2SGEE

Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgeE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgeE01
1IAUA 1O2MA 1L1GA 3BG4B 3SNEA 4AFZA 3ZZ9A 1MZAA 3SJIA 4XE4A 2BDHA 2ZTXA 4MNWA 1O31A 2AEIH 2NU4E 1NU7B 3MU1A 1A4WH 3OY6U 5IDKA 1O5DH 4YT6H 1MU6B 2W3IA 1P04A 1MTVA 3SU4A 4NWLA 2PTNA 3QGJA 1THSH 5FX5A 1NO9H 1GBKA 3TNTA 1DITH 3Q3YA 2VVVA 2BD9A 2Y5FA 1Y3WA 3M3TA 3GY5A 4F49A 3HGPA 2BXUH 3Q76A 1GHAF 1FN6A 1AU8A 1L2EA 3RXRA 1V2JT 4K8BA 4X1NU 1EATA 1QCPA 1V2UT 1YPHC 2WINI 1XXDA 3DT0H 1NS3A 2QXHA 2ZDMA 4NG9H 1P05A 5IYTA 1KTSB 1B0FA 2BQ6B 4INHA 4D76A 1OP0A 2ZU4A 5B6OA 3QK1A 1ZRBA 4ABHA 4E7NA 4RSPA 1IQLA 1CO7E 3GCTF 3PO1C 4UD9H 1O5EH 3MU8A 4K69A 2VWLA 4Y0ZE 1SR5C 1RIWC 2Z7FE 3GCOA 1GI8B 3MOCA 5J4QA 1GL1A 2PSXA 4HFPB 1UMAH 4FU7A 2QA9E 2C8WB 1SPJA 1JWTA 1ABJH 4JCNA 3M35A 4X6NA 1CU1A 2GP9B 4MPXA 1LTOA 1TBRH 2Z9GA 3ITIA 3RXBA 1V2PT 4BXWA 2FX6A 2WPMS 3STIA 1LO6A 1ZPZA 3L3TA 3RLYH 1AWFH 1BTZA 1S84A 2A4QA 3GDVA 3O8BA 3RUOA 2D1JA 1O0DH 3RLWH 1G37A 4ISOA 2LPRA 2FM2A 1NN6A 1QJ1B 3SI3H 1LHFH 5L2ZH 4FU9A 2V35A 2VIDA 2AMQA 4WWYA 4U32A 3HK6B 3OYPA 4ABGA 1HJAC 3BSQA 3MH6A 1O2JA 3SUGA 2CGAA 1XKAC 1GL0E 4YTAA 2Y5GA 4DG4A 3V3MA 3SV2H 1HNEE 4KTSA 1A5HA 3SBKA 1VZQH 4ZXYH 1K1PA 1O3BA 3VPKA 1E37B 3QZRA 5PTPA 1Y59T 2PUXB 3UY9A 3SV6A 3QO6A 1BJVA 2WV4A 4Y10E 2Z3DA 1BTHH 1JRTA 1O3EA 2EA3A 2FOCA 4CH8B 1O3IA 3FFGA 1JXPA 2ZPSA 1DFPA 1XMNB 3T62A 1ORFA 4O3TA 3RXMA 2BY6X 2GZ9A 1O3KA 1GDNA 4ZKSU 3RC6A 3K6YA 4UFFH 1O35A 3HKJB 4BAHB 7ESTE 5AHGH 3SGBE 1TA2A 4GPGA 1UCYK 2B7DH 1YYY1 1GMHG 3LPRA 3LONA 1ELFA 1DY9A 5FX6A 3BIVH 4ISNA 1C2LA 3GCNA 1MKXH 5FAHA 1GJ4H 1P9SA 2G4UA 1C5LH 3LJOA 3EDXB 1ZZZA 1GCTC 5EQSA 4CRGA 3FZDA 1XUGA 4B2BA 1KLIH 2BOHB 3RM0H 1K2I1 1BRUP 1QFKH 3D65E 4XSKU 1GMDG 1QB6A 3MH4A 3LGWA 1QNJA 4DJZB 4I8HA 1THRH 3BG4C 1FI8A 1AIXH 2JH0D 1N6XA 6GCHG 1FV9A 2NU2E 2Y82A 3ZVAA 1O32A 3OTJE 2GTBA 4MNXA 1IQJA 2P8OB 3NUMA 4K1EA 3AASA 2ZA5A 2VNTA 1DT2A 1NY22 3UR9A 2ZIQH 1C5WB 4FUBA 4NA9H 1EZSC 1T8MA 2BM2A 1C1PA 1F5RA 2ZECA 1XXFA 2P3TB 5SGAE 3SQEE 5DP7A 5EPNA 2FEQH 3SGAE 1A61H 3F68H 3UUZA 1GMCG 1H8IH 4K5ZA 1S0RA 2FPZA 1DVAH 3T25A 2QY0B 2FS8A 2M5TA 4ABEA 4UFDH 1ZMNA 5A09A 3LJJA 3MMGA 1K1MA 1PPFE 4LK4A 2ZDNA 3ZVEA 3SGQE 3K65B 1GBAA 2Z9KA 4NIWA 3T29A 1AN1E 4WF8A 2FOEA 4CREA 2O8WA 1UVPA 3MU4A 4O9VA 1ZTJA 2BDGA 4ZXXH 1UTMA 1UK2A 1XUFA 2XBVA 1GHBG 2UWLA 1XM1A 1NM6A 5DGJA 1X7AC 3E0PB 5CE1A 1A1RA 3QTVH 1BTXA 1GBDA 4ZKOU 1A2CH 6LPRA 1F5KU 2SGPE 1ZJDA 2B0FA 3KQBA 3SW2B 2W5EA 3LGIA 3FP6E 4I8JA 1ZGVA 1TGNA 2A4GA 3LKWA 5A8YA 3ZZDA 3S9AA 1LVBA 5GCHF 1BBRH 2BD3A 1V2QT 4UDWH 2ALPA 3PLKA 1O30A 3GY7A 5A0CA 1BJUA 1OXGA 4HZHA 1AY6H 3BTWE 3ZV8A 1A3BH 1OWKA 1ZLRA 1TRNA 3LC3A 3VXFH 4H6SB 2FI5E 2QV1A 3PMBB 2A7CA 3AVZA 3BTKE 1C5YB 1O2SA 3H7OA 2A2XH 1K9OE 1MD7A 4X6PA 4Z6AH 4XBBA 2BX3A 2W3KA 1EXFA 4BNRA 3KGPA 2BZ6H 1AUJA 2KAIB 1C1NA 3GYLB 4AZ2B 3UTUH 4BAMB 2BY8X 4NA8A 1KDQB 3UWIA 4B2CA 3A81A 3VGCB 3RC4A 1GDQA 4O3UA 2PUQH 1GJ5H 1P12E 1O2QA 1W7XH 2VIPA 4MTBA 2VWMA 1BTUA 1THPB 2A7HA 3C1KA 1NTPA 4J2YB 3ZVFA 1GBEA 3TITA 4MQAA 3SJOA 4MLFB 2CXVA 2J4IA 3TJVA 5DP5A 4ZKRU 4A92A 3BEIB 1L4DA 1RTLA 3KCGH 1QL8A 3I77A 4NCYA 1O37A 1P3CA 2ZHWH 3RXCA 2F91A 1IHSH 2BZAA 4X8TH 2XC0A 2PFEA 3MNSA 2VIWA 5JBBS 3S7KB 4WXIA 1TX7A 2OD3B 4X1QU 3SJ8A 2VH6A 