2SGEE

Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgeE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgeE01
4JYUH 1ZJKA 3IWMA 1GBHA 1GGDC 2WPJS 1SLWB 4YOGA 1AFQB 4PROA 3F68H 3M3VA 2PUXB 4GCHF 1G2LA 1MD7A 2FPZA 1MKWK 3TK5A 2ODPA 1Y59T 2GCTB 3QX5H 3MH7A 4SGAE 3SW2B 1NO9H 4UD9H 3QGNB 1J17T 1O3DA 1K1PA 5LPRA 3UNSA 2Z3EA 2FMJA 4K3JA 4I8LA 2ODYB 3LPRA 2UWLA 2VNTA 2Z9IA 1J16A 3K65B 4DIIH 1E37B 2BLWA 1W8BH 3DA9B 5GWZA 3O8DA 1O3HA 3TPIZ 4E7NA 2W5EA 1PPCE 1DSTA 2IOTA 1F0RA 1YF4A 3K9XB 4XDEA 1HPGA 1PPFE 3A81A 2LPRA 1TGTA 2GKVE 3EAJA 6GCHF 1NC6A 3PMAB 4A1TA 2G52A 4D7FA 3QDZB 1QL8A 1QNJA 3SJIA 2AIQA 3GYLB 3NZIA 3S0NA 3LC5A 3D23A 3STIA 3VB6A 3SJKA 1J8AA 2J9NA 2Q1JA 3S9AA 5C2ZA 2V6NA 2JH5D 1Z8GA 1CO7E 2NU2E 3GDSA 3P8OA 2GZ7A 2C4FH 3S9BA 2IN2A 1MMJN 2ANMH 3RMOH 1QGFA 1P10A 2FTLE 5EU8A 2RA0A 4O3UA 3SGBE 1K21H 2PSYA 3FP8E 1ELCA 1K1NA 1GI4A 3UOPA 4J1YA 1MTVA 1HAGE 2TGTA 1QJ7B 3A88A 1HBTH 1TABE 3MI4A 3FP6E 3RC6A 1LQEA 3SJOA 4UONA 1GBMA 3ATIA 1T8NA 3ELAH 2ILNA 1KXCA 2FWWA 1WAYB 1O2SA 1W3CA 1F92A 1XUKA 1DY9A 2GV7A 2VVVA 3JZ1B 2F9OA 1D6WA 1A2CH 2OP9A 4I8JA 2WPIS 1FAKH 1JIRA 5IDKA 1BJUA 1C5UA 3RLYH 1NRNH 1UTJA 1EB2A 2FEQH 1OWHA 4MPXA 3UIRA 1VCWA 3FANA 1Q2WA 1NM6A 4WJG2 4B2AA 2ZG0H 4AFZA 1ZPZA 3F9EA 1Z1IA 1YBWA 3UY9A 4NZLA 1JRTA 1FY4A 4IMZA 1W14U 3PV4A 2GT8A 3UREA 4ZKNU 4LZ4B 3BTKE 1GBBA 4XBCA 2ZP0H 1NRSH 5C1XA 5JYIA 1GBCA 1GBTA 1CHGA 1ZMNA 2AEIH 4X8UH 3Q77A 2WYJA 5JBTA 5DP7A 1NROH 2ZZUH 3GDUA 2AFQB 2ZC9H 1O3KA 1LVOA 4X6PA 3JZ2B 1AUJA 2ZU5A 4ABFA 2BVSH 3E0NB 1TRMA 1BMLA 5C20A 3BG4B 5DP4A 2G4TA 2SGAA 3MU0A 1UTLM 3RXEA 5JBCS 3HPTB 3MH6A 1HB0B 3GY7A 3KQCA 3BSQA 2C8WB 3KQEA 4XSKU 1LHFH 3T25A 2PR3A 1BMNH 1MKXH 1J14A 1S84A 3A86A 1D3QB 3MU8A 2FI3E 3OYPA 2JH0D 1JOUB 1O3IA 4ZUHA 2O8TA 2ZFTA 4UFEH 1ZOMA 2ZTXA 7GCHF 1SLUB 1FIZA 2F9VA 4FUGA 3TJNA 5CHAC 1TA2A 2A2XH 4CRCA 1H8IH 1G3CA 2ALPA 2HVXA 5J4SA 3Q76A 2BD9A 1EAXA 1C1PA 1OS8A 1GHAF 2ZDAH 1NRQH 3VXFH 2AMDA 1BTZA 1AQ7A 1BHXF 3SNDA 1RD3B 1HAIH 3A80A 4VGCC 5E0GA 3SNEA 5AF9H 2Z9JA 3CS0A 1P2NA 1FDPA 1AHTH 1K22H 1GDNA 2NU0E 2BDYA 2PV9B 2Z6BD 4THNH 2A4RA 1W13U 6CHAB 3E91A 5ETXA 1KLIH 2SGPE 1OWJA 5FX5A 1DM4B 4YLUA 2H9TH 1EPTB 4LZ1H 5T6GA 3ZZ3A 1CHOG 5ESBA 1HJAC 2SGDE 6ESTA 4YO9A 2SNVA 3TU7H 1TB6H 3AW0A 2W3KA 3NCLA 3TITA 3SGQE 1LHEH 1EOJA 5F03A 2H9EH 1DOJA 1O5AB 2QN5T 2VWLA 5AVDA 1MBMA 1C5YB 1SPJA 1NZQH 4F4OC 1O2PA 1YCPM 5GCHG 2UWPA 5CE1A 2BD4A 1G37A 4TWWA 5EXMA 1PYTD 2A5AA 2VJ1A 4Y7BA 1UCYK 4FUBA 4Y6DA 2BD7A 1NT1A 1O2ZA 1P04A 2R2MB 3DD2H 1CQQA 1E35B 2VGCB 1YPHE 1GCTB 1AB9B 2RCEA 2BQ6B 1P9UA 3LDXH 1ANEA 5LGOA 2GMTB 1GI1A 1JWTA 3PO1B 1LVMA 4IC6A 2STAE 2FO9A 5T6FA 1GJCB 1O38A 4I33A 1MTWA 1SI5H 1TNGA 4KKDA 1EOLA 2G81E 4Q7YA 1O2WA 2M5TA 3LGUA 2Z9GA 1SVPA 1UTPA 3BTDE 3P17H 3RXVA 1P57B 4OGXA 1ANCA 1IQFA 1S0RA 4MNVA 1D3DB 1IHSH 1XXFA 2LNCA 4UDWH 1WQVH 1HAZB 1GBEA 1YLCA 1H4WA 3M5MA 3GCNA 3F9GA 4YOJA 3GY5A 1O0DH 2A7CA 2XW9A 3TJOA 1MH0A 2B9LA 1BCUH 5FPTA 2PLXA 1AIXH 5K7RA 3MO9A 1GMHF 5A2MH 5SGAE 2VWMA 1AWHB 4AZ2B 2Z3CA 2CHAC 2IPHA 4J2YB 1O5EH 2B8OH 4NGAH 1AZ8A 2AGIX 3R3GB 3UR6A 2DE8A 2V0BA 5K0HA 2R0LA 1GL0E 3A8DA 3RXTA 5EG4A 5HYOA 4DCDA 3QGJA 1TNHA 4KGAA 1C5NH 1IAUA 1FN8A 1P11E 1GWAA 1YPEH 1P2KA 3H5CB 5HM2A 9ESTA 1HIAA 4TY7A 3RLWH 1GHZA 3ITIA 3SV7A 3E90B 3PWBA 1ZRKA 4OS5A 1DLKB 2SFAA 1GPZA 3NKKA 1G36A 3A84A 1MZAA 1V2JT 3UTUH 1Z8JB 2GD4B 3E6PH 3GDVA 5AFYH 4JMYA 3R0FA 3W94A 2H2ZA 4ZHMU 3HKIB 1V2QT 2FXRA 3ZYDA 1VGCB 1DDJA 2GCHG 1HUTH 4ZROA 1RRKA 1O5FH 4BOHA 1W0ZU 1F2SE 1BRBE 2GV6A 1O2VA 1VJ9U 3TH3H 2PKSB 1SB1H 2GP9B 2JETB 1LPKB 1GCDA 1AVWA 3OY5U 1C5RA 4I31A 1S6HA 3ZVDA 1JRSA 1O2UA 1XKBC 2EA3A 1T32A 1N8OC 5HXFA 2UUKB 4NIXA 3RXDA 4XE4A 2Y82A 2YNAA 3MMGA 1MBQA 3F1SB 3TH4H 3AW1A 1QA7A 4INHA 3H7TA 2Z9LA 1ZSJA 2GZ9A 1QRXA 3MH4A 2ZKSA 1AE5A 3A87A 3FFGA 1O2KA 2A0QB 2FI4E 5GJ4B 1P3EA 2BMGB 3DFLA 3RXMA 1FPCH 2A5KA 1W7GH 4IBLH 2F9UA 1AN1E 1T8MA 1HIAB 1HAVA 2G8TA 4CHAB 1XVOA 2K1QA 2FTMA 3SU4A 3A82A 1GDQA 1C1WH 4TPIZ 3M7QA 3ESTA 1AY6H 2CMYA 4DGJA 2ZDKA 1ZTLA 7ESTE 1ZSKA 3P92A 1N1LA 1P3CA 4WWYA 3ZZ9A 1B0FA 4TY6A 1DS2E 4MNYA 2J92A 1C5OH 2WINI 1ACBE 1CVWH 4OS4A 1C1RA 3FVFB 3NWUA 3L33A 2GDEH 1GJ8B 1C4V2 1VCQA 1AWFH 3UR9A 1TQ0B 1Z8IB 3VXEH 3TJVA 3UNQA 1D9IA 1AFQC 1BRUP 1GJBB 1T8LA 2V3HH 3MH5A 4B2CA 1NFUA 1LPGB 3EA9A 1S81A 3RMNH 2QY0B 3OY6U 2Z94A 1UVUH 4HTCH 1SSXA 4O3TA 1HJ9A 2FOCA 4AB9A 1E38B 1CU1A 1HAVB 2FDAA 3TIUA 2GCTC 2H6MA 4WXVA 2ZCKP 2QAAA 1P0SH 1SGIB 3DUXH 1UJ1A 3HK6B 4ZKSU 4BAMB 1FPHH 3IG6B 5EW1H 3E0PB 3M5LA 1MQ5A 3MOCA 4WH8A 3P6ZB 2G51A 1XM1A 1HRTH 1SGEE 4IGDA 4NWLA 2R0KA 3V7TA 1IQGA 8GCHG 2BM2A 2PKAB 2WPHS 1O2YA 5I46H 1NFYA 5C67A 1O2RA 3LGTA 2A4GA 1TBQH 4HGCA 1OSSA 3GY2A 4BXWA 3SJ8A 4H4FA 1UVPA 2FLRH 1QBVH 1ELFA 3VGCC 2GTBA 3ZVFA 1MCVA 3T29A 1P2JA 3E8LA 4I7YH 4MLFB 4GCHG 1C1TA 4AORA 1O3AA 3LONA 1CT2E 1V2PT 1BIOA 3RXIA 1P2MA 1TOMH 1WUNH 1Z1JA 3D49H 1MUEB 4WXIA 1SLXB 3U1IB 1PJPA 2RG3A 1HAOH 2CXVA 1WV7H 3NUMA 1GVKB 1N6XA 1ZZZA 1UTNA 2ZCLP 5JB8S 1WCZA 3ZVGA 2FIRH 1GI5A 1V2RT 1P02A 