2SGDE

Asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 45
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgdE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgdE01
5A8YA 3Q3YA 4BTUB 3EGKH 1A1RA 1XXDA 1C1SA 2ZP0H 4PROA 1DWBH 4K5ZA 4MPXA 1V2ST 1K1IA 1LQDB 2ESTE 1JMOH 1KLJH 4AN7A 4Y8ZA 4DOQA 1V2JT 2TRMA 5DP6A 3QO6A 3MU1A 1S83A 1FUJA 2QXGA 2H2ZA 3E8LA 1ZGIA 2BD2A 1AKSB 1CGHA 2GP9B 3RXQA 2VWOA 4IMZA 1L2EA 4YT6H 5C1XA 4A5TS 1KXEA 1ID5H 4F49A 1GBIA 1O33A 1RIWC 3HKJB 2ZO3H 2R3YA 4ABIA 4B1TA 5LPRA 1GBAA 2BM2A 1NS3A 1DUEA 5EXLA 4XFQA 1MQ6A 4AG1A 4FUGA 1P2JA 2ZU1A 2GT8A 1J17T 1DE7H 2HOBA 5EPYA 3S69A 1Y3WA 4X8UH 3RMMH 5TJXA 2A45B 1YF4A 1SSXA 1XVMA 3GY7A 1SGPE 2F9BH 1ETTH 1SPJA 2D1JA 3LGYA 3A84A 4KTSA 1QB1A 1KDQA 1TOCB 1F0UA 3D65E 3NZIA 1VR1H 2RCEA 3IITA 3PROA 2BQ7B 4R0IA 1C2LA 1HJ8A 4Q80A 1SLUB 2QV1A 3SV8A 1PPZA 2Z9KA 4GHQA 1SLXB 2EI6A 4WVPE 5ESBA 3RM2H 3MFJA 2OC7A 3SU3A 2ZWLH 2BMGB 3A7TA 3VB6A 1WQVH 5E0JA 4ISHH 3KN2A 4TWWA 1ZHPA 4Z6AH 5LPFA 2FOEA 4NIWA 3ITIA 2YNBA 1FONA 2B5TB 4DURA 3ZZ5A 4J2YB 2PLXA 2Z9GA 1IQMA 1HJ9A 5DG6A 1JIMA 1NO9H 1O3JA 1NFYA 1MZAA 1GBMA 2W5EA 5E0GA 1O3HA 1TPOA 2O9QA 4XDEA 1WYKA 2ALVA 2OP9A 2VGCB 1ANDA 1QQUA 2OBQA 3GCTF 2ZGCA 3M35A 3D49H 1NPMA 1U6QA 3TNSA 3BV9B 1LKBA 5JBTA 1Y3UA 4AYVB 4AG2A 5AHGH 2O8WA 2GCHG 3URDA 2A7JA 1VGCC 3TVJB 1OPHB 1OXGA 3SU2A 2BLQA 3SQHE 1QHRB 4KELA 3A7ZA 3S7KB 4KGAA 3KEEA 2ZU5A 1ZSLA 4BTIB 2A4QA 1O3MA 1BDAA 3I78A 4O3TA 5DK1A 2BVXH 1G3BA 3F6UH 2ZF0H 4ABGA 1EPTB 1PQ7A 1V2VT 1C5RA 4ISIH 3V12A 5JBBS 3SU4A 1O34A 1ZPCA 4Y6DA 2OC0A 1MUEB 5FBEA 2XXLA 1ZJKA 2FYQA 4IC6A 4YLQH 3M5LA 2ZDVH 2WPJS 3PWBA 1V2WT 5EGMA 3LDXH 3K65B 2Y82A 1AMHA 1QB6A 1TGBA 1GDNA 3A7VA 4Y71A 3KF2A 3NKKA 3RXHA 1HBTH 1SFQB 3BIUH 2FOFA 3O8BA 1C5VA 1EB1H 1O3PB 1B0EA 1FY5A 3ZZ8A 4X1NU 3GCTG 1T4UH 1LPGB 3MYWA 1FIZA 1OS8A 2A31A 3GY6A 3H7OA 1F0TA 1MTUA 3FVFB 3EYDA 1WTGH 1TX7A 1JOUB 1QA7A 3P70B 3V3MA 1O2YA 1EOLA 1Q3XA 3SORA 5HXFA 3F1SB 3R0FA 4MLFB 2Y7XA 1MTVA 3M61U 1UTMA 1K22H 1C5UA 2FOMB 3JZ1B 4WXVA 5F6MA 2WPHS 1UHBB 1P03A 5FCKA 3M3VA 4LOYH 1XVOA 2WPMS 4BAQB 1HJAC 1SR5C 4D9QA 1EAIA 2BVSH 2ZNKH 2HPPH 1T7CA 1DLKB 3QGNB 1LVYA 3PLKA 1ESAA 2PTCE 1QQ4A 1JXPA 2GDEH 2KAIA 1MH0A 4K3JA 1HGTH 2H5DA 4X1SU 3SJKA 3M5NA 3LJJA 1O2KA 5EXMA 2C8XB 2QXJA 1C5PA 4Y76A 2ZC9H 2BDGA 2M5TA 1MAXA 1UTLM 4I7YH 1NROH 1BBRE 2UUJB 1UCYK 3CS0A 2TGTA 1DUAA 4FUHA 1TA2A 4QT8C 4NSYA 3URCA 4E7NA 1C5TA 1YPKH 3NXPA 4IMQA 4YESB 1O2NA 1P57B 2RA0A 4FVBA 3V13A 2ZGJA 3M5OA 4I33A 1CA0C 2ZDNA 3EE0B 3QZRA 4Q7ZA 1KY9A 4ZUHA 1GI3A 2XCNA 1H9LB 3SU6A 2RDLA 4INHA 4YOJA 2GKVE 2OLGA 4X1QU 2XBWA 2FS8A 5EODA 4JMYA 1H8IH 1YGCH 3L33A 2C90B 1SFIA 4ABDA 1S81A 3RXPA 1W0ZU 5FXLA 1L1GA 3A83A 2CF9H 2A2QH 3HK6B 4I8HA 1IQLA 1T8LA 2P93A 2BTCE 1TBZH 1ZTLA 2XNIA 1IHSH 1UJ1A 4TY7A 1ARCA 3UY9A 1TOMH 1IQKA 3LGVA 1E34B 2BX3A 2P95A 1HFDA 3QN7A 1QCPA 3A87A 1O2VA 2AFQB 4HGCA 1G2LA 1ELAA 1HRTH 1EAXA 3SJ9A 2ODYB 1X7AC 1AU8A 6GCHF 2XWAA 1D3PB 4I8KA 1P2QA 4UFDH 1QBNA 1LHEH 2P94A 5GXPA 1DANH 1TMUH 1D3DB 5F8TA 3UOPA 2GGVB 3I29A 1H9HE 2AS9A 4XE4A 5B6OA 3T62A 1PPFE 2VIQA 3A8AA 1K2I1 1A0JA 1W8BH 2QGRA 3RU4E 5FPTA 2A4RA 2A0QB 3S9AA 2A5KA 1YBWA 1V3XA 2ZKSA 1O30A 4ZXYH 1C1WH 4A92A 1C2EA 1HAGE 1EXFA 4Q7XA 3A8BA 2R9PA 2PFEA 1ELVA 2FPZA 1MKWK 1LVOA 1BHXF 2VIOA 2BD8A 1ZHRA 1C1UH 1SC8U 1GBJA 1HIAA 1BB0B 4AYYB 1GI2A 2CV3A 1EX3A 1FI8A 2V6NA 3A7WA 3L6PA 1GG6C 2H5CA 1SLVB 4WH8A 1LPZB 1S84A 1BBRK 3E0PB 2GVFA 2FO9A 2QIQA 4JYUH 2GTBA 1HAIH 1FJSA 1QFKH 4BXSA 3ESTA 4KTUA 2ZPQA 2Y6TA 3QWCH 1VCWA 4IC5A 1BTUA 2J9NA 1CT0E 1MTNC 3LOXA 4ZXXH 1W10U 4MDSA 3LGTA 2OC1A 5T6GA 3OX7U 2YNAA 1TNKA 3S9BA 1AUTC 4Q7YA 5LH8A 1K1JA 2ZHWH 1EZUC 2CF8H 5DP9A 3LGUA 1V2OT 1EASA 3R3GB 5ESTE 1AIXH 1A61H 4SGAE 1AFQB 2J95A 1XKAC 1TONA 4DIHH 3LC3A 5EQSA 2ZZUH 1B7XB 4FUEA 1EZQA 2FS9A 4SGBE 4U01A 3RMOH 4FUDA 1LHCH 3A8DA 2ZEBA 4ZMAH 1C5OH 1V2QT 3RXGA 2AIPA 3O8DA 4FUCA 3E0NB 5GCHF 1EB2A 1AQ7A 2FESH 5DP5A 1DVAH 5K7RA 3MNBA 4BXWA 2FOAA 2ZDLA 4AB8A 3GCOA 4CRFA 1TB6H 3LJOA 2WV5A 2PUXB 1SQAA 2EI8A 6ESTA 2G52A 1GJ6A 1Z71A 1C5ZB 3OTJE 5A0CA 1UTPA 3BF6H 1SHHB 2ZIQH 1GBTA 1GJCB 1EKBB 4O9VA 5C1YA 3BIVH 2Z9LA 1F5KU 4GSOA 5FBIA 4ZAEA 2TGAA 1G30B 3MMGA 2GZ7A 6LPRA 1O3FA 2VWNA 2ZDAH 4M7GA 2FX4A 1SGEE 1O2PA 2WPIS 2GV6A 3Q3KA 1O2GH 4F4OC 1TBQH 2VVUA 3MH4A 1LMWB 2VJ1A 3TITA 3LU9B 3RXUA 2BD5A 4DT7B 1EAUA 1H4WA 1OOKB 4I32A 1PQ8A 1O3CA 1GVZA 1C2GA 1KXBA 1O39A 4VGCC 3SNCA 1O2OA 2Q6FA 4AGJA 1GMCF 5C20A 3BTQE 4INKA 1DY9A 2FYRA 2H9EH 3NPSA 1HXFH 5A0AE 3TIUA 1BRCE 1C5QA 2VH0A 2PKAA 1HAVB 1W7XH 1MKXH 2BLVA 4HFPB 3A8CA 2SGAA 2FI5E 3AVZA 1ELBA 1G3EA 3W95A 1GI0A 2A5IA 2ZTXA 3PMAB 4DW2U 3OU0A 4CHAC 1TMTH 3RXDA 3P8GA 2ULLA 3BTTE 4Z0KA 3QGJA 1G3CA 1FY4A 1KXDA 2ZU2A 1C2DA 3PLPA 1UO6A 2F9PA 1C1NA 3MOCA 3FZZA 1DWEH 2BLOA 1FPHH 5HM2A 2TPIZ 1H8DH 4X6PA 1KXAA 2F83A 2D26C 2NU1E 4BAKB 1DOJA 3P8FA 1TALA 1ESBA 5F8XA 2UUKB 1XXFA 1VGCB 3OY6U 1K1OA 1SQOA 1THRH 3LPRA 2ANMH 1O3IA 1YP9A 3MO9A 7GCHF 3RXLA 4BANB 1GMCG 5DP8A 1GBEA 2Z6BD 3HATH 4CH8B 1GDUA 1YKTA 1CT2E 