1HV7A 3SUFA 1HAIH 4HI3A 1GJBB 4NSYA 2FOHA 3SI4H 1QIXB 3EA9A 3SU3A 1SGYE 1TONA 1XUIA 2R3UA 2ZCHP 1Z8GA 7KMEH 3RM2H 1F0SA 3RXOA 1TGSZ 4WY3A 3M5MA 4I8GA 3PLBA 3QZQA 1KTTB 3UNQA 4H4FA 3DA9B 1S81A 1D3QB 4X1SU 1WU1A 2Z3CA 4OGYA 1TGTA 2P95A 2ZCKP 4Z0KA 4MVNA 1T31A 2XWAA 1PQ8A 3KIDU 2GCHF 2P8OC 3SUDA 4DURA 3A88A 4CH2B 5FPYA 1YKTA 3CS7A 4FUEA 1OX1A 4A7IB 2UUFB 1H1BA 1WYKA 1BMMH 1EPTB 5DKMA 1P01A 3PWCA 3PROA 1CE5A 1LHDH 1NFUA 4SGBE 3NK8A 3QUMP 5EG4A 3URDA 3IWMA 1WV7H 4ISIH 5JDUB 1O2RA 1OP8A 4UFEH 1W7GH 1C1VH 2SNVA 3RXTA 1NRSH 4VGCB 1PPGE 3VB3A 4ABJA 5T6FA 2XW9A 1SGPE 3PV4A 3TVJB 3LH1A 1YPMH 4XBCA 1Q31A 2ODPA 1GBCA 2ZZUH 3RXDA 2J9NA 2QN5T 2A5KA 2WPIS 3SHAH 4X2VA 3A7WA 1VITG 2WPHS 1YGCH 2FOFA 4AN7A 4E06H 9LPRA 1BUIA 4IN1A 4A1XA 1M9UA 1O3LA 5A0AE 3RP2A 4BAKB 3M5NA 1BRAA 2UUYA 1UHBB 1GBTA 5I46H 1Y3UA 4DGJA 4TYDA 1GJ8B 5DJ7A 3VFEA 1V3XA 1QL9A 1CHOF 2OXSA 1HYLA 5JYIA 5FCRA 1NROH 3ATWA 1UCYH 1TALA 3M5OA 3CS0A 1OPHB 1TGBA 2ZC9H 4BTUB 1S6HA 2AS9A 3A89A 1UTNA 4IGDA 1CHGA 1YLCA 3D49H 2ZTYA 2FIRH 1LMWB 5EXMA 1O2HA 1FY4A 3RMMH 5JBCS 2EEKA 3E1XB 1WQSA 5FBEA 2H5CA 3E0NB 1PQ5A 1INCA 3T28A 2GZ8A 2ZWLH 1SFQB 3VGCC 1C5PA 1HAGE 1VJAU 2GD4B 2W26A 3TJNA 3URCA 1O3NA 2ZQ1A 1ZHPA 2OBQA 3ZZ5A 1A0HB 2O8UA 3LGTA 4ESTE 3P8FA 2ZGJA 1C5NH 5JBAS 2PKAB 3M7QA 2G52A 1QJ7B 4A6LA 1MTWA 1AWHB 3BG8A 2FTLE 1OP2A 4K1SA 2OQ5A 1V2WT 3BTEE 2F9OA 2ZPQA 4Q80A 4TWYA 1QB9A 2XBWA 1AD8H 5F8XA 1C2IA 4O97A 4ZROA 2F9BH 5E0JA 1C4U2 4BTIB 1MBMA 1ZHMA 4I8LA 2UWPA 1Y3XA 1PYTD 4NFFA 3UQVA 4IS5A 3MH7A 4B71A 4NSVA 8KME2 1ELTA 3RXFA 3E3TA 3V7TA 4IMZA 4GHTA 1ZTKA 5C67A 3FANA 1NC6A 3SU0A 1A3EH 1V2LT 1YPGH 3U1JB 1FAXA 2LNCA 1FLEE 2QXGA 1SVPA 5DP6A 2PLXA 4NGAH 1C2MA 2A32A 2STBE 1SG8B 3MU5A 1GBHA 2HLCA 4XBDA 4UONA 5CMXH 4KP0A 3RXJA 1P2OA 3MU0A 4CHAB 3RXVA 2ZHFH 1F5LA 1C1UH 3DHKH 2HGTH 2BY5X 1TNJA 5GXPA 1LQDB 1NFYA 5T6GA 1LPGB 2F9UA 2KAIA 5ETXA 3P17H 1P9UA 1EPTC 2C8ZB 1KDQA 1YM0A 2ULLA 4DT7B 3SU2A 4I31A 3TK9A 2ZCLP 1CA0B 5K7RA 1BZXE 2Z9JA 1FZZA 1SLVB 2WUBA 3NKKA 2ZHEH 2TRMA 1F7ZA 4VGCC 3ZZAA 1SGRE 1K21H 2PKSB 1AVGH 2AERH 2BDBA 3A7VA 1S82A 2P93A 3MFJA 3BV9B 3U8OH 2BDCA 5G4BA 2BHGA 2F9VA 3M3VA 2ZGHA 3PTNA 1C1RA 4FUFA 2QC2A 4OS1A 2PHBA 5FPTA 4K60A 3SNAA 4GUXA 1SL3A 1C2KA 2BLQA 1O2LA 3VXEH 4B75A 4F4OC 2BLWA 4K8YA 1DWCH 4FUGA 2BTCE 3M7TA 4H42U 4JYVH 4AB8A 1TNHA 5LGOA 2ZU2A 1QA0A 3MNXA 1AZ8A 3U1IB 3F9HA 4AGJA 1UTPA 3RXAA 4K3JA 2ZPRA 4TY7A 2ZG0H 1GDUA 1TB6H 3CENA 2FO9A 5L2YH 4ABBA 2D2DA 4U30A 1OWJA 1KIGH 1RD3B 4MPVA 3IITA 2ZP0H 2PSYA 5GIBA 1BMNH 1HPGA 3NCLA 5J4SA 4YLQH 3RXUA 2AFQB 1V2NT 5JBTA 1EPTA 1WAYB 4JZDH 3GY2A 3TH3H 1MTUA 2OUAA 3R0FA 1SGIB 2SFAA 2ZGBH 1G3EA 1H8DH 1T4UH 2QXIA 3RXEA 1NRRH 1SGDE 3M36A 2TGDA 2R0LA 2IPHA 4GCHG 3F9EA 5E0GA 2VGCB 2H2ZA 1HUTH 3BTHE 5I25A 1TOCB 1ELBA 1VJ9U 4KTUA 5DP9A 2R9PA 2F9NA 4WMFA 1N6YA 1UTJA 3A8CA 4LXBH 1UCYE 5TJXA 3RXGA 4ABDA 1SI5H 1O2VA 1EASA 1WBGB 2XC5A 2C90B 3GISB 4DOQA 5GDSH 3A8DA 1P11E 1PFXC 1QBOA 3LOXA 1MQ6A 1DLEA 5DK1A 1Z1JA 3EGKH 1YPJH 2CV3A 2XC4A 1A0JA 2XCNA 1UTOA 3TK5A 1F0RA 2H1UA 1WOFA 1GJAB 2ANWA 1UHBA 3SJKA 1O34A 4FXGH 1A46H 2BVXH 4TPYA 1OWDA 4XFQA 2GX4A 3MNBA 2HVXA 2V0BA 5EGMA 2OBOA 1P02A 1Z1IA 3B8JA 2ZO3H 3RU4E 1D9IA 1YBWA 1DXPA 1P2JA 1ELDE 3SN8A 4ABAA 3JZ2B 3TJOA 4Q2KA 2J2UA 1KLJH 1EZQA 2ZDVH 1SBWA 