2SBTA

A comparison of the three-dimensional structures of subtilisin bpn and subtilisin novo
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN NOVO
publication title A comparison of the three-dimensional structures of subtilisin BPN' and subtilisin novo.
pubmed rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
total genus 45
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1976-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2sbtA00
5JXHA 1WMFA 4BWGA 4ZOQI 1EGQA 1SVNA 2DQKA 4H6VA 1AQNA 1P7VA 1Y48E 1TM3E 1YJCA 1Y33E 5JXGA 3VTAA 5JXIA 4NE9A 1TK2A 2PWAA 2Z2XA 2ZRQA 3DE6X 2WUWE 3A3NA 4OV6B 4H6XA 1Y9ZA 4I0WB 1Y4AE 3DW3X 1SBNE 1ST3A 4H6WA 3UNXA 4ZARA 3TI7A 3TECE 3F49S 3LPAA 1V6CA 1SCJA 2Z2YA 1TMGE 1SCNE 3BX1A 4KG7A 1PFGA 3WIUA 1AK9A 1GNSA 1ZVKA 2ID8A 1C9MA 1SH7A 3BGOS 3DVRX 3PRKE 3Q40A 1BFUA 2PRKA 3CO0S 4NMXB 4YN3A 3LPDA 4AKSA 3QTLA 1EA7A 2B6NA 3VHQA 2PQ2A 1YJAA 4MZDA 1KE2A 1ST2A 1WVMA 1S02A 1GNVA 2E1PA 1C9JA 5ARCA 5JMOA 2W2NA 2PKCA 2Z30A 1C3LA 1OYVA 1Y34E 2IY9A 1SCBA 2HPZA 3DWEX 1GA4A 4KB5A 5SICE 3Q5GA 1A2QA 3F7MA 1Y4DE 1OYOA 4C3VA 1XF1A 2Z57A 3ZXYA 3LXUX 2V8BA 2Z56A 3AJ9A 1IC6A 4HVLA 2Z2ZA 2X8JA 2DUJA 1BE6A 1IAVA 2W2MA 2DP4E 3GT3A 4GI3A 2PMWB 1TM4E 1VSBA 1TECE 1C9NA 2PYZA 2ZWPA 5FAXA 1GTL1 2IXTA 2ZWOA 3VV2A 1WMEA 1SUAA 4JP8A 2W2QA 1WSDA 5AMXA 2P4EA 3OSZA 1TO2E 3I30X 1R6VA 3CNQS 1LW6E 1SBCA 1NLUA 3WHIA 4B5LA 1CSEE 3VSBA 1PEKE 3GT4A 3GCWA 4NE7A 1T1IA 1CNMA 2WUVA 4LVNA 3VV3A 2SECE 1AVTA 1SUBA 1SPBS 3D43A 4OMDA 1GA1A 3I2YX 4C3UA 3DYBA 1AH2A 1BE8A 4FONA 4AKTA 4DZTA 1BJRE 1YU6A 4WOBA 1GT91 1SUCA 1MEEA 4K8RB 3LPCA 3DVQX 3WQBA 4CFZA 1GTJ1 3BPSA 3SQOA 2GKOA 5AVJA 3GCXA 2XTJA 4LVOA 3DE3X 5FBZA 1MPTA 3DE2X 5K7SA 4J94A 3AFGA 3DE0X 4HX2A 3HJRA 1S01A 1ZVJA 1SIOA 3EIFA 3DVSX 1SBHA 3A3OA 2HD4A 1SIBE 5ARBA 3ZXXA 4RYDA 1SCAA 1TO1E 3DE1X 1AU9A 1DBIA 3QFHA 4OMCA 1HT3A 1TM1E 2SNIE 1KE1A 4M1ZA 5JXJA 1UBNA 1Y3DE 5ARDA 1YJBA 1THMA 4KPGA 4CFYA 3EDYA 1TM5E 1KDYA 1R0RE 4DJ5X 1T1GA 5CW1A 2QTWB 3PTLA 3WIVA 1SUPA 2XRMA 2PWBA 4DWWA 1SELA 1SBTA 5AQEA 5I9SA 1BFKA 3F7OA 1P8JA 1SUEA 5B1EA 5FFNA 1P7WA 3DE5X 2Z58A 5B1DA 3I34X 1SCDA 1T1EA 2W2PA 5AVKA 1GA6A 1BH6A 1V5IA 3VYVA 2WV7A 2WWTA 2SICE 4CG0A 3DE7X 1SN7A 3H42B 1PJ8A 3T41A 1R64A 1DUIA 1Y1KE 2W2OA 1AF4A 2TECE 1JEAA 3A3PA 1NDQA 1Y3BE 1PTKA 1GCIA 1Y3FE 3P5BA 1SBIA 1SUDA 3AJ8A 1AV7A 1S2NA 1TM7E 3QMPA 2ID4A 1OT5A 2ST1A 3I37X 3DE4X 4Z2AA 1Y3CE 1NDUA 1SIUA 4WOCA 3TI9A 3L1KA 1GTG1 1WMDA 2G4VA 2SBTA 1Q5PA 1KDVA 3SICE 3DW1X 3EE6A 3DDZX 3D9QX 2X8JB 1KDZA
chains in the Genus database with same CATH superfamily
1ZOSA 2A88A 4XWAA 5JXHA 3RIMA 3CYFA 1L4UA 4MRMA 4A5SA 2XXAA 2EJWA 4NMMA 2GEBA 4MJ3A 4S12A 4X1IB 2JLQA 4BZWA 3EW7A 3TOZA 5TXGA 3ROKA 4DSAA 1YFZA 3NZEA 4YJ2F 3NOOA 3TIGA 1L4MA 2A1TR 2ZKIA 3GP3A 3QBJA 4Z1MA 1R4ZA 1IZYA 1PBTA 1TTTA 1IJEA 1PCXA 3WGJA 3IEUA 1NE2A 2BFWA 3RQSA 4IJQA 1H6DA 3HUEA 4FI3C 5AI8A 3S8YA 3PIDA 3T3NA 3NC4A 4XR4A 4ZDJA 4K3UA 3B82A 2ZU0C 1J0AA 4HXGA 1M33A 2VYCA 3VTKA 4GSKA 1O94C 2I7XA 4PBSA 2VH5R 1C9KA 1GLNA 3DV9A 3I6QA 3KAPA 3QJYA 5AVZA 1KJYA 2PLFA 3SPXA 1A9PA 2XRFA 1X1DA 2CKDA 2CJFA 3JU3A 3QVWA 1JILA 1T8UA 1CY7A 3H13A 4EHFA 5AD1A 5F35A 1N8KA 1NZDA 1EJ0A 1NI5A 4JMLA 4WECA 1M2JA 2BR3A 1GKKA 5E7QA 2B7LA 2AV6A 1CUVA 4I0WB 4YROA 3MBKA 2B99A 2BSQA 5SY6A 4E2XA 3NI2A 2UXDB 2XE4A 2Y1GA 3CCFA 3L7YA 4L0DA 3N2KA 2ZUCA 4PM4A 4REMA 1WDKA 2WINI 3B5JA 1FTQA 2K5UA 4AL4A 2UZ3A 3AHHA 5KQRA 3EMVA 2HNAA 3D6HA 1NMEA 2BGMA 4F1WA 1R10A 4BTLA 2FB9A 1AN0A 4HDQB 3D6MA 5CH3A 1E6LA 1EG2A 1HYEA 4OEHA 3LPAA 1SXJE 2J9RA 3KQYA 5D01A 4PQFA 1O96A 1PHRA 2P40A 3B3JA 3KZKA 2H31A 1JX6A 2FUNB 4B48A 4BNJA 2WSIA 4YJGA 1SCNE 3THYB 3ZLJA 4LQLA 3FOWA 1HLDA 3AYZB 3KR2A 3O93A 1O57A 4ERNA 1SNYA 1SH7A 4O4JA 4CTKA 1Q16A 2W6JD 5COAA 3THWB 1ULHA 3OT1B 4LDNA 3I4FA 2PRKA 4N8DA 1NMSA 1MIOA 1NSFA 1Z47A 2HSWA 3H9QA 5FOQA 1I01A 3H2ZA 3HKBA 2IQIA 3MTGA 3QGMA 1B8VA 3IEPA 2QIOA 4BO9A 1T8PA 4TT3A 2ZBVA 5IW8A 4EHJA 1JI3A 4QGSA 4WLNA 1UZMA 2QRUA 1U4OA 3KQTA 4M60A 4U7TB 3SR4A 3S6JA 5CU7A 4WKGA 4UU0A 1QCYA 4L3VA 3T5MA 2E4XA 2JI8A 4PIVA 4V1CB 2C4HA 3COYA 1M2VA 2IPNA 3LX8A 3N6RA 2N42A 1Y7TA 3HWSA 4PWZA 5ALYA 4P4UA 4QGFA 4WESA 1L4FA 1ZSYA 3B78A 1Y1TA 4QDKA 4XVHA 4YRJA 2XCRB 4A15A 3VKGA 1MAAA 1YMVA 5TQ0A 1HQDA 3SE7A 5I47A 5JFGA 1QCCA 2ZSUA 4FWBA 2CJWA 3IUPA 3P97A 2H54A 4PZCA 3RK4A 2I8LA 1HEIA 4DY4A 1K68A 1XZ8A 1ZUWA 3WQRA 4P83A 4RGVA 3T3GA 1M1YA 3AJEA 2VDQB 1QIJA 2PKCA 3H3JA 1XUOA 2QY6A 3HDGA 3OFJA 4G56A 1UBSB 4KV7A 1M8JA 2I6TA 2Z30A 5G0WA 3EBOA 2RJOA 5ALHA 1ZONA 3SXUB 3DT9A 3JQ6A 3LWZA 4PXSA 1T5TA 4KIFA 2R86A 1NONA 3K9QO 4IQ4A 1CQWA 2X0NA 4JYBA 3OUTA 4IL5A 1Y34E 4MH0R 4UVGA 2YCLA 3KSUA 3T7TA 2A58A 1W4ZA 4G85A 4LRSB 1NTOA 1NBME 3JAKB 3W3AD 5HKKD 5BMVB 2JK1A 2FFJA 2FW0A 2HPZA 3OE7A 4R1QA 3U7IA 3TQCA 4GR5A 4R2KA 3S2UA 1EFPA 3TDNA 2YMQA 3PHJA 1Q1BA 3CLHA 5HVNA 5DXAA 1B42A 2C42A 3W2IA 3MT0A 3UXMA 5JDCA 1VP3A 1K2WA 4O3MA 1F06A 3BMOA 3HJNA 1V8PA 3EMKA 1RYYA 4O4JF 3SN6A 4JJZA 2BZSA 4G23A 3QU5A 2PX3A 2RE8A 1OFIA 1BNCA 4NFHA 3RU3A 1OLOA 5AIBA 2A57A 4FZ3A 