2V3OH 3MO6A 3C1KA 1V6DA 3NPSA 2ZQ1A 2ZDVH 2FX4A 1TIOA 1SQOA 1UMAH 4Y7AA 4FUFA 1ZHMA 1PYTC 3SBKA 1ZSLA 1QB6A 1O2LA 1C5SA 2KAIB 1O3JA 3BTWE 1LTOA 2EI8A 1V2MT 6GCHG 1QBOA 2BY7X 1Q31A 1Z71A 3HKJB 4ZHAA 1V2KT 4OGYA 1WSSH 3LC3A 2F91A 3PROA 1Z7KA 4X8TH 1BA8B 2D2DA 2Y6TA 4AYYB 4ABEA 1GG6B 2ZFSA 3M7UA 1O36A 2JH6D 4INLA 3A7WA 1LDTT 1OWDA 1V3XA 2YOLA 2C8ZB 1EUFA 1OYQA 1M9UA 1EXFA 1VITF 1KSNA 1U6QA 4XOJA 1G32B 3RU4E 1QRWA 1QJ1B 4MG3A 4GLYA 1P09A 1BTUA 1SGFA 1SQTA 3GISB 3TK6A 1RTKA 4K5ZA 3KN2A 2HWLB 3CENA 3BG4C 2VB0A 4IMQA 2W7SA 5EPNA 4WF8A 2D26C 2TRMA 2P3FH 1O32A 2A4QA 1Y3UA 4Z6AH 1TGSZ 3GY8A 5A0CA 3RP2A 1RIWB 3N7OA 2VWNA 1RGQA 1ZMJA 3UQVA 2TGPZ 1CBWB 4UEHH 4CRFA 3BEFB 4DW2U 1P06A 1QR3E 2EI7A 1CT4E 3M35A 3K2UA 1S5SA 1CSOE 1KXFA 1TGNA 1AD8H 2P16A 1GMCF 4MTBA 1DXWA 4XBDA 1CGJE 1NS3A 4Y8ZA 1CGIE 1MKXK 2ZGCA 3S9CA 5JBBS 4FUJA 3QN7A 1FXYA 3E1XB 2ZEBA 1OYTH 1Y5UT 4NFFA 3PLBA 1Q3XA 2OXSA 4I32A 3RU4T 3ZZAA 5FAHA 1TX7A 1H9LB 1J15A 1INCA 2VIVA 1E36B 4HFPB 2ZHDA 3ATMA 4KELA 1AFEH 1TMBH 1GI0A 1THPB 6CHAC 1O39A 1ABIH 2XC5A 3P8FA 5FBEA 1BTPA 2H9HA 4X2XA 1UVSH 3A89A 5FPYA 1ESAA 1BRAA 1DWCH 3ZZ4A 1O3LA 2P3UB 3LOXA 2HPQH 1FAXA 1FMGA 2QF3A 1PPGE 1GJAB 2CF9H 2EC9H 2XBXA 3U1JB 1GDUA 1DANH 2OQUA 1MTSA 2OQ5A 1VCPA 3UWIA 4ISOA 2UUFB 1O2QA 4BTIB 1EAWA 1L1GA 4JZEH 3URCA 2XBWA 1Y5BT 5DGJA 2Y5HA 1QL9A 2WV4A 5L2YH 2OD3B 7GCHG 5EOKA 2VH6A 2GVFA 5DG6A 4X2YA 1Y3WA 5TJXA 3VB7A 2STBE 2VGCC 1GCTC 2ASUB 1AB9C 1L2EA 2PWXA 1GHAG 3GY3A 4MVNA 2GMTC 1TGBA 1TALA 1GL1A 3BF6H 3OU0A 9LPRA 1SL3A 1V2NT 2FX6A 3PO1C 4CRBA 5CMXH 1KIGH 4RKOB 3MNCA 2OCVB 2GZ8A 1ELTA 1ELVA 3B8JA 4X1QU 2CGAA 1D3TB 1O31A 3EE0B 1A46H 3A83A 1C1UH 1WU1A 4MQAA 3BG8A 3U98H 1GJ9B 1EPTA 1SHHB 2IJOB 4NG9H 4Y10E 1FN6A 1AMHA 1DWEH 1A0LA 1ETRH 2SNWA 3S7KB 3SUDA 1GMDF 2BDHA 2P95A 1GBAA 1SBWA 1ZGIA 3MTYA 1L4DA 5C1YA 1F5RA 1BMMH 2GDDA 1A3BH 2OBOA 8LPRA 1TX6A 4LXBH 2W3IA 5DP5A 3MNXA 4B74A 3IITA 4KP0A 1S85A 2ZGXH 4WH6A 1NU9A 3NXPA 1GBKA 3QTVH 4NSYA 3MO3A 2XNIA 3TNTA 3I77A 1TBZH 3EA8A 3L3TA 1OPHB 2FP7B 2ZECA 3E16B 4I8GA 1TPOA 2O8LA 5J4QA 4FVDA 1DX5M 3E3TA 2QC2A 3VEQB 4DVAU 1KXBA 1YPGH 3VB3A 1WYKA 4AFSA 2VIQA 1W0YH 1H9IE 3D62A 4Q7ZA 1ZHRA 2P93A 2TPIZ 2PFEA 2P3TB 1VR1H 2FS8A 2O8MA 2ULLA 4FUDA 1FY3A 2PKSC 4TYDA 3Q3YA 2FOFA 3KF2A 1WOFA 1G30B 2ANYA 2Q6FA 2BD8A 3SV2H 2FOMB 5DP3A 2VVUA 4Y8XA 3TGKE 2PGQB 1FLEE 1HCGA 1K28D 1T4VH 2Q6DA 3NK8A 4OS6A 3EDXB 5A8ZA 2A32A 4JZDH 1OWEA 2BLOA 1GBFA 1GMHG 1LMWB 1TAWA 3Q3KA 1CA8B 1TA6A 1TYNA 5JB9S 2ZTYA 3TK9A 1KXAA 5HGGA 1MQ6A 1OP0A 4UFFH 4AOQA 1C2GA 3BEUA 4FU7A 1TPSA 8ESTE 1C2IA 3MFJA 1S83A 1C1QA 4NWKA 4DY7B 2BDGA 2AH4X 4IS5A 1SOTA 5GDSH 3LKWA 4CHAC 2PUQH 2QXHA 3SV6A 3KCGH 4AGJA 2BY6X 1RTFB 5L30H 3BTQE 1CT0E 2AYWA 1C2KA 3D65E 3ZVEA 1IHTH 2O9QA 2ZPSA 4Q80A 1XUGA 4GVUA 1YP9A 4B75A 2BTCE 4Y79A 1DPOA 4ABGA 2BB4A 2BD5A 1V2OT 2Z9KA 2VWOA 1O3NA 2FLBH 2AMPA 4INKA 1GI6A 2HPPH 1ANBA 5FXLA 3T26A 5EQSA 4K2YA 2TGDA 2BVRH 3U69H 1KTTB 3AASA 3ATKA 4Y76A 4AG1A 4H6TA 4BAQB 1MZDA 5HMAA 2P94A 2Z3DA 2NWNA 1V2VT 3B23B 1C2EA 1UVTH 3U9AH 4MPVA 4NIVA 1OXGA 2WUBA 3A8AA 3PB1E 3SNCA 3ZVBA 1Z6JH 4K8BA 1YC0A 1HXEH 1K9OE 2H5CA 2Y7XA 3STJA 1B5GH 4JYVH 2ZU4A 3LJJA 2XBYA 2BVXH 2P59A 1AO5A 2XYAA 4LK4A 1DXPA 1ETSH 4AYVB 3GY6A 4CH2B 2VIOA 4JK6A 5A0AE 3GOVB 3F6UH 1QCPA 1QHRB 3SOSA 1NRRH 2WUCA 3EGKH 5BPEA 1T8OA 1FI8A 2A7HA 4YZUA 2XWBI 4NA7A 3P95A 3EYDA 2B7DH 3SI3H 1O3EA 1S6FA 2WYGA 5I25A 4K1TA 1S82A 4E05H 1A3EH 1HJAB 2ZDMA 3SQHE 2R2WU 2GGVB 2HLCA 3TJUA 3TLOA 2ZWLH 1EP6A 1BZXE 1KY9A 3K6YA 1HAPH 3KIDU 1C9TA 4E7RG 3TGIE 1PQ8A 4K60A 2C8YB 3MNSA 4X1PU 6LPRA 3ZZ6A 4U32A 3FZZA 3T5FH 3K6ZA 2THFB 1UTOA 1DLEA 5FX6A 1SGCA 2BZ6H 1CA0B 4CBNA 2FOHA 3A8CA 1SFIA 1LKBA 4WY3A 5E8EH 2ZQ2A 4Z0KA 1IQJA 2XC0A 5JDUB 4X2WA 4JYTA 1O35A 5A0BA 3KHVA 3PTNA 1YCPH 3BTME 2JKHA 2Y81A 2AS9A 3RXOA 1K1MA 2G5NA 3BIVH 4D7GA 4BAOB 1WTHD 2XC4A 1F0SA 1DUAA 1FIWA 1ZJDA 1Z6EA 3M36A 3A7XA 4MPWA 2Y5FA 4TPYA 3PLPA 1V2LT 1C2FA 1PPEE 3ZV9A 1B0EA 2VU8E 2A5IA 2ZFPH 1AUTC 1TNLA 1SGPE 1T31A 2PKAA 5DO4H 1ZYOA 4CR5A 3TNSA 5L6NH 2C90B 2Y5GA 3T27A 1PQAA 1X7AC 1O2JA 1ZGVA 1P01A 2ZHQH 1C5TA 1A61H 1YPKH 2EI6A 1F7ZA 1G3BA 4H6SB 1ARBA 3RXRA 1LVYA 3KQDA 2BHGA 3HGNA 3T62A 1O37A 3PMHB 1HFDA 2O8WA 1EJNA 3ZZBA 4Y71A 1TLDA 2TIOA 5EGMA 2HNTF 2RDLA 4CR9A 4B73A 2TBSA 4YM9A 2HOBA 4YOIA 1ELEE 2H5DA 2ZFQH 3F9FA 2GT7A 3BV9B 3KQBA 5EXNA 1GI3A 2ANKH 2D8WA 1GI2A 1WBGB 1V2UT 1C5MD 1K1IA 2QYIA 3LJOA 2OC0A 2YNBA 2CN0H 2ALVA 1TFXA 5B6OA 1HNEE 2ZF0H 1FV9A 2ZA5A 5FHTA 1NN6A 3QZRA 2UUJB 1HJ8A 2BY8X 1ZRBA 1IQHA 1VZQH 2O8UA 2ZU2A 4WMFA 4ABBA 1O5BB 1QFKH 1YKTA 3V3MA 4JZIA 1RIWC 3KGPA 1MU6B 4LOYH 1UK3A 1TOCB 1DWBH 2BX3A 4ZHLU 1AGJA 2FS9A 2KAIA 2J4IA 2A45B 3ZVAA 5DP8A 1MTNB 4WMEA 3SU2A 2F9PA 3DFJA 4ZXXH 4D9RA 4Y8YA 2CV3A 2PTCE 4DIHH 4O97A 1B7XB 1ZR0A 3TGJE 5C5OA 1BTWA 1GHYH 3SZNA 1ZPCA 1G3DA 1AU8A 1QJ6B 2OUAA 2A7JA 2ZGBH 5EW2H 3OTJE 1F5KU 2AGEX 3SNAA 1GVLA 1C1NA 1VITG 3FP7E 2BXUH 1EX3A 3QUMP 3VB4A 1C2HA 3UQOA 2WV5A 1RFNA 2HNTC 4YT6H 1G9IE 1P8VC 4NCYA 1GBJA 3LH1A 1ETTH 1SG8B 