4ZHLU 1TABE 2R0KA 4IC5A 2CHAB 4OS5A 3BTQE 5A8XA 2HPQH 4CHAC 1P03A 3KN2A 2BDYA 3QWCH 1OWHA 3ZZ6A 1NPMA 2H9TH 5C1XA 2UUJB 2FOAA 3RXPA 1UVTH 1G3CA 1GBLA 2PGBB 1O3HA 2FYRA 2XYAA 4FUIA 5FPSA 1JOUB 1CA0C 1H9HE 1H9LB 3UREA 1FPCH 1LHGH 1FIWA 3P8GA 1VGCB 4CR9A 2J94A 4BAQB 2PKAA 2FODA 1LDTT 1K22H 1CA8B 1UVOA 2OLGA 1DPOA 1O2UA 1J15A 1RTFB 2PKSC 3A87A 1QA7A 3PMAB 3PM3A 1YPEH 1Y5UT 2IN2A 3HK3B 4E7RG 4K2YA 1EOJA 3P70B 1IQEA 1OOKB 4FVBA 4JK6A 1V2KT 2ZDLA 1Z6JH 2ZKSA 3NPSA 3U8TH 2IOTA 1O2IA 2BQ7B 3U9AH 1O2GH 1TNKA 1W3CA 4YO9A 4JZEH 4IN2A 1HAYB 3L33A 4PROA 3T2NA 4BXSA 1GJ7B 3QGNB 3KQDA 1HJ8A 2WPJS 1LVYA 1GI3A 3BN9A 4CR5A 1ID5H 3LDXH 2VB0A 1C4Y2 1SQOA 2FX4A 2OC1A 4Y79A 1XUJA 7GCHG 3FVFB 3PMHB 3UWJH 1EZXC 5EOKA 4DW2U 1GVZA 1FUJA 1TE0A 4ZKNU 2HNTE 1E38B 4Y76A 1QR3E 2STAE 3ZZ3A 2QF3A 2H6MA 3KHVA 2UWOA 1GHVH 3TU7H 2ILNA 2BDAA 1MU8B 1AFEH 3QLPH 4NZLA 1E0FD 1TLDA 1RRKA 2GDDA 4Y7BA 4CRDA 2G5NA 1SGTA 1RTKA 4AX9H 1PPEE 1DUEA 1ETSH 1P2MA 1C5XB 1GJ9B 4CRAA 5E8EH 3OY5U 2P16A 2WYGA 2VGCC 1LPZB 2GZ7A 4AFQA 1IHTH 4IC6A 2VVUA 5EQRA 1UK4A 1HAPH 3E6PH 5EW2H 3L6PA 3A83A 4TY6A 3GDUA 1HLTH 5FXLA 1LKBA 2BY7X 3S7HB 1HRTH 3HPTB 3DUXH 3HGNA 1LCYA 4NWKA 3EE0B 2IJOB 4DCDA 2O8MA 4MG3A 1AO5A 1GI4A 1KLTA 4ZH8A 1SGNE 1T32A 4AYVB 1OYTH 3UPEA 3GY3A 1IQMA 1B5GH 1OWEA 4OS2A 2EI7A 1DSTA 1GBMA 1GJDB 1FIZA 3UOUA 2B8OH 5C2ZA 3SNCA 2FWWA 1QHRB 5C5NA 1D3PB 4CBNA 5HXFA 3SOSA 1ANDA 1TMUH 2BVRH 1O5CB 3ZZBA 1GI2A 1B0EA 4X8VH 1HAOH 2ASUB 1MD8A 3SU5A 1K1IA 2ALVA 3F9FA 1N8OB 4QT8C 1A5GH 3QDZB 1GMHF 3ENSB 3K6ZA 3RXSA 3KQCA 1ZMLA 1ETRH 5FCKA 1QB1A 4XOJA 1ELEE 4R0IA 1FMGA 5F8ZA 1TPAE 1BCUH 3RMNH 1PPBH 1EP6A 1BHXF 2AGEX 1SSXA 1TWXB 2QAAA 2K1QA 2CHAC 2A5IA 4OS7A 1L1JA 5EODA 2A2QH 3GY8A 1GMDF 2JKHA 2GT7A 5DG6A 1PPCE 1O33A 1AQ7A 5E2PA 1TX8A 6GCHF 1MTSA 3AAVA 1FY5A 1WSSH 1ZGIA 1EQ9A 2ZGXH 3OU0A 3P92A 5JPMH 4FUHA 5HM9A 5C1YA 3DFJA 3UQOA 1Y3VA 2B5TB 5E2OA 1UVSH 5LPEA 1VGCC 4UEHH 4Y0YE 1Y8TA 1EJAA 1O2WA 3FP8E 1AZZA 1HAVB 2HNTF 3A7XA 2NU1E 4LZ1H 4XDEA 5DP3A 1FN8A 3A84A 2BD8A 1GMCF 3QX5H 4IW4E 5T3HA 1PQAA 1FY3A 2FI3E 2GCTB 8GCHG 1PYTC 3A82A 1HXFH 1UTLM 3ZZ7A 1SOTA 4X8SH 5EPYA 2SGEE 1P10A 2XCFA 1SMFE 2NU0E 1WUNH 1V2ST 2G4TA 1O5AB 3BTME 4AORA 4Y8ZA 1TGCA 5A0BA 3ZVDA 2CN0H 2P59A 3GY4A 1YPKH 2FESH 1DS2E 1E36B 3TNSA 2GMTB 5K0HA 4Q7ZA 1GHBF 4I7YH 1DY8A 3TLOA 2BD4A 2Q6GA 1TAWA 1G30B 4BTTB 3TH4H 8LPRA 6CHAB 1V2MT 2C4FH 1GI6A 2PGQB 4LZ4B 3TH2H 3UNRA 2BVSH 2P3UB 1W10U 3M61U 3RXHA 2FMJA 2Q1JA 1GHYH 2O8TA 1J17T 1SHYA 1MKWK 1YCPK 4K1TA 2G5VA 4JK5A 1HAHH 1MMJN 1Y3YA 1HDTH 3SNDA 4OS6A 2VH0A 3SQHE 2YNBA 4AG2A 2R2MB 1FJSA 2FLRH 1DM4B 3ZV9A 1IQHA 1P2QA 1DE7H 1AHTH 3AW0A 1VCWA 2A5AA 1FDPA 3O8RA 1MAYA 2QIQA 3MH5A 2H9HA 1P2IA 4RKOB 1BMLA 1KXDA 4FUCA 4DVAU 1OSSA 1EP5A 2A4OA 1TFXA 3P6ZB 1AFQB 3EAJA 3N7OA 1FQ3A 4J1YA 1Z71A 1XVMA 2Z94A 1V2VT 2BLVA 1C2HA 1GBFA 1SGEE 1Z7KA 1E35B 1PPHE 5EU8A 1QQUA 3GCHB 4YESB 2OC7A 3ELAH 1GHAG 4JZFH 3LU9B 1Z8RA 2G81E 7LPRA 1JIMA 1UVUH 4D8NA 2ZEBA 2V3OH 1BTWA 3ZVCA 2C8YB 1BRCE 1SC8U 2OTVA 2ZFQH 2ZF0H 1EKBB 2VWOA 2VWNA 1GVLA 1SLUB 1E34B 4B2AA 3O8DA 4HGCA 1OKXA 1GGDB 3C27B 3ZVBA 2FZZA 3EQ0H 3GCTG 1NRQH 5ABWA 2ZU5A 3ATKA 1N8OC 4AFUA 4A1TA 1W13U 2A45B 2CMYA 1K28D 1NZQH 4CRFA 1ANCA 4MDSA 1ZPCA 4YOIA 2OCVB 2ZFRH 1MCTA 1NRPH 3VB5A 2ODQA 1TMBH 4NIXA 4TWWA 