQA 2AK3A 2SKDA 2QU7A 3UM9A 1X13A 1ES9A 1KI6B 1KFKB 1ZWLA 4A7PA 2X3YA 4AYXA 4DC9A 3JWGA 1K5GA 1L7AA 1Z7YA 5DHSA 4C4OA 2GZHA 2WMDA 3HY4A 1KWGA 4M38A 3JZFA 1G4HA 4GLFA 3JZAA 4UDOA 3VGJA 2CCKA 3TGPA 3STXA 4NV0A 4H0FA 4PAMA 2I03A 1FEZA 1VOTA 1WUTA 2PV0A 2EZ8A 3MTDA 3DYIA 1GTG1 1NW3A 2BISA 3LX8A 1NJ6A 1PJCA 1NJ5A 4I9UA 4MYSA 1F0NA 4MYUA 4BX9A 5BOSA 1KI9A 4U7DA 3HI6A 4P93A 1TU4A 1XO1A 4XIYA 4CKCB 2W0MA 5HJEA 4Q3OA 1IPEA 4YECA 4JKOA 1G5PA 3LBHA 4MQMA 4DG9A 4NU8X 4RLQA 4TM7A 4YP1A 3WR5A 4EW1A 3I5UA 3J7AC 2VQDA 1M8GA 3K70D 2JHAA 1KGDA 2OXFA 2W4IA 3LCJA 3N6RA 3WS7A 2B4KA 2QPOA 3WGYA 3G8BA 3SFZA 2FPMA 3NV7A 3A6DA 5HDQA 3NP7A 2X6QA 2F4NA 1ZXLA 2DQZA 2OD7A 5I9TA 1E3QA 3ZS8A 3UK2A 4A73A 4XFJA 5FIUA 1KAOA 1I5RA 2C88A 5T4HA 4G41A 3RAFC 4C2TA 3WMWA 2D4HA 4LOJA 3GLRA 3L06A 1FMJA 1H2AS 3TLKA 4HPWA 1UBCA 4K2HA 4B1FA 1WNFA 3AR4A 5I9MA 2FLWA 1X80B 5JXWA 3QVWA 3RVQA 3HJHA 1DLJA 1CJMA 1WL8A 5E1BA 5IUKC 3RTEA 2NO0A 2JIOA 2X6RA 4O2BF 3VAZA 5KYWB 2GXSA 2F17A 1IULA 2FP4B 2IUFA 2QLTA 4JQCA 3N0XA 4JBLA 3T5BA 3AVQA 4EG0A 3MJHA 1ZIOA 2PKQP 3KKMA 2XKBA 4IDBA 4LSGA 4UAUA 3A1DA 4EFLA 1W19A 2Q3MA 2BMEA 3KOXA 2GK7A 4FUTA 1QH8B 3WLEA 1G5TA 4OMCA 3R5KA 1J2YA 1M73E 5D3MB 2DJ5A 3CT6A 5PGMA 3ZGVA 3COJA 2R1VA 3JQFC 3LCUA 5F4ZA 1TGYA 4OQXA 4AS2A 3N6VA 4ZVVA 5K0GA 5DLEA 3OPYI 2Q2VA 3KSDO 3ZBQA 4YMTA 2QY6A 2N47A 1SBZA 3NHMA 1J23A 4I9FA 2JHFA 3DBVO 3WTBA 1D1PA 2PD6A 2ZBVA 3ZWQA 3WLLA 5I7VA 2C0PA 1HLGA 1PEKE 2D2VA 5D7NA 3PFWO 3PFIA 5JZVA 2HRRA 2VR1A 5HIKA 5IDQA 2C07A 2VJPA 2AE2A 4EVRA 1W44A 2V65A 3ZG6A 5A6SA 5LA6F 1HETA 2Y93A 2F7SA 5LUBA 4KE6A 2VDRB 4QGGA 4Z9BA 2E6UX 2WZCA 4FX2A 4G9BA 2BP7A 2ZUWA 3C6YA 1H2BA 1QIFA 2P3OA 3AUAA 4GWGA 3ZCTA 1VHTA 4CU5A 2F55A 3L07A 3E3LA 2A33A 1HORA 5G0WA 4ZOBA 2DSTA 2ZWOA 5JRJA 2Y2VA 3W8DA 2QENA 2Q4DA 5BVGB 1OV4A 3ZDFA 3CCFA 4QUJA 2VT3A 3ZNNA 1S2LA 3DKVA 3AZQA 3QBTA 4G0YA 4IHJB 4PX9A 3ROEA 4PCAA 4KZKA 5HILA 3T41A 2PL5A 4O2AB 3P9KA 5K99A 2Q0HA 5A0FA 1QCZA 1NF9A 3UYLA 1A2BA 4YXWA 4IX1A 4OLFA 1F8YA 5F9FA 1LGYA 4MWEA 2X5XA 2CXPA 4MMXB 4OAQA 1GNSA 1GU1A 2HN9A 2QUAA 3JR7A 5AK3A 621PA 2GM4A 2ZSKA 4KN5A 2V7PA 3C5EA 1QE5A 1J06A 1AO0A 4O4JB 4IGAA 4RK1A 1N5IA 4S0ZA 2CW5A 5ILGA 5E3HA 2QE7D 5AH0A 4DLTA 2FOIA 2C96A 1TGVA 4KW7A 2OCXA 2EDCA 2BN4A 1NVBA 3KOMA 2R8BA 3KK0A 1G8MA 3C6ZA 3EDYA 3JATB 4CIVA 2KS6A 2O8BB 5DIZA 1UOEA 3NVAA 3ADOA 5LB2A 5JI2E 4POOA 3FDJA 1HRDA 4DT1B 2WTBA 1NURA 3CH7A 3F7TA 3VZRA 4N6OA 3M3DA 2PX2A 4WAUA 4N0MA 1T5TA 1N7HA 2P3LA 3GRAA 1MB2A 3VV2A 5JQGF 2BFDB 5AOBA 1I10A 2PKYX 3VNUA 1MRZA 3CLSD 1C9YA 1VIYA 3D81A 5FL7A 1BYUA 1V7ZA 2ZJ7A 4O4LA 4NU0A 4BTEA 3CKLA 1TPZA 1Z2EA 4NZPA 1LBIA 3RAGA 1W5AA 3BQMB 3NDBB 1WLYA 2QX6A 4M2LA 3BCSA 5JAMA 2X86A 4UD6A 4UTOA 1MO6A 2ANBA 4TUYA 1Y9DA 5TLSA 1L7MA 1V45E 3GP5A 4F46A 1IPHA 1NATA 4U3JA 2OLKA 3M1YA 1C4OA 1MO5A 1TF5A 3BKXA 1IYZA 4AECA 1PGQA 1CUVA 3USES 3QITA 2AH5A 4G4IA 3VO8A 2QD5A 3PKJA 1U7XA 3ASVA 4QASA 2QZSA 5F2EA 2DH6A 1RAEA 2CLKB 5EZ5A 1KP2A 1ZSVA 1UP6A 2WABA 5EXEA 1MAHA 4H7DA 1XZEA 3ORFA 1N33B 3HB0A 3OCXA 5THQA 4LNAA 1P8AA 4GG1A 3UV7A 4YLGA 4LRXA 4BP1A 1I32A 2GK3A 2FK8A 4V2UA 4B33A 3OPYA 3CXUA 1PS9A 3A6HA 5ERGB 2H1IA 3OC6A 2ZG6A 2W2PA 4IDCA 2RSLA 2Z2YA 4NDNE 3EVZA 3AKCA 3UKJA 3C7DB 2KHZA 3DE2X 2DKFA 1IZ8A 1SD1A 2H1RA 3BWXA 1QG2A 2ESRA 2MSWA 3DG9A 4OP3A 3FB1A 4P22A 2LCFA 4HGQA 4QQNA 3MGKA 3SD7A 5FPYA 1OSNA 4JUIA 1I4WA 4OSEA 4U2GA 2V7UA 5G3ZA 4Z53A 3LWZA 4QSHA 4RPKA 4MVJD 1L4EA 2NO4A 2BDUA 2WYUA 2H3EA 3RC2A 3T95A 4BNTA 1YMVA 3AVWA 2HDWA 2IDZA 3ICVA 3I83A 3PENA 4NY1A 3STTA 2OUKA 3ANLA 4I9HA 1II8A 2B7BA 4OSOA 2E5LB 2IZOA 2QVXX 3ET5A 4YRPA 4HNVA 1N2JA 3BB4A 4OBEA 4JI2B 1XZCA 3Q3GE 3KSAC 4IY1A 3UPTA 3M6FA 3AXSA 4BO9A 4XQEA 2PUHA 2BGKA 1BMFD 3CLVA 1X8JA 4X62B 2A9FA 2R44A 2V1XA 2PMFA 3LL4A 1JZSA 4BLPA 4OYRA 4GKBA 4V0LA 4HXYA 5E6SA 2WR8A 3FI9A 4LRSB 2HJSA 1PZFA 3BGSA 4Y0NA 4YRAA 2AIRA 1BKSB 2OXRA 5EIAA 1Q91A 4HDSA 2ADOA 2D8MA 3LHSA 3F6YA 1GEEA 2QOEA 1V3TA 3PUKA 3VO2A 3F1LA 2AJTA 4KRGA 4ZEVA 3T0GA 1JXOA 1UPAA 5HSGA 1PJQA 3JX9A 2BGWA 2L0XA 3L7BA 3ROTA 1Q3TA 5CA1A 3THOA 4PSVA 1PLLA 4LMAA 4NOMA 4RD6A 2JANA 2B82A 2WSBA 4JC0A 