1XM1A 1KIGH 1SHYA 3MWIU 4LK4A 4X6NA 5I25A 1UTNA 2ZTZA 4X1PU 1W14U 2PSXA 4XSKU 2J34A 1SGIB 1FQ3A 2OUAA 2XYAA 2VB0A 2AGGX 1LHGH 3QDZB 1ARBA 1SI5H 2GCTC 5AFZH 1MTWA 1TFXA 1XUIA 1C5WB 3PO1C 2ZGBH 3AAVA 2ILNA 3BTKE 3HKIB 1DT2A 2JH5D 1DLEA 2BB4A 4CRAA 1SGCA 3KQCA 3ZZAA 3A88A 1QRZA 3RXMA 1JRSA 3TPIZ 1QA0A 1LVBA 4I8GA 1MD8A 1D3TB 2UWLA 2XC0A 1T8NA 3MO6A 1FAKH 4ABBA 1AE8H 1NM6A 1Y3YA 4BAMB 3TLOA 3NK8A 5JBAS 1VJAU 1AO5A 1ELGA 1SGTA 3BEUA 3TJVA 2BD4A 4R8TB 1AWHB 4YM9A 4AX9H 2FP7B 3A89A 1SOTA 1J15A 2BD9A 1EATA 2EEKA 3TK9A 4YZUA 2Y80A 4K2YA 4JZDH 7GCHG 2F91A 3UNRA 4J1YA 1A7SA 1QR3E 2PUQH 4FVDA 1D6WA 3SUDA 1TPAE 3ENSB 1K21H 3SJOA 4Q2KA 1H9IE 2CHAC 1HJAB 3M5MA 1SQTA 5LPEA 7LPRA 1MBQA 2ZPSA 4I8JA 3RXBA 2W3KA 1MTSA 1WU1A 2XWBI 3NCLA 3VFEA 1O2RA 4JYVH 4O03A 1GHWH 3K2UA 1GHZA 1NRSH 5L2YH 2BY6X 1KTSB 2SGQE 4D7GA 2SGDE 1C9PA 2GCHF 2VWLA 1HAOH 2O8TA 3GY3A 1TNGA 1K1PA 4GLYA 3SJ8A 1ZPZA 4X2XA 1CHGA 2B8OH 2WYJA 2FTLE 2SGPE 5C5OA 2K1QA 1KYNA 2P3UB 1ELTA 1QJ1B 3RXAA 2Z3DA 1FN8A 2ZI2H 1CSOE 1HAHH 4B74A 3ZVCA 1SGYE 1CA0B 1B0FA 4IGDA 1VCPA 3DHKH 1IQNA 4YTAA 1DSUA 1GHBF 2AH4X 2O8MA 2G4TA 1AE5A 3BTFE 4TPYA 3KL6A 1B5GH 2H6MA 2B7DH 1HAPH 2G8TA 2GMTC 4AFQA 3AAUA 3MH7A 1TYNA 1NRQH 1GHYH 3TGJE 1C2FA 1GJ5H 1TQ0B 1N1LA 1TGNA 3RXIA 1MQ5A 1XUKA 5A2MH 1XUHA 1A46H 2FLBH 2UWPA 2QAAA 2AMQA 2BD7A 2ZFRH 1CBWC 4X2WA 4E7RG 5H4IB 4MTBA 4MNWA 3AW0A 1BIOA 1V2MT 4JZFH 5JYIA 3SW2B 1A0HB 2C4FH 1UK3A 2J94A 3VEQB 2GX4A 1NFUA 1S0QA 2SNWA 4AGKA 1O2IA 1LHFH 1O5BB 2XTTB 1KLTA 3LH1A 1P2KA 1ELEE 4FUFA 1RJXB 4LZ4B 2NU0E 3BN9A 1AUJA 1MBMA 1GHBG 3WY8A 1C1TA 3ZVAA 1PJPA 1D9IA 3S0NA 2ZGHA 1GBFA 3GY5A 4ISNA 4A7IB 1RRKA 1FY8E 1GJAB 5EOKA 3K6YA 2JETC 5JPMH 3W94A 2W3IA 1DS2E 2F9UA 2OQUA 3V7TA 2ANKH 1PQ5A 3L3TA 1BMMH 1WQSA 2AGIX 4B73A 4MG3A 1FPCH 1WTHD 4ZH8A 3RLWH 1IOEA 3S7HB 4X1RU 1DSTA 1UTKA 3TK5A 1O2JA 1DX5M 2ZCHP 3F9HA 1RD3B 2Y5FA 4LXBH 1RS0A 2Q6DA 1PYTC 2FLRH 4HI3A 3ZZ3A 2V3HH 3MU8A 3SNBA 1BOQA 1GG6B 1O2SA 4YOIA 1MCVA 3UQOA 3BG8A 5EW2H 3KGPA 1L1JA 2ZG0H 5BRRE 1PPBH 3MNSA 3ZVFA 2BXTH 5IYTA 3ZYEA 1GI1A 1WV7H 2ZHFH 1YLDA 2RA3A 1D6RA 4A1TA 1MTNB 1SGRE 4UFGH 4A6LA 1UVUH 2TGDA 4GUXA 2ZECA 4DCDA 1KXFA 5T3HA 5L6NH 1L4ZA 1RFNA 1QBVH 1LVMA 2W7SA 3PV4A 3RXCA 1P8VC 3EDXB 1V2TT 3TGIE 4RSPA 1C4V2 3F9EA 2SGFE 2Z3EA 1L1NA 1W3CA 3O8RA 2A32A 4CBOA 5DKMA 4JYTA 3UOUA 1Z8RA 4WH6A 4DG4A 1BITA 1P9UA 1WSSH 2BY8X 3MH5A 3RUOA 3STJA 3GOVB 4D76A 1GJDB 1S6FA 3MI4A 1DICA 2BOKA 6CHAB 2G5VA 2ZHDA 2CN0H 3TH2H 2PGQB 2FM2A 2OQ5A 3LH3A 3UNSA 1FAXA 3SGQE 3DD2H 4BAOB 4ABHA 4Y7BA 1MD7A 4UONA 1NRRH 2PWXA 3MTYA 4WXIA 3QLPH 1V2RT 1JWTA 3SO3A 4K1TA 1ZHMA 3TNTA 1BZXE 1C2HA 3VPKA 1IQGA 1UCYH 1LHDH 3EA8A 2VIWA 3B8JA 4IW4E 3ELAH 3QTOH 3SZNA 2XW9A 3FP8E 1YPEH 1TNIA 3SV7A 3STIA 5EXNA 1CA8B 4FU9A 1EAWA 2OXSA 1IQEA 1QY6A 3P8OA 2CMYA 2DE9A 2R3UA 1YCPK 1N8OB 1O2LA 4VGCB 2GD4B 3M3SA 1P02A 3VGCC 2WUCA 3EAJA 3UPEA 3P95A 1AKSA 1ABJH 4MPUA 4WWYA 1P9SA 4CR5A 1T8OA 1JIRA 1Z6JH 2G5NA 1MAYA 3BG4C 4OS4A 1ZTKA 3KQBA 1AFEH 5TCCA 1HAXB 1HAZB 2A1DB 3KIDU 3SOSA 4CHAB 1VZQH 3TGKE 2XBYA 2HRVA 2FTMA 2Y81A 2RG3A 5E8EH 1JBUH 1SBWA 1AVGH 3G01A 3GCHC 2WYGA 1HB0B 1KDQB 1V2LT 2WPLS 1PQAA 1DXPA 3P8NA 1GBLA 4NZQA 1GCTC 1CVWH 1O37A 2P59A 3TH4H 2G55A 3SI4H 2ODQA 2H9TH 3TJOA 1O3NA 3QK1A 3RXVA 4MNYA 1AB9C 1INCA 1XUGA 1NRPH 1UVTH 1ZZZA 4X6OA 3U9AH 4GHTA 3PMBB 3F68H 1ZLRA 2F9VA 2QA9E 1FN6A 3O8CA 1V2PT 1QL8A 4GPGA 4AB9A 9ESTA 3RM0H 1O3BA 4K60A 3MU4A 1ETSH 1BMAA 3RLYH 4YT7H 4U32A 1EJAA 2JKHA 1DFPA 3SNDA 1GGDB 1NRNH 1MZDA 3TU7H 1QB9A 1NFWA 5GJ4B 1MU6B 1SGDE 2CXVA 2GCTB 1ANBA 1QJ6B 3PO1B 1IQIA 1IQFA 2G81E 2AGEX 1AY6H 1BJUA 2F9NA 1TPSA 1G2MA 3CP7A 1MKWH 1F5RA 1ANEA 2Z7FE 5FX5A 5CHAC 1C5NH 3QX5H 3ZV8A 4DVAU 2ODPA 2Y5GA 1BUIA 3LKWA 1GMHG 1GVKB 1T4VH 2V0BA 3GDUA 4NZLA 1GHVH 1DY8A 1A2CH 1H1BA 1TX6A 2ASUB 4MNVA 2ZQ1A 6CHAC 1S0RA 4GAWA 1Q31A 3FP6E 3GY2A 3SU5A 2ZCKP 1CHOF 1PYTD 3GISB 1OWDA 2D8WA 1SGFA 3Q76A 3KQDA 1MCTA 1YPHC 2AIQA 3F9FA 2HPQH 5J4SA 1LKAA 2FMJA 1LO6A 3U8OH 4NCYA 2I6QA 2STAE 4UDWH 1HNEE 1O2HA 3RP2A 3SGAE 1N6XA 3JZ2B 4JCNA 1EPTA 1AZZA 2ANYA 5FPYA 1XX9A 5E2OA 2A2XH 3PWCA 4JK6A 1TE0A 5HM9A 1DWDH 2CHAB 1LCYA 1GVLA 2STBE 2VWMA 2NU3E 3A86A 1Z7KA 2HWLB 2P8OC 3PYHA 2Z9JA 1TMBH 1O38A 4CR9A 3ODDA 1F0RA 2BOHB 1FV9A 3M7UA 5GIBA 1P10A 1C5SA 3DFJA 1SB1H 3M7QA 1TLDA 4IBLH 4CH2B 3MU5A 1UVPA 1C1OA 3S9CA 4H6SB 1YC0A 4YOGA 1ESTA 3PMJA 3U8RH 3F9GA 1EP5A 3GY8A 3BEIB 1N8OC 2PR3A 3DUXH 2ZU3A 3BEFB 1HCGA 2WV4A 4GVUA 2ZFPH 4NSVA 1W13U 3ATWA 1XUJA 2QCYA 2Q6GA 3ZZDA 1GJ4H 1CT4E 3HGPA 5EPNA 3RU4T 4TY6A 3EA9A 4INLA 3LIWA 1WAYB 2HGTH 1CHOG 2QXIA 3SUFA 1N6YA 2D2DA 5EG4A 1IAUA 1UHBA 4Y10E 5ABWA 3RDZA 2PSYA 1TRNA 3SBKA 2EI7A 1HLTH 1O5DH 1K1MA 4ISLA 3MU0A 3P92A 2KAIB 3QUMP 2UUFB 3ZVDA 3SHCH 1P05A 3GYLB 2AERH 3T5FH 1BQYA 2GMTB 1GCDA 1RTLA 4AFZA 1Y3VA 2P3FH 1PPHE 1V2UT 4TPIZ 1J14A 1WUNH 3M3TA 1ELFA 1ZTJA 1YPHE 1HAYB 1BHXB 1DDJA 1YM0A 1DITH 4UFFH 1YPJH 1HXEH 1CBWB 3T29A 3T27A 2QXHA 3T26A 3SV6A 1O32A 4D8NA 1Z8JB 4ESTE 3UR6A 1G32B 1O3GA 4TYDA 4K8YA 1P2OA 4Y8XA 1BTPA 3OSYA 