4KTCA 1HFDA 1SFIA 1W0YH 2C8XB 4INLA 4R8TB 1C9PA 3UOPA 2AMPA 2WYJA 2BLOA 1ZRKA 2FOGA 4ZUHA 5GJ4B 3KNXA 2SGQE 1V6DA 2DE8A 4WVPE 1FONA 3BTGE 1RS0A 3RXIA 4B73A 1FPHH 3SZNA 4Q7YA 4ZAEA 4ASHA 4GLYA 2ZNKH 2ESTE 2QCYA 1BTYA 1P0SH 1G3BA 1ARCA 3BEUA 1BQYA 5FHTA 3ATLA 1PPZA 3U98H 2ZU1A 2PW8H 2WV5A 1ABIH 1XVOA 2SGDE 1WTHD 4AFSA 1TBZH 3V0XA 1MUEB 3MWIU 1DX5M 2AIPA 1AI8H 4OS4A 4YLUA 3PWBA 1FAKH 3HATH 3Q3KA 4AYYB 1C5QA 1T8NA 1G36A 2GCTC 3T26A 1CGHA 1Q2WA 3TGIE 2ANKH 1O38A 2V6NA 1BBRK 4UFGH 3AAUA 1BHXB 1N1LA 1O2KA 1A7SA 1RXPA 3V13A 2FS9A 5AFZH 1ZMJA 3P8OA 2WPLS 2FOMB 1AB9B 2W7UA 2OINA 1BIOA 3F9GA 3U8RH 4AGKA 1DOJA 1AVWA 3LIWA 2A7JA 1DUAA 1P2NA 3UR6A 1CGIE 2ANYA 2GMTC 1VITF 5EQQA 3RMLH 1DANH 1C1MA 2VJ1A 1D4PB 3TJUA 1C5OH 1ELCA 2FI4E 3MHWU 6CHAC 2BY9X 2FOBA 2RA0A 4GSOA 5DO4H 1EAWA 1QGFA 1GI0A 1O3PB 4ZHMU 1ACBE 2VINA 3PTBA 5BRRE 1ZTLA 1VCQA 1JBUH 1C5ZB 1D3DB 3SU1A 1O3FA 1K1NA 2I6QA 3A7ZA 1O36A 2H9EH 3TGKE 3T27A 4DIHH 1P06A 5HM2A 3RDZA 3BEFB 4SGAE 1SOZA 1L4ZA 1LHCH 1W12U 2B9LA 1EZUC 1C2JA 3S69A 2VVCA 1TNGA 5JB9S 4KKDA 3UFAA 2BQWB 3MI4A 1MH0A 1MQ5A 1HAVA 1GI9B 1O2NA 2Z3EA 2ANMH 3M7UA 3HKIB 2CJIA 3QN7A 4NZQA 5CHAB 3KL6A 1NFXA 1AFQC 2W7SA 5A2MH 2FTMA 1VR1H 1F2SE 1ELGA 1O2TA 1V2TT 1MBQA 2D26C 4JYTA 1IQKA 1GJ6A 4ISLA 3GCHC 1SLWB 2ZDKA 5TCAA 1KXFA 1ZHRA 1KSNA 4ABFA 1F0TA 2HALA 3UIRA 4GHQA 4D9RA 1J16A 2XXLA 1RJXB 3U69H 3EA7A 3O8CA 1C5VA 1YPHE 4D7FA 3R3GB 1QTFA 1GGDC 3QTOH 3PLPA 1BTPA 2NWNA 4UE7H 2J34A 1G9IE 1ESTA 3T5FH 1O3OA 2ZFPH 2TGPZ 2FXRA 2VIVA 1O2PA 2RCEA 3TIUA 2BDIA 2V3HH 2FP7B 4Y8XA 2OQUA 2VIQA 2HOBA 2Y80A 1BMAA 2Y81A 3CP7A 1C5RA 5C1UA 2F3CE 2ZTZA 1XKBC 1S83A 1KXEA 4ISHH 5GCHG 1NESE 2EI8A 2GGVB 1K1OA 1UTKA 1EX3A 4FUDA 4E05H 3MO9A 4Y8YA 1KY9A 1CBWB 1MTNB 1JMOH 2G8TA 1C1WH 2TPIZ 3S0NA 5LH8A 4RKJB 1W0ZU 2FYQA 1QRZA 1TIOA 2JETB 1SLXB 4GVUA 5E0HA 1Y5AT 1O5GH 3KEEA 2BD7A 4X2YA 2OC0A 1MKWH 1YCPH 1GI1A 4JYUH 1S6FA 1GPZA 3RMOH 9ESTA 3LT3A 1TA6A 3D62A 1BITA 4Y6DA 1AKSB 1DWDH 1T4VH 1HGTH 1KXCA 2J95A 2Z6BD 4CRBA 1AVXA 1C2DA 4OGXA 1ZOMA 1UK3A 1O2OA 2YOLA 2BOKA 1UJ1A 1HAXB 2XRCA 1ELVA 2F83A 1SQTA 3TK6A 2AGIX 1JIRA 3A85A 4ZMAH 1DSUA 1Z6EA 5EXLA 1IQFA 1O3CA 4NIVA 1AB9C 1L0ZA 1QBVH 1ZSLA 1AE8H 1K1LA 4WH8A 2CF8H 1ZSKA 3ZYEA 5GWZA 1TPPA 1LPKB 2TIOA 2XTTB 1GI7B 4FVDA 2I6SA 3BIUH 1S5SA 4GAWA 3ZZCA 1EUFA 1F0UA 1OS8A 3E16B 5C20A 1EJNA 1A5IA 1EAXA 1TOMH 1TPSA 1Y5BT 1Z8IB 2BB4A 2CF9H 4Q7XA 3M37A 3WY8A 2HNTC 4KELA 3K2UA 2A0QB 3S9CA 1ESBA 2HWLB 3F6UH 1IOEA 1C5TA 2FLBH 1O39A 3LH3A 2P94A 5C5OA 1AE5A 1TBQH 2RA3A 4NFEA 3ZVGA 1YCPM 3JZ1B 4U01A 1L1NA 2DUCA 3E91A 4HTCH 4M7GA 1ZJKA 5C3NA 1HB0B 2Z9LA 1BOQA 1YC0A 1GJCB 1B7XB 3SV8A 3D23A 1CT4E 2OC8A 3H7TA 1IQNA 1JRSA 1VITH 2PTCE 5JB8S 3H5CB 1TNLA 2GCHG 3TGJE 1DICA 2O8LA 3UNSA 2ZFFH 2GKVE 4IBLH 4TPIZ 4D9QA 3TPIZ 1LKAA 1O3GA 2RG3A 5H4IB 5CHAC 5F03A 1YPLH 4X6MA 2GV7A 2XWBI 3ZYDA 4GCHF 3RU4D 4DIIH 5F6MA 1GI5A 1G2MA 1TYNA 1MCVA 1CT2E 1KXAA 1BT7A 3I29A 1LVMA 3IG6B 1YP9A 1GBBA 2A1DB 2BMGB 3SJ9A 3KQEA 1UO6A 4MNVA 5HGGA 3DFLA 1GG6B 1DLKB 3LC5A 2TGTA 1GBIA 3W95A 4JMYA 1HBTH 1GCDA 5AVDA 2ZDAH 1F92A 4YOJA 4THNH 2SGAA 1GHXH 2Y5HA 4DY7B 1GWAA 1D6WA 3B9FH 4X8UH 3PYHA 4U2WA 3BTTE 1C5SA 2G00A 3OSYA 1HXEH 1AUTC 1C2EA 1FY1A 2ZGCA 1OWIA 4ABIA 1QL7A 4B1TA 1ETTH 1ARBA 1O2ZA 8ESTE 1EB1H 4O03A 4BOHA 