2ZETA 4E2WA 1QOZA 1YQTA 1M9NA 1ZGBA 5KYWA 1DC8A 3H86A 1JG2A 1L4HA 3SJCA 3BJRA 2QXYA 2H48A 1AC5A 3E81A 4W5WA 3PPVA 2QT0A 1KMHA 4BFSA 1Q2UA 3JQCA 3A10A 5DI3B 4ZT7A 1M0SA 4IGFA 3NMUF 4Q1DA 1UFOA 2IUSA 1GCGA 2FG6C 1G41A 3AUUA 3L77A 3OTGA 4MWDA 5K8CA 3GH1A 3UWSA 4M76B 2R0QC 1WPRA 4H77A 2XGSA 3Q3JB 3VR4H 4C21A 1QV7A 3PGMA 3WL6A 3NTRA 1WVMA 2GD0A 3ER6A 4E4TA 1Y6ZA 3RYCB 4V0RA 2I1VB 3LV8A 1O94C 2G4VA 3SC2B 1QS0A 3AERB 4ES6A 2G8NA 2P8SA 4IYJA 1W52X 1G16A 1RWNA 4L6CA 2ID4A 2VJLA 5TS3A 2WAMA 3AEKA 3W1VA 3NKLA 1A9QA 1N3IA 3W5AA 4CQJA 2Z3ZA 4X97A 3KV3O 4X94A 3IVGA 4C29A 2F3TA 4FR5A 1N2BA 5FRDA 1VSUA 5AYVA 3O4HA 3EXG1 5T4FA 4OHWA 1DAEA 1KP9A 2WM8A 1NW5A 2O2SA 3RYIA 5AVXA 4X66B 1H42A 3BTUA 1UBFA 1YTUA 4WE3A 1RXUA 2RJOA 4Y6QA 4PWZA 2GNPA 1UPFA 3TLZA 1W5EA 1KZHA 1CR1A 2YHIA 1VG1A 3IHLA 1P31A 3KVRA 4GYJA 4RHTA 2AEJA 1W35A 2VDPB 3CUWA 3DLIA 6AT1A 5JTUA 5E95A 4DVGA 4HBGA 4B2IA 2C2GA 1XVLA 5JSZA 1J0CA 2PBRA 1D5WA 1XG5A 1OBVA 2ECQA 2VZ0A 3BMOA 2VSFA 3MWEB 3T5MA 1ZVVA 2JI4A 4GM1A 2ZYRA 3K0SA 2JGKA 3G9ZA 3RAEC 4RWZA 4YV2A 2HF8A 3HRHA 5AXDA 5BSHA 3R40A 3WIUA 2IXGA 4JP8A 2XMRA 3E23A 4RHYA 3K0AB 3HNOA 4RJJA 1XLTC 2LW7A 1J2EA 3WAGA 1G5FA 1QIKA 2GEDA 4N5LA 5KX5F 2FHSA 4PQRA 4BEWA 3QVUA 5HM8A 5K3DA 1PKXA 2QDKA 2Z8XA 2HO4A 1J07A 1IQRA 1KXJA 1SELA 1SUAA 3OCZA 4HQ6A 1CUIA 4KTTE 4II2A 5FOXA 1QF7A 2GT1A 2INGX 2OP1A 1RLTA 4J9UE 4KLAA 4PXYA 3HTXA 3NAGA 2WSLA 1R66A 1Z5UA 3JYLA 3F71A 1QYWA 3E9DA 3FDZA 3M2TA 4G5SA 4OAPA 4RC9A 3N28A 5AM0A 5AM4A 5HK8A 2DRIA 5AQ1A 2F67A 3CV3A 2G63A 3DOFA 2D3TA 5TDHA 1O95D 4ROSA 4KR6A 4Q21A 1QOQB 4AJPA 1E2NA 3QVLA 2NQ8A 1GCIA 3VYUB 3K8OE 4A27A 5A5GA 4B82A 3RBVA 3INTA 2P90A 3SZUA 3PX2A 1Z4OA 1L5QA 4B9AA 2ZSUA 3HBNA 3IOMA 4MS3B 3RWOA 3PX7A 4PG7A 1NASA 2YTZA 1E8DA 1PVOA 5KNDH 1PJZA 3VU9B 5JNWA 1O4WA 3OCCA 4K9RA 3OY7A 4QDTA 4LE0A 2EATA 3EHDA 1KO4A 1I36A 1UWVA 4XDYA 3TW4A 2JAOA 1T3SA 4XM2A 2W2OA 4RV9A 3AHHA 3EFOA 3DEZA 1VB3A 4P80A 1NE2A 1V1MB 1T36B 3BHNA 2OFOA 2H29A 3ZOKA 3EDMA 5DLDA 1TK3A 1AKYA 2PO7A 3P4UA 1IBRA 4S1OA 3UMBA 1TYCA 1G20B 4N03A 2BFCB 4A6DA 3P2JA 3VR1A 3KUDA 4NECA 1RRGA 3TQRA 2IXEA 2Z9BA 4IIXA 3LY8A 3UC5A 4J90A 4WECA 4HNTA 4MZDA 4RZHA 1UC8A 2G1JA 3WDKA 3QEMA 2OHJA 4OGGA 4QX6A 4Y6PA 5DOZA 3PSAA 5HM6A 2WTXA 1V7QA 2DETA 4XVCA 4LJ7A 2HA3A 5BOSB 1XELA 2B8NA 1L1QA 4WCVA 4RTMA 4GDMA 1JHMA 2YR0A 5BSUA 2Q5EA 4OFZA 4ER3A 3NFRA 1KI2A 3GZ4A 4AK9A 3AEXA 2P4EA 3JQPA 1GRNA 1P9LA 1T1SA 4Q1AA 2ZCVA 3FAZA 3C3AA 3IMFA 1QRUA 3L01A 1DX4A 3QVKA 5HIMA 3WDMA 2ZR8A 1S8OA 1DDOA 3H2ZA 3NYRA 3OHPA 3L8GA 4MW5A 2J8ZA 1EA5A 3DZBA 3GEBA 3D8HA 4H1HA 4HRYA 1OTYA 1UBEA 5ALSA 1M1YA 2ZBPA 1SXGA 2MOKA 1UPTA 4CL0A 3DA8A 4RKRA 3KQYA 4O4IF 3RODA 3EWSA 1PL8A 3ZWWA 5IZ4A 3EVEA 2W70A 4TTAA 4GBED 2OB1A 3BTVA 1AZTA 2X4IA 3BFKA 4Y7CA 3RW9A 3U1VA 1AJEA 3H5AA 3TPFA 2GCOB 3EXFB 3A1VA 2O6LA 3N05A 2HNBA 1T0PA 2JGDB 1Y34E 2PVCA 4UPDA 5C1PA 3NVKI 3K9NA 3D3EA 1N3LA 1PQYA 4XM0A 5H0IA 3TSCA 5HKAA 2XQIA 1VE7A 1NU8A 5FFMA 4DLNA 1IN4A 2NM0A 1M74A 4D8WA 4E1BA 3K1AB 4NZNA 3T1OA 1VKOA 4CBVA 4CQLA 3IEXA 4E5DA 3DOJA 1KH1A 4QRHA 4Y98A 5ALIA 1QHHA 4C4YA 1ZH2A 1GJRA 5CAEB 3FX2A 1FDIA 3QVOA 4D9JA 2Y67A 1NSFA 2XOKA 5LQJA 3FWZA 4TXJA 3VYRB 2H2AA 1OIXA 4IXDA 5HGXA 4DMUB 2VP3A 4KWCA 5LD2B 2PUBA 5BRAA 3BILA 5T4BA 3EIXA 3G8YA 4HEJA 4HFRA 3S4YA 4E5KA 1WZEA 2I1WA 2G80A 2FSFA 2QVLA 2YASA 3EDQA 3K15A 4IJMA 5A3QA 4II7A 3N59A 4JU9A 4P3KA 4ZVSA 5CX1A 4CLEA 3EE6A 1ECGA 1YE5A 2JNWA 4QG3A 3LUKA 3TLMA 4NP6A 1BFUA 4HFMA 3OZTA 5CH3A 3UJ6A 2D2XA 4AKEA 3WL8A 3RSFA 1NKSA 2JLYA 3FD8A 3SEQA 4CM8A 1F8UA 5G4KA 2VJMB 3LL7A 4YLEA 4LJYA 1XD2B 3OX1A 1WCIB 2VKTA 1ZIPA 3AETB 5ALOA 4BLUA 3WO0A 3LQRA 1DCFA 1JIJA 1S0UA 1F17A 3H11A 4RA6A 5G4KB 9MHTA 1KQOA 3WKDA 3R3HA 1LVUA 2UUOA 3L8EA 2J87A 3N2GB 4WIAA 1SEVA 3K2IA 3QU9A 4BUCA 1N8NA 2PX6A 5KTKA 1HFKA 3TFQA 1G20A 1L2TA 1P4HA 4LWQA 1VPDA 3TBKA 2K87A 4OJNA 5DNEA 3BMQA 1QHXA 4C0KA 2Q5CA 4BECA 2H51A 5IJ0A 4REOA 4RE5A 3AI2A 4Z54A 5ICCA 2OO7A 1CBUA 2W6IA 4O4JF 4TN5A 3WWEA 1CUDA 3U17A 3NHKA 2Z5FA 3ZCQA 4R2HA 2WICA 1MJ5A 3KB1A 4HWGA 3X2FA 4EABA 5K6TA 4P54A 5E3JA 3RH0A 2D2EA 3M1IA 1YCGA 4KODA 1Q0RA 1XE3A 