3VU0A 4CKEA 2IK8A 1NVFA 3MWDB 2V3CC 2ZTLA 4NJMB 2QAIA 4RZIA 2AKEA 1ZVQA 3EXIB 1VLMA 3BWEA 4G0PA 1TXGA 2NU6B 3LFUA 1ZN2A 2X1HA 4JB2A 2YJNA 1VJ1A 1MOPA 2DKOA 3A6DA 4EY3A 2FRDC 1M2OB 5I7RA 2PX0A 1JAXA 3K0KA 2WTXA 3B13B 3K6JA 1QZUA 1MJGA 2PUGA 3V8VA 2REBA 3EVAA 2GBGA 2VEOA 4G8BA 4LPSA 4IR7A 1PJQA 4BKMA 4OD0A 2HXGA 2DKFA 2FE1A 4V3BA 5CW2A 4GC9A 1WMAA 2P9QA 4IRUB 1NNEA 4L02A 2IH5A 4FR0A 3K70B 1KJ8A 3L8EA 1B3RA 3BTVA 3D81A 3TBFA 3KVNA 1H23A 1ORRA 4Z7OB 3KBOA 4XSHA 4ANFA 4CKWA 5I7SA 1DHRA 5DN6A 1IOWA 3URMA 1KZHA 3H8SA 4KQKA 1I32A 2Y9PB 3N2EA 3DFZA 1XP5A 3G2MA 2ZE6A 1WSDA 4K9KA 1ZHFA 4CGZA 3LT1A 1EZ4A 1S2OA 2L19A 3MQ4A 3RGWS 3F8TA 4EARA 4ZO6A 2WR8A 3TW0A 2O5EA 1K0FA 5BNFA 3STHA 1N9ZA 3DNMA 4LC9A 4HLUC 2VHWA 1Q92A 4Q9AA 4EI8A 3WHIA 1IDN1 3GPIA 4R9UC 1J00A 5CK5A 5JUWA 1FDTA 4XFKA 1KEWA 1Z12A 2ODNA 2EGUA 4GICA 4CIAA 1CY4A 3ELBA 3ENNA 4FNGA 4PLHA 4ENRA 2OXEA 3V8MA 2J0SA 1F4PA 3V7WA 4QUHA 4UW9A 1AGNA 4CU2A 3RTGA 3KWMA 4BFXA 4FFVA 4CI9A 4HAWA 4HRYA 4L6IA 1I9CA 4X00A 4ER0A 3SSOA 1FFYA 2ONZA 5EQDA 1CNMA 2IE0A 4FEEA 9LDTA 3GJZA 3C3JA 2GKGA 1ATZA 1RU3A 4E03A 1YOVA 3BXZA 2XAAA 4HV4A 1DEAA 4B7CA 3O8QA 1LPBB 4KAXA 1BYIA 1CR0A 1PSDA 2CBZA 2G8NA 2YQZA 4RVDA 3TE7A 1GGVA 4FFDA 3WMEA 2JLYA 3N1UA 2GUWA 3CBQA 3D2BA 5DP2A 2JIPA 2QRZA 2ZAIA 3PXCX 4BQNA 4K26A 4DC0A 1QF7A 1EVJA 1KO4A 3TSZA 3W6OA 3RWOA 1WZCA 3UFBA 3ANLA 5U1PA 5K9ZA 4BPRA 1FU8A 2F9MA 4R8KA 1L7VC 2HU5A 3LK6A 3ZUGA 5KOHB 2BM8A 2I4RA 3O3MB 5T3YA 1D0VA 2B34A 4WOBA 4NJOA 2ZROA 4X1YB 1JHAA 4MXDA 3ROQA 2JAXA 4MWEA 1CZLA 3DVQX 3WLTA 2XIJA 3QEAZ 3LHDA 1QGYA 2OV2A 4LC1A 3ABQB 4U7WA 5GQSA 1BDIA 3FETA 3PVSA 2X5KO 4AWBA 2Q1TA 4FR2A 1GUDA 4FFBA 3M7IA 3QU4A 1JW9B 1A7UA 4DCGA 1M7GA 3L1VA 5JQWA 1V95A 1NDHA 2XTJA 3G5TA 1GQ2A 3VBCA 1Z8HA 5AKEA 1UR5A 4CMKA 1NQ5A 2HDNB 3NJRA 1MW8X 4Z86A 4EG3A 2NXWA 4DJDC 1O5OA 3Q3VA 4EJSB 3GUYA 4HAVA 4MHSA 3E58A 3HXQA 3EEOA 1RC8A 1EFKA 3P9CA 1KOFA 1UBTS 3LXMA 4MVJD 2BTEA 2PBRA 3FGPA 2O8CB 2EX0A 3R6LA 5AM1A 1E1QA 1OC4A 3GZTB 1N7HA 2HHCA 4LKOA 1UPAA 1XMQB 2Y1DA 3T5PA 5D3QA 2G1JA 4DQLA 4M8SA 3HCNA 3U7HB 2ZR8A 4YP1A 3HJUA 5BSRA 3V8NA 1J09A 5KNDD 2Q6LA 2AH5A 3WZMA 1RKXA 3RU9A 2A3RA 1N2XA 2HNBA 3NVKI 1P80A 4QTUB 2YKGA 3DAFA 3HWRA 3C3WA 1OGYA 5EP1A 3KOWA 2NM0A 2QX7A 3OFVA 1B41A 2BFMA 4BTEA 4IWNA 1EWKA 1CVRA 1P18A 5ELLA 5IYZB 1A9XA 2RCNA 1UK8A 2NTEA 3LDGA 3LGAA 5KTSA 2VDPB 4DQKA 1S5PA 2D3WA 3T1OA 2PRZA 3X1WA 5COQA 1TVKA 4YP0A 1W5AA 1UMBB 1P1CA 4DIMA 3AR8A 3DEIA 3CB2A 2IWHA 2PJRA 2OAQ1 2O4CA 2BHNA 4RTMA 2Q5HA 1J90A 2VN8A 3FOAA 4LPKA 3TQRA 3LX5A 2WEKA 2YWXA 1MO5A 3FB1A 3RIXA 5ICEA 2JGDB 4KQMA 2IYRA 1IHPA 2SKEA 2X22A 3K6SB 2SNIE 3GEGA 3WRYC 1J9ZA 4Z4CA 5CD1A 4X84A 2WZBA 2QS9A 3C3PA 4RFSA 1BHSA 1QYCA 2L82A 2RHRA 4R0VA 4PVDA 4HDAA 4HI0E 1ORWA 4ZAFA 3FYTA 4WIAA 3SQLA 1AQLA 3CHYA 5DO9A 2ZAGA 1W49A 3R6TA 4GDFA 3QKTA 5CEEA 2O2DA 3SKYA 2VBIA 4XWGA 4F4FA 4KFUA 4LOLA 1RBYA 1PHPA 3SWWA 4LV8B 4FYMA 3V1YA 4YBZA 2V4ZA 1K97A 2ZCUA 1JBEA 3IUMA 3ZU3A 4CM8B 4YJFA 1OXKB 3GMDA 3LUCA 2QD5A 2NUTA 5ALTA 1UOPA 3LSTA 2WVHA 4YPFA 3NIFB 5KCMA 4ZJYA 5C52B 1HRKA 1E79A 1K8RA 4HX9A 1E6WA 2PV7A 3B1FA 1XZDA 5E38A 5TMBA 4KRFA 3AVYA 4JY7A 3Q0IA 4B6GA 1RRMA 4HRVA 1YHYA 4IX9A 4M21A 2TMGA 2P9FA 1XZCA 5D3KA 1DZIA 5F7ZA 5F7OA 2HWWA 1K9VF 4HB4A 4XFDA 1AHNA 3STVA 4BMPB 1CNEA 5B1EA 1IN5A 2VF4X 4QYSA 2MR5A 2D1RA 3PD1A 2ZBUA 4M55A 3PYXA 4KPEC 5CLIA 3VU1A 5IT5A 3OIVA 1CT9A 1E20A 1UAGA 4X7RA 2OUIA 5F21A 3ESCA 4BZPA 4ZVOA 3WGGA 3ERCA 2DR3A 4P2BA 4IDDA 1KZGB 3WHKA 3FYUB 1YZUA 4KKVA 3BQMB 1JSZA 1QQBA 1SUSA 2JBAA 1TQDA 3SZUA 1YFJA 3PUZA 1FLNA 4H4EA 2Q7OE 2WWTA 2FPPA 3Q2KA 2QY9A 2WMNB 2SICE 3RW9A 3O31A 2QTNA 1EA5A 1BX3A 2QX8A 5EJIA 4EZBA 2QTLA 3E9CA 3CGWA 3HVKA 4HDOB 4YI5A 1DQSA 1D7OA 3WLHA 4HNQA 3KYDB 4R6WA 5A7HA 3HR7A 4KXXA 2FEAA 1AA6A 1Q0TA 2ANCA 1I1QB 3HZOA 1MHTA 4X62B 2VOEA 1PEAA 4DUGA 2AG8A 4QOHA 3V9AA 5AHWA 5I9NA 2FRXA 1XP8A 4RNCA 5K0LA 3CNLA 4JJFA 4GM1A 5ALPA 2GM3A 3ASZA 1LBSA 3LVFO 4G5HA 4Y9UA 4DARA 3QV2A 1TYEB 1RMQA 4LWZA 1AF4A 4J43A 4N65A 2VHXA 3RG2A 1TKAA 2P6PA 3PD0A 1WG8A 4TTAA 2IIQA 2I6SA 1BE0A 1GVNB 3ICPA 1NYQA 3J81k 1Z74A 2CT8A 1RP7A 1T25A 5K8CA 5GZ3A 1ZR4A 5JROA 2KYRA 4NP6A 5ALZA 4DCPA 3TKAA 3QJGA 2OXIA 3TJMA 2IYQA 3T1VA 2VPQA 4DEXA 4GWKA 2CJXA 4IRMA 2NPFA 3TTVA 4UOEA 1ZUD1 1XDWA 3LZCA 5ALMA 3EDOA 4P92A 3AUYA 2PMKA 4R1MA 5DNDA 2WYIA 5C7LO 1ZLXA 3PC8A 4BQFA 3OOJA 2B61A 4DYDA 1OI7A 4Q18A 4TKUB 1HX7A 2P2ZA 5AW6A 3IQHX 4LFCB 1FYXA 2JB9A 4L5JA 4MYSA 4NAHA 4DKXA 2IP2A 5JJ5A 5I9BA 2ZUWA 3FVQA 1A5AB 1DEXA 1QZTA 3GI1A 3LUGA 1UZAA 4LXYA 2RCYA 1KGSA 1HL7A 3HEBA 3OLYA 4H7DA 1Q21A 3EFOB 1Y7IA 3IPLA 1NXWA 3OOSA 4UBOA 1XN1A 3DOIA 3P94A 1HQKA 4DW8A 4AIIA 3EZ6A 4M0EA 5GJVC 4LZWA 1XPOA 1UBUS 4JP1A 2OBYA 1WKBA 1YXMA 3RH0A 4YCAA 4LF5B 4J76A 4ETWA 1MFPA 2OQ2A 2ZT8A 1CB7A 1ZJZA 5ALIA 1QCDA 3PUHA 4KYUA 2GBFA 4WCDA 4TV8A 1XCOA 4PYRA 1AKTA 3A1UA 1UJ2A 4TQGA 5IBPA 1UZNA 3A1WA 4BO7A 1RJ9A 1R3DA 3QW4B 5KU7A 3STUA 5ALFA 1KXZA 1QZZA 3BFXA 1UFKA 3E53A 4NE2A 2F8SA 3MS7A 4ZFNA 1R0XA 4O08A 1CUUA 3PR1A 1IZ9A 3N2GB 5K5EA 1BGVA 1N2IA 1JU3A 2P3LA 1UWKA 