2W26A 2ZTYA 3DA9B 2IPHA 1OWKA 2R2WU 3BTHE 1G3DA 2GZ9A 2GZ8A 1GGDC 4ABFA 3PMHB 1BTWA 3ODFA 1KTTB 1S82A 2TBSA 1Y8TA 3ATKA 1ZSKA 4MNXA 5F8ZA 2HVXA 1GI6A 1O2UA 2B9LA 4ZHMU 1CU1A 1BTXA 1Y5BT 1A5IA 3ZZBA 1GL0E 5C67A 2BXUH 1P09A 1UK2A 2IJOB 1SL3A 1O3AA 4MVNA 4WMFA 1WOFA 2BVRH 2PHBA 4B2BA 5A8ZA 2JETB 4OS5A 3FZDA 3I77A 2BY9X 1O2ZA 4KKDA 1O5AB 3IWMA 4LZ1H 1C1VH 1VITG 1BA8B 1UTJA 1EZSC 1HV7A 2R0KA 2VINA 1QL9A 4WF8A 3ZVEA 1KXCA 1A0LA 4Y8YA 2ZFQH 2C93B 8LPRA 3SUGA 4OS1A 4AZ2B 1GJ7B 1UVSH 3U98H 1TNJA 1SGFG 3RMLH 2BDCA 1Y3XA 5AFYH 1YPMH 1O5EH 1SVPA 4CRCA 5ETXA 3GCNA 1OX1A 2A4OA 3PM3A 2ZU4A 2BX4A 2BDIA 4Y0ZE 1ZMJA 1WBGB 2ZFFH 3KNXA 4FUBA 5L30H 3HGNA 1A5HA 3TK6A 1C2MA 2FOGA 8GCHG 1O5FH 1LDTT 1VCQA 2XBXA 2FOBA 2FXRA 5JB8S 2OTVA 5GWZA 4U30A 4WMDA 3ZZ7A 1LQEA 1OYTH 3TJUA 2ZHEH 3E6PH 3SJIA 5EQQA 2QF0A 4KP0A 1ZRKA 1OWJA 4E05H 9LPRA 1BRAA 2V35A 2NU4E 3UREA 4H6TA 3U69H 3ZV9A 2HNTF 8ESTE 1O0DH 1HIAB 2DUCA 1CGJE 1O2XA 2C8ZB 1GWAA 5BPEA 3TH3H 2VVVA 1OP8A 1NN6A 1Y5UT 5CMXH 2ANWA 7ESTE 4B75A 1C5MD 2WINI 3U1JB 1D3QB 3ZZ4A 1GJBB 2BD3A 1GBHA 2FOCA 2BZAA 1C2JA 2O8LA 2FODA 2J2UA 2ZQ2A 3UIRA 1F92A 1P11E 3LGIA 1G37A 2AEIH 4X8VH 3BTME 4AFSA 2VIDA 5HGGA 2HALA 1AZ8A 1OP0A 4OGYA 1TRYA 2BHGA 1TGTA 3UWJH 4CBNA 1OSSA 3P6ZB 4AORA 2I6SA 3Q00A 1UCYE 4NA9H 1GI9B 4ZKOU 3AASA 3LT3A 4I8LA 3RC6A 3RC5A 3EA7A 1YPGH 1BTHH 3E1XB 1FMGA 1PPGE 5AVDA 2VU8E 2FX6A 4HZHA 4A1VA 2FEQH 1DPOA 2UUYA 1PPEE 3E90B 1CO7E 2CJIA 2GT7A 2ZHQH 2Y7ZA 1O35A 4FUJA 5FAHA 4RN6A 1FY3A 2EC9H 1TAWA 1PFXC 4X2YA 1E35B 1O2QA 4ASHA 1A5GH 1RTKA 1G9IE 4YLUA 4JZIA 4HTCH 2AYWA 1YLCA 3VGCB 1O3EA 1JRTA 2AMDA 3TJNA 1O3OA 1SGNE 1CGIE 1P3CA 3E3TA 1YCPM 4ZKSU 5CE1A 4FU7A 3SI3H 1P3EA 1J16A 2BYAX 4JZ1A 2BY5X 4WJG2 3BG4B 5J4QA 3ZZ6A 1SMFE 1GMDF 3QZQA 2VVCA 3PB1E 3SU0A 1QRWA 1GBBA 5DP4A 1F7ZA 1ACBE 2P16A 4MPVA 1EJMA 1FZZA 2P3TB 4NFFA 1AVXA 1DWCH 2Z9IA 2A4GA 1DM4B 5EQRA 2QN5T 3GCHB 1ZMNA 5FX6A 2PV9B 1S6HA 3ATIA 1GCTB 2ZFSA 2A7CA 1SOZA 2XCFA 1UTQA 1O3LA 1T8MA 2GV7A 1ZPBA 1HPGA 1QNJA 1AB9B 3C27B 3ZZCA 1O2TA 4TWYA 1Q2WA 3HPTB 3ZYDA 2PKAB 1NTPA 1GBKA 2QC2A 3NUMA 3A82A 8KME2 1ELDE 4XOJA 1Y5AT 5FPSA 5SGAE 1TPPA 1HUTH 1NY22 2ZA5A 2R2MB 3MO3A 1HAVA 1W12U 3H5CB 1P04A 3A81A 2BDAA 4ZKNU 2VIPA 5JBCS 4FXGH 3BTEE 1V6DA 2HLCA 2ZDMA 1GI8B 1O3DA 2IOTA 5AF9H 3SQEE 5HYOA 4H4FA 3SV9A 3B23B 1NU9A 1NU7B 1IHTH 4Y79A 1WCZA 1GMDG 5HMAA 3RXOA 4NIVA 4B2AA 2H1UA 3LGWA 1QJ7B 2J92A 1TGSZ 5CHAB 1NESE 1YYY1 3B9FH 5DGJA 1GHXH 1P01A 7KMEH 1OWEA 1W7GH 4AOQA 1TRMA 1EJNA 4OS7A 2YOLA 1AWFH 2LPRA 4WMEA 3LONA 4Y0YE 1EP6A 4WY3A 5C2ZA 2PGBB 2FDAA 2SGEE 4X8SH 3ZVGA 2C8YB 1TWXB 5TCAA 3FFGA 3OYPA 1P06A 1T31A 2Z3CA 3SU1A 1C1PA 4D7FA 3SHAH 2FWWA 4ZKRU 3T2NA 5GDSH 2OD3B 3FANA 1HYLA 1J9CH 3M36A 4JZEH 1GJ8B 2P8OB 1LPKB 1SGQE 4MPWA 1W2KH 5E0HA 1TIOA 1O2MA 2VGCC 3RXRA 1ORFA 3VB5A 1AGJA 1ELCA 4XBDA 4CRDA 4RKOB 1E37B 4OGXA 1NC6A 1VJ9U 1TABE 2PKSB 5C1UA 1D4PB 1ZR0A 2Y5HA 3ATMA 4DIIH 2XC4A 2F3CE 4UD9H 2OINA 1Z1JA 3GYMA 4UE7H 1C2IA 4B76A 1QGFA 5DO4H 2THFB 5DPAA 1Z8GA 3D62A 4E06H 1EPTC 3UR9A 4DGJA 3VB7A 2XBVA 1C9TA 1GL1A 2Z94A 4CREA 1ZRBA 3P17H 1UMAH 2VIVA 2ZPRA 3E91A 2GDDA 4Y7AA 4D9RA 1QIXB 1QURH 3U8TH 3D23A 2FIRH 3VXEH 1A3BH 1ZSJA 1MMJN 2QYIA 4BAHB 1Z8IB 3SUEA 1C4U2 2IN2A 2WUBA 5DP3A 1EZXC 2J4IA 4NWKA 1FLEE 2R0LA 1BTYA 3RMNH 3UNQA 5IDKA 1UTOA 1V2KT 1GMHF 3CS7A 4OS6A 4OS2A 4ABJA 2AMPA 3UQVA 1O36A 2ZDKA 3BSQA 1YCPH 3MNCA 1P0SH 3FAOA 2H9HA 5T6FA 3RXFA 3RXTA 1S85A 4YO9A 4BNRA 1ETRH 2B0FA 4NIXA 1TBRH 1KLIH 1S5SA 4A1XA 1GI4A 2JH6D 2VNTA 2NWNA 1QRXA 1TGCA 3VXFH 2V3OH 3PTNA 1CQQA 2ZFTA 1EQ9A 4JK5A 2BDYA 4ZHAA 4THNH 1FNIA 2CGAA 1UVOA 3ATLA 2BQ6B 2OC8A 1SG8B 3A7YA 1FDPA 3SV2H 4GCHF 1TQ7B 4ZHLU 4X8TH 3C1KA 3RXSA 1ZGVA 5F03A 3SNEA 1SLWB 2PTNA 2BQWB 1O5CB 2LNCA 3GDSA 5PTPA 6GCHG 4MQAA 4FUIA 4U2WA 2PW8H 1QL7A 4NA7A 2WPKS 1Z6EA 1AI8H 1NFXA 1OYQA 2ZGXH 1GBCA 4H42U 4CRGA 1V2NT 4K8BA 5I46H 5JB9S 4X2VA 2BZ6H 1DXWA 5EW1H 4UEHH 3LC5A 5FCRA 2HNTC 1C1RA 4X0WU 3A85A 3NWUA 1LTOA 2W7UA 1P2MA 3AW1A 1BBRH 3OY5U 1FY1A 1M9UA 5C3NA 1CE5A 4IN2A 2QF3A 3BTDE 1O2WA 1AHTH 1ABIH 3M37A 4O97A 1FIWA 1TNHA 5C5NA 1NZQH 3UTUH 2O8UA 4ABAA 2F9OA 3KQEA 2G4UA 3A7XA 3FP7E 1GI5A 1W0YH 3RXJA 1K9OE 3T25A 1RTFB 5JDUB 4GCHG 2BDBA 2NU2E 4I31A 1EUFA 2G00A 4NG9H 1E38B 1ANCA 3PLBA 4NA8A 4BOHA 4FU8A 3Q3XA 1XKBC 1RIWB 2J38A 2JH0D 3MNXA 5FHTA 4ISOA 5K0HA 2PKSC 3EQ0H 1MKXK 2A7HA 4IN1A 3KHVA 1T32A 1FXYA 3VB3A 2BLWA 4K1EA 4X6MA 2FI4E 4B71A 3MH6A 3UUZA 2QY0B 1TA6A 2SFAA 2ALPA 2XC5A 4CRBA 1P2IA 3IG6B 4RKJB 1BCUH 2TGPZ 2SNVA 1GBDA 1GHAF 3UWIA 1BTZA 1P2NA 3RXEA 1O31A 2BDHA 2BY7X 1G36A 3DT0H 3ZVBA 5LGOA 4AFUA 5L2ZH 5A09A 1A3EH 1UK4A 5GPIB 5G4BA 1RGQA 1OWHA 1ZOMA 1BRUP 2UWOA 5GCHG 1BJVA 2OBOA 3RC4A 3RU4D 3GDVA 2HNTE 1RXPA 4IS5A 1GPZA 4DJZB 1EOJA 1C5YB 2XRCA 1E0FD 3K6ZA 1ZYOA 3BTGE 2FZZA 1ZMLA 2G51A 1O5GH 4NGAH 3DFLA 3RXKA 1P12E 1XUFA 4UFEH 1VITF 1TNLA 3GICB 4ZROA 4K69A 1TX8A 2FOHA 3N7OA 1HDTH 1E36B 1BMLA 1F0SA 2C3SA 1Z1IA 4ABEA 1THSH 1C2KA 2FI3E 1C1QA 1C1MA 1PPCE 1BT7A 2VH6A 1O3KA 1VITH 1BRBE 4XBBA 3SN8A 1OWIA 1K1LA 2A5AA 1AD8H 1GHAG 5E2PA 3A80A 3QTVH 2ZCLP 4XBCA 4NFEA 3VB4A 1NT1A 1GJ9B 5A8XA 1OP2A 1C4Y2 1IQHA 3BTWE 4BTTB 1BMNH 3Q77A 4O3UA 3SNAA 5EU8A 4DY7B 1A4WH 3CENA 3KCGH 1QTFA 3V0XA 5DJ7A 1IQJA 1L4DA 1K28D 4NIYA 2TIOA 1AVWA 3SGBE 1THPB 3M7TA 3PTBA 1L0ZA 4NWLA 1QBOA 3MHWU 8GCHF 2OCVB 4K1SA 1ZJDA 5T6DA 1F2SE 1J8AA 2C8WB 1K1NA 1KSNA 1W11U 1C5LH 4B2CA 5DP7A 3E16B 1C5XB 1OKXA 2DE8A 1AN1E 1AFQC 3ZZ9A 1Y59T 3K9XB 3UFAA 4Y11E 2EA3A 3U1IB 1YPLH 3HK3B 1F5LA 3T28A 1GI7B 3GY4A 1GDQA 2Q1JA 3H7TA 5A0BA 1MU8B 1XMNB 4KTCA