3LZ6A 5FF9A 3RVSA 5EJ8A 4PLYA 1LDMA 5AW9A 5C1IA 3MWFA 4ZOAA 3BJIC 4IIGA 1TB4A 1ZP6A 3A1CA 4J4TA 1VCIA 4L0QA 2H08A 3VPAA 1Q7GA 3TK1A 4CMIB 5IBCA 3ANXA 3CCBA 2OD9A 3DE6X 2P27A 4NFSA 4AQ7A 1S4QA 1ABEA 1N7IA 1ELOA 1B6SA 2GPWA 5B7GA 1C1YA 2JFOA 4IS3A 4Y1GA 3AZPA 3EGXA 3A1SA 4QXMA 4GXNA 1SXHA 5DNDA 2JZOA 2IOQA 4PPFA 4DRYA 4MWGA 4YMSA 3EG5A 1ZOSA 4NNOA 3U4QA 1U8AA 1OREA 5BQXA 2O3UA 3HLYA 4AB1A 4R0NA 4ARAA 3U1TA 1MEEA 1JFFB 4EHLA 2QTGA 4MEAA 4REQA 1JTFA 2UYCA 2B1JA 2WJIA 4KXNA 2YZNA 1Z2PX 3LHFA 3IKVA 5C34B 4ZI7F 4UUOA 1A88A 1ZKDA 3IV7A 4GU5A 4LJ4A 5LDGA 3TTSA 1QANA 1L4GA 3F8TA 3NWOA 1U9CA 4BLSA 3ZZ1A 1C8LA 1H9BA 2G77B 2OESA 3FR7A 3GOQA 3LXXA 3OZXA 4Z2YA 4AZSA 4C01A 3IOBA 1GSOA 1YS9A 2NZ2A 4XLLA 3GWZA 1GTL1 1TT5A 3L79A 2PLWA 1N0IA 5TMDA 4PANA 5C5IA 4UTZA 1IHPA 2I87A 4ZT6A 3A36A 3BHJA 4AULA 2DLCX 1BCRA 1V43A 1SVKA 2YWCA 3VQTA 5T41A 4GBGA 4DCSA 1KZGB 2NQ2C 4A1OA 1QV6A 2P9TA 4DJ5X 2BFPA 1U9ZA 4UUMA 4XCQA 1P5RA 3D6HA 1DQYA 3GUCA 3EBLA 4G97A 1ZD3A 4BVBA 3B20A 4B6OA 4Y2QA 2ZZNA 4LOIA 1JI3A 5G2OA 3KPUA 4YCNA 1Z18A 3EIFA 4L4ZA 1E6MA 4HUJA 4PZLA 4H6WA 5BT8A 1QBKC 3T3GA 1NW7A 2GHQA 4DQDA 2FPWA 3OQMA 1TUIA 1U0NA 1G20E 1OGYA 3IQFA 4NS4A 2JFZA 2QX9A 3OO1A 4JDPA 4R1SA 3SNHA 1R6TA 3F4KA 3K5PA 2ERXA 3BAFA 2BFCA 3A9WA 4MPRA 1W85A 1T24A 3LUJA 1GL6A 4BZWA 5CVDA 2QRKA 5EQDA 1ZJZA 4M22A 5AJHA 5CDTA 3ZWNA 3H87A 5JS1A 1SBCA 3NWBA 3WK6A 1T3LA 1ORHA 3RF7A 1B3BA 4E21A 3LVRE 2A59A 3UQYS 2QTNA 2BBOA 3KJEA 1H1LB 4W9MC 2PCLA 1MKYA 5KTSA 1PR6A 4Q4DA 1KVSA 4R1MA 5H59A 4M89A 4JT8A 4W8GA 4ZVLA 3LT5A 3PXDA 4PLZA 4D26A 2BI7A 3SF8A 1GT6A 2ADFA 5GIPE 1KYVA 2ARKA 2OENG 3KKZA 5EUMA 2MCFA 1CQIB 1P80A 3RS0A 1O6ZA 4ZZ2A 4DJFC 3LW8A 2JS7A 2IELA 3E70C 3JARA 4RAOA 3ZDBA 2EL7A 2RHHA 2YCLA 2JDIA 4MTCA 2ZJBA 2GN9A 5EN4A 5GM1A 1YCDA 2CXOA 2HXYA 3DL0A 1WZIA 3CNBA 4X95A 1S5PA 1QTIA 5TJ9A 2FEMA 1DBIA 4K26A 4KWIA 3FNGA 5JJ5A 4IIJF 5EGSA 4F92B 5AVQA 1PUXA 1CIJA 4HGYA 2R6ZA 1NMYA 2IYOA 5K0CA 5KJ6A 3C3YA 5EPOA 4OCZA 4IICA 1XQ1A 5TSDA 1K92A 4NV3A 2P30A 4FMCF 4LDNA 4NZOA 2DPHA 1U7ZA 2RFLA 4LNUB 1P73A 3SLRA 3MWKA 1QR6A 4Z4CA 4KRFA 2G5TA 2J9XB 3RS9A 2WZBA 3Q3IA 1SXQA 1MJNA 4ZFNA 2Q1WA 2BMAA 2YWJA 1L5NA 4OJMX 2WJVA 3F5DA 4RGBA 3OMXA 3TO5A 2R8EA 1Y8AA 3HCOA 1E5QA 3SZRA 2AE1A 3P1JA 3NH6A 2BZGA 3BIOA 4M9QA 1XEXB 4C0HA 4GYKA 1BHQ1 1EX9A 4U2BA 1ZCFA 5B6PA 4E4YA 3ILXA 2ZYHA 5JDIC 3BOSA 2FWPA 3HRKA 4D44A 2IBTA 4DCCA 5JAZA 1WPXA 4KMRA 5K3FA 1J0XO 4RKQA 3H1PA 4ZO7A 1KR2A 3Q8XB 5FUXA 2O2IA 1EGHA 3A7EA 3E27A 2Y66A 3OU6A 3TBHA 1ZD5A 2PJDA 3U39A 5BQFA 1UXGA 5I9IA 3ZD9A 3VC1A 2WTUA 1U98A 3F6RA 4DCTA 4K0KB 1LK7A 5CJJA 2OB2A 3O75A 4ZT5A 3TQTA 5JZSA 3ETGA 3E9EA 5GZ3A 3FXAA 3UBTA 4IMPA 5G4LA 2G76A 2SECE 3AXTA 4JP5A 1DS6A 5LZ2A 3ENVA 1G0OA 3T5DA 1XU7A 4REMA 3RVNA 2IPXA 1J09A 1W4BA 4AMYA 1YZUA 1TFUA 5IAOA 3M5DA 1JDVA 3FPLA 3I2IA 4TRJA 1UIRA 3LYAA 3ODPA 1Q84A 2C9BA 4BKRA 2Y92A 4UNRA 3HJBA 1J5XA 5LQAA 4MO9A 3OC0A 4MJ3A 3DVRX 2XD9A 1VBNA 3ZIUA 4BFXA 4Z9AA 4C9BA 2BUBA 4CLRB 1YOVB 2KE5A 2ZIUB 5CB4A 2DERA 5K2OA 3QUCA 2B9EA 4FE3A 2DCUA 4D25A 2VVTA 3I05A 3M9LA 1SU7A 4LYHA 1KAHA 1GXSB 2R68A 4DSAA 5BSFA 3E5NA 3K9FC 3ABIA 3EF1A 3ONFA 2ZYTX 1ABBA 2P4UA 5DASA 2UV8A 2ZIEA 4MW9A 3K16A 4HF7A 2HHAA 4EB8A 5DB4A 4F1KA 1NNEA 2HEIA 4MIYA 4O2RA 4Y8VA 3WLQA 1Y8QB 3WZMA 4K5QA 3PXCX 4NAVA 1N7GA 3EQ2A 1LNSA 1WUIS 3IQIX 4TYPA 3N8IA 3C0KA 4G1EB 3KZCA 6NULA 2Q9UA 2BM8A 3VXKA 1RI5A 3CLRC 2VF7A 1NVKA 3FRIA 4XVQA 4ZVOA 2AI2A 5CH5A 3I6YA 1GLGA 1NXTA 3EZGA 2QUZA 2YXLA 3MPUA 4HDQB 4V0KA 1K5DA 4XDGA 5CRIA 3W9SA 4CKBB 3TS1A 2HBRA 5CW1A 3PFCA 3O1LA 5B37A 2HWKA 2WT4A 2AWOA 5E9AA 4AXBA 4D5EA 3CISA 1JP7A 1JRLA 2P67A 4O29A 1FFXB 2B3TA 1K27A 2EDAA 4AWBA 4PONA 1Z06A 3LO5A 4C6SA 5FOQA 1EHYA 4RY8A 3R5XA 1GZUA 2AR7A 2ATIA 3PP8A 4NL4H 2Y3IA 1GQQA 1R5OA 5KZMB 4H7IA 4UUNA 3EB9A 1AF4A 4KIFA 2BW0A 4A3SA 4WA7A 3WRYA 5EJ7A 2IV7A 4H0CA 1W581 2RGCA 1AN9A 5LYJA 1E92A 2AUMA 2OAEA 4PLWA 2WB2A 1FPQA 2D00A 4MS4A 2BM1A 2O14A 3G2NA 8ABPA 1Y8ZA 1HQCA 2IEDA 4I5EA 4CMGA 3K96A 3TUZC 1JEQB 2W0SA 2CNNA 4PPQA 3GUVA 1UP7A 3O8LA 5BORA 4WK0B 1Z4IA 1QHIA 3BQ9A 5F2NA 1RWKA 5EIBD 1TEHA 2EHJA 2GWRA 