1KTSB 1LQDB 4NA9H 1XUJA 4I8KA 3SGAE 1C2DA 3GCOA 3T2NA 2PW8H 1FY8E 1C5PA 3A7VA 4ZH8A 1GHVH 4ZKOU 3A85A 1OX1A 3RXJA 1A5IA 5GIBA 3LGWA 2ZI2H 2ANWA 4M7GA 2PTNA 2DE9A 3RC4A 3GCHB 1C1VH 4GHTA 4SGBE 4U30A 3P8NA 5JBAS 1EJAA 2XRCA 3BTTE 3SU3A 1UK2A 3O8BA 1EZUC 4DT7B 1BUIA 4ZMAH 5E0JA 3MNBA 1TNKA 5E2OA 4ZKRU 1GMCG 1QIXB 1ABJH 1OOKB 2A4OA 2ZNKH 5EODA 5PTPA 3UFAA 3QLPH 3PYHA 3O8RA 1DT2A 5ESTE 5BRRE 2GX4A 2NU3E 2R3YA 3M5NA 1DWDH 5TCAA 1IOEA 2P8OB 4CH8B 1VITH 5FPSA 1WQSA 1BDAA 1P2IA 2W7UA 1SGTA 2VIPA 1E0FD 1K1JA 2EEKA 1DY8A 1E34B 2DUCA 2HRVA 1XUHA 1YPMH 1SOZA 2BQWB 2V35A 4FUHA 4NIYA 1EB1H 1TWXB 2OLGA 5C1UA 3AAUA 1N6YA 1ZLRA 1TMUH 5F8ZA 3Q00A 4D9QA 3V0XA 3PMBB 1O2NA 1FONA 3QK1A 1TX8A 2OC1A 1ORFA 1V2ST 3ODFA 2QXIA 3HK3B 1ESBA 3A7YA 3AAVA 4X6MA 1AKSA 3C27B 4GAWA 5GPIB 3O8CA 4MNWA 5ABWA 1O3FA 1EASA 4KTCA 1SGDE 1TQ7B 4BANB 3U8TH 2ZFRH 4ABJA 3URDA 2OC7A 1TRNA 2QF0A 1A0JA 1O5GH 1O2IA 3QWCH 1ZHPA 1FJSA 2WPMS 1HAYB 1PQ7A 1TPAE 2BD3A 4Q2KA 3MWIU 4NSVA 2HGTH 2WPLS 1JMOH 3ZZ8A 1C5XB 2G5VA 1O3CA 1HLTH 1Y3YA 5LH8A 4K1SA 2Z7FE 5H4IB 4R0IA 1AVGH 4FU9A 3RXGA 4B76A 4R8TB 4DJZB 2G4UA 4YESB 2UUYA 3VGCB 2F9BH 1UTQA 2B5TB 4Y0YE 4ZAEA 3BIUH 4X8VH 4E06H 4UE7H 2Q6GA 2FOEA 3ZYEA 4JZ1A 4AX9H 2BD2A 2OBQA 3SHCH 4ABHA 1EP5A 1BBRH 4BNRA 3OX7U 5L2ZH 1UVOA 3SO3A 2BOHB 1L1JA 3PMJA 1OP2A 1EPTC 5E0HA 5EPYA 4CBOA 4X1SU 1D3PB 4IC5A 1AKSB 5EQRA 4BTUB 5AHGH 4K8YA 1PPZA 5EQQA 3RUOA 3SN8A 1ESTA 1XMNB 3RXLA 1O2HA 5E2PA 3SJ9A 1TNJA 2ZIQH 3U8OH 1KLTA 5DKMA 2BLVA 1GMDG 2BQ7B 2J94A 1TGCA 5A8YA 1ZPBA 1K2I1 2C93B 3S69A 3PLKA 4DOQA 1BBRE 1C5VA 2BYAX 3QO6A 3SHAH 1LPZB 1MKWH 3U8RH 1IQEA 2A2QH 2VIWA 3FAOA 2UWOA 3BTGE 4HI3A 1GJ7B 2CJIA 4AFUA 1O3PB 3AVZA 4NIWA 4JZFH 2BDIA 3RXSA 3P70B 1EZQA 1C4U2 1GGDB 1P2OA 1LHCH 1DFPA 1G3EA 1BOQA 1MCTA 1K1LA 1O3BA 2PSXA 1ANDA 1IQIA 2ZU3A 2C3SA 4AB8A 2QXGA 3SUEA 1C2LA 1P2QA 4RKJB 1QY6A 2ZO3H 4JCNA 5DP6A 5FCKA 1GI8B 1ID5H 1JBUH 1OWIA 1ELBA 3M61U 1C5QA 4FXGH 3LGVA 3RXPA 3W95A 7LPRA 1C1MA 1AE8H 1KXEA 1TPPA 4UFDH 1SHYA 1UO6A 1SMFE 2D1JA 3SUGA 4A6LA 5A09A 1H1BA 1HGTH 2PHBA 4HZHA 3SORA 1ZMLA 1ELGA 1LKAA 1L0ZA 5T6DA 4XBBA 3A7ZA 3BTFE 1QTFA 3PTBA 2ZPRA 4GUXA 1YPJH 1T7CA 1YM0A 1L4ZA 2SGEE 3M7TA 1NU7B 1GJ4H 2XXLA 3RXHA 2QA9E 1KYNA 3QZQA 2BLQA 2VINA 3QTOH 2ZFFH 2QCYA 1QURH 3SNBA 2ZHFH 3B9FH 1GI9B 1K1OA 1UTKA 4MNXA 3HGPA 4A5TS 4QT8C 4X1NU 4B71A 4O03A 4MDSA 1A1RA 3V12A 1QRZA 4CRGA 2R3UA 1O5DH 2ZGHA 2FM2A 5F8TA 4U2WA 8KME2 1RXPA 3BEIB 1QL7A 4ASHA 1HDTH 1V2TT 4OS7A 2I6QA 1YLDA 1VGCC 1NRPH 3ODDA 1DE7H 4BXSA 4NFEA 4AFQA 4OS2A 1GHBG 2B0FA 2F3CE 1O2GH 4AGKA 1UHBA 1O3OA 4FUCA 2JETC 3H7OA 3LGYA 1W12U 2J95A 3BTHE 3SQEE 3WY8A 4BTTB 1XX9A 3FZDA 2OINA 5TCCA 2NU1E 4FU8A 4K69A 1BTHH 4YLQH 3SV9A 3SV8A 4A92A 2ZGJA 2ZU1A 3LIWA 5LPEA 2FESH 1F5LA 3VB5A 2J34A 2BX4A 3MYWA 1FZZA 2ESTE 1NY22 1O2TA 1FY1A 2AIPA 4ISNA 3I29A 1O33A 3RXAA 4ABDA 4CRAA 2F83A 4GSOA 1FNIA 1O2MA 3EQ0H 3VFEA 1MAYA 1NFWA 1CA0C 4NA8A 3BN9A 1GJ5H 3RXBA 1A5HA 1BT7A 2CF8H 4D76A 1C9PA 1P05A 1BJVA 3MU4A 4X2VA 4X1RU 3ZZDA 4I8HA 1THRH 1ELAA 1GJDB 2ZTZA 3DT0H 5DK1A 3UOUA 4D8NA 1EQ9A 1HAXB 1GHBF 2SGFE 2AGGX 4IN2A 4X6NA 1G2MA 1UHBB 3GCTG 3KNXA 4AG2A 4WMDA 1MTUA 4Y11E 1NFXA 2Y80A 1HXFH 2BXTH 1IQKA 1YCPK 4F49A 1SFQB 1CHOF 3G01A 5LPFA 1Y3VA 3BTEE 2H1UA 1KDQA 1T4UH 5F6MA 1LCYA 2FYRA 1ZTKA 2NU4E 4FUIA 2SGQE 1YGCH 2F9NA 3RM0H 3LU9B 5GCHF 4A7IB 1EATA 1OWKA 1YPHC 1BMAA 3F9HA 1H8DH 5IYTA 4ISLA 2VIDA 5T3HA 3RXKA 3ZZCA 4X0WU 1D4PB 1O2XA 4BAKB 1HV7A 4UFGH 2XWAA 1A5GH 3CP7A 5CHAB 5JPMH 4CRDA 3LT3A 7KMEH 1TMTH 3SU5A 4O9VA 4OS1A 3UWJH 1C5LH 1GBLA 1SGRE 4GHQA 1Y5AT 2FYQA 3SU6A 1C2JA 1AZZA 4VGCB 4RSPA 3RU4D 1XVMA 3RC5A 1QQ4A 3OSYA 2TGAA 2VH0A 4ABIA 4Q7XA 3GCTF 2A31A 4XFQA 1UK4A 3TH2H 1RTLA 1Y8TA 4ABAA 1O30A 3ZV8A 2C8XB 1FY5A 3L6PA 4BAHB 1BITA 1UCYH 1MU8B 1KDQB 5EXLA 1QBNA 1GVZA 1SGQE 1MTNC 1DICA 3P8GA 1GI7B 3GYMA 1C5ZB 1L1NA 1SGNE 2WPKS 3ATLA 1LHDH 1TRYA 5C3NA 4H42U 3ATWA 3M37A 1KXDA 2XCNA 3SUFA 2XTTB 1DITH 1EZSC 1EAUA 2QV1A 2ZDLA 1FQ3A 1WTGH 3RXCA 3M3TA 1SGFG 4DURA 2AERH 1A4WH 2A1DB 2BY5X 4Y0ZE 3T28A 1SC8U 5DP9A 1UCYE 4FVBA 3LH3A 2QXJA 4NZQA 4WVPE 3VPKA 2OTVA 2BDAA 1THSH 3ZVCA 5AFZH 3LGIA 3M3SA 2FODA 1MD8A 1F0TA 3PM3A 1HYLA 1LVBA 1SR5C 2BY9X 4B2BA 1O3GA 4ISHH 5A8XA 1P9SA 1OKXA 1ZTJA 1BHXB 2BDCA 2XCFA 3MHWU 2J2UA 1NESE 1EAIA 3SU1A 3HATH 4KTSA 3GCHC 2GCHF 4TWYA 1TE0A 1DVAH 5C5NA 2ZCHP 3GY4A 1QB9A 3TVJB 1TNIA 1DUEA 4ZXYH 1GG6C 2BDBA 4GPGA 3RM2H 1GBIA 1S0QA 3UPEA 2PGBB 1O5CB 2P8OC 2FI5E 1EKBB 1C4Y2 1SQAA 1ELDE 3UUZA 3GICB 2RA3A 4U01A 3ZZ7A 3KEEA 3ZZ5A 1C1OA 2R9PA 2CHAB 1IQLA 1RJXB 1V2WT 3MU5A 1BTYA 3M5OA 2OC8A 4X8SH 1GHWH 2HALA 1GJ6A 1EJMA 3S7HB 1LHGH 1NPMA 4YTAA 5G4BA 1BTXA 1YPLH 2ODQA 1BRCE 1O2OA 1W11U 1J9CH 1A0HB 3RXQA 4AN7A 1SLVB 1JIMA 1QB1A 1PPBH 2HNTE 2BOKA 1ARCA 1OP8A 1VJAU 2ZPQA 3A8BA 4IN1A 5HM9A 1KLJH 1O3MA 1XXDA 1MAXA 1Z8RA 4X6OA 1TONA 1JXPA 3UNRA 3RDZA 1CBWC 4IW4E 1P12E 3ENSB 1PFXC 1GBDA 3KL6A 2ZHEH 1DSUA 2VVCA 1XKAC 1XUIA 1PQ5A 1QQUA 1AI8H 4K1EA 2W26A 2ZDNA 1BB0B 4ESTE 2ZHWH 5DJ7A 3V13A 4B1TA 1UTMA 2QGRA 1N8OB 4JK5A 4A1VA 1W7XH 4YT7H 4RN6A 1F0UA 1BQYA 3EA7A 4DG4A 1YYY1 3RMLH 1XUFA 4A1XA 3SI4H 1C2MA 1Y3XA 1NTPA 3MU1A 3A7TA 1FUJA 5F8XA 3RMMH 4CREA 2Y7ZA 4FUEA 1TBRH 1RS0A 2BZAA 3RXUA 3RXFA 3I78A 2FZZA 4MPUA 1IQNA 1CE5A 2QIQA 1QA0A 1O34A 1H9HE 2FOBA 1GHXH 2J38A 1W10U 1EZXC 1SGYE 1A7SA 1D6RA 1BBRK 2G00A 2XBVA 1C5WB 3DHKH 5FCRA 2AMQA 2FOGA 3PWCA 3Q3XA 3CS7A 5FBIA 4KTUA 5GXPA 2FOAA 8GCHF 2G55A 1IQMA 1P03A 2I6SA 1AVXA 5DPAA 3SU0A 4ISIH 1LO6A 1CGHA 1HAHH 1C1SA 1PPHE 1W2KH