1Z5WA 2QVXX 3BMQA 1NHWA 2WHRA 2C9BA 3B2QA 1Y8QA 3E5HA 1TA4A 4B6QA 4UREA 4TL6A 5KTMA 4I14A 2YWFA 5JYEA 1V7CA 5F4ZA 1ECCA 4CQNA 1X7ZB 5F4BA 4NTZA 2PX4A 4F3YA 4D9BA 2G9UA 2JAPA 3NBYC 4I1OA 2BRUA 4D02A 2PWAA 5DULA 1RI3A 4MUXA 2CB0A 3TSCA 4OTZA 3TX2A 2X8AA 2QL9A 3SC4A 2PE5A 1TC2A 2P2GA 4G89A 4GKBA 4KFSA 4U9IS 2CFTA 1KPIA 2HK6A 2O48X 4JD5A 4FK8A 3IA7A 2OFWA 3A9CA 4PR0A 2VK2A 2CLLB 3HKCA 4GXNA 4KR0A 3M6XA 2VRCA 2ZRPA 3PZBA 5G0UA 2FLWA 4DMHA 4DKJA 3ZVMA 1VJDA 2BEVA 5E7IA 5BYJA 4ZT4A 4ARCA 5DASA 3HMQA 5LIPA 4K1XA 3GLQA 4Q1EA 1II0A 1CX9B 2N9UA 4EO4A 3JYHA 2FJUA 3L06A 1NVXQ 2YJGA 3FWYA 4UVHA 1P75A 2WUEA 3AR9A 5JADA 3SQDA 1IY0A 2MYUA 4R9SA 2C4VA 5JYDA 4L7VA 5JI3E 2QZ9A 3DMTA 4MAFA 1E1LA 4KX5A 4RWZA 4EA9A 4YRIA 5JSZB 4TV8F 4B7UA 4ZCTA 2B9EA 1SKUA 2XGOA 3ZK8A 3MCZA 4P9NA 2V0NA 4MTLA 2NTYC 1I3CA 3ZI7A 2CYAA 2P1DA 1R0WA 1XTRA 3OHMA 3Q5DA 4AJKA 3O8OB 2X5JO 3B8HA 5DGXA 2X3FA 4URFA 1ZJ6A 2YVQA 1XFDA 2WU0A 4GEKA 5CURA 1EXNA 3L4BA 4LGVA 1J8DA 3FVRA 3S2IA 1A7AA 2ZS9A 1P33A 4KWIA 4NK5A 5FTWA 3FVTA 3LX6A 3WMWA 3C6YA 1JQJC 1P3DA 4IDEA 5CLJA 3ZJVA 1FX0B 4TS9A 1NYRA 4BVAA 3HY3A 3DCJA 3ZV7A 4TMTA 2B6NA 5EKXA 3VHQA 1M74A 1WPGA 2COEA 2PQ2A 4Y9TA 1WKVA 2FYTA 3KWLA 4GX2A 4EHBA 3UICA 3S44A 3E15A 4ZN6A 4WI1A 4BLVA 1YJ5A 3D7KA 2WQZA 4HBGA 3KSBC 4LF4B 4GX0A 3I2KA 5IAJA 1C1HA 1KE2A 3AKCA 1QU3A 4P2GA 4M98A 2C99A 5TPWA 3PKZA 1I3OA 4BLWA 2QR5A 3J80A 2P8JA 4FFSA 4MEJA 1QHFA 1XTBA 5GTDA 2QDKA 5I9IA 3OMXA 4H60A 2FZVA 3K3PA 2Q5IA 3U0BA 2CXHA 2WU8A 1Z2AA 5CVDA 3TTWA 1J2RA 5B6IA 2LRHA 2GT1A 1JHMA 1HKUA 3C7TA 3JQ9C 3NOVA 5F12A 3ZGNA 1XSEA 4EG7A 2O2CA 5BUCA 1MQ8B 1H2XA 1XDZA 1KZ7B 8AT1A 5KYNA 3IAS1 4J2TA 3NJ8A 1PS9A 3Q8WA 1A9SA 1CULC 1N5KA 4X3PA 5EYPA 3RVPA 1OXVA 2HEIA 2ZJ6A 3AV3A 2VQEB 2VJLA 2QN6A 2VYND 4B32A 4YCMA 1V8OA 4B4WA 3U4DA 1JKFA 2H2AA 3PF9A 3PJDA 3EDQA 1ID1A 2WTAA 3W78A 3GFRA 3PNPA 5DTQA 1GQOA 1M0SA 1VKOA 4Q01A 4UE2A 1QH9A 2AJLI 2VDWB 3DBLA 3FLBA 3NDRA 3OE4A 4GDMA 5F51A 5FHRA 4TTSA 1U2ZA 3W2HA 4EYSA 1BMTA 1YAHA 4ENQA 1N2BA 4EKEA 1T2FA 1T0IA 2WP8J 3CVVA 2ZIEA 3PL1A 4DG8A 2DPGA 3WL6A 4KTVE 2XMZA 2B20A 4AMYA 3ZGXA 2YYZA 5EG5A 5TJHA 4FE7A 2OOSA 3GELA 2R1TB 4LW8A 3W5DA 1I7PA 5FPTA 4G1VA 4PRZA 2QWXA 4J03A 3PJEA 4HNGA 4TLBA 1P6XA 1IC6A 2Q41A 3H6HA 3I01M 3OM9A 4FC6A 5EWLA 4PN7A 4CETA 4EBBA 2EW1A 2ZRNA 1NF8A 3LC1O 3NP7A 3TG8A 3QXCA 2OE2A 3JD0A 4Q9KA 1IWPB 2X8JA 3AUJB 5IBRA 3SZRA 4B44A 5A5DA 3K20A 2X6QA 4BLOA 2IXFA 1W4LA 3LXXA 5JWOA 3MJRA 1E5DA 1Q1EA 1JIJA 2WSSD 1K8ZB 2APJA 2DFVA 2PO5A 1SK9A 1EHCA 3W8DA 4JSTA 2XQJA 4QOSA 3B2NA 1T13A 4GLBA 3X1DA 3JASA 4IGIA 4DT1A 2FPSA 3P4YA 1AO3A 1W30A 4JC5A 5H4GA 2AMFA 1IIBA 3W3AH 1MOQA 2B98A 2PYZA 3IEMA 1E1CB 3OUZA 4DR7B 3L9WA 5FAXA 1WB6A 4OOFA 2IYTA 3OH8A 4AY5A 1UUFA 2PX2A 3FMIA 1WMEA 4A0RA 1ZD2P 5LYYA 2FK7A 3FWNA 3QEBZ 1SUAA 2FCRA 2H1RA 8ADHA 1XZMA 1DDGA 3ZQ6A 5KREA 3UHPA 1NMYA 2JC3A 3DWIA 4WZAB 4PZDA 1TZCA 1BEEA 2Q4EA 2ZWMA 1RCTE 4UMEA 5ECDA 2ZM6B 1Q7EA 1M5TA 1BXZA 1C1YA 3HB7A 1RWVA 1Y1QA 2ZI4A 1MRNA 2WK1A 5DX1A 4KAFA 4FCWA 4ZMRA 4Q03A 3P0HA 4JOCA 1XV5A 7REQB 3LBFA 1TCBA 4QYIA 3NIDB 1CSEE 3RT9A 1KO8A 121PA 3WGLA 4ZI7A 1NRIA 1PS0A 1G8MA 3WI7A 4MS3B 5TPZA 2BSAA 1S4QA 1OZFA 5B1SA 4BUJA 3IUQA 5E7MA 2C2MA 2P1RA 1Z2EA 2QZ4A 3Q1LA 2Z5VA 2CNDA 4H0NA 3F4BA 4GGOA 4JKYA 4R2WA 4EWLA 2BGRA 2VWQA 3VR0A 2A2ZA 1NP3A 2AZ4A 3D6AA 3FGNA 3A7DA 3OU6A 5F5LA 4EITA 1V26A 3MWFA 1ODJA 3HUTA 3IO5A 2ZTSA 1UJCA 3QV1A 3QYFA 4G9GA 1T9DA 2A30A 3FUWA 3GGSA 3M82A 2FPWA 1IEWA 1YK0A 1GA1A 4MHOA 3AB3A 4QWWA 3SMQA 4YLYA 5ICGA 3JRNA 2BL4A 4N12A 3KRTA 3ZDCA 1ECGA 2W4QA 1OR8A 3BCUA 2PU5A 3HGTA 4U6SA 4UMFA 5EOVA 4EPVA 4B2IA 2C5BA 1BE8A 1LI5A 3MLEA 4PSCA 3V4VB 4CT0A 5CEFA 2L42A 3MWEA 3O73A 3QZUA 4FDAA 2DEUA 2NP6A 1TU0A 1Z63A 1BJRE 1YGPA 3MCVA 1G8YA 4GXQA 2H5IA 1SC9A 3A1SA 4F85A 1GGEA 3UAXA 5HUQA 2M32A 5AW5A 1SUCA 2A9VA 3RKRA 1OFVA 4PFQA 4PFKA 3TYXA 3FWZA 1P3JA 3LMKA 3OZSA 2OBNA 1RP1A 2BONA 2OPHA 4P7FA 1WHSA 3C45A 1TK3A 3LV8A 1PWYE 1SOAA 2JFPA 1E60A 4IIFA 3UJ8A 1JPNA 2CZGA 1Q0UA 2MMCA 2OBXA 4DANA 1BG6A 4I66A 1DWUA 2ZBRA 2OD2A 3HVJA 3SGLA 5IX8A 2R0QC 4ZQBA 2WABA 3WBJA 2GEDA 4AKHA 3RM3A 1RM5A 5FOSA 4MMXB 2I5PO 3E7DA 1S7CA 1H9BA 3D59A 5L4LA 4BNLA 4ZI7F 2FEOA 2Q5QA 1OLUB 3WWZA 1R6AA 4EB3A 3VA7A 1UMDA 2HZBA 2VPXA 3AXSA 3IV6A 3ZDQA 1QJ4A 1YDHA 1EB9A 3E18A 5JV5A 3B1KA 3CW2A 1VZ2A 4X44A 1BMFA 1EUCB 3KT0A 4LY3A 4PZPA 3HA2A 3QLUA 4L78A 1EGMB 3MTIA 4IJ5A 4K6FA 2O57A 1LV7A 1K5PA 4QICA 1QGUB 2EIHA 2VNJA 3HA5A 4GXTA 1YBAA 1JJAA 3MCWA 1SBHA 2WJAA 4QL3A 4FUQA 1USKA 3VJKA 4EPTA 5JANA 4N7JA 3I9NA 2EDAA 2YJ4A 3GUVA 3BD7A 4FKMA 4OHXA 4Q9NA 5DB4A 5AOVA 5J2TA 1BU8A 5AJYA 1H1LB 5L6LB 3VPCA 4OU5A 3GRYA 3JD2A 4U8GA 5FWYA 1BEUB 4M8IA 3C3AA 3SIXA 3EBPA 4X97A 2J1LA 4ESEA 2BELA 5IXSA 2BMVA 3ZLBA 2PUAA 2ZIFA 4QGAA 1NBEA 1P4AA 3QKUA 5TT1A 1KI3A 1JMYA 4YK7A 3OETA 1SWVA 3YASA 3NRBA 1B8OA 3FJYA 3TOSA 5BW4A 1KQGA 2GD0A 5IABA 1JQ3A 2AMLA 1YZ3A 4IOKA 2AJDA 1Z5VA 3DONA 3T7KA 2WVJA 4IGFA 4CVNA 5CH8A 5IJ0A 4CEHB 2FH5B 4KO4S 5GJWC 1JDVA 13PKA 1V9LA 3QVMA 1MRSA 3HR8A 1JHXA 3S29A 1CRWG 4NAUA 3WMGA 3G9ZA 1N6KA 2OBBA 