4EY3A 1D3AA 4Q4AA 4XSHA 5IXJA 1NXVA 3DTNA 3WRWA 3VJRA 1FVFA 1C9KA 1NZDA 1LTKA 4OU5A 2BGUA 3IAAA 3P9SA 3U2QA 5EIHA 5J43A 1ZWKA 3GD7A 4CKZA 3L7LA 2ZDGA 2LWIA 1JDTA 2YMPA 5AVKA 2IH2A 3TF5A 3U3JA 3WK5A 4F7DA 1E1KA 2G9UA 2ZR0A 4MRPA 1GPH1 3D4IA 4GP9A 4A0SA 1KOLA 2Q2NA 3Q12A 4KC0A 2V6GA 3HO6A 1L9KA 4JLKA 5SY4A 2FETA 1U63A 1WF3A 1SCUB 1Z39A 3LBNA 1DQZA 2I7TA 2IEZA 4LI0A 5B1DA 4R3WA 1NTOA 4KGXA 5C5DA 2P2DA 5EXXA 4A0GA 3OIWA 2CT8A 2HEGA 1ML3A 1A2OA 3K30A 1WW8A 1D0SA 2FN7A 3ZDAA 4QDXA 3WJ2A 3DE5X 4NOLA 1EXWA 2MU1A 4LX8A 3HNPA 1UKBA 3VU3A 2JHGA 1BHSA 2QKYA 1WU8A 2HHJA 1U2ZA 1T26A 2FPXA 2DKOA 5IRCD 1CR6A 3SZ3A 2G83A 1EFVB 2GBLA 2F48A 1C29B 1MU0A 1TUEA 3DO8A 3NPMA 1R74A 1U2QA 2GKGA 4I4NA 4INJA 3UFXA 3ZEIA 3ZCUA 4F96A 4YUYA 4B9EA 3ZBTA 1ZVJA 3FIUA 3KD3A 4JN6B 5D86A 2OHOA 5IJ9B 2WHPB 1O0SA 1YQXA 5KUTA 5H82A 2VUUA 2OR3A 2OA0A 1QGED 1OT5A 4JJ4A 2IH5A 5HQ3A 1HT1E 1ONPA 1NLYA 1NQAO 1FNMA 1TKBA 3DQPA 4TS3A 4YRLA 3R5TA 4EUKA 3M9XA 5CM9C 3HHPA 4AS1A 2WM9B 3EY4A 4MKIA 3CPJB 3K2BA 1O08A 1T9GR 4BVAA 2AFIA 3IPCA 1CRLA 5FNZA 3GA7A 4EVIA 2H5IA 3OLZA 1OQAA 4LWZA 2XRZA 3Q72A 1ADBA 4URHA 3RK4A 3Q8LA 1QHNA 1QGDA 3MD9A 1NJ1A 2FV8A 1W47A 2AZTA 4PQYA 5A9SA 1IVSA 2NO1A 4QE3A 4A91A 3RASA 1RRCA 1L9XA 1SCKA 1BXGA 2HJWA 2O4UX 1VXOA 1MQSA 4RVDA 3R7WA 4NJMA 4BP9A 2JA2A 4BU1A 4CKCA 4HLDA 4GVLA 5A4AA 2NV0A 1U7PA 4GSYA 2KBEA 1PYGA 2LDXA 4HDMA 2ZWPA 4Y9SA 1WEHA 3IV9A 1ZM7A 3IQDB 3L6BA 4G9GA 4YRMA 3L2OB 5DWVA 1V47A 1B0UA 3B53X 4Z99A 1GA4A 3RABA 2GB4A 2FW8A 3JR3A 4EKNB 1PWHA 1ZSYA 2ZT7A 5HHTA 2RIPA 4M0PA 6REQA 2IHZA 1VJ5A 4ER0A 1A2KC 4L4SA 1RD4A 2X0RA 4Q05A 5CH8A 3IDFA 2DM6A 1IXYA 4HN4B 2XUKA 4QEZA 1DKMA 1SZCA 2GX6A 2BMVA 4C2UA 1A8IA 2WKPA 2PFKA 3EOBI 3RTCA 2EWVA 2OCGA 3GOHA 4UNPA 2VBCA 4D99A 3MHTA 3N87A 4YAUA 3RU3A 4FYHA 4MUYA 1JH8A 2PKWA 1UKCA 3RUDA 1S96A 5JEDA 1TIKA 2OHVA 1KI4A 2BE9A 1YB1A 4QBFA 4KOEC 1AK9A 3OQNA 3E8SA 4GC5A 4C7VA 3K70B 3N39C 4L8YA 2GM3A 2QTCA 4GOKA 3EYWA 4D3XA 3LQ1A 1V37A 3ZY6A 1XI2A 2O1XA 1XEWX 2WNHA 3RRFA 4BVGA 3IVRA 4FB4A 1VE3A 1RI4A 1ZJ4A 2FKNA 5A6VA 4ZODA 4N5IX 4AU1A 3D6MA 3EFOB 3SZMA 2ECPA 4QUBA 4J49A 2YINC 1IOLA 4F8YA 2DBZA 4B7XA 2MYUA 3T35A 3LRTA 3L4JA 1JJFA 4NS1A 4YCCA 3F9IA 2HMSA 2AG1A 4NZMA 2E49A 4XUGB 3V00A 1IBMB 2QPAA 5IJXA 5B57C 5F23A 3CEJA 5KIAA 1GAJA 5G41A 3W06A 4EFMA 5KU7A 1CUWA 4P2GA 4QDKA 5HWSA 4WXHA 1EIWA 1LB1B 1OX4B 2OCDA 4ZYTA 2Q62A 3DNPA 3IEPA 4I55F 2WJ3A 1GKLA 4G09A 1DJLA 2DPYA 3DS8A 1M83A 4B4DA 4JL5A 1EGAA 1PJLA 2PR2A 1EJ2A 2ODPA 3ECSA 5JSQA 1LY1A 4UVGA 3QJGA 3BXFA 4I1IA 3UHAA 4BO5A 4W1RA 4DCOA 2G36A 3CW9A 2PKXA 2FPSA 5K8VA 1FQWA 1BXRA 4DLSA 2QLFA 2VDNB 4WGFA 1WP9A 1YUBA 1K66A 1LW6E 1P4GA 3BXEA 421PA 4JZYA 3VKVA 2EJVA 5TPZD 4Q39A 3O8QA 1BMQA 2Q5QA 1ZESA 3IKJA 1X74A 3EW7A 1UCFA 1YE3A 2XB6A 3CH6A 1PAUA 1R1DA 2K7ZA 2YNMA 3NONA 3W2FA 3AY6A 3D3KA 1I6KA 3QELA 5JDCC 1RPNA 3OKFA 1E1DA 4XCXA 4BZQA 3SY8A 1Z2DA 3BXPA 2AA3A 3C43A 3WAJA 1HDEA 3KJXA 2PXHA 2QLJA 3OWXA 4AG3A 4C06A 2WW8A 5HUJA 1U3FA 2R86A 2G1KA 1WUJS 1E94E 2HJGA 2FW7A 3HEBA 2DPXA 3GLIE 1NQUA 1WSBA 1SKAA 4LY9A 4X7PA 5IKMA 4XIJA 4F71A 3L1KA 2ZSHA 2TMKA 4RKEA 1EWRA 1E6UA 4YAWA 2GPJA 4G5FA 1UK8A 2BKLA 1PR5A 3RYIB 2XGOA 1OY1A 4G1VA 1MAAA 1EBUA 1C7QA 4PSUA 3OPXA 1GSHA 1G60A 2EIHA 3H8JA 4WY8A 1J7KA 1I5EA 3LT4A 1C0LA 4UUPA 4GNRA 1U2TA 2HF7A 2JVIA 4CM7A 5B58T 3Q3HA 2CFOA 3ZQ6A 1WIWA 4YJGA 1XN4A 5ICSA 1EFDN 1Z3IX 2FZ5A 2AN3A 4F9TA 2JFPA 1YU9A 3VPFA 1S8AA 4XDHA 1MIOB 3MBIA 4FSDA 1LS1A 3C3KA 3G5UA 5FPQA 4PHTA 4C4SA 4EO4A 2IODA 2OAQ1 3R3YA 1UMBA 1X1DA 4FMDB 4XAQA 4P0QB 3U7QA 3MAAC 2C7RA 3R7DA 3GFQA 2QDXA 3E61A 4IDFA 3TLJA 2QAIA 2CGEA 3RFVA 1XC7A 2EBFX 5EZYF 3T9AA 4DLBA 2O7NA 4YJ3B 1MJHA 1RRMA 3AJAA 3E5HA 5SY9A 5KI6A 2ENWA 3KKPA 5FQNA 4LCBA 3UFXB 1UJBA 2P9EA 1WXXA 2PZFA 2OXTA 1U5AA 4LBZA 3HFRA 5AT1A 1QIIA 3ZEAA 4FI3F 5A0TA 2XUOA 1X42A 1W8IA 3TZKA 4G85A 1JWBB 4EAQA 3MTBA 1LVGA 2VTKA 1BEUB 5CURA 3HXOA 4US0R 2PKEA 3NIGB 4NENB 4DYDA 2EZTA 2WNIA 3RU9A 4B47A 5FI0B 5AW6A 2RK3A 5LXTF 4EK9A 3EMKA 5KNDD 1S1CA 1EWKA 3RCBA 3UT6A 4B6FA 1SPBS 821PA 2CV2A 4JEMA 2KLBA 2YQZA 1JGTA 3CEAA 3ZE1B 3PFFA 2CBXA 2ZU0C 1E3TA 4MIKA 