chains in the Genus database with same CATH superfamily
4JYUH 1ZJKA 3IWMA 1GBHA 1GGDC 2WPJS 1SLWB 4YOGA 1AFQB 4PROA 2JJ2D 3F68H 3M3VA 2PUXB 4GCHF 1G2LA 1MD7A 2FPZA 1MKWK 3TK5A 2ODPA 1Y59T 2GCTB 3QX5H 3MH7A 4SGAE 3SW2B 1NO9H 4UD9H 3QGNB 1J17T 1O3DA 1K1PA 5LPRA 3UNSA 2Z3EA 2FMJA 4K3JA 4I8LA 2ODYB 3LPRA 2UWLA 2VNTA 2Z9IA 1J16A 3K65B 4DIIH 1E37B 2BLWA 1W8BH 3DA9B 5GWZA 3OEHD 3O8DA 1O3HA 3TPIZ 4E7NA 2KCYA 2W5EA 1PPCE 1DSTA 2IOTA 1F0RA 1YF4A 3K9XB 4XDEA 1HPGA 1PPFE 3A81A 2LPRA 1TGTA 2GKVE 3EAJA 6GCHF 1NC6A 3PMAB 4A1TA 2G52A 4D7FA 3QDZB 1QL8A 1QNJA 3SJIA 2AIQA 3GYLB 3NZIA 3S0NA 3LC5A 3D23A 3STIA 3VB6A 3SJKA 1J8AA 2J9NA 2Q1JA 3S9AA 5C2ZA 2V6NA 2JH5D 1Z8GA 1CO7E 2NU2E 3GDSA 3P8OA 2GZ7A 2C4FH 3S9BA 2IN2A 1MMJN 2ANMH 3RMOH 1QGFA 1P10A 2FTLE 5EU8A 2RA0A 4O3UA 3SGBE 1K21H 2PSYA 5EIYA 3FP8E 1ELCA 5KECA 1K1NA 1GI4A 3UOPA 4J1YA 1MTVA 1HAGE 2TGTA 1QJ7B 4P00A 3A88A 1HBTH 1TABE 3MI4A 3FP6E 3RC6A 1LQEA 3SJOA 4UONA 1GBMA 3ATIA 1T8NA 3ELAH 2J97A 2ILNA 1KXCA 2FWWA 1WAYB 4YXWD 2V3MA 1O2SA 1W3CA 1F92A 1XUKA 1DY9A 2GV7A 2VVVA 3JZ1B 2F9OA 1D6WA 1A2CH 2OP9A 4I8JA 2WPIS 1FAKH 1JIRA 5IDKA 1BJUA 1C5UA 3SZEA 3RLYH 1NRNH 1UTJA 1EB2A 2FEQH 1OWHA 4MPXA 2J5UA 3UIRA 1VCWA 3FANA 1Q2WA 1NM6A 4WJG2 4B2AA 2ZG0H 4AFZA 1ZPZA 3F9EA 1Z1IA 1YBWA 3UY9A 4NZLA 1JRTA 1FY4A 4IMZA 1W14U 3PV4A 2GT8A 3UREA 4ZKNU 4LZ4B 3BTKE 1GBBA 4XBCA 2ZP0H 1NRSH 5C1XA 5JYIA 1GBCA 1GBTA 1CHGA 1ZMNA 2AEIH 4X8UH 3Q77A 2WYJA 5JBTA 3MQKC 5DP7A 1NROH 2ZZUH 3GDUA 2AFQB 2ZC9H 1O3KA 1LVOA 4X6PA 3JZ2B 1AUJA 2ZU5A 4ABFA 2BVSH 3E0NB 1TRMA 5T1VA 5F53A 1BMLA 5C20A 3BG4B 5DP4A 2G4TA 2SGAA 3MU0A 1UTLM 3RXEA 5JBCS 3HPTB 3MH6A 1HB0B 3GY7A 3KQCA 3BSQA 5EJZA 2C8WB 3KQEA 4XSKU 1LHFH 3T25A 2PR3A 1BMNH 2W6ID 1MKXH 1J14A 1S84A 3A86A 1D3QB 3MU8A 2FI3E 3OYPA 2JH0D 1JOUB 1O3IA 4ZUHA 2O8TA 2ZFTA 4UFEH 1ZOMA 2ZTXA 7GCHF 1SLUB 1FIZA 2F9VA 4FUGA 3TJNA 5CHAC 1TA2A 2A2XH 4CRCA 1H8IH 1G3CA 2ALPA 2HVXA 5J4SA 3Q76A 2BD9A 1EAXA 1C1PA 1OS8A 1GHAF 2ZDAH 1NRQH 3VXFH 5HKKD 2AMDA 1BTZA 1AQ7A 1BHXF 3SNDA 1RD3B 1HAIH 3A80A 4VGCC 5E0GA 3SNEA 5AF9H 2QF4A 2Z9JA 3CS0A 1P2NA 1FDPA 1AHTH 1K22H 1GDNA 2NU0E 2BDYA 2PV9B 2Z6BD 4THNH 2A4RA 1W13U 6CHAB 3E91A 5ETXA 1KLIH 2SGPE 1OWJA 5FX5A 1DM4B 1NBME 4YLUA 2H9TH 1EPTB 4LZ1H 5T6GA 3ZZ3A 1CHOG 5ESBA 1HJAC 2SGDE 6ESTA 4YO9A 2SNVA 3TU7H 1TB6H 3AW0A 2W3KA 3NCLA 3TITA 3SGQE 1LHEH 1EOJA 5F03A 2H9EH 1DOJA 1O5AB 2QN5T 2VWLA 5AVDA 1MBMA 1C5YB 1SPJA 1NZQH 4F4OC 1O2PA 1YCPM 5GCHG 2UWPA 5CE1A 2V7QD 2BD4A 1G37A 4TWWA 5EXMA 1PYTD 2A5AA 2VJ1A 4Y7BA 1UCYK 4FUBA 4Y6DA 2BD7A 1NT1A 1O2ZA 1P04A 3OFND 4TSFD 2R2MB 3DD2H 1CQQA 1E35B 2VGCB 1YPHE 1GCTB 1AB9B 2RCEA 2BQ6B 1P9UA 3LDXH 1ANEA 5LGOA 2GMTB 1GI1A 1JWTA 3PO1B 1LVMA 4IC6A 2STAE 2FO9A 5T6FA 1GJCB 1O38A 4I33A 1MTWA 5EJ1A 1SI5H 1TNGA 4KKDA 1EOLA 2G81E 4Q7YA 1O2WA 2M5TA 3LGUA 2Z9GA 1SVPA 1UTPA 3BTDE 3P17H 3RXVA 1P57B 4OGXA 1ANCA 1IQFA 1S0RA 4MNVA 1D3DB 1IHSH 3F0PA 1XXFA 2LNCA 4UDWH 1WQVH 1HAZB 2EY4C 1GBEA 1YLCA 1H4WA 3M5MA 3GCNA 3F9GA 4YOJA 3GY5A 1O0DH 2A7CA 2XW9A 3TJOA 1MH0A 2B9LA 1BCUH 5FPTA 2PLXA 1AIXH 5K7RA 3MO9A 1GMHF 5A2MH 5SGAE 2VWMA 1AWHB 4AZ2B 2Z3CA 2CHAC 2IPHA 4J2YB 1O5EH 2B8OH 4NGAH 1AZ8A 2AGIX 3R3GB 3UR6A 2WZQA 2DE8A 2V0BA 5K0HA 2R0LA 1GL0E 3A8DA 3RXTA 5EG4A 5HYOA 4DCDA 3QGJA 1TNHA 4KGAA 1C5NH 1IAUA 1FN8A 1P11E 1GWAA 1YPEH 1P2KA 3H5CB 5HM2A 9ESTA 1HIAA 4TY7A 3RLWH 1GHZA 3ITIA 3SV7A 3E90B 3PWBA 1ZRKA 4OS5A 1DLKB 2SFAA 1GPZA 3NKKA 1G36A 3A84A 1MZAA 1V2JT 3UTUH 1Z8JB 2GD4B 3E6PH 3GDVA 5AFYH 4JMYA 3R0FA 3W94A 2H2ZA 4ZHMU 3HKIB 1V2QT 2FXRA 3ZYDA 1VGCB 1DDJA 2GCHG 1HUTH 4ZROA 1RRKA 1O5FH 4BOHA 1W0ZU 1F2SE 1BRBE 2GV6A 1O2VA 1VJ9U 3TH3H 2PKSB 1SB1H 2GP9B 2JETB 4FOUC 1LPKB 1GCDA 1AVWA 3OY5U 1WXRA 1C5RA 4I31A 1S6HA 3ZVDA 1JRSA 1O2UA 1XKBC 2EA3A 1T32A 1N8OC 5HXFA 2UUKB 4NIXA 3RXDA 4XE4A 2Y82A 2YNAA 3MMGA 1MBQA 3F1SB 3TH4H 3AW1A 1QA7A 4INHA 3H7TA 4DT4A 2YMSB 2Z9LA 1ZSJA 2GZ9A 1QRXA 3MH4A 2ZKSA 1AE5A 3A87A 3FFGA 1O2KA 2A0QB 2FI4E 5GJ4B 1P3EA 2RFKC 3KYGA 2BMGB 3DFLA 3RXMA 4Q63A 1FPCH 2A5KA 1W7GH 4IBLH 2F9UA 3DSPA 1AN1E 1T8MA 2WPDD 1HIAB 1HAVA 2G8TA 4CHAB 1XVOA 2K1QA 2FTMA 3SU4A 3A82A 1GDQA 1C1WH 4TPIZ 3M7QA 3ESTA 1AY6H 2CMYA 4DGJA 2ZDKA 1ZTLA 7ESTE 1ZSKA 3P92A 1N1LA 1P3CA 1SQRA 4WWYA 3ZZ9A 1B0FA 4TY6A 1DS2E 4MNYA 2J92A 1C5OH 2WINI 1ACBE 1CVWH 1QZ8A 1C1RA 3FVFB 4OS4A 3F3BA 3NWUA 3L33A 2GDEH 1GJ8B 1C4V2 1VCQA 2KR7A 1AWFH 3UR9A 1TQ0B 1Z8IB 3VXEH 3TJVA 3UNQA 3N7DA 1D9IA 1AFQC 1BRUP 1GJBB 1T8LA 2V3HH 3MH5A 4B2CA 1NFUA 1LPGB 3EA9A 1S81A 3RMNH 2QY0B 3OY6U 2Z94A 1UVUH 