1O2YA 5T6DA 1W8BH 1VCPA 2PWXA 2UUKB 1V2RT 4I32A 4MPUA 3S9BA 1CHOG 1O3JA 2OP9A 4WJG2 2G51A 5HMAA 1C9TA 3MNCA 1HIAB 2FDAA 5LPRA 4X2WA 1ELAA 2JH6D 3K9XB 1D3TB 3A86A 1CBWC 1MTNC 2ZQ2A 1D6RA 2GT8A 1H9IE 1MZDA 1K1JA 2Y6TA 1C4V2 3Q00A 1W2KH 2GV6A 2JH5D 1C1TA 3ESTA 1SHHB 2ODYB 1ESAA 2Q6DA 3F1SB 1O5FH 3SORA 1GHWH 1AGJA 1SB1H 2AH4X 2JETC 2THFB 3BF6H 1C2FA 1Z8JB 1AMHA 4AOQA 3LGYA 2BXTH 4CRCA 1LQEA 2Q6FA 3V12A 2Y7XA 2A4RA 5TCCA 1DWBH 3FZZA 3RC5A 4MNYA 3E90B 4NA7A 1O3DA 1O5BB 4D7GA 4YT7H 4ZHAA 2XNIA 2BX4A 2ZHQH 3SHCH 1CSOE 1XUKA 3RU4T 3M5LA 1PQ7A 2SGFE 1G32B 1G2LA 2R2WU 2RDLA 2ZI2H 1RFNA 1HAZB 1ZR0A 1V2OT 4WMDA 3SU6A 1EB2A 1EAIA 4A1VA 2QF0A 2AYWA 4YOGA 3NWUA 2EC9H 3ATMA 1WCZA 5L30H 3SV7A 1SGQE 3RXLA 1TNIA 2ZFSA 6ESTA 1SGFG 1NU9A 7GCHF 1UTQA 3NXPA 4X1PU 1SGCA 1TQ0B 3W94A 1P3EA 1ANEA 3G01A 1O3MA 4X1RU 3RXKA 5AFYH 3EYDA 1EOLA 1TRYA 2TBSA 1C2GA 3MO3A 2C93B 4X0WU 1T8LA 4CBOA 2C3SA 4YZUA 4FU8A 4BANB 1HCGA 2PV9B 5AF9H 4WMEA 2GDEH 3SV9A 3B23B 4NIYA 1A0LA 1T7CA 2XBXA 3BTFE 1AKSA 3A7TA 1C1SA 1IQGA 1GVKB 3MO6A 5FBIA 3PMJA 1WQVH 3I78A 5DP8A 1J8AA 2XBYA 3GY6A 2WUCA 1C5UA 1YF4A 1QQ4A 1BRBE 1DDJA 4AG1A 3OX7U 2HPPH 3LGUA 4YM9A 2BYAX 3P95A 1EJMA 1DXWA 1DWEH 5A8ZA 1CQQA 3Q77A 3A8BA 1W14U 4RN6A 4X6OA 3VB4A 1P2KA 1OYQA 3GDSA 1NRNH 1GG6C 5F8TA 1LHEH 1CVWH 2Z9IA 1CGJE 5L6NH 1SGFA 1C1OA 2O9QA 2F9PA 1BDAA 1CT0E 1XUHA 3A7YA 4A5TS 3A8AA 3Q3XA 1H4WA 1LVOA 2SNWA 1MKXK 3ODFA 4X2XA 3GOVB 1XX9A 2A31A 1SQAA 2VU8E 2ZFTA 4MPWA 1FNIA 1P8VC 2TGAA 2EI6A 5ESBA 2J92A 3AW1A 3STJA 2WPKS 1GBJA 2QYIA 3PO1B 4Y7AA 3GICB 3SUEA 5EW1H 1TQ7B 2Y7ZA 1RIWB 2GVFA 3VEQB 3MYWA 2D8WA 3ZZ4A 3ODDA 2QGRA 5LPFA 1G3DA 1BA8B 2P3FH 3VB7A 3DD2H 3M3SA 1ZSJA 1QJ6B 2BD5A 1TRMA 1IQIA 3SNBA 4B76A 3NZIA 4I33A 1BBRE 1U6QA 2ZHDA 1O2XA 4INKA 5DP4A 1QBNA 4BAOB 1QY6A 2H5DA 5GPIB 1C1QA 4FUJA 4WH6A 1FY8E 2QXJA 1HJAB 2G55A 1QRXA 2AIQA 2PR3A 1J14A 1W11U 1ZPBA 1P57B 1BB0B 1TPOA 1QRWA 1O3AA 2AGGX 3VB6A 1WTGH 2HRVA 2YNAA 3ATIA 5BPEA 3BTDE 2DE9A 3KF2A 3SO3A 1TMTH 3E8LA 3GYMA 1ZYOA 8GCHF 3A80A 1MAXA 4JZ1A 1HJ9A 1ANBA 1S85A 4LOYH 3PB1E 1EAUA 1NT1A 1FXYA 1C5MD 3MTYA 2J38A 1YLDA 1KXBA 4B74A 3FP7E 1NFWA 2AMDA 4KGAA 4Y11E 1GHZA 1HIAA 1QURH 5HYOA 4IMQA 2VIOA 1PJPA 3RXQA 1TX6A 1T8OA 1Q3XA 3EA8A 3FAOA 2NU3E 1J9CH 4WXVA 1GCTB 4H6TA 2R3YA 1P09A 1S0QA 4AB9A 5DPAA 4I8KA 1KYNA 2ZU3A 4Y71A 3LGVA 2BD2A 4JZIA 5EXNA 3P8NA 1RGQA 5ESTE 3ZZ8A
chains in the Genus database with same CATH superfamily
1IAUA 1O2MA 1L1GA 3BG4B 3SNEA 4AFZA 3ZZ9A 1MZAA 3SJIA 4XE4A 2BDHA 2ZTXA 4MNWA 1O31A 2AEIH 2NU4E 1NU7B 3MU1A 1A4WH 3OY6U 5IDKA 1O5DH 4YT6H 1MU6B 2W3IA 1P04A 1MTVA 3SU4A 4NWLA 2PTNA 3QGJA 1THSH 5FX5A 1NO9H 1GBKA 3TNTA 1DITH 3Q3YA 2J98B 2VVVA 1YLNA 2BD9A 2KFWA 2Y5FA 1Y3WA 3M3TA 3GY5A 4F49A 3HGPA 2BXUH 3Q76A 1GHAF 1FN6A 1AU8A 1L2EA 3RXRA 1V2JT 1KMHB 4K8BA 4X1NU 1EATA 1QCPA 1V2UT 1YPHC 2WINI 1XXDA 3DT0H 1NS3A 2QXHA 2ZDMA 4NG9H 5DN6D 1P05A 5IYTA 1KTSB 1B0FA 2BQ6B 4INHA 4D76A 1OP0A 2ZU4A 5B6OA 3QK1A 1ZRBA 4ABHA 4E7NA 4RSPA 1IQLA 1CO7E 3GCTF 3PO1C 4UD9H 1O5EH 3MU8A 4K69A 2VWLA 4Y0ZE 1SR5C 1RIWC 2Z7FE 3GCOA 1E79D 1GI8B 3MOCA 5J4QA 1GL1A 2PSXA 4HFPB 1UMAH 4FU7A 2QA9E 2C8WB 1SPJA 1JWTA 1ABJH 4JCNA 3M35A 4X6NA 1CU1A 2GP9B 4MPXA 1LTOA 1TBRH 2AHME 2JJ1D 2Z9GA 2KM0A 3ITIA 3RXBA 3EE7A 1V2PT 4RT1A 4BXWA 2FX6A 