1RPTA 5F3DA 3ZHRA 2ZRAA 3SEZA 4IIHA 4PSUA 2NXCA 1E2HA 2R6AA 4WKPA 4MARA 2GYVA 1GVHA 3L93A 1GDTA 4B3RB 1CPYA 5JD4A 4JFAA 2ZSAA 1CFZA 1IUOA 2G5CA 1YRAA 4RAQA 4AKGA 3ITDA 3N59A 2VJPA 2BBOA 2ZPUA 1JVBA 1YQQA 1CDDA 4A36A 2BFDA 3D4NA 2XMBA 5AI5A 1O1YA 3ESDA 2JG3A 1MUUA 2Q9CA 3DOUA 3M1YA 5ALOA 4QDOA 3TXAA 3W9UA 3ZGYA 2NSDA 4LXQA 5FBWB 2JHGA 4A26A 1XRPA 4I4CA 2Q9UA 3FYCA 4RSGA 2O23A 4A1OA 4ETMA 5AXAA 2JGLA 3OECA 4X7BA 2ZT6A 1TVCA 1TYDE 3EC7A 3NHRA 2C9MA 4WZBE 2GZDA 3KG2A 3OPQA 3R0ZA 3QKWA 5EIWA 4EEZA 2WNSA 1DO2A 3CVYA 1QH1B 4GO1A 3AFOA 2CNWA 3RT7A 4FFMA 1MA0A 4MV5A 5J2TF 3PUVA 3GQBB 2RK4A 3ZGVA 1V25A 1K92A 4G41A 1FLVA 1TF7A 2VNSA 4LV6A 4DWWA 1PQPA 1EX6A 4D8XA 2JI7A 1JSCA 2GTPA 1OQAA 1QIIA 2FR0A 3FTCA 1KJNA 4XGRA 3FXAA 1T9BA 3DE5X 4D56A 3AX6A 5MN6A 1AM4D 1QMGA 5JH7B 2MCFA 5DTMA 5LU9A 2WSYB 4FCCA 2OKGA 4ZO9A 5EJGA 4LJ4A 4OLBA 5CVJA 1SU8A 1Q44A 3DBRB 1KOLA 4BV3A 3UB3A 4TMWA 1TQHA 2FE4A 5KAMA 3L7JA 4GE0A 2ZYIA 4R98A 2GRUA 3A06A 3B36A 1F6WA 3GXBA 5F52A 3RAFC 4LNAA 3MUNA 3L5OA 5H7XA 5I8ZA 5HIIA 3W1WA 3WX0A 4DDWA 4TGLA 1KNXA 3EC2A 3F0TA 4LOJA 4E21A 2CSXA 3WLKX 1YF3A 5IK2A 1G9TA 1O3YA 1X9IA 2YZNA 2RGRA 3NKLA 4OJQA 4Y1GA 4EA7A 3KB8A 1CY1A 5CB4B 4LG1A 4LMRA 2VEDA 3CF2A 2OVBA 2FPRA 2ICAA 1TCAA 4LY9A 5LL6P 2I87A 3DXFA 3BYZA 3L1UA 3ND5A 1PJ8A 1ZHHA 2WJZB 3PBKA 3PR3A 3PWTA 4ITRC 4MUFA 5EERA 3Q1KA 3TBKA 4UAGA 3W9BA 4ZJPA 2B1RA 1HWYA 3PQ7A 4ZQGA 3F9CA 1XX6A 2TMKA 4R51A 3TCKA 3G5LA 4IH1A 4WNAB 4HAOA 5A6VA 2IXBA 3FZNA 3H1EA 2PK3A 1XIVA 4QGHA 4INOA 5K3BA 3VOBA 2VC2B 2AUTA 3D7SA 4DVJA 2XGSA 1G5TA 1J2EA 4PC2A 4ALKA 3AJDA 3TQHA 1U6JA 5KYXB 2NO6A 3MS4A 4FX5A 3VR2A 1E63A 2V7GA 3IAM1 5J9FA 4Z4FA 4QSMA 3ESQA 4R81A 4BXOA 5B3JC 2YX1A 3NIWA 1FTYA 3NBZC 1E9AA 3RGGA 1LF0A 3GRUA 3B1YA 5LQCA 1QIFA 3LVBA 3AZPA 4DNXA 2HDHA 4MUYA 5JBIA 1S2NA 2VUSA 3MAJA 1W85A 4IF6A 8ATCA 2YR0A 3SVZA 2DCMA 2FXIA 5K01A 4TTIA 2WG2A 4LQ4A 2JCXA 3J81A 2DX7A 1F4VA 1FJHA 5H8WA 2XYPA 4OI0A 1XD9A 4BKOA 4BV9A 3AFIA 3RTAA 3TZCA 1F2UB 4FDTA 4Q3CA 1YAJA 2FEPA 3C7DB 2OTCA 3MAAC 2ZRFA 2C29D 3BD8A 4WOCA 1CC1S 1N2CE 1Z8FA 2CHFA 4LK2A 3TM4A 1GAQA 1P5FA 5KWEA 1P0MA 4C78A 2IWRA 1Z36A 5C51B 5K3FB 3A28A 2ZZKA 3DXXA 1XEWY 3CZAA 1I3NA 1UZLA 2CW5A 1Y8ZA 2PQMA 1H6CA 4J0KA 5K4AA 4RIIA 4RORA 4H1UA 3TSOA 5AJVB 3TE6A 2G07A 1BA3A 1NXVA 1QHIA 2FG6C 1S8NA 2FF5A 2H2FA 4IFBA 4XW2A 4YQEA 1Z39A 4E6EA 3AVPA 4EFKA 2Z6UA 1F0PA 2FN3A 2GERA 2CSUA 3C8ZA 5AJTA 2OCXA 3NHJA 3AVUA 4H35A 3WLQA 2W2TA 3SHFA 2ZLBA 1VE7A 4IIJB 4AFNA 1LV8A 4E4TA 1MBZA 1FBTA 1UBHS 2QLFA 3B5EA 3PDJA 3R5SA 5JEEA 4J0CA 1DO0A 1W9MA 2KJQA 1DQRA 2QYSA 3SNKA 3F5DA 5D5PA 4O2AA 3ZG6A 4U3JA 5KNCH 4K3VA 4ND6A 4D8YA 1ZK1A 1ORVA 4DA4A 3VGJA 4ZT5A 1YZQA 4RHUA 3ACCA 3E2MA 5EXSA 4DB2A 3WMXA 4M53A 3ELYA 2I9KA 3ELUA 2NTVA 2MSLA 4W8GA 4HTFA 3T3OA 3WLJA 5BN5A 3JAWA 1F51E 1N6RA 2XWJI 3M1AA 4PAWA 1M34B 3AETB 4G4SP 4MEAA 4V0QA 3TMKA 1SUWA 1YWGO 3H1BA 3WJ7A 3ZW7A 2I7DA 1G8KA 1X3LA 4X60A 5K2MA 5CB8A 2DT5A 3KEMA 3CWQA 1VCNA 3BE8A 4H08A 4DY6A 1TK2A 1ZDMA 3BRWA 1XMOB 1E5QA 1NPYA 2A0XA 4Q34A 4Q4DA 3IP8A 3IR5A 3K05A 3ZV3A 1QG6A 5JY6A 2HJGA 1YZGA 2RKWA 4AX8A 4DBVO 1IHUA 4YXFA 1I94B 3EF1A 4R1UA 5E4FA 2WWIA 3NCTA 1EUYA 1XRQA 3HMKA 2NOAA 4MWBA 2D1TA 2HWKA 3WIOA 3D8SA 2DM6A 4PYLA 5M3BA 1FQKA 1Q7TA 2IHYA 1IOVA 4JVLA 3GJSA 1ACLA 2ZUFA 2P4QA 4NS4A 2PCLA 3NHYA 1FSSA 1Y5RA 3AF3A 3UATA 1J4AA 1ST3A 2AUNA 3IP3A 1RLJA 1TT5B 1TA0A 3IUJA 1JHPA 1K9SA 1GADO 4GG1A 5E3IA 2OO5A 1FRZA 4ZI3A 5I6DA 3QBEA 2Q3LA 4ZQHA 2OORA 3QXHA 3ZIAA 1RXYA 5B1HA 5A62A 1I51A 1QKJA 2R5FA 4XIYA 1FSZA 2RAPA 5LD2C 1KXJA 2R00A 4CKBA 3HHPA 3DPIA 4AS1A 4KQGA 4KDEA 3W8RA 3C48A 2Q4DA 3AFMA 3NBMA 4ZRMA 2R8BA 4ZU1X 2W93A 2IVZA 2RHBA 2OCBA 2HSZA 1RYZA 2VUUA 5LYJA 4J90A 1NVGA 2EQBA 3RVLA 1AK9A 3SDBA 1EPUA 3ZWNA 4HDRB 4O2AF 2ISQA 4UBIA 1DT5A 4EJSC 3X1KA 1W88A 1BFUA 3EGOA 5ITZA 1RJEA 1XEXA 4HJXA 2XKBA 1LW7A 4FB5A 4EIWA 5ADHA 3R6WA 1ZIOA 4IM7A 3VSAA 2W8ZA 1FNMA 1YQXA 1N6NA 4OLFA 1WDTA 4C7XA 4YRRA 4MRAA 4NOMA 4U6QA 2HK8A 4EUEA 4E31A 3DR5A 2JIRA 2QUKA 2QT0A 3EAQA 4PCVA 1FY2A 1W46A 1UDBA 2Q1UA 3HY6A 3MTEA 4AZWA 4Q4LA 2HTFA 3MGCA 1VOTA 1QLWA 1E58A 5GWXA 1TZKA 3AIOA 3ZW8A 4GYYA 4YRLA 3P4UA 2F3UA 4HN4B 3AL2A 3IT2A 2P35A 2E55A 4NCKA 4ZCMA 5FUMA 1QHGA 5KOJB 3OQBA 3KPUA 1UXGA 2C04A 3DNFA 3GQVA 1FK8A 5F2OA 1KU6A 2YY7A 1PT7A 1RIIA 3RSSA 3TJZA 5CDGA 2HCJB 2DETA 1Y6QA 1CUXA 5LLDA 1M10A 1VBNA 5K8JB 1R00A 4OQMA 1K88A 2R1VB 1YJXA 2EL9A 5DISB 3RARA 4YRCA 5DI9A 2WG0A 1SKYE 4PPYA 3BTUA 3OIFA 5CLGA 1JQLB 2Y1KA 5ECYA 3P9XA 4B9AA 3A25A 1QMPA 3EXHC 3KX2A 3LQQA 4NYIR 3CFYA 1PJ4A 4O1HA 5I7HA 1XZPA 1U7DA 2VPZA 2PNJA 3RJ9A 4QBHA 4RZQA 2AA3A 1V9SA 4EJ2A 1AIPA 1F7VA 4OHVA 1R5NA 4AG6A 1Q0PA 3P2IA 4FVTA 1O4VA 1OC2A 4JKIA 4GVXA 1A8UA 1M1NA 1DKNA 2W90A 1T8TA 3DO8A 2NV0A 4OQYA 5LYJF 1U6KA 3I6YA 1DXYA 1YBHA 2GUGA 4KRXA 4GKVA 4X3OA 4JYCA 4Q48A 3A31A 3GRFA 4MJ7A 1VIDA 3EH1A 3DGFC 1OI2A 1W5SA 2REXB 3NTRA 2G1KA 1AGPA 1FFBA 3SC6A 1F14A 3FCCA 4FMDF 2VNHA 5EZYA 3JYQA 3KJNA 2CUZA 2IFTA 3MJCA 1GUZA 4RLHA 3RKSA 4TUYA 3CZCA 5C46F 2HREA 1MN6A 2IHKA 2XVYA 3KLOA 1Z3CA 1S3SA 3GLIB 