1ODLA 5CPFA 3WHIA 3NKFA 1AN0A 2GFIA 2QRGA 4UHKA 1CWUA 2OZPA 4ZV7A 3ZWXA 4B4OA 4ZJPA 2IZZA 4DNPA 4F5ZA 1VBKA 3V6MA 1IHXA 3B12A 4R1NA 1VPEA 1E8NA 4KREA 4GPTA 1UKZA 1XPJA 2JD2A 2C82A 4OGLA 4R7GA 2X4DA 1WKVA 4R9UC 5KX5A 2P5UA 3L7KA 4MA0A 2JLXA 2VIIA 4PGAA 2BL4A 5JYCA 2VSQA 2V1UA 2XUZA 1O9GA 4JYAB 2B69A 4Q4AB 3O8NA 2C95A 3L18A 5B2EA 1E5LA 2YNMD 3HY3A 4TT3A 1LLDA 4FI3C 5JAPA 2JDID 1PT6A 1R9NA 3OE4A 3IKTA 3WHPA 3ZWDA 2IEBA 5LZ4A 4DR3B 2K4MA 1ZOLA 3MWYW 4PYKA 2M1XA 4GW3A 4FYPA 1U6JA 1OV6A 4GMXA 2WZDA 3EDRA 4GZLA 3FPJA 1E98A 3N8HA 5KNBA 2VNIA 1TXGA 4L0CA 1U11A 3VPSA 5LL6P 1BXZA 5D8DA 4ZT2A 3QVVA 4TZ6A 1W6RA 3MTGA 5G53C 4GOOD 1LV7A 3V4PB 4FDUA 4WWHA 3NGXA 5HE8A 3H2SA 1FXWA 2D62A 3UWPA 2OV6A 4OOEA 4Q66C 3B7GA 2IDMA 4BUJA 1SG0A 1EPUA 2PGLA 4EL0A 1KMNA 1FFSA 4LYGA 4KUGA 5BOVA 1FFXA 3ZHVA 5HQ3B 5ITWA 2VRWA 5K3AA 3P26A 3AR6A 4UHBA 4A8HA 3ELYA 4Z7OB 1F7VA 3Q9SA 1XDDA 2XKJE 5C8YA 1OI2A 2ZUUA 1R8JA 4GT1A 4E15A 3THWB 2RGWA 3CTPA 2VTBB 2HBZA 4DG5A 4PTLA 2PRYA 5J4LA 1XPRA 1GFWA 1TKAA 2PEYA 2CLHB 4Q3DA 5CK5A 3IMKA 3VH4A 2CFCA 1KS9A 4BNYA 2HA7A 3ICPA 3IOEA 2HU8A 2Q28A 1C0PA 3HYSA 4HS9A 4KPFC 3DBRA 4D5GA 3GNLA 4L74A 2VTVA 5B1HA 3WKAA 3BMNB 1GRVA 2W11A 4KSBA 2W83A 1Z6GA 2HPZA 3L0DA 4XVHA 4B17A 4YMUA 5CVVA 2X2OA 5I7RA 4FINA 2HCFA 3C5HA 4XD7D 3BJMA 3Q6IA 3D0OA 4FN4A 4H59A 3U4HA 3FKJA 3L6CA 4WPGA 3ZXXA 3DDCA 1CUEA 2JK0A 2GR9A 2VEDA 1SXIA 4WXMA 4DRXB 2EWMA 5TQJA 1W87A 2PQ6A 3QQPA 3GEDA 4DBVO 2OKGA 3E9QA 3O4GA 4PN3A 1FDUA 1Y5IA 2RDMA 2ZBGA 1QVVA 3AR7A 3F6PA 1TC1A 3HCDA 4QYXA 1U6KA 3JQAD 3TJRA 1I24A 1OYWA 1Z5PA 2HDNB 3BBLA 2IGBA 1CRWG 4IRMA 5IH7A 3MQ4A 1EI9A 3NOVA 3V1LA 2WPDA 3RB8A 1RYDA 3PJRA 4DCGA 2B36A 3CUKA 2PQMA 1BJRE 4Z1MA 3MAJA 5K0FA 2XJ9A 3L4EA 1KVRA 3V4LA 2Z0MA 5T4EA 1RZUA 3RPEA 2A58A 4LMPA 3PKZA 4Y6OA 1T6ZA 2XYQA 4B40A 4YYEA 4CODB 2LP4Y 1NBIA 3DAPA 3BHMA 1NRIA 2N0SA 3PQ7A 4IOLA 3FSEA 3RFXA 1TW3A 3M5CA 5DX8A 3KJFA 3NRBA 4DQXA 4GXRA 5JOQA 3M1LA 1C9MA 2XR1A 3DE0X 3P45A 4YVFA 5DN6D 1B26A 1EHIA 1XZLA 3A28A 1RVV1 3QQ5A 3KQNA 3AESA 1QFSA 5IVHA 5I6DA 3PFNA 5B53A 4G4SP 3WWDA 2ZUSA 1AMUA 2ODBA 3JQQA 4D3YA 3IMEA 1L6RA 4XARA 1BG6A 2P35A 1C80A 2JVJA 4JT4A 5F5LA 4D0NA 3GJ5A 2CXXA 4LK3A 4NULA 3RR2A 4BTLA 2W2MA 4Y2XA 1TA4A 1IWOA 3HP1A 2AXNA 3BZWA 1R8XA 5KVQA 4AJNA 4F1WA 2NYAA 1EVZA 3DBLA 3TWOA 2MR5A 1PF7E 3RGWS 2J7KA 4XWKA 2YY6A 5CX4A 1Y98A 4KR3A 2XAUA 1DFGA 1KNQA 1QF6A 1F48A 2J0QA 4PTZA 3U13A 2O8CA 4LTNA 1O5TA 2P2ZA 5K3CA 5KJCA 1X8XA 1F8FA 2I4MA 3AHDA 1SQSA 2PHZA 4RH3A 5HFJA 4CCAA 2PAAA 2R3SA 5I7WA 5HTOA 2FEOA 1GL7A 2P8JA 4H0NA 4ZI7A 1CUFA 1NNUA 2R8OA 4G5RA 1Z5NA 4A0RA 2BCEA 4RDXA 2QE7A 4WTOA 2ISCA 1NFRA 4HRAA 3QM1A 4EHAA 4DCPA 3COZA 5ALMA 2Q6VA 4WLVA 1V5IA 4AYWA 2PLNA 3VNQA 2BTQA 2E3JA 3QPWA 4MB2A 4BKQA 5KQPA 1ML4A 2L17A 1JPUA 1YMQA 1L4MA 4AUNA 1FSSA 4AY6A 2VTBA 5DYTA 1BVRA 4LF6B 1S1MA 3NEPX 5EWLA 3MJVA 4K9OA 1KYZA 3WNCA 5HKOA 3ZIAA 3V1YA 3O2NA 2N42A 3QG5A 3KYJB 3WWCA 2D2IA 4H6XA 3LPCA 1DV1A 3PZRA 3JWHA 3CUEF 3VR4D 1RBMA 2ZJ0A 1UF9A 1U2GA 2X7XA 4NCHA 1Y6FA 1ZUHA 4PRKA 4CHTA 4ARVA 2EL9A 4IZIA 1NQWA 4MH0R 4E11A 3EZXA 4OQMA 3OJXA 5T8KC 4FFRA 4A5OA 5IEJA 1XZBA 4MVWA 4RIHA 4UVDA 3E1SA 5LC1A 2PJUA 2Y1WA 1V16A 3ID6C 3G2KA 4Q47A 1QIMA 3DXZA 2LGJA 2AT1A 1JE1A 5KQLA 2Y05A 5EC8A 2CSUA 1AZLA 4ZAGA 3GZTB 4CMKA 1ZNZA 2FSGA 3QHPA 4MI1A 2VHTA 4L7VA 4PC2A 4LBWA 2X76A 4PX2A 1Z63A 2IYFA 3LU1A 3GLHA 2MT9A 5HG0A 2Z6UA 4QYTA 3UV3A 1XJQA 1WKBA 3I73A 3R4VA 2GBIA 2L19A 1JU3A 3EWNA 1Z2OX 2WFLA 2WJAA 3K5WA 4JU8A 4LOHA 4OHYA 5D5HA 1TC2A 2JIBA 3JD4A 1AQJA 4DTIA 1N0HA 3M4NA 1SKMA 2WDZA 2GD6A 5EWMA 3T3PB 3RLIA 2ZT8A 4JYBA 4PZEA 2C98A 4PN7A 3BTSA 3A3YA 3FJYA 3BWMA 1BE0A 5FCDA 4E1AA 1AKEA 3CB2A 2D2FA 1FBNA 1OASA 1XNJA 3RIEA 5C9ZA 5EERA 1W7AA 2IHKA 1EWQA 4FZ5A 1L1FA 3QIAA 3DCYA 4MWCA 4U0KA 4N0DA 4TL7A 3TLCA 5K1ZA 4UOZA 2QN6A 1Y6GA 1QQBA 2V4MA 1DWOA 3L7OA 4KPUB 1IXZA 3K9CA 4HK4A 3U7IA 2ZR7A 2GLXA 4J03A 1QKIA 1R5JA 2QYTA 4BC0A 3E53A 1CERA 1TD9A 2WIJA 3DSRA 2X42A 4EY5A 2FWMX 4DV3B 3I1IA 3HYRA 4A2PA 3DHEA 4MGYR 5JMOA 2JBAA 4RVUA 1MZPA 4DQKA 4OXYA 2IYNA 3OMLA 5F1PA 3PIDA 3SYRA 1QVRA 2VJBA 4AY5A 4KPYA 4L22A 2J48A 