2WPMS 3STIA 1LO6A 1ZPZA 3L3TA 3RLYH 1AWFH 1BTZA 1S84A 2A4QA 3GDVA 3O8BA 3RUOA 2D1JA 1O0DH 3RLWH 1G37A 4ISOA 2LPRA 2FM2A 1NN6A 1QJ1B 3SI3H 1LHFH 5L2ZH 4FU9A 2V35A 2VIDA 2AMQA 4WWYA 4U32A 3HK6B 3OYPA 4ABGA 1HJAC 2J97A 3BSQA 3MH6A 1O2JA 3SUGA 2CGAA 5KGOA 1XKAC 1GL0E 4YTAA 2Y5GA 4DG4A 3V3MA 3SV2H 1HNEE 4KTSA 1A5HA 3SBKA 1VZQH 4ZXYH 1K1PA 1O3BA 3VPKA 1E37B 3QZRA 5PTPA 1Y59T 2PUXB 3UY9A 3SV6A 3QO6A 1BJVA 2WV4A 4Y10E 2Z3DA 1BTHH 1JRTA 1O3EA 2EA3A 2FOCA 4CH8B 1O3IA 3FFGA 1JXPA 5DSFA 2ZPSA 1DFPA 1XMNB 3T62A 1ORFA 4O3TA 3RXMA 2BY6X 2GZ9A 1O3KA 1GDNA 4ZKSU 3RC6A 3K6YA 4UFFH 1O35A 3HKJB 4BAHB 7ESTE 5AHGH 3SGBE 1TA2A 4GPGA 1UCYK 2B7DH 1YYY1 1GMHG 3LPRA 3LONA 1ELFA 1DY9A 2IJD1 5FX6A 3BIVH 4ISNA 1C2LA 3GCNA 1MKXH 5FAHA 1GJ4H 1P9SA 2G4UA 1C5LH 3LJOA 3EDXB 1ZZZA 1GCTC 5EQSA 4CRGA 3FZDA 1XUGA 4B2BA 1KLIH 2BOHB 3RM0H 1K2I1 1BRUP 1QFKH 3D65E 4XSKU 1GMDG 1QB6A 3MH4A 3LGWA 3OTPA 1QNJA 4DJZB 4I8HA 1THRH 3BG4C 1FI8A 1AIXH 2JH0D 1N6XA 6GCHG 1FV9A 2NU2E 2Y82A 3ZVAA 1O32A 3OTJE 2GTBA 4MNXA 1IQJA 2P8OB 3NUMA 4K1EA 3AASA 2ZA5A 2VNTA 1DT2A 1NY22 3UR9A 2ZIQH 1C5WB 4FUBA 4NA9H 1EZSC 1T8MA 2BM2A 1C1PA 1F5RA 2ZECA 1XXFA 2P3TB 5SGAE 3SQEE 5DP7A 5EPNA 2FEQH 3SGAE 1A61H 3F68H 3UUZA 1GMCG 1H8IH 4K5ZA 1S0RA 1VKYA 2FPZA 1DVAH 3T25A 2QY0B 2FS8A 2M5TA 3FKSD 4ABEA 4UFDH 1ZMNA 5A09A 3LJJA 3MMGA 1H8ED 1K1MA 1PPFE 4LK4A 2ZDNA 3ZVEA 3SGQE 3K65B 4Z1MD 1GBAA 2Z9KA 4NIWA 3DSGA 3T29A 1AN1E 3H09A 4WF8A 5HIZA 2FOEA 4CREA 2O8WA 1UVPA 3MU4A 4O9VA 4Q4LA 1ZTJA 2BDGA 4ZXXH 1UTMA 1UK2A 1XUFA 2XBVA 1GHBG 2UWLA 1XM1A 1NM6A 5DGJA 1X7AC 3E0PB 5CE1A 1A1RA 3QTVH 1BTXA 1GBDA 4ZKOU 1A2CH 6LPRA 1F5KU 2SGPE 1ZJDA 2B0FA 3KQBA 3SW2B 2W5EA 3LGIA 3FP6E 4I8JA 1ZGVA 1TGNA 2A4GA 3LKWA 3SYJA 5A8YA 3ZZDA 3S9AA 1LVBA 5GCHF 1BBRH 2BD3A 1V2QT 4UDWH 2ALPA 3PLKA 5EIYA 1O30A 3GY7A 5A0CA 1BJUA 1OXGA 4HZHA 1AY6H 3BTWE 1E1RD 3ZV8A 2VBCA 1A3BH 1OWKA 1ZLRA 1TRNA 3LC3A 3VXFH 4H6SB 2FI5E 2QV1A 3PMBB 2A7CA 2XOKD 3AVZA 3BTKE 1C5YB 1O2SA 3H7OA 2A2XH 1K9OE 1MD7A 4X6PA 4Z6AH 4XBBA 2BX3A 2W3KA 1EXFA 4BNRA 3KGPA 2BZ6H 2J98A 3GS9A 1W0JD 1AUJA 2KAIB 1C1NA 3GYLB 2QF5A 4AZ2B 3UTUH 4BAMB 2BY8X 4NA8A 1KDQB 3UWIA 4B2CA 3A81A 3KYFA 1YWUA 3RC4A 3VGCB 1GDQA 4O3UA 2PUQH 5KEDA 1GJ5H 1P12E 1O2QA 1W7XH 2VIPA 4MTBA 2VWMA 1BTUA 1THPB 2A7HA 3C1KA 1NTPA 4J2YB 3ZVFA 1GBEA 3TITA 4MQAA 3SJOA 4MLFB 2CXVA 2J4IA 3TJVA 3FO8D 5DP5A 4ZKRU 3MQKC 4A92A 3BEIB 1L4DA 1RTLA 3KCGH 1QL8A 3I77A 4NCYA 1O37A 1P3CA 2ZHWH 2K8IA 3RXCA 2F91A 1IHSH 1SQRA 2BZAA 4X8TH 2XC0A 2PFEA 3MNSA 2VIWA 5JBBS 3S7KB 4WXIA 1TX7A 2OD3B 4X1QU 3SJ8A 2VH6A 1HV7A 3SUFA 1HAIH 4HI3A 1GJBB 4NSYA 2FOHA 3SI4H 1QIXB 3EA9A 3SU3A 1SGYE 1TONA 1XUIA 2R3UA 2ZCHP 1Z8GA 7KMEH 3RM2H 1F0SA 3RXOA 1TGSZ 4WY3A 3M5MA 4I8GA 3PLBA 3QZQA 1KTTB 3UNQA 4H4FA 3DA9B 1S81A 3OAAD 1D3QB 4X1SU 1WU1A 2Z3CA 4OGYA 1TGTA 2P95A 2ZCKP 4Z0KA 4MVNA 1T31A 2XWAA 1PQ8A 3KIDU 4YXWD 2GCHF 2P8OC 3SUDA 4DURA 3A88A 4CH2B 5FPYA 1YKTA 3CS7A 4FUEA 1OX1A 4A7IB 2UUFB 1H1BA 4Q63A 1WYKA 1BMMH 1EPTB 5DKMA 1P01A 3PWCA 3PROA 5B6LA 1CE5A 1LHDH 1NFUA 4SGBE 3NK8A 3QUMP 5EG4A 3URDA 3IWMA 1WV7H 4ISIH 5JDUB 5C17A 1O2RA 1OP8A 4UFEH 1W7GH 1C1VH 2SNVA 3RXTA 1NRSH 4VGCB 1PPGE 3VB3A 4ABJA 5T6FA 2XW9A 2LELA 1SGPE 3PV4A 3TVJB 3LH1A 1YPMH 4XBCA 1Q31A 2ODPA 1GBCA 2ZZUH 3RXDA 2J9NA 2QN5T 2A5KA 2WPIS 