4HTCH 1SSXA 1WDIA 4O3TA 1HJ9A 2FOCA 4AB9A 1E38B 1CU1A 1HAVB 2FDAA 3TIUA 2GCTC 2H6MA 4WXVA 2ZCKP 2QAAA 1P0SH 1SGIB 3DUXH 1UJ1A 3HK6B 4ZKSU 4BAMB 1FPHH 3IG6B 5EW1H 1KMHB 3E0PB 3M5LA 1MQ5A 3MOCA 4WH8A 3P6ZB 2G51A 1XM1A 1HRTH 1SGEE 4IGDA 4NWLA 2R0KA 3V7TA 1IQGA 8GCHG 2BM2A 2PKAB 2WPHS 1O2YA 5I46H 1NFYA 3OAAD 5C67A 1O2RA 3LGTA 2A4GA 1TBQH 5DSFA 2KCPA 1OSSA 4HGCA 3GY2A 3U28C 4BXWA 3SJ8A 4H4FA 1UVPA 2FLRH 1QBVH 1ELFA 3VGCC 2GTBA 3ZVFA 1MCVA 3T29A 1P2JA 3E8LA 4I7YH 4MLFB 4GCHG 1C1TA 4AORA 1O3AA 3LONA 1CT2E 1V2PT 1BIOA 2YMSD 3RXIA 1P2MA 1TOMH 1WUNH 1Z1JA 3D49H 1MUEB 4WXIA 1SLXB 3U1IB 1PJPA 2RG3A 3WWBA 1HAOH 2CXVA 1WV7H 3NUMA 1GVKB 1N6XA 1ZZZA 1UTNA 2ZCLP 5JB8S 1WCZA 3ZVGA 2FIRH 1GI5A 1V2RT 1P02A 2V3OH 3MO6A 3C1KA 1V6DA 3NPSA 2ZQ1A 2ZDVH 2FX4A 1TIOA 1SQOA 1UMAH 4Y7AA 4FUFA 1ZHMA 4B6EA 1PYTC 3SBKA 1ZSLA 1QB6A 4F55A 1O2LA 1C5SA 2KAIB 1O3JA 3BTWE 1LTOA 2EI8A 1V2MT 6GCHG 1QBOA 2BY7X 1Q31A 1Z71A 3HKJB 4ZHAA 1V2KT 4OGYA 1WSSH 3LC3A 2F91A 3PROA 1Z7KA 4X8TH 1BA8B 2D2DA 4ACBA 2Y6TA 4AYYB 4ABEA 1GG6B 2ZFSA 3M7UA 1O36A 2JH6D 4INLA 3A7WA 1LDTT 1OWDA 1V3XA 2YOLA 2C8ZB 1EUFA 1OYQA 3AK5A 1M9UA 1EXFA 1VITF 1KSNA 1U6QA 4XOJA 1G32B 3RU4E 1QRWA 1QJ1B 4MG3A 4GLYA 1P09A 1BTUA 1SGFA 2WSSD 1SQTA 1FX0B 3GISB 3TK6A 1RTKA 4K5ZA 3KN2A 2HWLB 3CENA 3BG4C 2VB0A 4IMQA 2W7SA 3FKSD 5EPNA 4WF8A 2D26C 2TRMA 2P3FH 1O32A 2A4QA 1Y3UA 4Z6AH 1TGSZ 2F4LA 3GY8A 5A0CA 3RP2A 1RIWB 3N7OA 2VWNA 1RGQA 1ZMJA 3UQVA 2KCAA 2TGPZ 1CBWB 4UEHH 4CRFA 3BEFB 4DW2U 5C94A 1P06A 1QR3E 2EI7A 1CT4E 3M35A 2XNDD 3K2UA 1S5SA 1VKYA 1CSOE 1KXFA 1TGNA 1AD8H 2J98A 1GMCF 2P16A 4MTBA 1DXWA 4XBDA 1CGJE 1NS3A 4Y8ZA 1CGIE 1MKXK 2HLDD 2ZGCA 3S9CA 5JBBS 4FUJA 1SKYE 3QN7A 1FXYA 3E1XB 2ZEBA 1OYTH 1Y5UT 4NFFA 3PLBA 1Q3XA 2OXSA 4I32A 2W6JD 3RU4T 3ZZAA 5FAHA 1TX7A 1H9LB 1J15A 1INCA 2VIVA 1E36B 4HFPB 3NRLA 2ZHDA 3ATMA 4KELA 1AFEH 1TMBH 1GI0A 1THPB 6CHAC 1O39A 1ABIH 2XC5A 3P8FA 5FBEA 1BTPA 2H9HA 4X2XA 1UVSH 3A89A 3UAIC 5FPYA 1ESAA 1BRAA 1DWCH 3ZZ4A 1O3LA 2P3UB 3LOXA 2HPQH 1FAXA 1FMGA 2QF3A 1PPGE 1GJAB 2CF9H 2EC9H 2XBXA 3U1JB 1GDUA 2F43B 1DANH 2OQUA 1MTSA 2OQ5A 1VCPA 3UWIA 4ISOA 2UUFB 1O2QA 4BTIB 1EAWA 1L1GA 4JZEH 3URCA 2XBWA 2J98B 1Y5BT 2EQNA 5DGJA 2Y5HA 1QL9A 2WV4A 5L2YH 2OD3B 7GCHG 5EOKA 2VH6A 2GVFA 5DG6A 4X2YA 1Y3WA 5TJXA 3VB7A 2STBE 2VGCC 5FL7D 1GCTC 2PP6A 2ASUB 1AB9C 1L2EA 2PWXA 1GHAG 3GY3A 4MVNA 2GMTC 1TGBA 1TALA 1GL1A 3BF6H 3OU0A 9LPRA 1SL3A 1V2NT 2FX6A 3PO1C 4CRBA 2GJGA 5CMXH 1KIGH 4RKOB 3MNCA 2OCVB 2GZ8A 1ELTA 1ELVA 3B8JA 4X1QU 2CGAA 1D3TB 1O31A 3EE0B 1A46H 3A83A 1C1UH 1WU1A 4MQAA 3BG8A 3U98H 1GJ9B 1EPTA 1SHHB 2IJOB 4NG9H 4Y10E 1FN6A 1AMHA 1DWEH 1A0LA 1ETRH 2WHXA 3OEED 2SNWA 3S7KB 3SUDA 1GMDF 2BDHA 2P95A 1GBAA 1SBWA 1ZGIA 3MTYA 1L4DA 5C1YA 1F5RA 1BMMH 2GDDA 1A3BH 2OBOA 8LPRA 1TX6A 4LXBH 2W3IA 5DP5A 3MNXA 4B74A 3IITA 4KP0A 1S85A 2ZGXH 4WH6A 1NU9A 3NXPA 1GBKA 3QTVH 4NSYA 3MO3A 2XNIA 3TNTA 3I77A 1TBZH 3EA8A 3EE7A 1OPHB 2FP7B 2ZECA 3E16B 3L3TA 4I8GA 1TPOA 2O8LA 5J4QA 4FVDA 1DX5M 3E3TA 2QC2A 3VEQB 4DVAU 1KXBA 1YPGH 3VB3A 1WYKA 4AFSA 2VIQA 1W0YH 1H9IE 3D62A 4Q7ZA 1ZHRA 2P93A 2TPIZ 2PFEA 2P3TB 1VR1H 2FS8A 2O8MA 2ULLA 4FUDA 1FY3A 2PKSC 4TYDA 3Q3YA 2FOFA 3KF2A 1WOFA 1G30B 2ANYA 2Q6FA 2BD8A 3SV2H 2FOMB 5DP3A 2VVUA 4Y8XA 3TGKE 1FLEE 1HCGA 1K28D 1T4VH 2PGQB 2Q6DA 3NK8A 4OS6A 3EDXB 5A8ZA 2A32A 4JZDH 1OWEA 2BLOA 1GBFA 1GMHG 1LMWB 1TAWA 2KX4A 3Q3KA 1CA8B 1TA6A 1TYNA 5JB9S 2ZTYA 3TK9A 1KXAA 5HGGA 1MQ6A 1OP0A 2YMSC 4UFFH 4AOQA 1C2GA 4XRNA 3BEUA 4FU7A 1TPSA 8ESTE 1C2IA 3MFJA 1S83A 1C1QA 4NWKA 4DY7B 2BDGA 2AH4X 4IS5A 1SOTA 5GDSH 3LKWA 4CHAC 2PUQH 2QXHA 3SV6A 3KCGH 4AGJA 2BY6X 1RTFB 5L30H 3BTQE 1CT0E 2AYWA 1C2KA 3D65E 3ZVEA 1IHTH 2O9QA 2ZPSA 4Q80A 1XUGA 4GVUA 1YP9A 4B75A 2BTCE 4Y79A 1DPOA 4ABGA 2BB4A 2BD5A 1V2OT 2Z9KA 2VWOA 1O3NA 2FLBH 2AMPA 4INKA 1GI6A 2HPPH 1ANBA 5FXLA 5HIYA 3T26A 5EQSA 3UB0A 4K2YA 2TGDA 2BVRH 2VBCA 3U69H 1KTTB 3AASA 3ATKA 4Y76A 4AG1A 4H6TA 4BAQB 1MZDA 5HMAA 2P94A 2Z3DA 2NWNA 1V2VT 3B23B 2IJD1 1C2EA 1UVTH 3U9AH 4MPVA 4NIVA 4ASUD 1OXGA 2WUBA 3A8AA 3PB1E 3SNCA 3ZVBA 1Z6JH 4K8BA 1YC0A 1HXEH 1K9OE 3PRBA 2H5CA 2Y7XA 3STJA 1B5GH 4JYVH 2ZU4A 3LJJA 1K0HA 2XBYA 2BVXH 2P59A 1AO5A 2XYAA 4LK4A 1DXPA 1ETSH 4AYVB 3GY6A 4CH2B 2VIOA 4JK6A 3VG8A 5A0AE 4P02A 3GOVB 3F6UH 1QCPA 1QHRB 2JIZD 3SOSA 1NRRH 2WUCA 3EGKH 3F2GA 5BPEA 1T8OA 1FI8A 2A7HA 4YZUA 2XWBI 4NA7A 3P95A 3EYDA 2B7DH 3SI3H 1O3EA 1S6FA 2WYGA 5I25A 4K1TA 1S82A 4E05H 1A3EH 1HJAB 2ZDMA 3SQHE 2R2WU 2GGVB 2HLCA 3TJUA 3FO8D 2ZWLH 3TLOA 1YWUA 1EP6A 1BZXE 1KY9A 3K6YA 1HAPH 3KIDU 1C9TA 4E7RG 2XOKD 3TGIE 1PQ8A 4K60A 2C8YB 3MNSA 4X1PU 6LPRA 3ZZ6A 4U32A 3FZZA 2CK3D 3K6ZA 3T5FH 2THFB 1UTOA 1DLEA 5FX6A 1SGCA 2BZ6H 1CA0B 3KQ5A 4CBNA 2FOHA 3A8CA 1SFIA 1LKBA 4WY3A 5E8EH 2ZQ2A 4Z0KA 1IQJA 2XC0A 5JDUB 4X2WA 1W0KD 4JYTA 1O35A 5A0BA 3KHVA 3PTNA 1YCPH 3BTME 3DCLA 2JKHA 2Y81A 2AS9A 3RXOA 1K1MA 2G5NA 3BIVH 4D7GA 4BAOB 1WTHD 2XC4A 1F0SA 1DUAA 1FIWA 1ZJDA 1Z6EA 3M36A 3A7XA 4MPWA 2Y5FA 4TPYA 3PLPA 1V2LT 1C2FA 1PPEE 3ZV9A 1B0EA 2VU8E 2A5IA 2ZFPH 1AUTC 