4HVCA 1C9JA 3GV0A 2PT6A 5BXQC 1QRSA 1KOJA 2IKQA 2YVUA 3RHSA 3NQ41 3AVVA 3OZEA 1E9VA 2VJOA 5CXUA 3IUYA 4WLFA 2OK7A 3DNMA 4B0OA 4KSCA 1IN7A 4KE7A 1ODFA 2V55B 3NM5A 3R6TA 3N6XA 5AJTA 2A9OA 3QPUA 1D2GA 1TCCA 2LIPA 2VYNA 2FMUA 3BBPA 2JZNA 3FMOB 1G21A 1HEIA 4UJ5A 4XB6B 3SYNA 3ILHA 4A26A 4GBMA 1Q7CA 4O2BA 5KWIA 1LS6A 3HO1A 2W9XA 3QTBA 1OMOA 2X58A 1PIWA 5JS6A 1XZAA 1VIDA 2W42A 3ILSA 4NCBA 2BMJA 2ACKA 3TTUA 2NXNA 3C98A 1WMEA 4YJGB 5IJZA 1L7VC 1NR7A 2AXPA 1HRKA 2XTZA 2C2MA 3U4MA 5HDBB 2J85A 3EEOA 5IT4A 1YS6A 4H7PA 3DD1A 2FZGA 4DLWA 1UPXA 2VK4A 1WNTA 5D6OA 3AVPA 3I9FA 5B3JA 5TVKA 5IM4A 3UW3A 3OBIA 5ES3A 1RP7A 3OURA 5I3ZA 1DAPA 2O48X 1ZRSA 1U81A 2P4QA 3I6ZA 3HKDA 4ZAXA 2F4VB 4Q02A 1SN7A 3CURA 4Y1RA 1JBEA 2FKAA 1RDFA 4HGZA 4HSEA 3T1TA 4E7PA 3AVYA 1PO7A 2M9MA 3M34A 3SHQA 2CVQA 4BQSA 4D3DA 2JK1A 1H8HA 2JA1A 2AMJA 3DAOA 1SXJB 1NXOA 4FCWA 4ZV9A 4QPDA 4TYYA 3DXYA 2PBLA 2GXQA 2HMTA 1XTKA 2C3MA 1WPGA 2JHCA 4B32A 1XHEA 2HQOA 6REQB 1FFBA 3L43A 3IYLW 3CC8A 3VHLB 5BR4A 5BURA 3S1LA 1P5ZB 2NAFA 3OT4A 1JA1A 1E1NA 4Z9YA 4ZVRA 4O4HA 4G5QA 3UAYA 4DAOA 4L08A 2IPOA 1RWMA 3O8QB 2Q6OA 2O5CA 1F5NA 1Z6XA 5BUSA 4OI2A 1FLNA 4KN9S 5U4QA 1U4SA 2C00A 3EFBA 3ZKAA 1QK3A 2QAJA 5TQ0B 1S8FA 2IZ5A 3D8SA 2GA9A 4QEDA 3VR5D 3OU7A 4KQ9A 1CXZA 2BTEA 1QVWA 1U1GA 3BC1A 3OJEA 5KVCA 5TPZA 2WSMA 1EE2A 2FJ0A 4EX7A 1CVLA 5CYFA 3JVVA 2XECA 2NZUG 1WMAA 4YQYA 4BLRA 2J5KA 3THYA 3LRPA 3I4CA 4ENVA 3PXAA 1Y4AE 3RYFB 3MUEA 3I39X 2J3HA 2WIFA 4H60A 3A2MA 2PD4A 5A7HA 4X91A 5AMXA 1UFRA 3FCEA 5FXMA 3U49A 4JQSA 5MFPA 3K0FA 1ECLA 1BRTA 3ZCRA 4ZAYA 4D6YA 1I6LA 1ILWA 1R8SA 1X1AA 3WBFA 4F85A 5A1JA 1W0JA 5JAUA 5K45A 1QRRA 2CK3D 3TX6A 3VVMA 2C4MA 3DEHA 1V8PA 2YIMA 4IKPA 3KQWA 4MQUA 1WQ4A 2ZDHA 5FQOA 4Y9DA 5KTPA 1MZVA 3JXEA 3AEZA 4D4IA 3WOHA 5ELLA 1QFJA 4F91B 1P18A 1FYFA 1LSJA 2B4RO 4KRXA 3X1KA 3PR1A 2FPIB 2QRJA 3OPNA 1P0IA 1LSUA 3N3AC 4HH0A 1JFVA 5AWFC 3WDSA 4E5MA 2V7BA 4HH4A 3ZE9A 1HA3A 2WIBA 1E4EB 5IC4A 2QRHA 3HLKA 2F00A 1RS0A 1Z4JA 2KB0A 3CX8A 1CUZA 2YWRA 1OWPA 4MUBA 4K2AA 1KMMA 3K53A 1HO3A 2O2HA 4KNVA 2BY4A 3JALA 4LHXA 5EHIA 3RTAA 4BNDA 1F6DA 1SWWA 2A0YA 1NHGA 3G8CA 3FB4A 1UQTA 4OUKX 2XGMA 3RIMA 1LZKA 3ZK7A 4U8GA 3DTVD 3WQHA 4YV1A 3LCCA 4ZO6A 4H9GA 4C43A 4CF7A 5LOVB 3NHAA 2JCGA 1IMJA 2R87A 5M04A 5F4BA 3VDQA 5LXTA 5ISMA 4ZYVA 2CL7X 2REQB 2VLIA 3KL2A 4BX2A 2X5OA 1T3HA 2J6CA 4MPTA 1RABA 2VN8A 2Q4BA 3KTAA 5FOUA 4RMJA 4E5SA 1KA9H 3LHKA 1KEEB 1R0YA 4TTQA 4WOJA 1T4CA 4YACA 2IYPA 4U9IS 1U3GA 3OQHA 3ZJ5A 5JY1A 5HZKA 3O21A 4N12A 4RQTA 1H8HD 1BSVA 1RYFA 1C7RA 2NUTA 3BD7A 1E9RA 3TCKA 3DM5A 5A3RA 4KXQA 1UC9A 5IKPA 1RLOA 1DNPA 1K4MA 2X1LA 4IGIA 5DT2A 3PNOA 4YP5A 1LZLA 1V4NA 1V11B 3OVMA 3KT8A 1X7DA 2A6PA 1ECBA 1M2GA 3PPYA 2PS0A 4FFNA 1QIHA 2F8LA 5LYJB 1Q0TA 3O92A 1LFAA 3T5TA 2GZDA 5IYZA 3VH3A 4UDNA 2G1UA 3PYXA 5DGCA 3T8YA 2C1EA 2QF7A 3B1WA 3KAPA 1Z7EA 3W4KA 2QRVB 2WUFA 2GZSA 221PA 1HGXA 2KI5A 2ZBQA 5MDHA 3CF4G 3SCZA 3NW9A 2C8KA 1XL0A 4DLAA 4RVOA 1NP6A 4HEHA 5B1SA 4DSUA 3KJNA 3DDZX 1QNFA 2ZVQX 3ND9A 1YZHA 5LWHA 4S04A 4AMZA 4DR4B 2V0CA 3AYZB 1TO1E 4RU1A 4YCDA 1XX6A 5CDFE 2PT7A 4PO9A 1LWOA 1ZGGA 1E66A 3RANA 3S29A 2J0UB 3BXHA 3PF9A 4O8CA 2WMYA 1B6TA 5TJHA 2EW1A 4QJ4A 3TD9A 5IDYA 6LDHA 1T4MA 3MGBA 4KKVA 3PJEA 2Q5OA 2R7NA 1OBHA 1ZUNA 3COVA 3U60B 3RARA 4A10A 4CYMA 4F2DA 1OFGA 1M2HA 4V3BA 2Z1DA 2AW5A 3HUFA 3TUIC 4IV5A 4AIRA 3PHCA 3MOIA 4LXTA 3DEAA 3WFIA 3JVDA 2ZYWX 4JY7A 5JMTA 3JSXA 3BZUA 1W6UA 1UT6A 3E6AA 1XEFA 2ID8A 3A9UA 3R5JA 2V59A 4IKEA 4QYIB 5TXGA 4MB6A 4N1AA 5JJBA 3W1WA 3GUUA 2B1IA 5BWOA 5F7JA 1KQPA 1N2SA 1WSDA 1THTA 2H54A 1D6JA 4FBMA 1B3RA 4HLUC 1M5TA 1RXEA 3T34A 3LQFA 1R00A 4PPNA 4PZYA 3U40A 4BNFA 1SCUA 5IK2D 3M5PA 3FYUC 4JJKA 2GN6A 2B98A 3H9EO 1GPKA 3EPJA 4EKDA 1E2UA 5E2BA 2QX8A 5WRFA 2GRAA 4AWAA 4MW7A 4RO0A 2ZXEA 3HN6A 4LV5B 3KZXA 4EOGA 1UEJA 4NCJA 3QV1A 5CDUA 4X1YA 2RH5A 1SVUA 4DSZA 3D2AA 4AF7A 4ARZB 3TE7A 4WADA 3LT0A 1W2HA 2ODWA 1PGPA 3L7NA 2FMTA 5TB5A 1YA4A 2J4FA 1X0VA 1Z13A 2J6HA 2WTAA 3I2FA 4PZ0A 3RSHA 1A9SA 3K1JA 4PC1A 2V54A 3RYHB 1Z0DA 1P2SA 4URFA 4X44A 3PITA 2J0SA 3DTVA 2R8RA 4AJLA 3V3KA 4ZI5A 2JEOA 1WSAA 4FHCA 