3U4QA 4OHRA 1N7JA 4M8NE 4NR0A 1R66A 2W2MA 2F3PA 3LNTA 4CQMA 3T5GA 4DQ0A 1WCIA 4Z5XA 2QBYB 4EW2A 2YZ7A 4ZK6A 5FP0A 4NABA 3K9BA 5JC8A 5DI3B 3WNDA 3IDSA 1IPHA 4JLUA 2FVXA 4CM4A 5FDFA 4CF5A 2PLAA 4FT2A 1DPFA 4FFOA 4DM7A 2BGUA 2F3TA 2JIBA 1N6PA 2JLRA 3D8RA 4UTZA 5J58A 2AZXA 2OV8A 4CF7A 1JKMA 1IH8A 3CH5A 4FKBA 3DMNA 3MIIA 4TSKA 3ZY3A 1FMJA 2X7HA 4URYR 1QB7A 2GEFA 3U44A 1K0UA 1RPJA 4IHKA 1YMUA 1M7BA 4JROA 1CJVC 3SR0A 5B2ZA 4FFRA 4QEKA 2AC7A 3V8PA 4EVIA 4YIHA 1SKMA 1FNCA 3OI7A 4RTNA 1XCGB 1CEEA 1FW6A 1E59A 4ZOAA 3ZK9A 3ES9A 4GLOA 4WK4B 3ZVKA 4A73A 3T3HA 2CMDA 4DEYA 3BJEA 1CY8A 1VFNA 2FSUA 4R1PA 1ZM9A 2FZEA 5IT4A 4N1AA 4MRSA 3OSZA 2MT9A 3K9LA 2RH8A 1W0JD 3GUCA 3J7TA 2Y1CA 1EH5A 2CCGA 3PSHA 1YE3A 1DTWA 1HNWB 3CIFA 2HUPA 3EVGA 2ZI9A 4HDNB 1BN6A 4JXXA 3IVAA 4J16A 3VZPA 1BQ4A 4YALA 4B5LA 1XEFA 6GPBA 4MP3A 2VXYA 3IAFA 2HCTA 2P6OA 5EJMA 3BWMA 1Q0SA 4Q37A 3VSBA 4XQGA 1J9EA 3GC6A 5DLEA 3OQPA 3PXGA 1BCRA 4D92A 4ND8A 3WFJA 1CV2A 4YAEA 4S04A 2R4TA 1SU6A 4UHKA 3KEQA 5EIBC 2O8EB 3NVDA 4MUIA 4G63A 2JFGA 3TOXA 4Z49A 1XMPA 1S8AA 3NQ41 2AF3C 4GPBA 4MVYA 2WUVA 1DDIA 5EZYF 4TVBA 2QUZA 2IBMA 3DOEA 4B3BA 3FBTA 1TZBA 3CGGA 4TUYF 2PUDA 3HCOA 3VX4A 2Z43A 2K2WA 5SZIA 3UCXA 1OAAA 1QWSA 3S55A 3UZUA 2WWHA 3N0RA 1L5WA 4NY1A 3DTVD 1N1GA 2XHZA 4MAMA 1XDDA 1WULS 2D5LA 1EFTA 1VA5A 2C9OA 2DQZA 2J30A 1EAMA 2WTEA 1MIHA 2F4VB 2IEZA 1LJ8A 4PLZA 3DYBA 2ZEJA 3L0OA 4FR5A 4DIUA 4X6XA 1TZJA 4ICIA 5DBGA 4YAUA 4MKXA 1YV9A 2EHJA 2I91A 2C92A 5KYUA 2A1UB 2UZ4A 2JEOA 2JKYA 1KYWA 3L8DA 5HQ3A 3IYLW 4HCJA 4ZZ2A 3D7LA 4JUAA 2QD1A 1JFLA 4Q4JB 3TH5A 3WKAA 3HBLA 3MSCA 3M33A 1KEVA 4GNRA 2DFPA 3JWEA 2WD7B 5KZMB 1VL6A 2GH1A 4BFCA 2DY1A 4MCJA 1D0IA 5AIAA 2V6FA 5B3AA 1RAEA 521PA 1VHTA 4FJ0A 1RXIA 4WK2B 1R18A 4RK1A 5E1OA 1XMJA 1YHZA 3ETGA 1YBMA 3DKIA 3KZVA 1E1DA 2ESRA 3M4NA 2ODTX 5F5XA 3DE2X 3G9TA 4CG3A 1QHEA 4YR9A 2JA2A 3DXZA 1V96A 1PU2A 3HUFA 3V4PB 5C5CA 3KUXA 4Q66C 5T41A 1XVIA 2MDTA 1QIMA 3F1LA 3DO6A 5CXQA 3R3UA 2II6A 7YASA 1ZO8A 3TNDA 4D9HA 1T36A 1K75A 2BJVA 3ISTA 1NJFA 3OURA 4EO7A 4L76A 3ZHYA 4TZ0A 4WXEA 5CITA 1L8XA 3C3DA 1AOXA 1NBMA 2CEAA 5E1BA 3GFTA 4WWHA 3GWGA 2H29A 1UBKS 1JQDA 3VR6A 4N7RA 4GBMA 1H65A 3F3MA 3FSGA 4CTOA 2BGGA 3CNEA 2C7QA 5K6AA 3OIUA 4OHPA 5BRNA 5CVEA 2BEUA 2J3EA 5KTPA 2OGWA 3OKCA 1SGWA 3HG7A 1ZAKA 3DLIA 4JSYA 4MQEB 4IEIA 2WUGA 2NU8B 5BN3B 5IUJC 3RVSA 3W06A 3OESA 3T94A 4L6CA 3UPDA 2CXPA 4H9GA 3IEVA 1J33A 3DAHA 4PRLA 1S4MA 3DE1X 3VSCA 3NBAA 4IHJA 3SD7A 4HEHA 3EEIA 4YT5A 3W7AA 4JLJA 2Z9BA 3STYA 1E6CA 3C6XA 2V5AA 1SBZA 2FP4B 2XMCA 3FDZA 1DAOA 3VR5A 4LQDA 3G0BA 4XAQA 1PDWA 5DNYB 4EYGA 1JG2A 4PCUA 5C5DA 4ZT2A 2FMTA 3AR6A 1DKLA 1FP4B 1P5JA 1PLKA 2VT6A 3PNQA 1D8AA 2AX4A 4XKJA 3I2IA 4Y2JA 1HA3A 3FOZA 4UHHA 3R7NA 3N2YA 3NTOA 4JNCA 4FOLA 2OLKA 4RIHA 4BNXA 3CSUA 1IVNA 1Z38A 1ITZA 3NTVA 1KE1A 5K4HA 1UM8A 4TZTA 5KWVA 4FMBB 3BL6A 3PEVA 1U1IA 4Q6WA 5IKMA 5L6MB 1UODA 1QK3A 5AK6A 1KVSA 1QO0A 2GNAA 2IUEA 2CVZA 5SZKB 3ZGZA 3PXXA 4KZKA 2XVXA 4HL6A 3RTDA 3TLBA 4CTJA 1NE7A 1XQ9A 4AS3A 1IQPA 1N1EA 3V46A 4HWGA 4WNYA 4NV1A 1PK8A 3LC2O 3KYIB 4L75A 5ESDA 4NF2A 1G20B 2FR1A 3HUUA 3TZEA 3AESA 2I2WA 1M2GA 2ZJ3A 3JVVA 5I4BA 1V48A 1OWPA 3L41A 4FFWA 4KV9A 4XX0B 3GGCA 4WKBA 4NCAA 1RTTA 4J91A 4BVBA 2GYUA 3EVEA 2QQFA 4YMSA 5DF1A 1KYYA 3CF4A 2Q5LA 3BFJA 2RGNC 2YHSA 3CR7A 4KZPA 4JJ8A 3E2PA 3WIVA 1LQ2A 3DTVB 1GZ4A 4OXRA 1H2WA 1LVUA 1LPPA 2Q2NA 4RZ2A 3NWPA 4MLDA 5DLYA 3RVJA 3S0JA 1XPUA 1GXSA 5LXTA 2IV7A 4KPYA 2GA9A 2V96A 2EFCB 2WIBA 4BGEA 5C35A 4Z3OA 4QWMA 4OCZA 1SHUX 3CF4G 3P9YA 2I62A 3TVYA 3R0QA 1OAOC 1Y3IA 4Q9LA 4C7BA 3I72A 1E96A 3PX7A 3PYLA 3SYKA 4IHJF 5C8VA 3I62A 5LZ8A 3D3WB 1L4NA 2C2WA 1DAMA 3UG6A 4CG1A 1ISGA 5EXDA 3A04A 4YR7A 3H0KA 4J3JA 3K92A 2IU0A 1KFBB 3KD3A 4KLNA 2I4IA 3T9EA 3QKSA 1JHOA 2HLDA 1I7NA 5IS2A 1S9HA 3H2HA 2AS0A 4WEOA 5CNIA 2VRNA 2BAGA 3OQNA 2QZZA 1X7GA 1R9GA 2W8BB 3DHWC 5HJ2A 1E61A 2V8OA 3GARA 3HSKA 1OPRA 4II7A 4B3XA 3WC4A 3AMVA 3H1AA 2BMFA 3QVSA 3G0OA 5A3JA 1RABA 1S3GA 2OD7A 5HIKA 1AS3A 3THXA 2D8MA 1M2KA 4RQBA 1YZNA 1V43A 3E7PA 4N5DA 4XYMA 2G83A 2GN9A 4OH1A 4BNKA 5HQJA 2CK3D 1NZFA 1OKKD 4RIFA 3UGJA 3EIWA 4NPAA 1EK6A 2ZRIA 1A8QA 3KQPA 3JQCA 3IVMA 2IYSA 1RJGA 3KJIA 1CZRA 1ZNQO 4I5EA 2GN8A 1MGOA 2OOKA 2Q1SA 2G71A 3U4MA 3SJCA 2O14A 1NQAO 3Q3CA 4IIBA 4P31A 1GCIA 4XTRA 5AM0A 2O54A 3AUUA 3TBHA 1CW2B 4Y9DA 1UZUA 2XCUA 4C6SA 1V11A 2ZAOA 3H1GA 221PA 5BYKA 1SUDA 1QDLB 3RTEA 5JARA 1I9GA 4RTLA 5HTKA 4QDZA 4KDFA 5D6OA 1QO9A 3LUJA 1R6BX 2LWIA 3AUXA 4N0EA 2J67A 4F04A 5EMHA 2IS4A 4M1OA 3AY6A 4XJSA 1B93A 4WY8A 4BQEA 1YR6A 3ADOA 1W34A 4LIPD 5LXTF 4DMKA 4G0UA 5MHTA 3H4TA 2HSEA 3S1AA 4ZPJA 5JNRA 2QD4A 4QUJA 5EJEA 4KSBA 5DLQC 1FLAA 2CMHA 3CJQA 4WBNB 3WB0A 1E98A 2RJNA 1D8TA 2V58A 3KSRA 3QW2A 4HAUA 4MIYA 1BS2A 4M9XA 1EUZA 1PJBA 2EC5A 3KOZA 1WOYA 5IDYA 5BOSB 5HCIA 4CM1A 1ZHOA 2OD9A 2XRYA 3LWNA 1GTG1 2WF7A 2ZR7A 4FEYA 4CG2A 5LC1A 3BIJA 2NSYA 3QVLA 5CXUA 1KQ3A 1T0UA 4X64B 1ZZEA 1OZ0A 2IXAA 3H5TA 3IBTA 2H5JA 4JJGA 3K2QA 4YT8A 1JJVA 1D4ZA 3L0PA 1MW9X 2I1WA 3OJXA 3T7IA 1AHPA 4OJNA 2JI9A 4Y0NA 1W6UA 1KDVA 1NX6A 3ZZNA 