1TNLA 1SGPE 1T31A 2PKAA 5DO4H 1ZYOA 4CR5A 3TNSA 5L6NH 2C90B 2Y5GA 5C17A 3GS9A 3T27A 1PQAA 1X7AC 1O2JA 1ZGVA 1P01A 2ZHQH 1C5TA 1A61H 1YPKH 2EI6A 1F7ZA 1G3BA 4H6SB 1ARBA 3RXRA 1LVYA 2L6OA 3KQDA 3DSGA 2BHGA 3HGNA 3T62A 1O37A 3PMHB 1HFDA 2O8WA 1EJNA 3ZZBA 4Y71A 1TLDA 2TIOA 5EGMA 2HNTF 2RDLA 4RT1A 4CR9A 3W1EA 4B73A 2TBSA 4YM9A 2HOBA 4YOIA 1ELEE 2H5DA 2ZFQH 3F9FA 2GT7A 3BV9B 3KQBA 5EXNA 1GI3A 2ANKH 2D8WA 1GI2A 1WBGB 1V2UT 1C5MD 1K1IA 2QYIA 2QF5A 3LJOA 2OC0A 2YNBA 2CN0H 2ALVA 1TFXA 5B6OA 1HNEE 2ZF0H 1FV9A 2ZA5A 5FHTA 4RT0A 1NN6A 3QZRA 2UUJB 1HJ8A 2BY8X 1ZRBA 1IQHA 1VZQH 2O8UA 2ZU2A 4WMFA 4ABBA 1O5BB 1QFKH 5KGOA 1YKTA 3V3MA 4JZIA 1RIWC 3KGPA 1MU6B 4LOYH 1UK3A 1TOCB 1DWBH 2BX3A 4ZHLU 1AGJA 2FS9A 2KAIA 2J4IA 2A45B 3ZVAA 5DP8A 1MTNB 3PV5A 4WMEA 3SU2A 2F9PA 3DFJA 4ZXXH 4D9RA 4Y8YA 2CV3A 2PTCE 4DIHH 4O97A 1B7XB 1ZR0A 3TGJE 5C5OA 1BTWA 1GHYH 2JJ1D 3SZNA 1ZPCA 1G3DA 1AU8A 1QJ6B 2OUAA 2A7JA 2ZGBH 5EW2H 3OTJE 1F5KU 2AGEX 3SNAA 1GVLA 1C1NA 1VITG 3FP7E 2BXUH 1EX3A 3QUMP 3VB4A 1C2HA 3UQOA 2RDEA 1RFNA 2HNTC 2WV5A 4YT6H 1G9IE 1P8VC 4NCYA 1GBJA 3LH1A 1ETTH 1SG8B 1KTSB 1LQDB 4NA9H 1XUJA 4I8KA 3SGAE 1C2DA 3GCOA 3T2NA 2PW8H 1FY8E 1C5PA 3A7VA 4ZH8A 1GHVH 4ZKOU 2HVYB 3A85A 1OX1A 3RXJA 1A5IA 5GIBA 3LGWA 2ZI2H 2ANWA 1NBMD 4M7GA 2OK5A 2PTNA 2DE9A 3RC4A 3GCHB 1C1VH 4GHTA 4SGBE 4U30A 3P8NA 5JBAS 1EJAA 2XRCA 3FOAA 3BTTE 3SU3A 1UK2A 3O8BA 1EZUC 4DT7B 1BUIA 4ZMAH 5E0JA 3MNBA 1TNKA 5E2OA 4ZKRU 1GMCG 1BMFD 1ABJH 1OOKB 1QIXB 2A4OA 2ZNKH 5EODA 5PTPA 3UFAA 3QLPH 3PYHA 3O8RA 1DT2A 5ESTE 5BRRE 2GX4A 2NU3E 2R3YA 3M5NA 1DWDH 5TCAA 1IOEA 2P8OB 4CH8B 1VITH 5FPSA 1WQSA 1BDAA 1P2IA 2W7UA 3WW7A 1SGTA 2VIPA 1E0FD 1K1JA 2EEKA 1DY8A 1E34B 2DUCA 2HRVA 1XUHA 1YPMH 1SOZA 2BQWB 2V35A 4FUHA 4NIYA 1EB1H 1TWXB 2OLGA 5C1UA 3AAUA 1N6YA 1ZLRA 1TMUH 5F8ZA 3Q00A 4D9QA 3V0XA 3PMBB 1O2NA 1FONA 3QK1A 1TX8A 2OC1A 1ORFA 1V2ST 3ODFA 2QXIA 3HK3B 3OE7D 1ESBA 3A7YA 3AAVA 4X6MA 1AKSA 3C27B 4GAWA 5GPIB 3O8CA 4MNWA 5ABWA 1O3FA 1EASA 4KTCA 1SGDE 3FN8A 1TQ7B 4BANB 3U8TH 2ZFRH 4ABJA 4ACAA 3URDA 2OC7A 1TRNA 2QF0A 1A0JA 1O5GH 1EFRD 1O2IA 3QWCH 1ZHPA 1FJSA 2WPMS 1HAYB 1PQ7A 4OM9A 1TPAE 2BD3A 4Q2KA 3MWIU 4NSVA 2HGTH 2WPLS 1JMOH 3ZZ8A 1C5XB 2G5VA 1O3CA 1HLTH 1Y3YA 5LH8A 4K1SA 2Z7FE 5H4IB 4R0IA 1AVGH 4FU9A 3RXGA 4B76A 4R8TB 4DJZB 2G4UA 4YESB 2AHME 2UUYA 3VGCB 2F9BH 1UTQA 2B5TB 4Y0YE 4ZAEA 3BIUH 4X8VH 4E06H 4UE7H 2Q6GA 2FOEA 1COWD 3ZYEA 4JZ1A 4AX9H 2BD2A 2OBQA 3SHCH 4ABHA 1EP5A 1MABB 1BBRH 4BNRA 3OX7U 5L2ZH 1UVOA 3SO3A 2BOHB 1L1JA 3PMJA 1OP2A 2K8IA 1H8ED 1EPTC 5E0HA 5EPYA 4CBOA 4X1SU 1D3PB 4IC5A 1AKSB 5EQRA 4BTUB 5AHGH 4K8YA 2QE7D 1PPZA 5EQQA 3RUOA 3SN8A 1ESTA 1XMNB 3RXLA 1O2HA 5E2PA 3SJ9A 1TNJA 2ZIQH 3U8OH 1KLTA 5DKMA 2BLVA 1GMDG 2BQ7B 2J94A 1TGCA 5A8YA 1ZPBA 1K2I1 2C93B 3S69A 3PLKA 4DOQA 1BBRE 1C5VA 2BYAX 3QO6A 3SHAH 1LPZB 1MKWH 3U8RH 1IQEA 2A2QH 2VIWA 3FAOA 2UWOA 3BTGE 4HI3A 1GJ7B 1E1RD 2CJIA 4AFUA 1O3PB 3AVZA 4NIWA 2KFWA 4JZFH 2BDIA 2KM0A 3RXSA 3P70B 1EZQA 1C4U2 1GGDB 1P2OA 1LHCH 1DFPA 1G3EA 1BOQA 1MCTA 1K1LA 1O3BA 2PSXA 3CNRA 1ANDA 1IQIA 2ZU3A 2C3SA 4AB8A 2QXGA 3SUEA 1C2LA 1P2QA 4RKJB 1QY6A 2ZO3H 4JCNA 5DP6A 5FCKA 1GI8B 1ID5H 1JBUH 1OWIA 1ELBA 2LELA 3M61U 1C5QA 4FXGH 3LGVA 3RXPA 3W95A 3KYFA 7LPRA 1C1MA 1AE8H 1KXEA 1TPPA 4UFDH 1SHYA 1UO6A 1SMFE 2D1JA 1S6LA 3SUGA 4A6LA 5A09A 5HIZA 1H1BA 1HGTH 2PHBA 4HZHA 3SORA 1ZMLA 1ELGA 1LKAA 1L0ZA 5T6DA 4XBBA 3A7ZA 3BTFE 1QTFA 3PTBA 2ZPRA 4GUXA 4Z1MD 1YPJH 1T7CA 1YM0A 1L4ZA 2SGEE 3M7TA 1NU7B 4TT3D 5CDFE 1GJ4H 2XXLA 3RXHA 2QA9E 1KYNA 3QZQA 2BLQA 2VINA 3QTOH 2ZFFH 2QCYA 1QURH 3SNBA 2ZHFH 3B9FH 1GI9B 1K1OA 2IPQX 3PRDA 1UTKA 4MNXA 3HGPA 4A5TS 4QT8C 4X1NU 4B71A 4O03A 4MDSA 1A1RA 3V12A 1QRZA 4CRGA 1E1QD 2R3UA 1O5DH 2ZGHA 2FM2A 5F8TA 3H09A 4U2WA 2K0QA 8KME2 1RXPA 3BEIB 1QL7A 4ASHA 1HDTH 1V2TT 4OS7A 2I6QA 1YLDA 1VGCC 1NRPH 3ODDA 1DE7H 4BXSA 4NFEA 4AFQA 4OS2A 1GHBG 2B0FA 2F3CE 1O2GH 4AGKA 1UHBA 1O3OA 4FUCA 2JETC 3H7OA 3LGYA 1W12U 2J95A 3BTHE 3SQEE 3WY8A 4BTTB 3DSOA 1XX9A 1W0JD 3FZDA 2OINA 5TCCA 2NU1E 4FU8A 4K69A 1BTHH 4YLQH 3SV9A 3SV8A 4A92A 1OHHD 2ZGJA 2ZU1A 3LIWA 5LPEA 2FESH 1F5LA 3VB5A 2J34A 2BX4A 3MYWA 1FZZA 2ESTE 1NY22 1O2TA 1FY1A 2AIPA 4ISNA 3I29A 1O33A 3RXAA 4ABDA 4CRAA 2F83A 4GSOA 1FNIA 1O2MA 3EQ0H 3VFEA 1MAYA 1NFWA 1YY3A 1CA0C 4NA8A 3BN9A 2WV9A 1GJ5H 3RXBA 1A5HA 1BT7A 2CF8H 4D76A 1C9PA 1P05A 1BJVA 3MU4A 4X2VA 4X1RU 3ZZDA 4I8HA 1THRH 1ELAA 1GJDB 2ZTZA 3DT0H 5GNDA 5DK1A 3UOUA 4D8NA 1EQ9A 1HAXB 1GHBF 2SGFE 2AGGX 4IN2A 4X6NA 1G2MA 1UHBB 3GCTG 3KNXA 4AG2A 4WMDA 1UW7A 1MTUA 4Y11E 1NFXA 2Y80A 1HXFH 2BXTH 1IQKA 1YCPK 4F49A 1SFQB 1CHOF 3G01A 5LPFA 1Y3VA 3BTEE 2H1UA 1KDQA 1T4UH 5F6MA 1LCYA 2FYRA 1ZTKA 2NU4E 4FUIA 2SGQE 1YGCH 3ZIAD 2F9NA 3RM0H 3LU9B 5GCHF 4A7IB 1EATA 1OWKA 1YPHC 1BMAA 3F9HA 1H8DH 5IYTA 4ISLA 2VIDA 5T3HA 3RXKA 3ZZCA 4X0WU 1D4PB 5DN6D 1O2XA 4BAKB 1HV7A 4ZCNA 4UFGH 2XWAA 1A5GH 3CP7A 5CHAB 5JPMH 4CRDA 3LT3A 7KMEH 1TMTH 3SU5A 4O9VA 4OS1A 3UWJH 1C5LH 1GBLA 1SGRE 4GHQA 4M9FA 1Y5AT 2FYQA 3SU6A 1C2JA 1AZZA 4VGCB 3F2FA 4RSPA 3RU4D 