1GG8A 3CUYA 3C8UA 4JJ6A 4LHYA 3AONB 1U94A 3VOTA 1YU6A 4ER7A 1U02A 2V5VA 3FUWA 3DC2A 4KBGA 1ZR2A 1F9EA 1CZUA 1KYQA 3CRW1 2H4ZA 2FUKA 2UVPA 2AR9A 3ZU5A 3G0DA 1SXPA 4ID3A 1FQJA 3WWPA 4OVKA 1XFAA 2C2ZA 2QMYA 3DZFA 3BG5A 3P20A 3FWPA 4MR7B 4PM4A 3UAVA 4JLVA 5EMHA 1VMDA 4UHFA 1ZXBA 1U2RA 3T9FA 1RNLA 3GVXA 2HO5A 1HLDA 4Q7QA 3UJDA 1YZNA 4M0FA 3S44A 3RVKA 4X65B 2C3UA 1U5CA 2JC3A 3VHQA 3WGTA 3IL2A 4Z1MD 1A82A 2I7CA 4JV5B 4NC9A 4RJTA 5FOVA 5CYPA 3LCVB 1KI8A 4FNOA 3ZWYA 1QO7A 2GDZA 3I9JA 4YJFA 1G3IA 4RD1A 5FTNA 5EP4A 2IE0A 3PK0A 2I6TA 5JSZB 1EVEA 1P7VA 4NQZA 4IXMA 5IVKA 3UMCA 1AO3A 1QFYA 2NVOA 2C5BA 4MRAA 5EWJA 5DN6A 1LBTA 1ZHHA 1PR9A 1QF9A 4O1HA 4TN1A 1LBHA 1JEAA 2EW8A 3K9HA 4P92A 1E2QA 4TSRA 5EZYA 1LBQA 1NSTA 3AESB 4XUEA 1K88A 3FKQA 2DQ4A 4TPKA 2UKDA 3R7FA 4PAGA 2P9GA 2RH4A 2A35A 1K1EA 2CJPA 5KNBH 4XDZA 5G3YA 4EYKA 1GZ6A 2QTZA 3QA3E 5IDXA 4XCVA 4IHKA 3VZPA 3QI7A 4C0BA 2JLQA 2XT9A 3I04A 3B3JA 3H9JA 4YJDA 5DM1A 1CS4C 2X0NA 1G6Q1 4TV8A 3UH1A 4I1PA 1QHGA 2B4AA 2PSSA 1Z38A 2RCNA 1K7EB 4HGOA 4XD7A 2JLZA 1PG0A 3IEVA 4HWSA 2JIRA 1AT1A 5LM3A 4DR1B 3DR3A 3CINA 2HF2A 3KHSA 1K06A 5KS2A 3QFHA 3GGGA 2CV0A 1ZH0A 2P6UA 3CCCA 4HWKA 1VI6A 4IX9A 5T3UA 1PFUA 1U3UA 3B8EA 2PZ8A 3HXPA 3N0WA 3ICOA 1QYCA 2X13A 1GPAA 5FOSA 3TVTA 2PWBA 4GOND 4TUYB 2PUDA 4ATNA 2UYGA 4ZOLB 1D1TA 1ETHA 3O8OB 4MS1A 3R3XA 3D9QX 5DI9A 4WXPA 3TJMA 1FFCA 1WBDA 2PL3A 5LBIA 3JQRA 5K3BA 4YHBA 4CMAA 3C3CA 3PC4A 1DDIA 3T3IA 1H3NA 2YFKA 3PXEA 3OCUA 4KKXB 2OCPA 3S8YA 4G0WA 3ZIAD 4MLDA 3I62A 1RXSA 1Z0JA 1YRHA 2X22A 1DGQA 3C6XA 3H2JA 1UJ5A 4J0CA 1L3BA 2OZKA 3X44A 4D9CA 4ZK2A 3I61A 1XVAA 2VSXA 3DUFA 3F74A 3GQVA 1DHTA 4X20B 5HQTA 1HSZA 3H13A 3CLTD 1NV9A 3LOPA 5FL3A 4BWVA 3K05A 1FSZA 4GFDA 5K3OA 2VOJA 1C8VB 1T2CA 2O23A 5CTAA 4CNBA 1RAFA 3CUVA 2AL7A 2HHCA 2XDWA 5CBKA 4HD8A 4J2OA 4AXXA 3WOVA 3GMDA 2HD4A 2PYIA 3HZOA 1LRKA 1YASA 4F3TA 2I4LA 4DJEC 3HXTA 5HOEA 1INLA 5CFNA 3NWJA 4GL4A 4I9NA 3V2HA 4DMKA 3BWEA 4GLOA 1WKCA 2C9CA 5BQ5A 3U6BA 3UHJA 1L8OA 5BR1A 3DLCA 3KKNA 3HHEA 1KEVA 3WLNA 4M7WA 2XMDA 2PUVA 1GWNA 4CTJA 4M36A 4A8TA 2YC4C 3PXXA 1ZZGA 2QYOA 1K7SN 4OQZA 1Z25A 1BE1A 3I4LA 4WVLA 1JN0A 1N1GA 4KQIA 3W7VA 1TECE 3I9NA 1II0A 1T0BA 1PT5A 4QT4A 2F3QA 1SBQA 2ZWMA 1I94B 1I3KA 1MABA 5J5AA 3SF8B 3ZCSA 4HUQB 4R1UA 2EFJA 4L57A 3ZBUA 2V3CC 1R0CA 3HFJA 4L50A 4YMIA 4B83A 4TT3D 1GA1A 4BFWA 1VYUA 4PPGA 2WF9A 1G7RA 2XCTB 1S3SA 4R1OA 3QVGB 3FTQA 2CVPA 3C3XA 3L6DA 5A4DA 2Y9PB 4IDAA 1YB7A 3ZV7A 1OT3A 2DWQA 3CVJA 1FJ2A 2XIJA 3F78A 3W0LB 1SUIA 3UT5B 8OHMA 5E2IA 4JUCA 4FEAA 4I14A 3ZH2A 1LRJA 1FA9A 4N6GA 1TA0A 3I01A 4TMZA 3FBGA 3O3CA 3KT3A 1VE1A 1DARA 2RI1A 3OI7A 5ALXA 4LTDA 1L5OA 1E3IA 1WUKS 2AX3A 3BXOA 3ES9A 3JASB 4OHRA 3SJZA 1A9XB 3U3XA 1XAJA 3TZHA 1YXMA 3WE7A 4CMJA 3BMCA 2O2DA 2G25A 1JR3A 2AN4A 1DJNA 3RV3A 1V1RB 1DAFA 5AW0A 3GZNA 3I6MA 5EHZA 2IWHA 2YMMA 1NIPA 3UAGA 4B4UA 1C3EA 2DY0A 4L28A 3AM3A 4EFDA 2XXAB 3FOWA 2HX1A 3BQNB 4E22A 1E62A 5KHAA 1TQHA 3I04M 3M1AA 2QORA 4EVSA 2QQFA 3WLTA 1REQB 4I1RA 2RC5A 1KEUA 2GLUA 1QH0A 5CX1B 3PGVA 3T1YB 5REQB 1HURA 4X3PA 5GQSA 3L4BC 3KKEA 4UDXX 3SC3A 2XBMA 4DLPA 2IC5A 4FE4A 1NQ5A 1U8XX 3EGEA 1USIA 2D1QA 3RIHA 4JWKA 4G5XA 2GCIA 1G7CA 3R41A 5FUBA 5A5VA 4HAIA 3WSWA 2BRUA 3JZDA 3PR2B 5AFSA 1YE8A 4KH0A 5DBOA 3UVEA 5JJCA 2ZIGA 2YV2A 3GEPA 5JJLA 1F51E 3GRZA 5CFQA 5DTIA 3RNOA 3NU1A 2EAUA 2GYUA 4M0KA 3W78A 4J29A 2OCYC 4JENA 1XRMA 4KO2S 1O5OA 2F43A 4WESB 1QB8A 4QPPA 1RM0A 5FFFA 1W36C 5HFNA 2F8MA 1NT2A 5DGHA 3BGWA 1GL3A 3ESXA 3N53A 1RAIA 1MX3A 2DMRA 1E9EA 3R1IA 2HAEA 4MKGA 3TSYA 5FUYA 3WWZA 2OZLA 3HC7A 5C31A 1WCWA 3VKHA 3V7UA 1Y6QA 3EA4A 4DF3A 3PE4A 5AD1A 1A50B 1H2HA 3T7CA 4B09A 3DEIA 3Q40A 2FPGB 4FS8A 2O1EA 4IIHA 1M33A 4PBSA 1X2BA 5C7IO 1M2WA 3GFGA 3IOCA 4UUAA 1V9CA 1KIFA 1XTQA 4DNQA 1E1CB 4YAGA 2QR5A 4MHOA 2BGLA 4XJSA 2NT3A 1A5AB 1Z7WA 3BSSA 3V33A 4BMXA 4RACA 4A5SA 2BFMA 1D03A 2XA1A 2FCAA 4MVJA 3GP3A 4OIMA 1SUFA 2RMKA 4PSDA 4PF1A 5ALRA 4IPTA 1D6NA 4FFWA 1EUYA 1SKQA 2BMFA 3R2JA 2FFBA 3IUEA 3STYA 4PSAA 1ID1A 2A88A 2ST1A 2XDAA 3R3VA 4US1R 5FI3A 5JSHA 2DE0X 1ZK4A 4JT2A 4W8HA 3GGDA 3HA5A 2FX2A 1XQXA 5AO9A 5FBRB 4NBNA 