1OXMA 1P5ZB 1XROA 1G3QA 1QVAA 4I1UA 4D57A 5JASA 3DDZX 1M6HA 2C2ZA 2PMCA 1J8QA 1X8JA 3BGVA 1TKCA 1XCJA 2F1HA 3PNMA 3KE8A 2Y3IA 3LY7A 2X14A 1KI9A 1EK5A 1WEHA 2CWWA 3R6DA 3A9VA 4TLLB 1WQ1R 3JVDA 2OESA 1AKYA 2FUG1 3QNWA 4ZZ3A 4I55A 2D2FA 3QMMA 5DSZA 1DVRA 1L7XA 2JNWA 1YCGA 1WMFA 2OGTA 4ZGWA 5BURA 1JZQA 4KW7A 5FOWA 2XBMA 1O9BA 2SKDA 4N6GA 4Q9IA 3FGZA 3FSJX 1UDCA 2O1EA 2YHBA 3H0EA 721PA 1EEHA 4H6PA 2IW1A 3AM3A 1E9FA 4ZEWA 1XU7A 1WY5A 3HGQA 1CUHA 2G63A 5TDHA 5KU1A 1Y33E 1V5GA 2B4KA 4PLVA 5KJCA 4QPDA 1C30B 5AKGA 3DFIA 5JTUA 5JSKA 2OZPA 5C34B 1DKQA 4A8HA 3Q72A 3DE6X 3MRTA 1QFXA 1YDWA 2FF7A 4E07A 3R9XB 4HPJB 4KK4A 1SK8A 1K6EA 4DJFC 1XYVA 3KB1A 2P62A 3I5UA 3V7YA 4FHGA 1Y7PA 1ISPA 1PW5A 2DPXA 3M6MD 2YL2A 4DCVA 2O0HA 4H6XA 4RY0A 2HKIA 2UVPB 3GHHA 2GVZC 3HI4A 3HYRA 4O3FA 1NG9A 2XUJA 4CM6A 4R1OA 2XB4A 3EQ7A 3ZCQA 4M83A 2HOQA 5KTRA 3OZFA 3U9LA 1RT9A 5CBPA 5JZOA 5E8RA 1MEJA 2B3DA 1RADA 2BN4A 4I1IA 3KDAA 4U2EA 3ZD8A 5FUBA 5AUPB 5AKHA 5KO2A 4GECA 3BDVA 4JWKA 3UTCA 4NULA 3OO0A 3USZA 2H2IA 2WAAA 1QK4A 1N1MA 1RXEA 2A7XA 2GBLA 3PXAA 3WL3A 4DVGA 2BCGY 4EM6A 1U2GC 2QRGA 3AI1A 4N48A 1Y80A 2ZK7A 3D3KA 2QHXA 3DMFA 3H5LA 2VDJA 3O3OB 3O2SB 2HO4A 4PIMA 2SKCA 1SCJA 2ZAYA 4YYZA 1EK2A 1I7LA 2XNKA 2PS9A 2UYOA 2C77A 3ICCA 3I9JA 3BFKA 1W76A 2O2EA 2RGCA 3BX1A 3CO5A 5IC5A 4D5EA 3Q41A 1U3TA 1ZVKA 4XVQA 1YQUA 4I55F 2O20A 4CQLA 1GPLA 2GPJA 5HJ5A 3MT8A 3QXXA 1ZA1A 3N0XA 1ZA2A 4L8VA 4EUHA 2VPIA 1GPBA 2L17A 5DBEX 1UOEA 4L72A 2XZDA 2QL7A 5EE3A 4C05A 5LZ9A 3CNHA 3IAS6 1D5CA 4FMCB 1ATIA 3D64A 4N5NA 2E48A 4ZQCB 3KD2A 2ID7A 2PEZA 2V7TA 4EOGA 4BGIA 5LMNB 3OKPA 2EGGA 3OKAA 3Q9UA 4C2TA 2WDPA 2NTJA 3JY6A 4W4TA 3ZHQA 2A8YA 2ZXFA 2QN7A 4GMXA 2VDLB 3Q5EA 3OQOA 3AC0A 3WE7A 2C97A 2ONCA 3RFVA 4C7KA 2J0UA 3PJGA 4QRIA 2FX3A 2MYTA 3H05A 1JBKA 1R0SA 3FJOA 5BOVA 3KLMX 3WLSA 3WLIA 4BL5A 3HABA 3DVAA 2VHUA 4M87A 5F9MA 1SAYA 4HZGA 2ZTVA 3VDRA 3E7XA 1P9RA 4LE1A 1P17A 2HQOA 1NQUA 2Q1XA 3NPAA 1TRKA 2RHMA 1X80B 4M7WA 1LFDB 2GWHA 2ZRMA 4GBJA 4PG4A 3QEJA 3BMCA 4YFYA 3OFNA 4JU9A 2EW8A 2GK4A 3NLLA 1N5IA 1M2FA 2N47A 3PWSA 4N54A 5ILGA 3ZI4A 2IS1A 5LKAA 1RR6A 2J6BA 5A4JA 1GU0A 1P4HA 1JTVA 2O8VA 3EH2A 4B73A 3ANMA 1E1RD 3FRHA 1PFKA 1JI0A 1YL7A 5DCYA 1EM8A 5LU8A 1BU5A 3GLVA 3OU2A 3R1IA 3R3VA 1EKXA 1DC3A 1VB3A 4FCVA 4UULA 4WBXC 1YKGA 1NJ6A 3NRJA 2A33A 1KIMA 1PQYA 2HF8A 3NUZA 4E32A 3BSWA 4GNKA 1G5IA 1UK7A 2X15A 1NLZA 5DHTA 3CE6A 3O3CA 2O8NA 2YIDA 1IBCA 1K6XA 1R0KA 1E9EA 3ONEA 4LSGA 3VNSA 5J4YA 2Z8XA 4DMRA 3VZQA 3U3MA 5CDFE 1Z08A 1J8FA 3OQIB 1YO6A 3SQNA 5I48A 2V9PA 5ALRA 3UANA 2BF7A 1XF1A 2X9GA 3A37A 3FHOA 1RMYA 3EIXA 4U5XA 4DIKA 1F12A 4WUVA 5B4VA 3ZXYA 3GEHA 3PQ8A 1PNTA 1U81A 1YSCA 3L9XA 2CD7A 3EPHA 4NCBA 5IZCA 4IEEA 5JD5A 1QYIA 4HD8A 1OLSA 2XOEA 4XGQA 2GKSA 2FX5A 2Q9BA 3WB2A 3LZDA 3BL5A 4LCBA 2Z8YA 1OY1A 2PGXA 1ZBDA 1HNXB 2BUCA 4JI5B 2GF2A 2QU8A 2ZSEA 3S7ZA 1UC9A 5EP4A 3U7QB 2HIHA 1DPGA 3F3KA 4UD2A 1PRYA 3WGZA 3GT3A 4BKPA 5IAAA 1YDFA 3BGSA 2I3DA 1V1MB 5K45A 3RADC 1S2GA 4Y0VA 5TS2A 4ATNA 4B82A 1SD1A 5K8LA 1YCDA 4OBBA 4P7GA 2XYVA 4LYFA 4S0XA 5HZGA 3TZ6A 2XWBF 4O2BB 5A02A 2G25A 3LAWA 2MINB 3SZ3A 4XYGA 1TEZA 5DRTA 1E9BA 2ABWA 4L9RA 4MWTA 4B6OA 3PI7A 5EE5B 3TLYA 2GCOA 1Z34A 3EVCA 3O1LA 3P4XA 4X6LA 3PLAE 4Q7KA 2QXUA 3MN1A 3GV0A 4X95A 5KQGA 1WW2A 1IXYA 5AK5A 2ECPA 3S5UA 3WGOA 2G7ZA 4HAYA 4PNZA 2NV2B 3LPNA 3IJEB 2O0KA 3PJRA 1PFQA 4K9MA 4A6EA 4CR6A 1QIKA 4Z4GA 1SBCA 4RANA 4KBFA 1MKYA 2GZMA 3HBAA 1FVXA 2AG6A 2PL1A 2Q6KA 5DYWA 1FUKA 1E7MA 1UC4B 2R8YA 5L7TA 5LMZA 2DWCA 2QSZA 3NHZA 4ROTA 3DBHB 3SY8A 2JLAA 4Y6PA 4BO0A 1XZGA 1KMNA 1OWMA 2GETA 3O3NB 2QTVB 3P2MA 3PFBA 3EGEA 2DLDA 1DJNA 3EGDA 4KEAA 3LH5A 3UM9A 2VSYA 5K0EA 1B7GO 4XUCA 1EUDB 5AKLA 3FOBA 4NCIA 4HAXA 5T4EA 3M0EA 5AVTA 4S05A 1UJBA 4P81A 2C7PA 3VU3A 1IEXA 3P2JA 1USIA 1AZLA 3FTNA 3P8ZA 2BVNA 2LP4Y 3PEEA 2FOXA 3NGLA 3SMVA 1IPEA 3E61A 2F64A 4ZYZA 2PUBA 4M0DA 1KJ9A 1GILA 1BQEA 5I4IA 4R05A 2P2SA 3WDKA 4TRRA 1SPBS 1UBLS 5A06A 3ZJUA 1NNI1 2LBPA 4I19A 2R6FA 5K0NA 4MQUA 4GF5A 2GPBA 2CVHA 3KXKA 4OHWA 4CEJA 4O25A 2P67A 4OKIA 5LLTA 2V4MA 2AC2A 1HDZA 3HXTA 5AW9A 4QD3A 1IN6A 1RCFA 1UBCA 2IOFA 2X9LA 5ITWA 2H4ZA 2NGRA 4KYTA 4PFJA 1Y3HA 1I2ZA 3LCUA 4V0MA 3VVLA 1QF6A 4DILA 2PRSA 3DZ8A 2VSFA 1T8SA 4LDRA 4EG4A 2AZDA 3FPSA 4D4JA 7ADHA 4K46A 1CR4A 1FS4A 3OQHA 1GSHA 4L4XA 4P54A 5EPUA 3RFUA 5EIEA 5KUTA 1SXJD 4G4GA 2IDZA 3VKVA 1Q0QA 3ZI0A 5FTMA 5KS2A 2WMDA 3BE5A 1U5BB 2H52A 1RVV1 3TD2A 5BR1A 1WZIA 3VU9A 1DIHA 3CLTC 1MFZA 2IU3A 1DELA 4FJ2A 5FL7A 4C7JA 3WGHA 1R0BA 2OT3B 3QUQA 3AL3A 3IAHA 1O8CA 1YK1A 3QXGA 4EQ6B 5K0SA 4BLRA 1WXFA 1E4OA 2M1ZA 2QAGB 3GVCA 4FTWA 4DZRA 1F1BA 1D5WA 1VL2A 4R31A 4ZHQB 1BTOA 3G89A 4X66B 2ZYTX 1UM9A 2XE8A 3A3YA 1ISFA 3Q6MA 5H81A 3O91A 3KQHA 3L0CA 1LX7A 4G65A 2C9CA 2F3QA 2WM3A 3FHJA 5HBGA 1ISMA 2AOUB 3OOYA 1OZAA 3ZN2A 3JWPA 4HQLA 4EDFA 3C5EA 3EIFA 3OZDA 3RC2A 4HB2A 2NAFA 3VGPA 5JS8A 1UKEA 2HU2A 4U7JA 1QTQA 3N75A 1IYZA 1XE3A 4MWZA 3UT5B 1H8ED 4DNOA 2H7YA 5ELMA 3F6PA 3IGFA 4X20B 4H7KA 2V7QA 4EATA 4NMLA 4EJ6A 1BKSB 1AJEA 1PZGA 4HLNA 2QQGA 4F1JA 5L51A 1BHJA 5CCXA 