chains in the Genus database with same CATH superfamily
5A8YA 3Q3YA 4BTUB 3EGKH 1A1RA 1XXDA 1C1SA 2QF5A 2ZP0H 4PROA 1DWBH 4K5ZA 4MPXA 1V2ST 1K1IA 1LQDB 2ESTE 1JMOH 1KLJH 2WV9A 4AN7A 4Y8ZA 4DOQA 1V2JT 2TRMA 5DP6A 3QO6A 3MU1A 3VG8A 1S83A 1FUJA 2QXGA 2H2ZA 3E8LA 1ZGIA 2BD2A 1AKSB 1CGHA 2GP9B 3RXQA 2VWOA 4IMZA 1L2EA 4YT6H 5C1XA 4A5TS 1KXEA 1ID5H 4F49A 1GBIA 1O33A 1RIWC 3HKJB 2ZO3H 2R3YA 4ABIA 4B1TA 5LPRA 1GBAA 2BM2A 1NS3A 1DUEA 5EXLA 4XFQA 1MQ6A 4ASUD 2KCYA 4AG1A 4FUGA 1P2JA 3SZEA 2ZU1A 2GT8A 1J17T 1DE7H 2HOBA 5EPYA 3S69A 1Y3WA 4X8UH 3RMMH 5TJXA 2A45B 3PV5A 1YF4A 1SSXA 1XVMA 3GY7A 1SGPE 2F9BH 1ETTH 1SPJA 2D1JA 3LGYA 3A84A 4KTSA 1QB1A 1KDQA 1TOCB 1F0UA 3D65E 3NZIA 1VR1H 2RCEA 3IITA 3PROA 2BQ7B 4R0IA 1C2LA 1HJ8A 4Q80A 1SLUB 2QV1A 3SV8A 1PPZA 2Z9KA 4GHQA 3NRLA 1SLXB 2EI6A 4WVPE 5ESBA 3RM2H 3MFJA 2OC7A 3SU3A 2ZWLH 2BMGB 3A7TA 3VB6A 1WQVH 5E0JA 4ISHH 3KN2A 4TWWA 1ZHPA 4Z6AH 5LPFA 2FOEA 4NIWA 3ITIA 2YNBA 1FONA 2B5TB 4DURA 3ZZ5A 4J2YB 2PLXA 2Z9GA 1IQMA 1HJ9A 5DG6A 1JIMA 1NO9H 1O3JA 1NFYA 1MZAA 1GBMA 2W5EA 5E0GA 1O3HA 1TPOA 2O9QA 4XDEA 1WYKA 2JDID 2ALVA 2OP9A 4P02A 2RDEA 2VGCB 1ANDA 1QQUA 2OBQA 3GCTF 2ZGCA 3M35A 3D49H 1NPMA 1U6QA 3TNSA 3BV9B 1LKBA 5JBTA 1Y3UA 2F43B 4AYVB 4AG2A 5AHGH 2O8WA 2GCHG 3URDA 2A7JA 1VGCC 3TVJB 1OPHB 1YY3A 5DN6D 1OXGA 3SU2A 2BLQA 3SQHE 1QHRB 2YMSC 3A7ZA 4KELA 3S7KB 4KGAA 3KEEA 2ZU5A 1ZSLA 4BTIB 2A4QA 1O3MA 1BDAA 3I78A 4O3TA 5DK1A 2BVXH 1G3BA 3F6UH 2ZF0H 4ABGA 1EPTB 1PQ7A 1V2VT 1C5RA 4ISIH 3V12A 5JBBS 3SU4A 1O34A 1ZPCA 5C0TA 4Y6DA 2OC0A 1MUEB 5FBEA 2XXLA 1ZJKA 2FYQA 4IC6A 4YLQH 3M5LA 2ZDVH 2WPJS 3PWBA 1V2WT 5EGMA 3WWFA 3LDXH 2KCOA 3K65B 2Y82A 1AMHA 1QB6A 1TGBA 1GDNA 2EY4C 3A7VA 4Y71A 3KF2A 3NKKA 3RXHA 1HBTH 1SFQB 3BIUH 2GJGA 2FOFA 3O8BA 1C5VA 1EB1H 1O3PB 1B0EA 3PV2A 1FY5A 3ZZ8A 4X1NU 3GCTG 1T4UH 1LPGB 3MYWA 1FIZA 1OS8A 2A31A 3GY6A 3H7OA 1F0TA 1MTUA 3FVFB 3EYDA 1WTGH 1TX7A 1JOUB 1QA7A 3P70B 3V3MA 1O2YA 1EOLA 1Q3XA 3F2GA 3SORA 5HXFA 3F1SB 3R0FA 4MLFB 2Y7XA 1MTVA 3M61U 1UTMA 1K22H 1C5UA 2FOMB 3JZ1B 4WXVA 2J97A 5F6MA 2WPHS 1UHBB 1P03A 5FCKA 4YXWD 3M3VA 4LOYH 1XVOA 2WPMS 4BAQB 1HJAC 5FL7D 1SR5C 4D9QA 1EAIA 2BVSH 2ZNKH 2HPPH 1T7CA 1DLKB 3QGNB 1LVYA 3PLKA 1ESAA 2PTCE 1QQ4A 1JXPA 2GDEH 2KAIA 1MH0A 4K3JA 1HGTH 2H5DA 4X1SU 5C94A 3SJKA 3M5NA 3LJJA 1O2KA 5EXMA 2C8XB 2QXJA 1C5PA 4Y76A 2ZC9H 2BDGA 2M5TA 1MAXA 1UTLM 4I7YH 1NROH 4P00A 1BBRE 2UUJB 1UCYK 3CS0A 2TGTA 1DUAA 4FUHA 1TA2A 4QT8C 4NSYA 3URCA 4E7NA 1C5TA 1YPKH 3NXPA 4IMQA 4YESB 1O2NA 1P57B 2RA0A 4FVBA 3V13A 2ZGJA 3M5OA 4I33A 1CA0C 2ZDNA 3EE0B 3QZRA 4Q7ZA 1KY9A 4ZUHA 1GI3A 2XCNA 1H9LB 3SU6A 2RDLA 4INHA 4YOJA 2GKVE 2OLGA 4X1QU 2XBWA 2FS8A 5EODA 4JMYA 1H8IH 1YGCH 2J98B 3L33A 2C90B 1SFIA 4ABDA 1S81A 3RXPA 1W0ZU 5FXLA 1L1GA 3A83A 2CF9H 2A2QH 3HK6B 4I8HA 1IQLA 1T8LA 2P93A 2BTCE 1TBZH 2CK3D 1ZTLA 2XNIA 3N7EA 1IHSH 1UJ1A 4TY7A 1ARCA 3UY9A 1TOMH 1IQKA 3LGVA 1E34B 2BX3A 2P95A 1HFDA 3QN7A 1WXRA 1QCPA 3A87A 1O2VA 2AFQB 4HGCA 1G2LA 1ELAA 1HRTH 2W6JD 1EAXA 1YWUA 5HKKD 1OHHD 3SJ9A 2ODYB 1X7AC 1AU8A 6GCHF 2XWAA 1D3PB 4I8KA 1P2QA 4UFDH 1QBNA 1LHEH 2P94A 5GXPA 1DANH 2QE7D 1TMUH 1D3DB 5F8TA 3UOPA 4TT3D 2GGVB 3I29A 1H9HE 2AS9A 4XE4A 5B6OA 3T62A 1PPFE 2VIQA 3A8AA 5HIZA 1K2I1 4FETA 1A0JA 1W8BH 2QGRA 3RU4E 5FPTA 2A4RA 2A0QB 3S9AA 2A5KA 1YBWA 1V3XA 2ZKSA 1O30A 4ZXYH 1C1WH 4A92A 1C2EA 1HAGE 1EXFA 4Q7XA 3A8BA 2R9PA 1ELVA 2PFEA 2FPZA 1MKWK 1LVOA 1BHXF 2VIOA 2BD8A 1ZHRA 1C1UH 1SC8U 1GBJA 1HIAA 1BB0B 4AYYB 2YMSD 1GI2A 2CV3A 3PRBA 1EX3A 1FI8A 2V6NA 3A7WA 3L6PA 1GG6C 2H5CA 1SLVB 4WH8A 1LPZB 1S84A 1BBRK 3E0PB 2GVFA 2K8IA 2FO9A 2QIQA 4JYUH 2GTBA 1HAIH 1FJSA 1QFKH 4BXSA 3ESTA 4KTUA 2ZPQA 2Y6TA 3QWCH 1VCWA 4IC5A 1BTUA 2J9NA 1CT0E 1MTNC 3FOAA 3LOXA 4ZXXH 1W10U 4MDSA 3LGTA 2OC1A 5T6GA 3OX7U 2YNAA 1TNKA 3S9BA 1AUTC 4Q7YA 5LH8A 1K1JA 2ZHWH 3F3BA 1EZUC 2CF8H 5DP9A 3LGUA 1V2OT 1EASA 3R3GB 5ESTE 1AIXH 1A61H 4SGAE 1AFQB 2J95A 1XKAC 1TONA 4DIHH 3LC3A 5EQSA 2ZZUH 1B7XB 2JJ2D 1EZQA 2FS9A 4FUEA 4SGBE 4U01A 3RMOH 4FUDA 1LHCH 3A8DA 2ZEBA 4ZMAH 1C5OH 1V2QT 3RXGA 2AIPA 3O8DA 4FUCA 3E0NB 5GCHF 5KGOA 1EB2A 1AQ7A 2FESH 5DP5A 1DVAH 5KECA 5K7RA 3MNBA 4BXWA 2FOAA 2ZDLA 4AB8A 3GCOA 4CRFA 1TB6H 3LJOA 2WV5A 2PUXB 1SQAA 2EI8A 2KZ4A 6ESTA 2G52A 1GJ6A 1Z71A 1C5ZB 3N7DA 3OTJE 5A0CA 1UTPA 3BF6H 1SQRA 1SHHB 2ZIQH 3DSGA 1GBTA 1GJCB 1EKBB 4O9VA 5C1YA 3BIVH 2Z9LA 1E1QD 1F5KU 4GSOA 5FBIA 4ZAEA 2TGAA 1G30B 3MMGA 2GZ7A 6LPRA 1O3FA 2VWNA 4XRNA 2ZDAH 4M7GA 2FX4A 1SGEE 1O2PA 2WPIS 2GV6A 3Q3KA 1O2GH 4F4OC 1TBQH 2VVUA 