1XVMA 3RC5A 1QQ4A 3OSYA 2TGAA 4I86A 2VH0A 4XD7D 4ABIA 4Q7XA 3GCTF 2A31A 4XFQA 1UK4A 3TH2H 1RTLA 1Y8TA 4ABAA 1O30A 3ZV8A 2C8XB 3OTPA 1FY5A 3L6PA 4BAHB 1BITA 1UCYH 1MU8B 1KDQB 5EXLA 5KEDA 1QBNA 1GVZA 1SGQE 1MTNC 1DICA 3P8GA 1GI7B 3GYMA 1C5ZB 5IK2D 1L1NA 1SGNE 2L74A 2WPKS 3ATLA 1LHDH 1TRYA 5C3NA 4H42U 3ATWA 3M37A 3WWFA 1KXDA 2XCNA 3SUFA 2XTTB 1DITH 1EZSC 1EAUA 2QV1A 2ZDLA 4HG6A 1FQ3A 1WTGH 3RXCA 3M3TA 1SGFG 4DURA 2AERH 1A4WH 2A1DB 2BY5X 4Y0ZE 3T28A 1SC8U 5DP9A 1UCYE 4FVBA 3LH3A 2QXJA 4FETA 4NZQA 4WVPE 3VPKA 2OTVA 2BDAA 1THSH 3ZVCA 5AFZH 3LGIA 3M3SA 2FODA 1MD8A 4Q4LA 1F0TA 3PM3A 1HYLA 1LVBA 1SR5C 1YLNA 2BY9X 4B2BA 1O3GA 4ISHH 5A8XA 1P9SA 1OKXA 1ZTJA 1BHXB 2BDCA 2XCFA 3MHWU 2J2UA 1NESE 1EAIA 3SU1A 3HATH 2LP6A 4KTSA 3GCHC 2GCHF 4TWYA 1TE0A 1DVAH 5C5NA 3N7EA 1H8HD 2ZCHP 3GY4A 1QB9A 3TVJB 1TNIA 1DUEA 4ZXYH 1GG6C 2BDBA 2KZ4A 4GPGA 3RM2H 1GBIA 1S0QA 3UPEA 2PGBB 1O5CB 2P8OC 2FI5E 1EKBB 4AC9A 1C4Y2 1SQAA 1ELDE 3UUZA 3GICB 2RA3A 4U01A 3ZZ7A 3KEEA 3ZZ5A 1C1OA 2R9PA 2CHAB 1IQLA 1RJXB 1V2WT 3MU5A 1BTYA 3M5OA 2OC8A 4X8SH 3F2HA 1GHWH 2HALA 1GJ6A 1EJMA 3S7HB 1LHGH 1NPMA 4YTAA 5G4BA 1BTXA 1YPLH 2ODQA 1BRCE 1O2OA 1W11U 1J9CH 1A0HB 3RXQA 4AN7A 1SLVB 1JIMA 1QB1A 1PPBH 2HNTE 2BOKA 1ARCA 1OP8A 1VJAU 2ZPQA 3A8BA 4IN1A 5HM9A 1KLJH 1O3MA 1XXDA 1MAXA 1Z8RA 4X6OA 1TONA 1JXPA 3UNRA 3RDZA 1CBWC 4F48B 4IW4E 1P12E 3ENSB 2KCOA 1PFXC 1GBDA 3KL6A 2ZHEH 1DSUA 2VVCA 1XKAC 1XUIA 1PQ5A 1QQUA 1AI8H 4K1EA 2W26A 2ZDNA 1BB0B 4ESTE 2ZHWH 2JDID 5DJ7A 3V13A 1UTMA 4B1TA 2QGRA 3PV2A 1N8OB 4JK5A 4A1VA 1W7XH 4YT7H 4RN6A 1F0UA 2M2AA 1BQYA 3EA7A 4DG4A 1YYY1 3RMLH 1XUFA 4A1XA 3SI4H 1C2MA 1Y3XA 1NTPA 3MU1A 3A7TA 1FUJA 5F8XA 3RMMH 4CREA 1E79D 2Y7ZA 4FUEA 1TBRH 1RS0A 2BZAA 3RXUA 3RXFA 3I78A 2FZZA 4MPUA 1IQNA 1CE5A 2QIQA 5B6LA 1QA0A 1O34A 1H9HE 2FOBA 1GHXH 2J38A 1W10U 1EZXC 1SGYE 1A7SA 1D6RA 5CHBA 1BBRK 2G00A 3SYJA 2XBVA 1C5WB 4B6FA 3DHKH 5EJLA 5FCRA 2AMQA 2FOGA 3PWCA 3Q3XA 3CS7A 3N99A 4KTUA 5FBIA 5GXPA 2FOAA 8GCHF 2G55A 1IQMA 1P03A 2I6SA 1AVXA 5DPAA 3SU0A 5C0UA 4RI0A 4ISIH 1LO6A 1CGHA 1HAHH 1C1SA 1PPHE 5C0TA 3F0OA 1W2KH
chains in the Genus database with same CATH topology
4JYUH 1ZJKA 3IWMA 1GBHA 1GGDC 2WPJS 1SLWB 4YOGA 1AFQB 4PROA 3F68H 3M3VA 2PUXB 4GCHF 1G2LA 1MD7A 2FPZA 1MKWK 3TK5A 2ODPA 1Y59T 2GCTB 3QX5H 3MH7A 4SGAE 3SW2B 1NO9H 4UD9H 3QGNB 1J17T 1O3DA 1K1PA 5LPRA 3UNSA 2Z3EA 2FMJA 4K3JA 4I8LA 2ODYB 3LPRA 2UWLA 2VNTA 2Z9IA 1J16A 3K65B 4DIIH 1E37B 2BLWA 1W8BH 3DA9B 5GWZA 3O8DA 1O3HA 3TPIZ 4E7NA 2W5EA 1PPCE 1DSTA 2IOTA 1F0RA 1YF4A 3K9XB 4XDEA 1HPGA 1PPFE 3A81A 2LPRA 1TGTA 2GKVE 3EAJA 6GCHF 1NC6A 3PMAB 4A1TA 2G52A 4D7FA 3QDZB 1QL8A 1QNJA 3SJIA 2AIQA 3GYLB 3NZIA 3S0NA 3LC5A 3D23A 3STIA 3VB6A 3SJKA 1J8AA 2J9NA 2Q1JA 3S9AA 5C2ZA 2V6NA 2JH5D 1Z8GA 1CO7E 2NU2E 3GDSA 3P8OA 2GZ7A 2C4FH 3S9BA 2IN2A 1MMJN 2ANMH 3RMOH 1QGFA 1P10A 2FTLE 5EU8A 2RA0A 4O3UA 3SGBE 1K21H 2PSYA 3FP8E 1ELCA 1K1NA 1GI4A 3UOPA 4J1YA 1MTVA 1HAGE 2TGTA 1QJ7B 3A88A 1HBTH 1TABE 3MI4A 3FP6E 3RC6A 1LQEA 3SJOA 4UONA 1GBMA 3ATIA 1T8NA 3ELAH 2ILNA 1KXCA 2FWWA 1WAYB 1O2SA 1W3CA 1F92A 1XUKA 1DY9A 2GV7A 2VVVA 3JZ1B 2F9OA 1D6WA 1A2CH 2OP9A 4I8JA 2WPIS 1FAKH 1JIRA 5IDKA 1BJUA 1C5UA 3RLYH 1NRNH 1UTJA 1EB2A 2FEQH 1OWHA 4MPXA 3UIRA 1VCWA 3FANA 1Q2WA 1NM6A 4WJG2 4B2AA 2ZG0H 4AFZA 1ZPZA 3F9EA 1Z1IA 1YBWA 3UY9A 4NZLA 1JRTA 1FY4A 4IMZA 1W14U 3PV4A 2GT8A 3UREA 4ZKNU 4LZ4B 3BTKE 1GBBA 4XBCA 2ZP0H 1NRSH 5C1XA 5JYIA 1GBCA 1GBTA 1CHGA 1ZMNA 2AEIH 4X8UH 3Q77A 2WYJA 5JBTA 5DP7A 1NROH 2ZZUH 3GDUA 2AFQB 2ZC9H 1O3KA 1LVOA 4X6PA 3JZ2B 1AUJA 2ZU5A 4ABFA 2BVSH 3E0NB 1TRMA 1BMLA 5C20A 3BG4B 5DP4A 2G4TA 2SGAA 3MU0A 1UTLM 3RXEA 5JBCS 3HPTB 3MH6A 1HB0B 3GY7A 3KQCA 3BSQA 2C8WB 3KQEA 4XSKU 1LHFH 3T25A 2PR3A 1BMNH 1MKXH 1J14A 1S84A 3A86A 1D3QB 3MU8A 2FI3E 3OYPA 2JH0D 1JOUB 1O3IA 4ZUHA 2O8TA 2ZFTA 4UFEH 1ZOMA 2ZTXA 7GCHF 1SLUB 1FIZA 2F9VA 4FUGA 3TJNA 5CHAC 1TA2A 2A2XH 4CRCA 1H8IH 1G3CA 2ALPA 2HVXA 5J4SA 3Q76A 2BD9A 1EAXA 1C1PA 1OS8A 1GHAF 2ZDAH 1NRQH 3VXFH 2AMDA 1BTZA 1AQ7A 1BHXF 3SNDA 1RD3B 1HAIH 3A80A 4VGCC 5E0GA 3SNEA 5AF9H 2Z9JA 3CS0A 1P2NA 1FDPA 1AHTH 1K22H 1GDNA 2NU0E 2BDYA 2PV9B 2Z6BD 4THNH 2A4RA 1W13U 6CHAB 3E91A 5ETXA 1KLIH 2SGPE 1OWJA 5FX5A 1DM4B 4YLUA 2H9TH 1EPTB 4LZ1H 5T6GA 3ZZ3A 1CHOG 5ESBA 1HJAC 2SGDE 6ESTA 4YO9A 2SNVA 3TU7H 1TB6H 3AW0A 2W3KA 3NCLA 3TITA 3SGQE 1LHEH 1EOJA 5F03A 2H9EH 1DOJA 1O5AB 2QN5T 2VWLA 5AVDA 1MBMA 1C5YB 1SPJA 1NZQH 4F4OC 1O2PA 1YCPM 5GCHG 2UWPA 5CE1A 2BD4A 1G37A 4TWWA 5EXMA 1PYTD 2A5AA 2VJ1A 4Y7BA 1UCYK 4FUBA 4Y6DA 2BD7A 1NT1A 1O2ZA 1P04A 2R2MB 3DD2H 1CQQA 1E35B 2VGCB 1YPHE 1GCTB 1AB9B 2RCEA 2BQ6B 1P9UA 3LDXH 1ANEA 5LGOA 2GMTB 1GI1A 1JWTA 3PO1B 1LVMA 4IC6A 2STAE 2FO9A 5T6FA 1GJCB 1O38A 4I33A 1MTWA 1SI5H 1TNGA 4KKDA 1EOLA 2G81E 4Q7YA 1O2WA 2M5TA 3LGUA 2Z9GA 1SVPA 1UTPA 3BTDE 3P17H 3RXVA 1P57B 4OGXA 1ANCA 1IQFA 1S0RA 4MNVA 1D3DB 1IHSH 1XXFA 2LNCA 4UDWH 1WQVH 1HAZB 1GBEA 1YLCA 1H4WA 3M5MA 3GCNA 3F9GA 4YOJA 3GY5A 1O0DH 2A7CA 2XW9A 3TJOA 1MH0A 2B9LA 1BCUH 5FPTA 2PLXA 1AIXH 5K7RA 3MO9A 