4YAGA 1OWNA 5JNUA 5F1OA 5JAOA 5CCBA 2D6FA 2IODA 5FD8A 1PR2A 3QHAA 5AVSA 1MO6A 4GPTA 3OIGA 2PMBA 2DCUA 4BBPA 3EPRA 2FFBA 1FFXB 2RBGA 1QQ5A 4Q19A 1Y9DA 4YAWA 3RS8A 5DHRA 4L1KA 4YWHA 4AJPA 5KVAA 3C41J 1LB1B 2P69A 4Q47A 3WSVA 4PEVA 2YC4C 4YVFA 3PEFA 4LHWA 5GVRA 2JAWA 3LBNA 2BTQA 2VLIA 3GJ5A 4WERA 3N0VA 3D1VA 4LMPA 4Q1DA 4MUHA 4BMVA 2XPCA 1QFSA 1ORTA 1U2DA 1H3NA 3ZWMA 2AVDA 1Z62A 1YZFA 3G2HA 3AH8A 3FKQA 4OBWA 4DNFA 2M9MA 4F97A 1LCIA 2O59A 1GV0A 4BNNA 1L5HA 1XQ1A 5HBRA 4I99A 5ILOA 5CX1B 4L73A 4BVHA 4E1AA 3A6ZA 4QFDA 3SYRA 4ZTUB 1THMA 2EWVA 3CB4A 4TL8A 4OB6A 2V0GA 2OHOA 3E22B 3SYMA 3RYCB 2PS3A 3PHHA 5BORA 4IHQA 1CUWA 1GP2A 3ONWA 4HG2A 3GCGA 4LZJA 1B73A 1L4GA 3ZCTA 4CL8A 3OEYA 5PGMA 1DL5A 1LBIA 3LT5A 3ZYZA 4C7MA 5D5HA 1XTPA 3UGTA 4B0PA 1Z33A 2QMOA 3LBAA 4J1SA 5I9TA 3AF2A 4TTRA 3WLNA 1VMAA 1SA0A 3LPLA 5TS3A 1LF5A 3PJFA 2QLMA 3DFUA 1Q19A 4TSFD 1VG1A 2B21A 3DEKA 4MIOA 2YASA 4MV9A 4X45A 1IJBA 2AD5A 1TM2A 1QLHA 2Q6IA 3DHNA 4W1PA 5DWVA 3UMCA 4YDQA 2WV9A 3SXPA 1AKUA 3FFWA 3C39A 2DJIA 4MGHA 4B4DA 4XOUA 5A6SA 1HDXA 3RO7A 3M1IA 4XLLA 5C5IA 4Q4HB 1HE2A 1R8YA 1KIFA 2QJOA 4J0EA 2D5IA 2NP7A 2FDXA 4K28A 1TDJA 1P3Y1 3AGQA 4D3DA 4HS9A 4BVLA 4BP9A 5YASA 2G3YA 4L9SA 1U3WA 2AJBA 5KVCA 1HT0A 4BNVA 1ZMRA 5FULA 1KC3A 4AKEA 4YJDA 5EKSA 5KTOA 1DBVO 2FGKA 2J46A 2R62A 4BB0A 1MXFA 1SXJB 1IQUA 3IALA 1ABEA 1JKJA 3Q9LA 4IWYA 4OJYA 5L7YA 1FVOA 1DBSA 3IAM6 3KTOA 1XDUA 1PYDA 1N3LA 2EKLA 2AJTA 4BKQA 3QVJA 1T9CA 3QI2A 1EINA 4RD3A 1S6YA 4LI0A 4P0QB 4Z3KA 4MQ5A 1N5OX 2ATIA 1DAKA 1P7PA 1SN7A 3ZR4B 1DHTA 3LE8A 3T41A 4LGYA 1R64A 2WWVD 3PFFA 3K9WA 2HPVA 3BQNB 1JP7A 3ML1A 5AHOA 1EFRD 3PC8C 3VYUB 4TLMB 2PWYA 1RIFA 3WDLA 4RMNA 2V7EA 1RBMA 1E5XA 2PKQO 1XL0A 4MQMA 3QVGB 3RIHA 1DKUA 3LQ2A 3MWGA 1DTSA 3BB1A 1GR1A 1J2YA 1H6AA 4KUEA 4TT3D 3VOAA 5K6RA 3QVXA 4KQXA 4ZO8A 3FCOA 1XNHA 2PZMA 1T2NA 1CDOA 2Q3CA 1DUVG 1U5CA 3AG6A 3K9NA 4F6CA 1KJZA 3H5OA 1SHTX 1WM1A 1EBBA 3GLRA 4W1QA 4EB6A 3IIMA 1OB2A 3ZK7A 3T4EA 3AEUA 2D2IA 3H18A 3V4FA 1M0TA 4I81A 4IJKA 4N40A 4Y98A 3FY4A 5IT0A 2D62A 2PHZA 5IAGA 4O63O 4ZCRA 4HT3B 5K8IA 4JBYA 4I6GA 3AR3A 2ZSFA 5I9MA 2QXTA 2QN8A 2RAFA 2OQRA 2F6RA 4JR1A 3DOCA 1N0VC 4QTZA 3MRXA 4LXGA 2GFHA 5ALEA 4MGYR 3TPCA 1E3DA 1K3UB 3GFOA 2YN2A 4OSPA 1IBSA 4D9EA 3OWHA 3OY2A 2BP7B 1G6Q1 4N5MA 3RRZA 1JEOA 4IG9A 4CIYA 4B3CA 4NDNE 4NBNA 2ZU6A 1D2CA 1Y3CE 4NNPA 1QKIA 3C3YA 1NDUA 1B2RA 1ZC3A 4J7CA 4JI2B 5TEVA 3BJRA 2P7IA 1GL6A 3LUDA 3TNYA 5CLHA 4ZODA 1KSGA 4IF4A 2GZ2A 2GF0A 1RZVA 4DDHA 1RZ3A 3ADPA 3IVRA 4MR9B 5KNBA 4NKRA 3QVKA 1NQTA 1DXOA 1QGZA 5EINA 1OB5A 4ID9A 5DRYA 2XE7A 3B53X 3E9ZA 2ZDHA 1A9QA 4J3NA 2GYWA 4KX3A 4Y67A 1ZL0A 2AG1A 2RGEA 2CXOA 1GWNA 3A9WA 2HMWA 2QTAA 3P2YA 3P20A 3QOFA 4K9QA 4RSHA 3R7LA 2OSBA 3UG7A 4DBLE 1WR8A 3KKNA 3BWVA 4DV2B 1L7RA 4LDJA 4FBMA 3VO1A 4GM0A 2O06A 5E3HA 1C4WA 1L9XA 1L1QA 3AP3A 5FEUA 3R5FA 2MSCB 1DLJA 4E1BA 3MMPA 4EHLA 4ZOQI 2GX6A 2E0IA 2XWSA 1E3MA 5EZQA 1KFCB 5BNIA 4H15A 1S1CA 1PE0A 4PX9A 3JD4A 1OGJA 4PE5B 2NUPA 1NOKA 2G0AA 4EY5A 4A2PA 3T5AA 4LECA 2J0VA 2AQKA 1S1MA 1RQNA 2Y2UA 4LOIA 2GMWA 1X7YB 4FOTA 4OXNA 2FG7C 3NR2A 5DYYA 1GAEO 4I4TB 2JFNA 5FJIA 1DC5A 3RR2A 1HE3A 4R2IA 4D7AA 4WRRA 1KVRA 1ZH8A 1MHPA 2HZ7A 5A9RA 2K7ZA 2XB2A 3F47A 4ZVQA 2YV3A 3I9V1 4G1FA 4RDHA 3KKOA 5T3UA 3F71A 2IV3A 4AI6A 1DAPA 2Y1XA 3CKMA 5B12A 3RSCA 1ML3A 4C21A 1RMTA 1S7GA 3NFYA 1GGFA 3D8UA 4MRNA 1BO6A 2HCFA 2J9FB 2X0RA 4UAVA 1QH8B 3WAKA 1BQ3A 1R9JA 2ZJZA 2W6NA 5KJ1A 3EWSA 2DF8A 2BFPA 4JLBA 1AN9A 3G6KA 2RGYA 4OHYA 2HY7A 3L4BC 4W5NA 1E66A 1U4NA 2I1VB 1NQVA 1N2OA 4L5BA 2QYTA 1BKDR 2YRWA 1G2QA 4RVHA 3HXMA 4FM9A 5H82A 2HNKA 1PTJA 3SJBA 2FSHA 2QT1A 4PO9A 1JZTA 2A67A 2FPLA 2NQTA 3QVUA 2JDID 2QTCA 3C87A 4JB3A 4QXOA 2A9QA 2CXRA 4YMHA 1KRXA 4GM4A 3UPTA 2CHVA 2I9PA 1J0CA 1SB8A 4JBWA 4KLCA 1KP3A 6ABPA 3FOCA 5TMEA 1GZUA 3NIGB 1ZH0A 1EP3B 3WOHA 2XUIA 3JS5A 2EFJA 1MIOB 4FGWA 3E9DA 3UJ3X 3ABIA 3IBFA 1QQTA 2IPXA 4LNUA 4WDQA 5HE9A 4CV3A 1G60A 3BGOS 3N0WA 4XPIB 5DYGA 3WSWA 4KQ6A 1IVYA 1U0JA 3E4CA 1BEZA 3O8CA 4HB0A 4QJ3A 5L3QB 3CQ9A 5CT5A 1V35A 4EB8A 1NL3A 3W7BA 4ESHA 4F7DA 1RYDA 3THWA 3DEJA 3NAQA 2ZS8A 1G9SA 2UDPA 4X94A 5HOQA 2IYPA 1CRPA 1F2TB 1WUTA 2WIDA 1DIGA 3VNQA 2V6JA 3E5RA 3IP6A 2ZBFA 3WKCA 5EIHA 5JS7A 4RVFA 4ND2A 4EYEA 2B5OA 3LUKA 1FYWA 1KY4A 4Y2YA 1YJAA 2VTKA 1ECLA 3OEED 3NEPX 1H2RS 2GZAA 2A9PA 4G0NA 2GK7A 1SXHA 3QG1A 1I4EB 1ST2A 2W2KB 1H8HA 1KNQA 2WF8A 3CX8A 3I73A 2Y68A 2VP9A 3AEYA 4YT4A 1FRQA 3B6IA 3CXUA 1IHDA 2IZOA 2Q2VA 3U6KA 3K7EA 2YFQA 4MRPA 3OLVA 3C6KA 2H1SA 1EVYA 2BCJQ 4KSYA 4PTLA 3ZXSA 3TNFA 1REQA 2BZ0A 3LYAA 1G8GA 3F2VA 3GLTA 2M6SA 1H0KA 3LDFA 4HDMA 4FCTA 4V24A 4PANA 1B8PA 3OPYA 1RFLA 4DG9A 1OYVA 3BZWA 3BBPA 2JARA 2YVAA 5CUQA 2BD0A 5FEMA 1TVEA 2G4LA 3DEAA 4EB0A 1ZISA 4YDRA 3GLHA 2ADMA 3RREA 3K1AA 4JJEA 4AP9A 1K1EA 1PEYA 3EXG1 1Z26A 3O0DA 5AI4A 3LCRA 3P1JA 4TKVB 1IZ8A 3EQ6A 2OZEA 4RNDB 2KM1A 3A6FA 3KLNA 3KJGA 3MAGA 2XDQB 5AOAA 2KB0A 2H06A 4B45A 3NDIA 3W5VA 1LWOA 1PQ4A 4DIEA 2NUAA 2A1TS 1HQCA 4MYTA 1WU7A 2G77B 4JOBA 3GLGE 3ZS9A 3EG9A 3PRJA 2UZ1B 2QLLA 1W4RA 5CA1A 3DLTA 4AJLA 