3F2FA 4B6EA 3SHAH 4X2VA 3A7WA 1VITG 2WPHS 1YGCH 2FOFA 4AN7A 4E06H 9LPRA 1BUIA 4IN1A 4A1XA 1M9UA 1O3LA 5A0AE 3RP2A 4BAKB 3M5NA 1BRAA 2UUYA 1UHBB 1GBTA 5I46H 1Y3UA 4DGJA 4TYDA 1FX0B 2KCPA 1GJ8B 5DJ7A 3VFEA 1V3XA 1QL9A 1CHOF 2OXSA 1HYLA 5JYIA 5FCRA 1NROH 3ATWA 2WSSD 4ACAA 1UCYH 1TALA 3M5OA 3CS0A 1OPHB 1TGBA 2GJGA 4DT4A 2ZC9H 4BTUB 1S6HA 2AS9A 3A89A 5CHBA 1UTNA 4IGDA 2J5UA 1CHGA 1YLCA 3D49H 2ZTYA 2FIRH 1LMWB 5EXMA 1O2HA 1FY4A 3RMMH 5JBCS 2EEKA 3E1XB 1WQSA 5FBEA 2H5CA 3E0NB 1PQ5A 1INCA 3T28A 2GZ8A 2ZWLH 1SFQB 3VGCC 1C5PA 1HAGE 1VJAU 2GD4B 2W26A 3TJNA 3URCA 1O3NA 4OM9A 2ZQ1A 1ZHPA 2OBQA 3ZZ5A 1A0HB 2O8UA 3LGTA 4ESTE 3P8FA 2ZGJA 1C5NH 5JBAS 2PKAB 3M7QA 2G52A 1QJ7B 4A6LA 1MTWA 1AWHB 3BG8A 2FTLE 1OP2A 3SZEA 4K1SA 2OQ5A 1V2WT 3BTEE 2XNDD 2F9OA 2ZPQA 4Q80A 4TWYA 1QB9A 2XBWA 1AD8H 5F8XA 1C2IA 4O97A 4ZROA 2F9BH 5E0JA 1C4U2 4BTIB 1MBMA 1ZHMA 4I8LA 2UWPA 1Y3XA 3FN8A 1PYTD 4NFFA 3UQVA 4IS5A 3MH7A 4B71A 4NSVA 8KME2 1ELTA 3RXFA 3E3TA 3V7TA 4IMZA 4GHTA 1ZTKA 5C67A 3FANA 1NC6A 3SU0A 1A3EH 1V2LT 1YPGH 3U1JB 1FAXA 2LNCA 1FLEE 2QXGA 1SVPA 5DP6A 2PLXA 4NGAH 1C2MA 2A32A 2STBE 1SG8B 3MU5A 1GBHA 2HLCA 4XBDA 4UONA 5CMXH 4KP0A 3RXJA 1P2OA 3MU0A 4CHAB 3RXVA 2ZHFH 1F5LA 1C1UH 3DHKH 2HGTH 2BY5X 1TNJA 5GXPA 1LQDB 1NFYA 5T6GA 1LPGB 2F9UA 2EQNA 2KAIA 3UB0A 5ETXA 3P17H 1P9UA 1EPTC 2C8ZB 1KDQA 1YM0A 2ULLA 4DT7B 3SU2A 4I31A 3TK9A 2ZCLP 1CA0B 5K7RA 1BZXE 2Z9JA 1FZZA 1SLVB 4FETA 2WUBA 3NKKA 2ZHEH 2TRMA 1F7ZA 4VGCC 3ZZAA 1SGRE 1K21H 2PKSB 1AVGH 2AERH 2BDBA 3A7VA 1S82A 2P93A 3MFJA 3BV9B 3U8OH 2BDCA 5G4BA 2BHGA 2F9VA 3M3VA 2ZGHA 3PTNA 1C1RA 4FUFA 2QC2A 4OS1A 2PHBA 5FPTA 4K60A 3SNAA 1W0KD 4GUXA 1SL3A 1C2KA 2BLQA 1O2LA 3VXEH 4B75A 4F4OC 2BLWA 4K8YA 1DWCH 4FUGA 2BTCE 3M7TA 4H42U 4JYVH 4AB8A 1TNHA 5LGOA 2ZU2A 1QA0A 3MNXA 1AZ8A 3U1IB 3F9HA 4AGJA 1UTPA 1E1QD 2JDID 3RXAA 4K3JA 2ZPRA 4TY7A 2ZG0H 1GDUA 1TB6H 2F43B 3CENA 2FO9A 5L2YH 4ABBA 2D2DA 4U30A 1OWJA 1KIGH 1RD3B 4MPVA 2QE7D 3IITA 2ZP0H 2PSYA 5GIBA 1BMNH 1HPGA 2V7QD 3NCLA 5J4SA 4YLQH 3RXUA 2AFQB 1V2NT 5JBTA 1EPTA 2F4LA 1WAYB 4JZDH 3GY2A 3TH3H 1MTUA 2OUAA 3R0FA 1SGIB 2SFAA 2ZGBH 1G3EA 1H8DH 1T4UH 2QXIA 3RXEA 3F3BA 1NRRH 3OFND 1SGDE 3M36A 2TGDA 2R0LA 2IPHA 4GCHG 3F9EA 5E0GA 2VGCB 2H2ZA 1HUTH 3BTHE 5I25A 1TOCB 1ELBA 1VJ9U 4KTUA 5DP9A 2R9PA 2F9NA 1EFRD 4WMFA 5C0UA 1N6YA 1UTJA 3A8CA 4LXBH 1UCYE 5TJXA 3RXGA 4ABDA 1SI5H 1O2VA 1EASA 1WBGB 2XC5A 2C90B 3GISB 4DOQA 5GDSH 3A8DA 1P11E 3N7EA 1PFXC 1QBOA 2CK3D 3LOXA 1MQ6A 1DLEA 5DK1A 1Z1JA 3EGKH 2L6OA 1YPJH 5EJ1A 2CV3A 2XC4A 1A0JA 2XCNA 1UTOA 3TK5A 1F0RA 2H1UA 1WOFA 1GJAB 2ANWA 1UHBA 3SJKA 1O34A 4FXGH 1A46H 2BVXH 4TPYA 1OWDA 4XFQA 2OK5A 3WW7A 2GX4A 3MNBA 2HVXA 2V0BA 5EGMA 2OBOA 1P02A 1Z1IA 3B8JA 3F0PA 2ZO3H 3RU4E 3OE7D 1D9IA 1YBWA 1DXPA 1P2JA 1ELDE 3SN8A 4ABAA 3JZ2B 3TJOA 4Q2KA 2J2UA 1KLJH 1EZQA 2ZDVH 1SBWA 4ZHLU 1TABE 2R0KA 4IC5A 2CHAB 4OS5A 3BTQE 5A8XA 2HPQH 4CHAC 1P03A 3KN2A 2BDYA 3QWCH 1OWHA 3ZZ6A 1NPMA 2H9TH 5C1XA 2UUJB 2FOAA 3RXPA 1UVTH 2EY4C 1G3CA 1GBLA 1O3HA 2PGBB 2FYRA 2XYAA 4FUIA 5FPSA 1JOUB 1BMFD 1CA0C 4B6FA 1H9HE 1H9LB 3UREA 5HIYA 1FPCH 1LHGH 1FIWA 3P8GA 1VGCB 4HG6A 2J94A 4BAQB 4CR9A 2PKAA 2FODA 1LDTT 2WZQA 1K22H 1CA8B 1UVOA 2OLGA 1DPOA 1O2UA 1J15A 1RTFB 2PKSC 3A87A 1QA7A 3PMAB 3PM3A 1YPEH 1Y5UT 2IN2A 3HK3B 4E7RG 4K2YA 