3MH4A 1LMWB 2VJ1A 3TITA 3LU9B 3RXUA 2BD5A 4DT7B 1EAUA 1H4WA 1OOKB 4I32A 1PQ8A 1O3CA 1GVZA 1C2GA 1KXBA 1O39A 4VGCC 3SNCA 1O2OA 2Q6FA 4AGJA 1GMCF 5C20A 3BTQE 2KCAA 4INKA 1DY9A 2FYRA 2H9EH 2KFWA 3NPSA 1HXFH 5A0AE 3TIUA 1BRCE 1C5QA 2VH0A 2PKAA 1HAVB 1W7XH 1MKXH 2BLVA 4HFPB 3A8CA 2SGAA 2FI5E 3AVZA 1ELBA 1G3EA 3W95A 1GI0A 2A5IA 3KQ5A 2ZTXA 3PMAB 4DW2U 2QF4A 3OU0A 4CHAC 1TMTH 3RXDA 3P8GA 2ULLA 3BTTE 4Z0KA 3QGJA 1G3CA 1FY4A 1KXDA 2ZU2A 1C2DA 4ACBA 3PLPA 1UO6A 2F9PA 1C1NA 3MOCA 3FZZA 1DWEH 2BLOA 1UW7A 1FPHH 5HM2A 2TPIZ 1H8DH 4X6PA 1KXAA 2F83A 2D26C 2NU1E 4BAKB 1DOJA 3P8FA 1TALA 1ESBA 5F8XA 2UUKB 1XXFA 1VGCB 3OY6U 1K1OA 1SQOA 1THRH 3LPRA 2ANMH 1O3IA 1YP9A 3MO9A 7GCHF 3RXLA 4BANB 1GMCG 2YMSB 5DP8A 1GBEA 2Z6BD 3HATH 4CH8B 4OM9A 1GDUA 1YKTA 1CT2E 1XM1A 1KIGH 1SHYA 3MWIU 4LK4A 4X6NA 5I25A 1UTNA 5C17A 2ZTZA 4X1PU 1W14U 2PSXA 4XSKU 2J34A 1SGIB 1FQ3A 2OUAA 2XYAA 2VB0A 2AGGX 1LHGH 3QDZB 1ARBA 1SI5H 2GCTC 2W6ID 5AFZH 1MTWA 1TFXA 1XUIA 1C5WB 3PO1C 2ZGBH 3AAVA 2ILNA 3BTKE 3HKIB 2RFKC 1DT2A 2JH5D 1DLEA 2BB4A 4CRAA 1SGCA 3KQCA 3ZZAA 3A88A 1QRZA 3RXMA 1JRSA 3TPIZ 1QA0A 1LVBA 3OEED 4I8GA 1MD8A 1D3TB 2UWLA 2XC0A 1T8NA 3MO6A 1FAKH 4ABBA 1AE8H 1NM6A 1Y3YA 4BAMB 3TLOA 3NK8A 5JBAS 1VJAU 1AO5A 1ELGA 1SGTA 2KM0A 3BEUA 3TJVA 2BD4A 4R8TB 1AWHB 4YM9A 4AX9H 2FP7B 3A89A 4RT0A 1SOTA 1J15A 2BD9A 3FO8D 1EATA 2EEKA 3TK9A 4YZUA 2Y80A 4K2YA 4JZDH 5EJZA 7GCHG 2F91A 3UNRA 4J1YA 1A7SA 1QR3E 2PUQH 4FVDA 1D6WA 3SUDA 1TPAE 3ENSB 1E1RD 1K21H 3SJOA 4Q2KA 1H9IE 2CHAC 1HJAB 3M5MA 1SQTA 5LPEA 7LPRA 1MBQA 1W0JD 2ZPSA 4I8JA 3RXBA 2W3KA 1MTSA 3DSOA 1WU1A 2XWBI 3NCLA 3VFEA 5EJLA 1O2RA 4JYVH 4O03A 1GHWH 2KR7A 3K2UA 1GHZA 1NRSH 5L2YH 1BMFD 2BY6X 1KTSB 2SGQE 4D7GA 2SGDE 1C9PA 2GCHF 2VWLA 5T1VA 1HAOH 2O8TA 3GY3A 1TNGA 1K1PA 4GLYA 3SJ8A 1ZPZA 4X2XA 1CHGA 2B8OH 2WYJA 2FTLE 2SGPE 5C5OA 2K1QA 1KYNA 2P3UB 1ELTA 1QJ1B 3RXAA 2Z3DA 3CNRA 1FN8A 2ZI2H 1CSOE 2V7QD 1HAHH 4B74A 3ZVCA 1SGYE 1CA0B 1B0FA 4IGDA 1VCPA 3DHKH 1IQNA 4YTAA 1DSUA 1GHBF 2AH4X 2O8MA 2G4TA 1AE5A 4F48B 3BTFE 4TPYA 3KL6A 1B5GH 2H6MA 2B7DH 1HAPH 2G8TA 2GMTC 4AFQA 1WDIA 3AAUA 3MH7A 1TYNA 1NRQH 3OTPA 1GHYH 3TGJE 1C2FA 1GJ5H 1TQ0B 5EIYA 1N1LA 1TGNA 3RXIA 1MQ5A 1XUKA 5A2MH 1XUHA 1A46H 2FLBH 2UWPA 2QAAA 2AMQA 2BD7A 2ZFRH 1CBWC 4X2WA 4E7RG 5H4IB 4MTBA 4MNWA 3AW0A 1BIOA 1V2MT 5HIYA 4JZFH 5JYIA 3SW2B 1A0HB 2C4FH 1UK3A 2J94A 3VEQB 2GX4A 1NFUA 3KYGA 1S0QA 2SNWA 4AGKA 1O2IA 1LHFH 1O5BB 2XTTB 1KLTA 3LH1A 1P2KA 2L74A 2M2AA 1ELEE 4FUFA 1RJXB 4LZ4B 2NU0E 3BN9A 3FN8A 1AUJA 1MBMA 1GHBG 3WY8A 1C1TA 3ZVAA 1PJPA 1D9IA 3S0NA 2ZGHA 1GBFA 3GY5A 4ACAA 4ISNA 4A7IB 1RRKA 1FY8E 1GJAB 5EOKA 3K6YA 2JETC 5JPMH 3W94A 2W3IA 1DS2E 2F9UA 2OQUA 2HVYB 3V7TA 2ANKH 1PQ5A 3L3TA 1BMMH 1WQSA 2AGIX 4B73A 4MG3A 1FPCH 1WTHD 4ZH8A 3RLWH 1IOEA 3S7HB 4X1RU 1DSTA 1UTKA 3TK5A 1O2JA 1DX5M 2ZCHP 3F9HA 1RD3B 2Y5FA 4LXBH 1RS0A 4I86A 2Q6DA 1PYTC 2FLRH 4HI3A 3ZZ3A 2V3HH 3MU8A 3SNBA 1BOQA 1GG6B 1O2SA 4YOIA 1MCVA 3UQOA 3BG8A 5EW2H 3KGPA 1L1JA 2HLDD 2ZG0H 3WW7A 5BRRE 1PPBH 3MNSA 3ZVFA 2BXTH 5IYTA 3ZYEA 1GI1A 1WV7H 2ZHFH 1YLDA 2RA3A 1D6RA 4A1TA 1MTNB 1SGRE 4UFGH 4A6LA 1UVUH 2TGDA 4GUXA 2ZECA 4DCDA 1KXFA 5T3HA 5L6NH 1MABB 1L4ZA 1RFNA 1QBVH 1LVMA 2W7SA 3PV4A 3RXCA 1P8VC 3EDXB 1V2TT 3TGIE 4RSPA 1C4V2 3F9EA 2SGFE 2Z3EA 1L1NA 1W3CA 3O8RA 2A32A 4CBOA 5DKMA 4JYTA 3UOUA 1Z8RA 4WH6A 4DG4A 1BITA 1P9UA 1WSSH 2BY8X 3MH5A 3EE7A 3RUOA 3STJA 3GOVB 4D76A 1GJDB 1S6FA 3MI4A 1DICA 2BOKA 6CHAB 2G5VA 2ZHDA 2CN0H 3TH2H 2PGQB 2FM2A 2OQ5A 3LH3A 3UNSA 1FAXA 3SGQE 3DD2H 4BAOB 4ABHA 4Y7BA 1MD7A 4UONA 1NRRH 2PWXA 3MTYA 4WXIA 3QLPH 1V2RT 1JWTA 3SO3A 4K1TA 1ZHMA 3TNTA 1BZXE 1C2HA 3VPKA 1IQGA 1UCYH 1LHDH 3EA8A 2VIWA 3B8JA 4IW4E 3ELAH 3QTOH 3SZNA 2XW9A 3FP8E 1YPEH 1TNIA 3SV7A 3STIA 5EXNA 1CA8B 4FU9A 3U28C 1EAWA 2L6OA 2OXSA 1IQEA 4B6FA 1QY6A 3P8OA 2CMYA 2DE9A 2R3UA 1YCPK 1N8OB 1O2LA 4VGCB 2GD4B 3M3SA 1P02A 3VGCC 2WUCA 3EAJA 3UPEA 3P95A 1AKSA 1ABJH 4MPUA 4WWYA 1P9SA 4CR5A 1T8OA 1JIRA 1Z6JH 2G5NA 1MAYA 3BG4C 4OS4A 3OFND 1ZTKA 2WHXA 3KQBA 1AFEH 5TCCA 1HAXB 1HAZB 2A1DB 3KIDU 3SOSA 4CHAB 1VZQH 3TGKE 2XBYA 2HRVA 2EQNA 2FTMA 2Y81A 2RG3A 5E8EH 1JBUH 1SBWA 1AVGH 3G01A 3GCHC 2WYGA 1HB0B 1KDQB 1V2LT 2WPLS 1PQAA 1DXPA 3P8NA 1GBLA 4NZQA 1GCTC 1CVWH 3W1EA 1O37A 4RI0A 2P59A 3TH4H 2G55A 3SI4H 2ODQA 2H9TH 3TJOA 1O3NA 3QK1A 3RXVA 4MNYA 4ZCNA 1AB9C 1INCA 1XUGA 1NRPH 1UVTH 1ZZZA 4X6OA 3U9AH 4GHTA 2V3MA 3PMBB 3F68H 1ZLRA 2F9VA 2QA9E 1FN6A 3O8CA 1V2PT 1QL8A 4GPGA 5B6LA 4AB9A 9ESTA 3RM0H 1O3BA 4K60A 3MU4A 1ETSH 1BMAA 3RLYH 4YT7H 4U32A 1EJAA 2JKHA 1DFPA 3SNDA 1GGDB 1NRNH 1MZDA 3TU7H 1QB9A 1NFWA 5GJ4B 4F55A 1MU6B 3N99A 1SGDE 2CXVA 2GCTB 2WZQA 1ANBA 1QJ6B 3PO1B 1IQIA 1IQFA 2G81E 2AGEX 1AY6H 1BJUA 2F9NA 1TPSA 1G2MA 3CP7A 5C0UA 1MKWH 1F5RA 1ANEA 2Z7FE 5FX5A 5CHAC 1C5NH 3QX5H 3ZV8A 4DVAU 2ODPA 2Y5GA 1BUIA 3LKWA 1GMHG 1GVKB 1T4VH 2V0BA 3GDUA 4NZLA 1GHVH 1DY8A 1A2CH 3UB0A 1H1BA 1TX6A 2ASUB 4MNVA 2ZQ1A 6CHAC 1S0RA 4GAWA 1Q31A 3FP6E 3GY2A 4RT1A 3SU5A 2ZCKP 1CHOF 1PYTD 3GISB 1OWDA 2D8WA 1SGFA 3Q76A 3KQDA 1MCTA 1YPHC 