1GMHF 5A2MH 5SGAE 2VWMA 1AWHB 4AZ2B 2Z3CA 2CHAC 2IPHA 4J2YB 1O5EH 2B8OH 4NGAH 1AZ8A 2AGIX 3R3GB 3UR6A 2DE8A 2V0BA 5K0HA 2R0LA 1GL0E 3A8DA 3RXTA 5EG4A 5HYOA 4DCDA 3QGJA 1TNHA 4KGAA 1C5NH 1IAUA 1FN8A 1P11E 1GWAA 1YPEH 1P2KA 3H5CB 5HM2A 9ESTA 1HIAA 4TY7A 3RLWH 1GHZA 3ITIA 3SV7A 3E90B 3PWBA 1ZRKA 4OS5A 1DLKB 2SFAA 1GPZA 3NKKA 1G36A 3A84A 1MZAA 1V2JT 3UTUH 1Z8JB 2GD4B 3E6PH 3GDVA 5AFYH 4JMYA 3R0FA 3W94A 2H2ZA 4ZHMU 3HKIB 1V2QT 2FXRA 3ZYDA 1VGCB 1DDJA 2GCHG 1HUTH 4ZROA 1RRKA 1O5FH 4BOHA 1W0ZU 1F2SE 1BRBE 2GV6A 1O2VA 1VJ9U 3TH3H 2PKSB 1SB1H 2GP9B 2JETB 1LPKB 1GCDA 1AVWA 3OY5U 1C5RA 4I31A 1S6HA 3ZVDA 1JRSA 1O2UA 1XKBC 2EA3A 1T32A 1N8OC 5HXFA 2UUKB 4NIXA 3RXDA 4XE4A 2Y82A 2YNAA 3MMGA 1MBQA 3F1SB 3TH4H 3AW1A 1QA7A 4INHA 3H7TA 2Z9LA 1ZSJA 2GZ9A 1QRXA 3MH4A 2ZKSA 1AE5A 3A87A 3FFGA 1O2KA 2A0QB 2FI4E 5GJ4B 1P3EA 2BMGB 3DFLA 3RXMA 1FPCH 2A5KA 1W7GH 4IBLH 2F9UA 1AN1E 1T8MA 1HIAB 1HAVA 2G8TA 4CHAB 1XVOA 2K1QA 2FTMA 3SU4A 3A82A 1GDQA 1C1WH 4TPIZ 3M7QA 3ESTA 1AY6H 2CMYA 4DGJA 2ZDKA 1ZTLA 7ESTE 1ZSKA 3P92A 1N1LA 1P3CA 4WWYA 3ZZ9A 1B0FA 4TY6A 1DS2E 4MNYA 2J92A 1C5OH 2WINI 1ACBE 1CVWH 4OS4A 1C1RA 3FVFB 3NWUA 3L33A 2GDEH 1GJ8B 1C4V2 1VCQA 1AWFH 3UR9A 1TQ0B 1Z8IB 3VXEH 3TJVA 3UNQA 1D9IA 1AFQC 1BRUP 1GJBB 1T8LA 2V3HH 3MH5A 4B2CA 1NFUA 1LPGB 3EA9A 1S81A 3RMNH 2QY0B 3OY6U 2Z94A 1UVUH 4HTCH 1SSXA 4O3TA 1HJ9A 2FOCA 4AB9A 1E38B 1CU1A 1HAVB 2FDAA 3TIUA 2GCTC 2H6MA 4WXVA 2ZCKP 2QAAA 1P0SH 1SGIB 3DUXH 1UJ1A 3HK6B 4ZKSU 4BAMB 1FPHH 3IG6B 5EW1H 3E0PB 3M5LA 1MQ5A 3MOCA 4WH8A 3P6ZB 2G51A 1XM1A 1HRTH 1SGEE 4IGDA 4NWLA 2R0KA 3V7TA 1IQGA 8GCHG 2BM2A 2PKAB 2WPHS 1O2YA 5I46H 1NFYA 5C67A 1O2RA 3LGTA 2A4GA 1TBQH 4HGCA 1OSSA 3GY2A 4BXWA 3SJ8A 4H4FA 1UVPA 2FLRH 1QBVH 1ELFA 3VGCC 2GTBA 3ZVFA 1MCVA 3T29A 1P2JA 3E8LA 4I7YH 4MLFB 4GCHG 1C1TA 4AORA 1O3AA 3LONA 1CT2E 1V2PT 1BIOA 3RXIA 1P2MA 1TOMH 1WUNH 1Z1JA 3D49H 1MUEB 4WXIA 1SLXB 3U1IB 1PJPA 2RG3A 1HAOH 2CXVA 1WV7H 3NUMA 1GVKB 1N6XA 1ZZZA 1UTNA 2ZCLP 5JB8S 1WCZA 3ZVGA 2FIRH 1GI5A 1V2RT 1P02A 2V3OH 3MO6A 3C1KA 1V6DA 3NPSA 2ZQ1A 2ZDVH 2FX4A 1TIOA 1SQOA 1UMAH 4Y7AA 4FUFA 1ZHMA 1PYTC 3SBKA 1ZSLA 1QB6A 1O2LA 1C5SA 2KAIB 1O3JA 3BTWE 1LTOA 2EI8A 1V2MT 6GCHG 1QBOA 2BY7X 1Q31A 1Z71A 3HKJB 4ZHAA 1V2KT 4OGYA 1WSSH 3LC3A 2F91A 3PROA 1Z7KA 4X8TH 1BA8B 2D2DA 2Y6TA 4AYYB 4ABEA 1GG6B 2ZFSA 3M7UA 1O36A 2JH6D 4INLA 3A7WA 1LDTT 1OWDA 1V3XA 2YOLA 2C8ZB 1EUFA 1OYQA 1M9UA 1EXFA 1VITF 1KSNA 1U6QA 4XOJA 1G32B 3RU4E 1QRWA 1QJ1B 4MG3A 4GLYA 1P09A 1BTUA 1SGFA 1SQTA 3GISB 3TK6A 1RTKA 4K5ZA 3KN2A 2HWLB 3CENA 3BG4C 2VB0A 4IMQA 2W7SA 5EPNA 4WF8A 2D26C 2TRMA 2P3FH 1O32A 2A4QA 1Y3UA 4Z6AH 1TGSZ 3GY8A 5A0CA 3RP2A 1RIWB 3N7OA 2VWNA 1RGQA 1ZMJA 3UQVA 2TGPZ 1CBWB 4UEHH 4CRFA 3BEFB 4DW2U 1P06A 1QR3E 2EI7A 1CT4E 3M35A 3K2UA 1S5SA 1CSOE 1KXFA 1TGNA 1AD8H 2P16A 1GMCF 4MTBA 1DXWA 4XBDA 1CGJE 1NS3A 4Y8ZA 1CGIE 1MKXK 2ZGCA 3S9CA 5JBBS 4FUJA 3QN7A 1FXYA 3E1XB 2ZEBA 1OYTH 1Y5UT 4NFFA 3PLBA 1Q3XA 2OXSA 4I32A 3RU4T 3ZZAA 5FAHA 1TX7A 1H9LB 1J15A 1INCA 2VIVA 1E36B 4HFPB 2ZHDA 3ATMA 4KELA 1AFEH 1TMBH 1GI0A 1THPB 6CHAC 1O39A 1ABIH 2XC5A 3P8FA 5FBEA 1BTPA 2H9HA 4X2XA 1UVSH 3A89A 5FPYA 1ESAA 1BRAA 1DWCH 3ZZ4A 1O3LA 2P3UB 3LOXA 2HPQH 1FAXA 1FMGA 2QF3A 1PPGE 1GJAB 2CF9H 2EC9H 2XBXA 3U1JB 1GDUA 1DANH 2OQUA 1MTSA 2OQ5A 1VCPA 3UWIA 4ISOA 2UUFB 1O2QA 4BTIB 1EAWA 1L1GA 4JZEH 3URCA 2XBWA 1Y5BT 5DGJA 2Y5HA 1QL9A 2WV4A 5L2YH 2OD3B 7GCHG 5EOKA 2VH6A 2GVFA 5DG6A 4X2YA 1Y3WA 5TJXA 3VB7A 2STBE 2VGCC 1GCTC 2ASUB 1AB9C 1L2EA 2PWXA 1GHAG 3GY3A 4MVNA 2GMTC 1TGBA 1TALA 1GL1A 3BF6H 3OU0A 9LPRA 1SL3A 1V2NT 2FX6A 3PO1C 4CRBA 5CMXH 1KIGH 4RKOB 3MNCA 2OCVB 2GZ8A 1ELTA 1ELVA 3B8JA 4X1QU 2CGAA 1D3TB 1O31A 3EE0B 1A46H 3A83A 1C1UH 1WU1A 4MQAA 3BG8A 3U98H 1GJ9B 1EPTA 1SHHB 2IJOB 4NG9H 4Y10E 1FN6A 1AMHA 1DWEH 1A0LA 1ETRH 2SNWA 3S7KB 3SUDA 1GMDF 2BDHA 2P95A 1GBAA 1SBWA 1ZGIA 3MTYA 1L4DA 5C1YA 1F5RA 1BMMH 2GDDA 1A3BH 2OBOA 8LPRA 1TX6A 4LXBH 2W3IA 5DP5A 3MNXA 4B74A 3IITA 4KP0A 1S85A 2ZGXH 4WH6A 1NU9A 3NXPA 1GBKA 3QTVH 4NSYA 3MO3A 2XNIA 3TNTA 3I77A 1TBZH 3EA8A 3L3TA 1OPHB 2FP7B 2ZECA 3E16B 4I8GA 1TPOA 2O8LA 5J4QA 4FVDA 1DX5M 3E3TA 2QC2A 3VEQB 4DVAU 1KXBA 1YPGH 3VB3A 1WYKA 4AFSA 2VIQA 1W0YH 1H9IE 3D62A 4Q7ZA 1ZHRA 2P93A 2TPIZ 2PFEA 2P3TB 1VR1H 2FS8A 2O8MA 2ULLA 4FUDA 1FY3A 2PKSC 4TYDA 3Q3YA 2FOFA 3KF2A 1WOFA 1G30B 2ANYA 2Q6FA 2BD8A 3SV2H 2FOMB 5DP3A 2VVUA 4Y8XA 3TGKE 2PGQB 1FLEE 1HCGA 1K28D 1T4VH 2Q6DA 3NK8A 4OS6A 3EDXB 5A8ZA 2A32A 4JZDH 1OWEA 2BLOA 1GBFA 1GMHG 1LMWB 1TAWA 3Q3KA 1CA8B 1TA6A 1TYNA 5JB9S 2ZTYA 3TK9A 1KXAA 5HGGA 1MQ6A 1OP0A 4UFFH 4AOQA 1C2GA 3BEUA 4FU7A 1TPSA 8ESTE 1C2IA 3MFJA 1S83A 1C1QA 4NWKA 4DY7B 2BDGA 2AH4X 4IS5A 1SOTA 5GDSH 3LKWA 4CHAC 2PUQH 2QXHA 3SV6A 3KCGH 4AGJA 2BY6X 1RTFB 5L30H 3BTQE 1CT0E 2AYWA 1C2KA 3D65E 3ZVEA 1IHTH 2O9QA 2ZPSA 4Q80A 1XUGA 4GVUA 1YP9A 4B75A 2BTCE 4Y79A 1DPOA 4ABGA 2BB4A 2BD5A 1V2OT 2Z9KA 2VWOA 1O3NA 2FLBH 2AMPA 4INKA 1GI6A 2HPPH 1ANBA 5FXLA 3T26A 5EQSA 4K2YA 2TGDA 2BVRH 3U69H 1KTTB 3AASA 3ATKA 4Y76A 4AG1A 4H6TA 4BAQB 1MZDA