4ZP1A 3LXUX 3IPXA 5D1NA 3GNTA 3BE6A 1B00A 3RYHA 3OLZA 1M76A 1YD7A 2WYWA 3ESAA 3IURA 4UKDA 4BN5A 3UB2A 1Z4PX 1M72A 2QRMA 4QIHA 3P9IA 2FN8A 5A1TA 1MCZA 3GVHA 4MA5A 1X1AA 3T9FA 3GJ7A 4OYRA 4XWOA 1PG2A 1WP4A 5BSTA 2FETA 1BCSA 3TFOA 1TECE 1LU9A 4PPGA 1UT5A 1KH2A 1RJDA 4RIGA 4J7AA 3U0VA 2C7RA 3BMNB 3ME5A 4D3SA 1NNUA 5I5EA 2CL7X 2YZ2A 1LH0A 3AOGA 4QFBA 4Y6LA 2PT6A 4BU1A 4GX1A 3M83A 2RD2A 4IDQA 3IX7A 3EHEA 4FXOA 3A6GA 3BBLA 3HKDA 1HO3A 1QOPB 1Z15A 3BIWA 4ZKDA 3H9BA 1RAIA 3I3OA 4W82A 4WZAE 3EDMA 1A77A 2A9KA 5IWCA 5FOXA 3KTAB 3RHTA 3SJAA 2OK7A 2FUCA 4EHDA 1Z2OX 3HCPA 4GP6A 5HIAA 1JDZA 3GLSA 2ORIA 3KUKA 4RK0A 5FPQA 4N47A 4TV9B 3D0QA 2ERCA 2FW8A 4JDPA 2JIZA 4UCFA 4RA6A 4OY3A 2VYVD 1FTNA 2REOA 3T9CA 5EHGA 1QQ6A 3GVXA 2PANA 4F9TA 1Q3HA 3JVIA 3KPVA 4WASA 2PGJA 1A7KA 1R0ZA 1AKWA 5EE1A 3RSOA 2FSPA 4ZREA 2XCTB 1WXIA 1E3LA 2EG9A 4YAFA 4YRFA 1JSLA 5FBHA 1L1FA 2BFFB 1NJ2A 3AHFA 3LA6A 4L4ZA 4TWBA 4UDOA 4J2OA 3H16A 3ZZ1A 4CMAA 2JLXA 1THZA 2OZLB 5CT6A 4R8MA 3FKJA 4BQPA 2UV8A 2BFBB 4RKYA 5CA1F 2L69A 4WVFA 4ZTZB 3HCBA 2QN9A 2NU9B 2LCFA 3WLEA 3E3LA 3CRQA 3K15A 4MTCA 1UKCA 1Y89A 4NPCA 3TZBA 2CLMB 1GPH1 2OCYC 4UBKA 4ZJUA 1DOZA 1I8TA 3NHFA 4P35A 1CJTC 3QIAA 4FZVA 4KE7A 4KN9S 5B64A 1QAMA 3G0IA 5CK4A 1ZVVA 2UU9B 3C7AA 1RC0A 4C3UA 2B4YA 4KR7A 1Z4QA 3K9HA 1CUGA 5GJCA 3T6KA 3L4JA 3LRXA 4D43A 3PEUA 2H0QA 3RVDA 3S2ZA 5J3JA 1CQJB 2FTKE 2C31A 3LTEA 4B8WA 3K0HA 4ZYTA 4PC1A 2HBRA 2O5RA 4L5IA 3F6BX 1P0CA 3NM4A 1B4DA 3HCCA 2ET6A 5ALWA 2EQAA 4A16A 1GT91 1HV8A 1MEEA 1YL5A 4WCFB 4BASA 4ZDIA 1NVEA 3GA5A 5GIPE 2ZZNA 4FQ7A 3WLMA 1GQSA 3HJBA 4NPHA 5KSOA 1KYIA 1G66A 1VCMA 3GDFA 2EBUA 1PT5A 3OZCA 4IZOA 4NONA 1P61B 2PA3A 4CUJA 4I3HA 3U7EB 3UXHA 1EX9A 2GM9A 1GPDG 5F77A 3RVKA 3T7EA 3WTCA 3ZYCA 4GOND 1QAQA 3ANSA 4FOSA 1DBRA 5KDOA 1GRNA 3MTAA 3ILHA 1LD3A 4R0NA 1OFTA 4LVOA 4QGBA 3C8HA 4Z0HO 3VBEA 4AZ3A 1K63A 3MA0A 1FQOA 1OH5A 2OBLA 3AR5A 3LOPA 4QARA 1BZYA 3MHTA 1E5TA 1U1FA 3PIIA 2DULA 5ALDA 4IMPA 4YO7A 1N2ZA 4L08A 3NHKA 2OEPA 1KOJA 3D5TA 4TZ6A 2VPWA 1FUYB 1CZKA 4HEQA 4PZ0A 3ZWAA 2FEWB 1LDYA 1PS8A 3T4PA 3UVEA 5HF6A 1GOTA 4COOA 2E5WA 3MXTA 4RLSA 2VJNA 4MKHA 5A4AA 1C1XA 4PLCA 1Y81A 2BHTA 3M6WA 4UE3S 3HV0A 3GRRA 3I9OA 4IW3B 2OCGA 5EY5B 4BJHB 1PG5A 3CR8A 1E6KA 2D54A 4OBXA 1ZR2A 1UANA 1WMBA 1ZGAA 3G0HA 1UKBA 1MV5A 4DUYB 2CHUA 2RKBA 5FTNA 1CEQA 3UMGA 4X5OA 2QW8A 2J9ZB 2ZOSA 1DRKA 1ZEJA 3RV4A 5FUQA 4LWOA 1CYDA 4BMNA 5FWXA 4EY8A 2P9HA 1KVQA 2YY5A 3IQFA 3H9GA 2HA4A 4OHOA 5KYWB 2H0RA 2ZB7A 1X74A 3EVBA 3W5CA 1JHDA 3LCJA 4G0ZA 3ONDA 3WISA 3RFTA 1DC4A 3MTDA 2VNKA 5FWAA 1K7EB 4QBIA 1D2AA 4JCOA 5DDIP 2PZEA 5DM70 3VH3A 4QJIA 1NYLA 1B8UA 2BGLA 2G5GX 3I04A 4KC0A 4TTPA 4GKKB 1Z8NA 3BS4A 3VNBA 4LNHA 2QTFA 3C5CA 1GJRA 4DYVA 5F3WB 3G7NA 3I39X 4CF4A 3IHLA 1ZM4A 1H4SA 1TJ5A 3IQDB 3LF2A 1XPRA 3H84A 3NNSA 1QHYA 2VUIB 4OGKA 3EISA 4AS2A 4OMCA 2NZ2A 3MGKA 1TM1E 3B3AA 3NDPA 3N5KA 1U98A 4MO9A 1WOMA 2ZTMA 2LKDA 4NV3A 5KJFA 2NMVA 3KVYA 3M6VA 2H59A 3DL2A 1U0GA 2PCJA 4IS2A 1G21E 4CBVA 2AFHE 4H1VA 4HEA1 4XCQA 2WIKA 4FZJA 3GK3A 4E2FA 2NQ2C 1S89A 3EXFA 3AY0A 4ZAVA 2H7VA 3C74A 3CY6A 5IHPA 2UYCA 4CR7A 3HZHA 3Q7TA 1WUIS 2OV4A 2VDNB 3L7LA 4RK6A 3WLAA 4AXXA 1JA9A 2XD4A 3EGWA 3GOHA 5K3AA 1BW9A 2AYXA 2HBYA 3GPBA 5KVQA 5HZHA 4YJHA 1V7QA 3ISJA 3S28A 3AEQA 4P3PA 3E3MA 5AM3A 1DKPA 3HB4X 4QPCA 5CHEA 4B85A 4BGUA 4D9CA 4ZI2A 3BTSA 3CPHA 4US1R 4IIDA 1Y5LA 4AMBA 1GCAA 3WKEA 2O0JA 1V47A 4ZV4A 3W5JA 4CIBA 1CLUA 4IH4A 5BNTA 4G3XA 5AQEA 4B7ZA 1HLPA 2IP4A 1IXSB 1XWWA 3JYLA 1JPUA 3P0IA 1H9AA 3PQCA 1U8UA 1WQ4A 4YAJA 5JS1A 2WF6A 5JQGB 1U1CA 2BE9A 5I7WA 2DBRA 1Z6GA 3WLOA 3WDMA 4KQIA 5FXMA 1GDDA 2DBZA 1KP9A 3HB5X 3QKIA 4ZHSA 2EARA 4X24A 5TQJA 3VR6H 3QOWA 4ER3A 4MDEA 2WZDA 2J32A 4FT4A 4AULA 3HFGA 4D3ZA 2D0PB 3HO8A 4NWIA 1DJOA 5TY0A 2XWPA 3UMJA 4F56A 4ENUA 3CKKA 2ZIUB 5ITSA 2O07A 3NETA 3QK7A 3QKRA 4QYTA 1OYYA 5HG0A 3TAUA 2O7VA 3TB4A 3ZHBA 5JZ9A 4J6FA 4CLHA 1IQ0A 1NF2A 1BWSA 2G9QA 2OILA 4NFSA 3CLSC 5J2UB 3K1JA 4GR4A 5CYOA 4CG0A 2V6MA 1XVLA 2YBEA 4MQ6A 4ZU3A 2AOTA 2QYHA 2C9ZA 2GN4A 3H8WA 1UF9A 2EGHA 1XYYA 5AUQA 2NYRA 1U7XA 2YXNA 5CLFA 5KB3A 2JGRA 3T3PB 4DC1A 3KKZA 2WWFA 1U2SA 4YECA 5TGDA 3VR5H 1HDRA 3C5WP 5CNMA 2E7ZA 4XH9B 1R0YA 2QX4A 3HACA 2KI5A 4BLTA 1JEEA 2DH5A 4OGWA 3QITA 2GM4A 2JFHA 5IBQA 2JCGA 2C20A 1HDYA 4YRBA 5JMWA 1EXMA 1Z4OA 3U3XA 3AZOA 1PR1A 2IIBA 1B3BA 2RHJA 3DPUA 4B3FX 3I0ZA 3EIEA 4CTNA 5LKRA 2NU7A 1A8PA 1PT8A 3L2OB 3N8DA 2HV8A 3WNZA 2A0KA 3WGUA 1X0XA 4M6WA 3NIBA 4FGUA 2BY4A 3SKVA 2CLIB 4DPLA 3HI6A 3P5BA 2B8TA 1THTA 4DMFA 5ALXA 2YDYA 1BXGB 1AV7A 2GTHA 2BHSA 2VQDA 1N7GA 5CJJA 5FQNA 2CJPA 1GN8A 2B36A 2PBZA 3OVMA 3R5XA 2J33A 3GJ3A 2ZYRA 3M34A 4QXPA 3R3XA 2WWWA 8GPBA 4Z53A 4PBRA 4A8PA 4RK5A 1CDZA 2WM8A 5HCNA 4Q3EA 3MILA 1YL6A 2A9FA 3FPAA 1L4KA 3KJZA 1N8NA 5IHXA 1OT3A 3L7OA 1T1JA 2R8PA 3MCAA 1TPZA 3GHYA 3CLKA 5AVVA 1PJCA 3L1KA 4KXVA 4MULA 2RGDA 4DQDA 2FUG6 2V55B 5BSKA 3DZDA 1KZ1A 1X7WB 3M8KA 1II8A 4ZYXA 3VSEA 3FUVA 2E82A 4DLPA 1CIVA 4C0AC 2O0MA 3GDWA 4MS4B 2HQRA 2O2JA 4BBZA 1F0YA 1K89A 2O2GA 1C41A 4UZSA 1Z2NX 2JRCA 3FZYA 3I1IA 2VJMA 5EHQA