2AIQA 3F9FA 2HPQH 5J4SA 1LKAA 2FMJA 1LO6A 3U8OH 4NCYA 2VBCA 2I6QA 2STAE 4UDWH 1HNEE 1O2HA 5CHBA 3RP2A 3SGAE 1N6XA 3JZ2B 4JCNA 1EPTA 1AZZA 2ANYA 5FPYA 1XX9A 5E2OA 2A2XH 3PWCA 4JK6A 1TE0A 5HM9A 1DWDH 2CHAB 1LCYA 1GVLA 2STBE 2VWMA 2NU3E 3A86A 1Z7KA 1K0HA 2HWLB 2P8OC 3PYHA 2Z9JA 1TMBH 1O38A 4CR9A 3ODDA 2LP6A 1F0RA 2BOHB 1FV9A 3M7UA 4Q4LA 5GIBA 1P10A 1C5SA 3DFJA 1SB1H 3M7QA 1TLDA 4IBLH 4CH2B 3MU5A 1UVPA 1C1OA 3S9CA 4H6SB 1YC0A 1NBMD 4YOGA 1ESTA 3PMJA 3U8RH 3F9GA 1EP5A 3GY8A 3BEIB 1N8OC 2PR3A 3DUXH 2ZU3A 3BEFB 3MQKC 1HCGA 2WV4A 4GVUA 2ZFPH 4NSVA 1W13U 3ATWA 1XUJA 2QCYA 2Q6GA 3ZZDA 1GJ4H 1CT4E 3HGPA 5EPNA 3RU4T 4TY6A 3EA9A 4INLA 2LELA 3LIWA 1WAYB 2HGTH 1CHOG 2QXIA 3DCLA 3SUFA 1N6YA 2D2DA 5EG4A 1IAUA 1H8ED 1UHBA 4Y10E 3GS9A 3RDZA 2PSYA 1TRNA 3SBKA 5ABWA 2EI7A 1HLTH 1O5DH 1K1MA 4ISLA 3MU0A 3P92A 3FKSD 2KAIB 3QUMP 1S6LA 2UUFB 3ZVDA 3SHCH 1P05A 3GYLB 2AERH 3T5FH 1BQYA 2GMTB 1GCDA 1RTLA 4AFZA 1Y3VA 2P3FH 1PPHE 1V2UT 4TPIZ 1J14A 1WUNH 3M3TA 1ELFA 1ZTJA 3DSPA 1YPHE 1HAYB 2F4LA 1BHXB 1DDJA 1YM0A 1DITH 4UFFH 1YPJH 5KEDA 1HXEH 1CBWB 3T29A 3T27A 2QXHA 3T26A 3SV6A 1O32A 4D8NA 1Z8JB 4ESTE 3UR6A 1G32B 1O3GA 4TYDA 4K8YA 4B6EA 1P2OA 3F0OA 4Y8XA 1BTPA 3OSYA 1COWD 2W26A 2ZTYA 3DA9B 2IPHA 1OWKA 2R2WU 3BTHE 1G3DA 2GZ9A 2GZ8A 1GGDC 4ABFA 3PMHB 1BTWA 3ODFA 1KTTB 1S82A 2TBSA 1Y8TA 3ATKA 1ZSKA 4MNXA 5F8ZA 2HVXA 1GI6A 1O2UA 2B9LA 4ZHMU 1CU1A 1BTXA 1Y5BT 1A5IA 3ZZBA 1GL0E 5C67A 2BXUH 3OAAD 1P09A 1UK2A 2IJOB 2J98A 1SL3A 1O3AA 4MVNA 4WMFA 1WOFA 2BVRH 2PHBA 4B2BA 5A8ZA 2JETB 2JJ1D 4OS5A 3FZDA 3I77A 2BY9X 1O2ZA 4KKDA 1O5AB 3IWMA 4LZ1H 1C1VH 1VITG 1BA8B 1UTJA 1EZSC 1HV7A 2R0KA 2VINA 1QL9A 4WF8A 3UAIC 3ZVEA 1KXCA 1A0LA 4Y8YA 2ZFQH 2C93B 8LPRA 3SUGA 4OS1A 4AZ2B 1GJ7B 1UVSH 3U98H 5EJ1A 1TNJA 1SGFG 3RMLH 2BDCA 1Y3XA 5AFYH 1YPMH 1O5EH 1SVPA 4CRCA 5ETXA 3GCNA 1OX1A 2A4OA 3PM3A 1FX0B 2ZU4A 4HG6A 2BX4A 2BDIA 4FOUC 4Y0ZE 1ZMJA 1WBGB 2ZFFH 3KNXA 4FUBA 5L30H 3HGNA 1A5HA 3TK6A 1C2MA 2FOGA 8GCHG 1O5FH 1LDTT 1VCQA 2XBXA 2FOBA 2FXRA 5JB8S 2OTVA 5GWZA 4U30A 4WMDA 3ZZ7A 1LQEA 1OYTH 3TJUA 2ZHEH 3E6PH 3SJIA 5EQQA 2QF0A 4KP0A 1ZRKA 1OWJA 4E05H 9LPRA 1BRAA 2V35A 2NU4E 2PP6A 3UREA 2J5UA 4H6TA 3U69H 3ZV9A 2HNTF 8ESTE 1O0DH 1HIAB 2DUCA 2IPQX 2JIZD 1CGJE 1O2XA 2C8ZB 1GWAA 5BPEA 3TH3H 2VVVA 1OP8A 3F2FA 1NN6A 1Y5UT 5CMXH 2ANWA 7ESTE 4B75A 1C5MD 2WINI 3U1JB 4Q63A 3OE7D 1D3QB 3ZZ4A 1GJBB 2BD3A 1GBHA 2FOCA 2BZAA 1C2JA 2O8LA 2FODA 2J2UA 2ZQ2A 5CDFE 3UIRA 1F92A 1P11E 2KCPA 3LGIA 1G37A 2AEIH 4X8VH 3BTME 4AFSA 2VIDA 5HGGA 2HALA 1AZ8A 1OP0A 4OGYA 1TRYA 2BHGA 1TGTA 3UWJH 4CBNA 1OSSA 3F0PA 3P6ZB 4AORA 2I6SA 3Q00A 1UCYE 4NA9H 5IK2D 1GI9B 4ZKOU 3AASA 3LT3A 4I8LA 3RC6A 3RC5A 3EA7A 1YPGH 1BTHH 3E1XB 1FMGA 1PPGE 5AVDA 2VU8E 2FX6A 4HZHA 4A1VA 2FEQH 1DPOA 2UUYA 3F2HA 1PPEE 3E90B 1CO7E 2CJIA 2GT7A 2ZHQH 2IJD1 2Y7ZA 1O35A 4FUJA 4M9FA 5FAHA 4RN6A 1FY3A 2EC9H 1TAWA 1PFXC 4X2YA 3PRDA 1E35B 1O2QA 4ASHA 1A5GH 1RTKA 1G9IE 4YLUA 4JZIA 4HTCH 2AYWA 1YLCA 3VGCB 1O3EA 1JRTA 2AMDA 3TJNA 1O3OA 1SGNE 1CGIE 1P3CA 3E3TA 1YCPM 4ZKSU 4AC9A 5CE1A 4FU7A 3SI3H 1P3EA 1J16A 2BYAX 4JZ1A 2BY5X 4WJG2 3BG4B 5J4QA 3ZZ6A 1SMFE 1GMDF 3QZQA 2VVCA 3PB1E 3SU0A 1QRWA 1GBBA 5DP4A 1F7ZA 1ACBE 2P16A 2WPDD 4MPVA 1QZ8A 5F53A 1EJMA 1FZZA 2P3TB 4NFFA 1AVXA 1DWCH 2Z9IA 2A4GA 1DM4B 5EQRA 2QN5T 3GCHB 1ZMNA 5FX6A 2PV9B 1S6HA 3ATIA 1GCTB 2ZFSA 2A7CA 1SOZA 2XCFA 1UTQA 1O3LA 1T8MA 2GV7A 1ZPBA 1HPGA 1QNJA 1AB9B 3C27B 3ZZCA 1O2TA 4TWYA 2KX4A 1Q2WA 3HPTB 3ZYDA 2PKAB 1NTPA 1GBKA 2QC2A 3NUMA 3A82A 8KME2 1ELDE 4XOJA 1Y5AT 5FPSA 5SGAE 1TPPA 2XNDD 1HUTH 1SKYE 1NY22 2ZA5A 2R2MB 3MO3A 1HAVA 1W12U 3H5CB 1P04A 3A81A 2BDAA 4ZKNU 2VIPA 5JBCS 4FXGH 3BTEE 2XOKD 1V6DA 2HLCA 2ZDMA 1GI8B 1O3DA 2IOTA 5AF9H 3SQEE 5HYOA 4H4FA 4XD7D 3SV9A 4Z1MD 3B23B 1NU9A 1NU7B 1IHTH 4Y79A 1WCZA 1GMDG 5HMAA 3RXOA 4NIVA 4B2AA 2H1UA 3LGWA 1QJ7B 2J92A 3OEHD 1TGSZ 5CHAB 3AK5A 1NESE 1YYY1 3B9FH 5DGJA 1GHXH 1P01A 7KMEH 1OWEA 1W7GH 4AOQA 1TRMA 1EJNA 4OS7A 2WSSD 2YOLA 1AWFH 2LPRA 4WMEA 3LONA 4Y0YE 1EP6A 2K0QA 4WY3A 5C2ZA 2PGBB 2FDAA 2SGEE 4X8SH 3ZVGA 2C8YB 1TWXB 5TCAA 3FFGA 3OYPA 1P06A 1T31A 2Z3CA 3SU1A 1C1PA 4D7FA 3SHAH 2FWWA 4TSFD 4ZKRU 3T2NA 5GDSH 2OD3B 3FANA 1HYLA 1J9CH 3M36A 4JZEH 1GJ8B 2P8OB 1LPKB 1SGQE 3KYFA 4MPWA 1W2KH 5E0HA 1TIOA 1O2MA 2VGCC 3RXRA 1ORFA 3VB5A 1AGJA 1ELCA 4XBDA 4CRDA 4RKOB 1E37B 4OGXA 1NC6A 1VJ9U 1TABE 2PKSB 5C1UA 1D4PB 1ZR0A 2Y5HA 3ATMA 4DIIH 2XC4A 2F3CE 4UD9H 2OINA 1Z1JA 3GYMA 4UE7H 1C2IA 4B76A 1QGFA 5DO4H 2THFB 5DPAA 1Z8GA 3D62A 4E06H 1EPTC 3UR9A 4DGJA 3VB7A 2XBVA 1C9TA 1NBME 1GL1A 2Z94A 4CREA 1ZRBA 1H8HD 3P17H 1UMAH 2VIVA 1E79D 2ZPRA 3E91A 2GDDA 4Y7AA 4D9RA 1QIXB 1QURH 3U8TH 3D23A 2FIRH 3VXEH 1A3BH 1ZSJA 1MMJN 2QYIA 4BAHB 1Z8IB 3SUEA 1C4U2 2IN2A 2WUBA 5DP3A 1EZXC 2AHME 2J4IA 4NWKA 1FLEE 2R0LA 1BTYA 3RMNH 3UNQA 5IDKA 5GNDA 1UTOA 1V2KT 1GMHF 3CS7A 4OS6A 4OS2A 4ABJA 2AMPA 3UQVA 1O36A 2ZDKA 3BSQA 1YCPH 3MNCA 1P0SH 3FAOA 2H9HA 3ZIAD 5T6FA 1VKYA 3RXFA 3RXTA 1S85A 4YO9A 4BNRA 1ETRH 2B0FA 4NIXA 1TBRH 1KLIH 1S5SA 4A1XA 1GI4A 2JH6D 2VNTA 2NWNA 