3QYPA 2C0QA 1D2EA 1NNI1 4UU8A 4RIGA 5EQFA 4MCJA 5JWHA 3DMTA 4HTFA 4EB6B 3GJZA 1SUBA 2AFHA 2C4UA 4G01B 4TTRA 3CZ4A 4ENSA 4PYIA 1S7CA 5EP1A 5FWAA 3EXHC 4RIIA 5K0JA 1M72A 4DVJA 2FPLA 4WW0A 4LX0A 1IY1A 1OA1A 2VDJA 2FP4A 2G88A 3K09A 1UAAA 1K0UA 4V39A 1DUIA 3CNEA 2GCNA 4AJIA 1A8UA 1N32B 3A1EA 1CKEA 1MH1A 3WYFA 2W6JD 5ALVA 5LQKA 2QTLA 5HF9A 3W6UA 4YT4A 4YIHA 1I0IA 1GTVA 3V46A 4MR8A 4GDFA 4C04A 1YJBA 1M0EA 2WM3A 2O8DB 1M6NA 3DVLA 3DNFA 2A9PA 3RU7A 4L5CA 1FX1A 4MS3A 5ENDA 1B43A 1PQUA 3TRFA 2V6JA 4ARBA 3PFKA 1QCCA 4EY4A 3G7UA 5ALZA 1GADO 4NMHA 4YRBA 3GF4A 3L92A 4I5IA 4QFDA 1NM5A 4BN5A 1DV2A 1R2QA 5DHTA 4C78A 2VEOA 4B35A 2V7WA 3H9BA 3T0FA 2PE5A 5FTLA 4IEIA 4FHGA 4KLCA 3JQBA 1EWYA 3H5TA 3FWHA 4KO3S 2A9JA 3HPQA 3HV2A 1VHQA 3OWHA 4ZEWA 3RUHA 3AK4A 2IYEA 4JA2A 4X7BA 3GXBA 3I58A 2OHGA 2FSSA 1WHSA 4CF3A 2YZ2A 4MV6A 5BSTA 1E2KA 2OGZA 1Y9EA 4DUGA 3L0SA 1NVTA 1IBSA 1ZI6A 3MQ2A 4OXNA 1RQPA 4JLJA 2GVNA 3TLEA 3LG2A 2ZJ1A 1QAMA 1LJLA 4CL8A 5JCXA 2IZ0A 1OLXA 2CVFA 1NX6A 1L5VA 2ZGVA 4M6WA 3CSSA 3OEEA 5ALNA 1YA6A 5FTWA 4G07A 2I7XA 1KP3A 2QL9A 2WM2A 3QLJA 1EJ6A 2VDKB 3GQBB 3HVHA 2QTBA 1GCUA 4JFAA 4JVNA 2MDTA 1I6WA 3ROFA 1UKVY 3UENA 4PVCA 2X4LA 1X9HA 1FFHA 4TT8A 5BW8A 1FZTA 3OLWA 2FQ1A 4DIDA 2ZE6A 3FKSD 3U37A 2H7VA 4DARA 2FK7A 4HDMB 2AI3A 2QYHA 2XQJA 2QIPA 4FKBA 1SZDA 1R3UA 3NHLA 1SHJA 3C70A 3TZ6A 2WWIA 1E6LA 2EHDA 3PT9A 4GXTA 3DMGA 3FCCA 4WMLA 5EYPA 1MGOA 3WIEA 1JWLA 4Q37A 1QCYA 5BSWA 2KW5A 2ZT6A 1GGMA 1WVGA 3G0IA 2ZJ2A 3MCZA 3IV6A 4WOPA 5MFZA 1KPGA 2DCMA 2QAGA 5KSZA 4TMWA 5C1BA 3WNZA 3GLIB 4BV8A 2GD1O 1CF2O 4TWJA 1YQQA 2C78A 2FPPA 3ENQA 1ZQ9A 1SOWA 1AQ6A 4W63A 4ESVA 1LDEA 3RNLA 3WGKA 3OKAA 4YP7A 3KVYA 4G25A 1EUCA 3FNFA 4BIIA 1HY3A 4BB6A 2PYZA 3M0EA 4HBZA 4Q03A 3U3KA 4FSXA 1P0PA 2XWJI 4IJVA 3GJ0A 3EH2A 5A71A 5J9FA 4W6QA 1X1TA 1MW9X 2FH5B 2H2DA 2Q5IA 5K4HA 2EGGA 5EWLB 4R2XA 2X2PA 4GSLA 4CM3A 5REQA 5LZ5A 2PXAA 2ROQA 1XK6A 2YL2A 4EMTA 1XMVA 1BWSA 3KQHA 4AC9A 1G7SA 2GARA 2FAXA 3NC4A 2ORIA 1CUSA 2HTFA 2OM6A 1YZVA 3C1UA 2R11A 4H7EA 3F4LA 5IM5A 4UQLA 2CHUA 3GPBA 4AS3A 3BTOA 1HFJA 2ZBFA 4A6PA 1HL7A 2K5UA 4CG1A 1WV1A 3GRRA 2ZJAA 2WWFA 4WCFB 3WGVA 3EX7C 3CG0A 4RSGA 1U8UA 5CVEA 1JSXA 4P9NA 4LZZA 2QGNA 1EK0A 5BRNA 5AIBA 2O3JA 3TOZA 4TQUS 4D43A 1LDNA 4HPJB 5BRJA 1RKBA 1LNZA 4RXUA 5FV7A 1NZJA 2JAWA 2Q0QA 3OCYA 1NW8A 1YONA 1SUSA 1NULA 1PUIA 5M3BA 2AI1A 1GPDG 3RM3A 4B31A 2H2IA 2YOHA 2GWHA 3DEKA 2EW2A 3BMOB 3UT5A 4E2YA 4Y6GB 1X7ZB 2WUGA 4JJAA 2WWGA 1RQGA 2GJ9A 5KSWB 1QGOA 2CJXA 3NBQA 1KVQA 4NX2A 1Y81A 5E3IA 1VLHA 2WFLB 2XX3A 5ELMA 1ZC4A 3RRYA 4HMQA 2OD2A 3VH2A 1FCJA 4J0QA 4WJLA 5CFMA 4GKKB 4EY8A 4FKZA 2FPGA 1PSZA 3MLBA 1ACJA 1Q21A 2EZ9A 3D5TA 5AICA 4DE5A 1ZNYA 4AKHA 1RI2A 4Q16A 3K1ZA 3IVCA 4UQPA 3AL0C 1KYTA 4QUDA 4NBSA 1PV1A 4L4RA 5CFRA 4GWKA 5H8WA 1XJWA 3OEHA 4MW4A 4UE2A 1RJGA 1G17A 5FOWA 4BFUA 1IXKA 1P2UA 4K8OA 3G2QA 3PC3A 4HZUA 5JRDS 1XRQA 4CV1A 3FHTA 4UFNA 5A5EA 1MG0A 1XZ8A 4BAGA 1KJQA 3LWNA 4C5BA 4MJ7A 4TZKA 3RVDA 1BGVA 5BYBA 3U3DA 1W0KD 2BEKA 2GM9A 4JLPA 1MDFA 1XU9A 2WU4A 5FKJA 1UK9A 2IHYA 3H1TA 3O4VA 2PSHA 1K5PA 3O1JC 4ODIA 2CVHA 4WDRA 5EI5A 5TV2A 5JD5A 1NPDA 1E7RA 1NXSA 3P9YA 1YR9A 2GF2A 4IINA 3S2IA 2D3WA 5ER9A 5AJWA 1NW4A 1MTZA 2GILA 3GVPA 3HMQA 5J63A 1IN6A 1E9CA 4HVLA 3THXA 3E7DA 1E2IA 4YCBA 4L78A 2I22A 1SUDA 1CUUA 2O5RA 2RAFA 2FSVC 2ZTVA 3HCWA 1G291 3M6WA 3K0EA 2Q2WA 3C4VA 2BZ0A 4KWTA 1Y3IA 4JEUA 4PAOA 2OP0A 3FHCB 3UHOA 1GZDA 4B8ZA 4E1VA 3OZUA 1FMTA 4EPXA 4DMGA 4J07A 2H18A 1NMZA 1K86A 3OQIB 4N3BA 5AI5A 1KC3A 4MSUA 4HQKA 4PIVA 1NJ2A 2JRCA 3FNRA 3ZGXA 2QNBA 4YMHA 4RTQA 5DRTA 3U4GA 5EMMA 4EPVA 3NHBA 3LYHA 5C35A 1JSLA 3ABRB 1CEEA 1UXKA 4EJSB 1VPVA 4RL4A 4X60A 3BE8A 2DQSA 4TVOA 3K9QO 4UCXA 4YUZA 4G24A 5EL0A 2SBTA 1IM5A 1N8KA 1Z5WA 3PBKA 4EJFA 5IS2A 3W8RA 1QYVA 3MSCA 3FTFA 2Q5JA 1NYQA 1U2EA 1OLSA 3DMNA 1JVBA 1XAIA 3FMFA 1OX6A 3JATA 3LYLA 4P7BA 4CLRA 5KTNA 5C8YB 1NYLA 1SQFA 2NPFA 3M82A 4CEHA 3RTDA 4DB2A 3FZEA 3N2IA 1MQ8B 1RYNA 1Y1KE 3NAQA 4FBLA 5CR9A 3KQOA 4C1BA 1KSFX 1UH5A 1ST2A 4RPCA 1T9KA 3AP2A 3KXDA 4P7GA 3ADCA 2P2YA 1N92A 2PQ0A 3I9LA 3QP9A 4H3HB 4YH1A 5ALLA 1RYEA 1E99A 1DI0A