1QRXA 1TGCA 3VXFH 2V3OH 3PTNA 1CQQA 2ZFTA 1EQ9A 4JK5A 2BDYA 4ZHAA 4THNH 1FNIA 2CGAA 1UVOA 3ATLA 2BQ6B 2OC8A 1SG8B 3A7YA 1FDPA 3SV2H 4GCHF 1TQ7B 4ZHLU 4X8TH 3C1KA 3RXSA 1ZGVA 5F03A 3SNEA 1SLWB 2PTNA 2BQWB 1O5CB 2LNCA 3GDSA 5PTPA 6GCHG 4MQAA 4FUIA 4U2WA 2PW8H 1QL7A 4NA7A 2WPKS 1Z6EA 1AI8H 1NFXA 1OYQA 2ZGXH 1GBCA 4H42U 4CRGA 1V2NT 4K8BA 5I46H 5JB9S 4X2VA 2BZ6H 1DXWA 5EW1H 4UEHH 3LC5A 5FCRA 2HNTC 1C1RA 4X0WU 3A85A 3NWUA 1LTOA 2W7UA 1P2MA 3AW1A 1BBRH 3OY5U 1FY1A 1M9UA 5C3NA 1CE5A 4IN2A 2QF3A 3BTDE 1O2WA 1AHTH 1ABIH 3M37A 4O97A 1FIWA 1TNHA 5C5NA 1NZQH 3UTUH 2O8UA 4ABAA 2F9OA 3KQEA 2G4UA 3A7XA 3FP7E 1GI5A 1W0YH 3RXJA 1K9OE 3T25A 1RTFB 5JDUB 4GCHG 2BDBA 3WWBA 2NU2E 4I31A 1EUFA 5DSFA 2G00A 4NG9H 1E38B 1ANCA 3PLBA 4NA8A 4BOHA 4FU8A 3Q3XA 1XKBC 1RIWB 2J38A 2JH0D 3MNXA 5FHTA 4ISOA 5K0HA 2PKSC 3EQ0H 1MKXK 2A7HA 4IN1A 3KHVA 1T32A 1FXYA 3VB3A 2BLWA 4K1EA 4X6MA 2FI4E 4B71A 3MH6A 3UUZA 2QY0B 1TA6A 2SFAA 2ALPA 2XC5A 3H09A 4CRBA 1P2IA 3IG6B 1W0KD 4RKJB 1BCUH 2TGPZ 2SNVA 1GBDA 1GHAF 3UWIA 1BTZA 1P2NA 3RXEA 1O31A 2BDHA 2BY7X 1G36A 3DT0H 3ZVBA 5LGOA 4AFUA 5L2ZH 5A09A 1A3EH 1UK4A 5GPIB 4DT4A 5G4BA 1RGQA 1OWHA 1ZOMA 1BRUP 2UWOA 5GCHG 1BJVA 2OBOA 3RC4A 2OK5A 3GDVA 3RU4D 2HNTE 1RXPA 4IS5A 1GPZA 4DJZB 1EOJA 1C5YB 2XRCA 1E0FD 3K6ZA 1ZYOA 3BTGE 2FZZA 1ZMLA 2G51A 1O5GH 4NGAH 3DFLA 3RXKA 1P12E 1XUFA 4UFEH 1VITF 1TNLA 3GICB 4ZROA 4K69A 1TX8A 2FOHA 3N7OA 1HDTH 1E36B 1BMLA 1F0SA 2C3SA 1Z1IA 4ABEA 1THSH 1C2KA 2FI3E 1C1QA 1C1MA 1PPCE 1BT7A 2VH6A 1O3KA 1VITH 1BRBE 4XBBA 3SN8A 1OWIA 1K1LA 1KMHB 2A5AA 3SYJA 1AD8H 1GHAG 5E2PA 3A80A 1EFRD 3QTVH 2ZCLP 4XBCA 4NFEA 3VB4A 1NT1A 1GJ9B 5A8XA 1OP2A 1C4Y2 1IQHA 3BTWE 4BTTB 1BMNH 3Q77A 4O3UA 3SNAA 5EU8A 4DY7B 1A4WH 3CENA 3KCGH 1QTFA 3V0XA 5DJ7A 1IQJA 1L4DA 1K28D 4NIYA 2TIOA 1AVWA 3SGBE 1THPB 3M7TA 3PTBA 1L0ZA 4NWLA 1QBOA 3MHWU 8GCHF 2OCVB 4K1SA 1ZJDA 5T6DA 1F2SE 1J8AA 2C8WB 1K1NA 1KSNA 1W11U 1C5LH 4B2CA 5DP7A 3E16B 1C5XB 1OKXA 2DE8A 1AN1E 1AFQC 3ZZ9A 1Y59T 1YLNA 3K9XB 3UFAA 4Y11E 2EA3A 3U1IB 1YPLH 3HK3B 1F5LA 3T28A 1GI7B 3GY4A 1GDQA 2Q1JA 3H7TA 5A0BA 1MU8B 1XMNB 4KTCA
chains in the Genus database with same CATH topology
5A8YA 3Q3YA 4BTUB 3EGKH 1A1RA 1XXDA 1C1SA 2ZP0H 4PROA 1DWBH 4K5ZA 4MPXA 1V2ST 1K1IA 1LQDB 2ESTE 1JMOH 1KLJH 4AN7A 4Y8ZA 4DOQA 1V2JT 2TRMA 5DP6A 3QO6A 3MU1A 1S83A 1FUJA 2QXGA 2H2ZA 3E8LA 1ZGIA 2BD2A 1AKSB 1CGHA 2GP9B 3RXQA 2VWOA 4IMZA 1L2EA 4YT6H 5C1XA 4A5TS 1KXEA 1ID5H 4F49A 1GBIA 1O33A 1RIWC 3HKJB 2ZO3H 2R3YA 4ABIA 4B1TA 5LPRA 1GBAA 2BM2A 1NS3A 1DUEA 5EXLA 4XFQA 1MQ6A 4AG1A 4FUGA 1P2JA 2ZU1A 2GT8A 1J17T 1DE7H 2HOBA 5EPYA 3S69A 1Y3WA 4X8UH 3RMMH 5TJXA 2A45B 1YF4A 1SSXA 1XVMA 3GY7A 1SGPE 2F9BH 1ETTH 1SPJA 2D1JA 3LGYA 3A84A 4KTSA 1QB1A 1KDQA 1TOCB 1F0UA 3D65E 3NZIA 1VR1H 2RCEA 3IITA 3PROA 2BQ7B 4R0IA 1C2LA 1HJ8A 4Q80A 1SLUB 2QV1A 3SV8A 1PPZA 2Z9KA 4GHQA 1SLXB 2EI6A 4WVPE 5ESBA 3RM2H 3MFJA 2OC7A 3SU3A 2ZWLH 2BMGB 3A7TA 3VB6A 1WQVH 5E0JA 4ISHH 3KN2A 4TWWA 1ZHPA 4Z6AH 5LPFA 2FOEA 4NIWA 3ITIA 2YNBA 1FONA 2B5TB 4DURA 3ZZ5A 4J2YB 2PLXA 2Z9GA 1IQMA 1HJ9A 5DG6A 1JIMA 1NO9H 1O3JA 1NFYA 1MZAA 1GBMA 2W5EA 5E0GA 1O3HA 1TPOA 2O9QA 4XDEA 1WYKA 2ALVA 2OP9A 2VGCB 1ANDA 1QQUA 2OBQA 3GCTF 2ZGCA 3M35A 3D49H 1NPMA 1U6QA 3TNSA 3BV9B 1LKBA 5JBTA 1Y3UA 4AYVB 4AG2A 5AHGH 2O8WA 2GCHG 3URDA 2A7JA 1VGCC 3TVJB 1OPHB 1OXGA 3SU2A 2BLQA 3SQHE 1QHRB 4KELA 3A7ZA 3S7KB 4KGAA 3KEEA 2ZU5A 1ZSLA 4BTIB 2A4QA 1O3MA 1BDAA 3I78A 4O3TA 5DK1A 2BVXH 1G3BA 3F6UH 2ZF0H 4ABGA 1EPTB 1PQ7A 1V2VT 1C5RA 4ISIH 3V12A 5JBBS 3SU4A 1O34A 1ZPCA 4Y6DA 2OC0A 1MUEB 5FBEA 2XXLA 1ZJKA 2FYQA 4IC6A 4YLQH 3M5LA 2ZDVH 2WPJS 3PWBA 1V2WT 5EGMA 3LDXH 3K65B 2Y82A 1AMHA 1QB6A 1TGBA 1GDNA 3A7VA 4Y71A 3KF2A 3NKKA 3RXHA 1HBTH 1SFQB 3BIUH 2FOFA 3O8BA 1C5VA 1EB1H 1O3PB 1B0EA 1FY5A 3ZZ8A 4X1NU 3GCTG 1T4UH 1LPGB 3MYWA 1FIZA 1OS8A 2A31A 3GY6A 3H7OA 1F0TA 1MTUA 3FVFB 3EYDA 1WTGH 1TX7A 1JOUB 1QA7A 3P70B 3V3MA 1O2YA 1EOLA 1Q3XA 3SORA 5HXFA 3F1SB 3R0FA 4MLFB 2Y7XA 1MTVA 3M61U 1UTMA 1K22H 1C5UA 2FOMB 3JZ1B 4WXVA 5F6MA 2WPHS 1UHBB 1P03A 5FCKA 3M3VA 4LOYH 1XVOA 2WPMS 4BAQB 1HJAC 1SR5C 4D9QA 1EAIA 2BVSH 2ZNKH 2HPPH 1T7CA 1DLKB 3QGNB 1LVYA 3PLKA 1ESAA 2PTCE 1QQ4A 1JXPA 2GDEH 2KAIA 1MH0A 4K3JA 1HGTH 2H5DA 4X1SU 3SJKA 3M5NA 3LJJA 1O2KA 5EXMA 2C8XB 2QXJA 1C5PA 4Y76A 2ZC9H 2BDGA 2M5TA 1MAXA 1UTLM 4I7YH 1NROH 1BBRE 2UUJB 1UCYK 3CS0A 2TGTA 1DUAA 4FUHA 1TA2A 4QT8C 4NSYA 3URCA 4E7NA 1C5TA 1YPKH 3NXPA 4IMQA 4YESB 1O2NA 1P57B 2RA0A 4FVBA 3V13A 2ZGJA 3M5OA 4I33A 1CA0C 2ZDNA 3EE0B 3QZRA 4Q7ZA 1KY9A 4ZUHA 1GI3A 2XCNA 1H9LB 3SU6A 2RDLA 4INHA 4YOJA 2GKVE 2OLGA 4X1QU 2XBWA 2FS8A 5EODA 4JMYA 1H8IH 1YGCH 3L33A 2C90B 1SFIA 4ABDA 1S81A 3RXPA 1W0ZU 5FXLA 1L1GA 3A83A 2CF9H 2A2QH 3HK6B 4I8HA 1IQLA 1T8LA 2P93A 2BTCE 1TBZH 1ZTLA 2XNIA 1IHSH 1UJ1A 4TY7A 1ARCA 3UY9A 1TOMH 1IQKA 3LGVA 1E34B 2BX3A 2P95A 1HFDA 3QN7A 1QCPA 3A87A 1O2VA 2AFQB 4HGCA 1G2LA 1ELAA 1HRTH 1EAXA 3SJ9A 2ODYB 1X7AC 1AU8A 6GCHF 2XWAA 1D3PB 4I8KA 1P2QA 4UFDH 1QBNA 1LHEH 2P94A 5GXPA 1DANH 1TMUH 1D3DB 5F8TA 3UOPA 2GGVB 3I29A 1H9HE 2AS9A 4XE4A 5B6OA 3T62A 1PPFE 2VIQA 3A8AA 1K2I1 1A0JA 1W8BH 2QGRA 3RU4E 5FPTA 2A4RA 2A0QB 3S9AA 2A5KA 1YBWA 1V3XA 2ZKSA 1O30A 4ZXYH 1C1WH 4A92A 1C2EA 1HAGE 1EXFA 4Q7XA 3A8BA 2R9PA 2PFEA 1ELVA 2FPZA 1MKWK 1LVOA 1BHXF 2VIOA 2BD8A 1ZHRA 1C1UH 1SC8U 1GBJA 1HIAA 1BB0B 4AYYB 1GI2A 2CV3A 1EX3A 1FI8A 2V6NA 3A7WA 3L6PA 1GG6C 2H5CA 1SLVB 4WH8A 1LPZB 1S84A 1BBRK 3E0PB 2GVFA 2FO9A 2QIQA 4JYUH 2GTBA 1HAIH 1FJSA 1QFKH 4BXSA 3ESTA 4KTUA 2ZPQA 2Y6TA 3QWCH 1VCWA 4IC5A 1BTUA 2J9NA 1CT0E 1MTNC 3LOXA 4ZXXH 1W10U 4MDSA 3LGTA 2OC1A 5T6GA 3OX7U 2YNAA 1TNKA 3S9BA 1AUTC 4Q7YA 5LH8A 1K1JA 2ZHWH 1EZUC 2CF8H 5DP9A 3LGUA 1V2OT 1EASA 3R3GB 5ESTE 1AIXH 1A61H 4SGAE 1AFQB 2J95A 1XKAC 1TONA 4DIHH 3LC3A 5EQSA 2ZZUH 1B7XB 4FUEA 1EZQA 2FS9A 4SGBE 4U01A 3RMOH 4FUDA 1LHCH 3A8DA 2ZEBA 4ZMAH 1C5OH 1V2QT 3RXGA 2AIPA 3O8DA 4FUCA 3E0NB 5GCHF 1EB2A 1AQ7A 2FESH 5DP5A 1DVAH 5K7RA 3MNBA 4BXWA 2FOAA 2ZDLA 4AB8A 3GCOA 4CRFA 1TB6H 3LJOA 2WV5A 2PUXB 1SQAA 2EI8A 6ESTA 2G52A 1GJ6A 1Z71A 1C5ZB 3OTJE 5A0CA 1UTPA 3BF6H 1SHHB 2ZIQH 1GBTA 1GJCB 1EKBB 4O9VA 5C1YA 3BIVH 2Z9LA 1F5KU 4GSOA 5FBIA 4ZAEA 2TGAA 1G30B 3MMGA 2GZ7A 6LPRA 1O3FA 2VWNA 2ZDAH 4M7GA 2FX4A 1SGEE 1O2PA 2WPIS 2GV6A 3Q3KA 1O2GH 4F4OC 1TBQH 2VVUA 3MH4A 1LMWB 2VJ1A 3TITA 3LU9B 3RXUA 2BD5A 4DT7B 1EAUA 1H4WA 1OOKB 4I32A 1PQ8A 1O3CA 1GVZA 1C2GA 1KXBA 1O39A 4VGCC 3SNCA 1O2OA 2Q6FA 4AGJA 1GMCF 5C20A 3BTQE 4INKA 1DY9A 2FYRA 2H9EH 3NPSA 1HXFH 5A0AE 3TIUA 1BRCE 1C5QA 2VH0A 2PKAA 1HAVB 1W7XH 1MKXH 2BLVA 4HFPB 3A8CA 2SGAA 2FI5E 3AVZA 1ELBA 1G3EA 3W95A 1GI0A 2A5IA 2ZTXA 3PMAB 4DW2U 3OU0A 4CHAC 1TMTH 3RXDA 3P8GA 2ULLA 3BTTE 4Z0KA 3QGJA 1G3CA 1FY4A 1KXDA 2ZU2A 1C2DA 3PLPA 1UO6A 2F9PA 1C1NA 3MOCA 3FZZA 1DWEH 2BLOA 1FPHH 5HM2A 2TPIZ 1H8DH 4X6PA 1KXAA 2F83A 2D26C 2NU1E 4BAKB 1DOJA 3P8FA 1TALA 1ESBA 5F8XA 2UUKB 1XXFA 1VGCB 3OY6U 1K1OA 1SQOA 1THRH 3LPRA 2ANMH 1O3IA 1YP9A 3MO9A 7GCHF 3RXLA 4BANB 1GMCG 5DP8A 1GBEA 2Z6BD 3HATH 4CH8B 1GDUA 1YKTA 1CT2E 1XM1A 1KIGH 1SHYA 3MWIU 4LK4A 4X6NA 5I25A 1UTNA 2ZTZA 4X1PU 1W14U 2PSXA 4XSKU 2J34A 1SGIB 1FQ3A 2OUAA 2XYAA 2VB0A 2AGGX 1LHGH 3QDZB 1ARBA 1SI5H 2GCTC 5AFZH 1MTWA 1TFXA 1XUIA 1C5WB 3PO1C 2ZGBH 3AAVA 2ILNA 3BTKE 3HKIB 1DT2A 2JH5D 1DLEA 2BB4A 4CRAA 1SGCA 3KQCA 3ZZAA 3A88A 1QRZA 3RXMA 1JRSA 3TPIZ 1QA0A 1LVBA 4I8GA 1MD8A 1D3TB 2UWLA 2XC0A 1T8NA 3MO6A 1FAKH 4ABBA 1AE8H 1NM6A 1Y3YA 4BAMB 3TLOA 3NK8A 5JBAS 1VJAU 1AO5A 1ELGA 1SGTA 3BEUA 3TJVA 2BD4A 4R8TB 1AWHB 4YM9A 4AX9H 2FP7B 3A89A 1SOTA 1J15A 2BD9A 1EATA 2EEKA 3TK9A 4YZUA 2Y80A 4K2YA 4JZDH 7GCHG 2F91A 3UNRA 4J1YA 1A7SA 1QR3E 2PUQH 4FVDA 1D6WA 3SUDA 1TPAE 3ENSB 1K21H 3SJOA 4Q2KA 1H9IE 2CHAC 1HJAB 3M5MA 1SQTA 5LPEA 7LPRA 1MBQA 2ZPSA 4I8JA 3RXBA 2W3KA 1MTSA 1WU1A 2XWBI 3NCLA 3VFEA 1O2RA 4JYVH 4O03A 1GHWH 3K2UA 1GHZA 1NRSH 5L2YH 2BY6X 1KTSB 2SGQE 4D7GA 2SGDE 1C9PA 2GCHF 2VWLA 1HAOH 2O8TA 3GY3A 1TNGA 1K1PA 4GLYA 3SJ8A 1ZPZA 4X2XA 1CHGA 2B8OH 2WYJA 2FTLE 2SGPE 5C5OA 2K1QA 1KYNA 2P3UB 1ELTA 1QJ1B 3RXAA 2Z3DA 1FN8A 2ZI2H 1CSOE 1HAHH 4B74A 3ZVCA 1SGYE 1CA0B 1B0FA 4IGDA 1VCPA 3DHKH 1IQNA 4YTAA 1DSUA 1GHBF 2AH4X 2O8MA 2G4TA 1AE5A 3BTFE 4TPYA 3KL6A 1B5GH 2H6MA 2B7DH 1HAPH 2G8TA 2GMTC 4AFQA 3AAUA 3MH7A 1TYNA 1NRQH 1GHYH 3TGJE 1C2FA 1GJ5H 1TQ0B 1N1LA 1TGNA 3RXIA 1MQ5A 1XUKA 5A2MH 1XUHA 1A46H 2FLBH 2UWPA 2QAAA 2AMQA 2BD7A 2ZFRH 1CBWC 4X2WA 4E7RG 5H4IB 4MTBA 4MNWA 3AW0A 1BIOA 1V2MT 4JZFH 5JYIA 3SW2B 1A0HB 2C4FH 1UK3A 2J94A 3VEQB 2GX4A 1NFUA 1S0QA 2SNWA 4AGKA 1O2IA 1LHFH 1O5BB 2XTTB 1KLTA 3LH1A 1P2KA 1ELEE 4FUFA 1RJXB 4LZ4B 2NU0E 3BN9A 1AUJA 1MBMA 1GHBG 3WY8A 1C1TA 3ZVAA 1PJPA 1D9IA 3S0NA 2ZGHA 1GBFA 3GY5A 4ISNA 4A7IB 1RRKA 1FY8E 1GJAB 5EOKA 3K6YA 2JETC 5JPMH 3W94A 2W3IA 1DS2E 2F9UA 2OQUA 3V7TA 2ANKH 1PQ5A 3L3TA 1BMMH 1WQSA 2AGIX 4B73A 4MG3A 1FPCH 1WTHD 4ZH8A 3RLWH 1IOEA 3S7HB 4X1RU 1DSTA 1UTKA 3TK5A 1O2JA 1DX5M 2ZCHP 3F9HA 1RD3B 2Y5FA 4LXBH 1RS0A 2Q6DA 1PYTC 2FLRH 4HI3A 3ZZ3A 2V3HH 3MU8A 3SNBA 1BOQA 1GG6B 1O2SA 4YOIA 1MCVA 3UQOA 3BG8A 5EW2H 3KGPA 1L1JA 2ZG0H 5BRRE 1PPBH 3MNSA 3ZVFA 2BXTH 5IYTA 3ZYEA 1GI1A 1WV7H 2ZHFH 1YLDA 2RA3A 1D6RA 4A1TA 1MTNB 1SGRE 4UFGH 4A6LA 1UVUH 2TGDA 4GUXA 2ZECA 4DCDA 1KXFA 5T3HA 5L6NH 1L4ZA 1RFNA 1QBVH 1LVMA 2W7SA 3PV4A 3RXCA 1P8VC 3EDXB 1V2TT 3TGIE 4RSPA 1C4V2 3F9EA 2SGFE 2Z3EA 1L1NA 1W3CA 3O8RA 2A32A 4CBOA 5DKMA 4JYTA 3UOUA 1Z8RA 4WH6A 4DG4A 1BITA 1P9UA 1WSSH 2BY8X 3MH5A 3RUOA 3STJA 3GOVB 4D76A 1GJDB 1S6FA 3MI4A 1DICA 2BOKA 6CHAB 2G5VA 2ZHDA 2CN0H 3TH2H 2PGQB 2FM2A 2OQ5A 3LH3A 3UNSA 1FAXA 3SGQE 3DD2H 4BAOB 4ABHA 4Y7BA 1MD7A 4UONA 1NRRH 2PWXA 3MTYA 4WXIA 3QLPH 1V2RT 1JWTA 3SO3A 4K1TA 1ZHMA 3TNTA 1BZXE 1C2HA 3VPKA 1IQGA 1UCYH 1LHDH 3EA8A 2VIWA 3B8JA 4IW4E 3ELAH 3QTOH 3SZNA 2XW9A 3FP8E 1YPEH 1TNIA 3SV7A 3STIA 5EXNA 1CA8B 4FU9A 1EAWA 2OXSA 1IQEA 1QY6A 3P8OA 2CMYA 2DE9A 2R3UA 1YCPK 1N8OB 1O2LA 4VGCB 2GD4B 3M3SA 1P02A 3VGCC 2WUCA 3EAJA 3UPEA 3P95A 1AKSA 1ABJH 4MPUA 4WWYA 1P9SA 4CR5A 1T8OA 1JIRA 1Z6JH 2G5NA 1MAYA 3BG4C 4OS4A 1ZTKA 3KQBA 1AFEH 5TCCA 1HAXB 1HAZB 2A1DB 3KIDU 3SOSA 4CHAB 1VZQH 3TGKE 2XBYA