1EOJA 3P70B 1IQEA 1OOKB 4FVBA 4JK6A 1V2KT 2ZDLA 1Z6JH 2ZKSA 3NPSA 3U8TH 2IOTA 3PV2A 1O2IA 2BQ7B 3U9AH 1O2GH 1TNKA 1W3CA 4YO9A 4JZEH 4IN2A 1HAYB 3L33A 1NBME 4PROA 2YMSD 3T2NA 4BXSA 1GJ7B 3QGNB 3KQDA 1HJ8A 2WPJS 1LVYA 1GI3A 3BN9A 4CR5A 1ID5H 3LDXH 2VB0A 1C4Y2 1SQOA 4ASUD 3F0OA 2FX4A 2OC1A 4Y79A 1XUJA 7GCHG 3FVFB 3PMHB 3UWJH 1EZXC 5EOKA 4DW2U 1GVZA 1FUJA 1TE0A 4ZKNU 2HNTE 1E38B 4Y76A 1QR3E 2STAE 3ZZ3A 2QF3A 2H6MA 3KHVA 2UWOA 1GHVH 3TU7H 2ILNA 2BDAA 1MU8B 5EJZA 1AFEH 3QLPH 4NZLA 1E0FD 1TLDA 1RRKA 2GDDA 4Y7BA 4CRDA 2G5NA 1SGTA 1RTKA 4AX9H 1PPEE 2QF4A 1DUEA 1ETSH 1P2MA 1C5XB 1GJ9B 4M9FA 4CRAA 1WDIA 5E8EH 3OY5U 2P16A 2WYGA 2VGCC 1LPZB 2GZ7A 4AFQA 1IHTH 4IC6A 2VVUA 5EQRA 1UK4A 1HAPH 3E6PH 3KQ5A 5EW2H 3L6PA 3A83A 4TY6A 3WWFA 3GDUA 1HLTH 5FXLA 1LKBA 2BY7X 3S7HB 1HRTH 3HPTB 2PP6A 3DUXH 3HGNA 1LCYA 4NWKA 3EE0B 2IJOB 4DCDA 2O8MA 4MG3A 1AO5A 1GI4A 1KLTA 4ZH8A 1SGNE 1T32A 4AYVB 1OYTH 3UPEA 3GY3A 1IQMA 1B5GH 1OWEA 2WHXA 4OS2A 2EI7A 1DSTA 1GBMA 1GJDB 1FIZA 2W6ID 3UOUA 2B8OH 5C2ZA 3SNCA 2FWWA 1QHRB 5C5NA 1D3PB 4CBNA 5HXFA 3SOSA 1ANDA 1TMUH 2BVRH 1O5CB 3ZZBA 1GI2A 1B0EA 1UW7A 2JJ2D 4X8VH 1HAOH 2ASUB 1MD8A 3SU5A 1K1IA 2ALVA 3F9FA 1N8OB 4QT8C 1A5GH 3QDZB 1GMHF 3ENSB 3K6ZA 3RXSA 1SKYE 1OHHD 3KQCA 1ZMLA 1ETRH 5FCKA 1QB1A 4XOJA 1ELEE 4R0IA 1FMGA 5F8ZA 1TPAE 1BCUH 3RMNH 1PPBH 1EP6A 1BHXF 2AGEX 1SSXA 1TWXB 2QAAA 2K1QA 2CHAC 2A5IA 4OS7A 1L1JA 5EODA 2A2QH 2L74A 3GY8A 1GMDF 2JKHA 2GT7A 5DG6A 1PPCE 1O33A 4ZCNA 1AQ7A 5E2PA 5GNDA 1TX8A 6GCHF 1MTSA 3AAVA 1FY5A 1WSSH 1ZGIA 1EQ9A 2ZGXH 3OU0A 3P92A 5JPMH 4FUHA 5HM9A 5C1YA 3DFJA 3UQOA 1Y3VA 2B5TB 5E2OA 1UVSH 5LPEA 1VGCC 4UEHH 4Y0YE 1Y8TA 1EJAA 1O2WA 3PV5A 3FP8E 1AZZA 1HAVB 2HNTF 3A7XA 2NU1E 4LZ1H 4RI0A 4XDEA 1FN8A 5DP3A 3A84A 2BD8A 1GMCF 3QX5H 4IW4E 5T3HA 1PQAA 1FY3A 2FI3E 2GCTB 8GCHG 1PYTC 3A82A 1HXFH 1UTLM 3ZZ7A 1SOTA 4X8SH 5EPYA 2SGEE 1P10A 2XCFA 1SMFE 2NU0E 1WUNH 1V2ST 2G4TA 1O5AB 3BTME 4AORA 4Y8ZA 1TGCA 5A0BA 5KECA 3ZVDA 2CN0H 1COWD 2P59A 3GY4A 1WXRA 1YPKH 2FESH 1DS2E 1E36B 3TNSA 2GMTB 5K0HA 4Q7ZA 1GHBF 4I7YH 1DY8A 3TLOA 2BD4A 2Q6GA 1TAWA 1G30B 4BTTB 3TH4H 1K0HA 8LPRA 6CHAB 1V2MT 2C4FH 1GI6A 2PGQB 4LZ4B 3TH2H 3UNRA 2BVSH 2P3UB 1W10U 3M61U 3RXHA 2FMJA 2Q1JA 1GHYH 2O8TA 1S6LA 1J17T 1SHYA 3PRBA 1MKWK 1YCPK 4K1TA 2G5VA 4JK5A 1HAHH 1MMJN 1Y3YA 1HDTH 3SNDA 4OS6A 2VH0A 3SQHE 2YNBA 4AG2A 2R2MB 1FJSA 2FLRH 1DM4B 3ZV9A 1IQHA 1P2QA 5IK2D 1DE7H 1AHTH 3AW0A 4AC9A 1VCWA 2A5AA 1FDPA 3O8RA 1MAYA 2QIQA 3MH5A 2H9HA 1P2IA 4RKOB 4ACBA 1BMLA 1KXDA 4FUCA 4DVAU 1OSSA 1EP5A 2A4OA 3OEHD 1TFXA 3P6ZB 1AFQB 3EAJA 3N7OA 1FQ3A 4J1YA 1Z71A 1XVMA 2Z94A 1V2VT 2BLVA 1C2HA 1GBFA 1SGEE 1Z7KA 1E35B 1PPHE 5EU8A 2YMSB 1QQUA 3GCHB 4YESB 2OC7A 3ELAH 1GHAG 4JZFH 3LU9B 1Z8RA 2G81E 7LPRA 1JIMA 1UVUH 4D8NA 2ZEBA 2V3OH 1BTWA 3ZVCA 2C8YB 1BRCE 1SC8U 2OTVA 2ZFQH 2ZF0H 1EKBB 2VWOA 2VWNA 1GVLA 1SLUB 1E34B 4B2AA 3O8DA 4HGCA 1OKXA 1GGDB 3C27B 3ZVBA 3OEED 2FZZA 3EQ0H 3GCTG 1NRQH 5ABWA 4RT0A 2ZU5A 3ATKA 1N8OC 4AFUA 2HLDD 4A1TA 1W13U 2A45B 2CMYA 1K28D 1NZQH 4CRFA 1ANCA 4MDSA 1ZPCA 4YOIA 2OCVB 2ZFRH 1MCTA 1NRPH 3VB5A 2ODQA 1TMBH 4NIXA 4TWWA 4KTCA 1HFDA 1SFIA 1W0YH 2C8XB 4INLA 4R8TB 1C9PA 3UOPA 2AMPA 2WYJA 2BLOA 1ZRKA 2FOGA 4ZUHA 5GJ4B 3KNXA 2SGQE 1V6DA 2DE8A 4WVPE 1FONA 3BTGE 1QZ8A 1RS0A 3RXIA 4B73A 1FPHH 3SZNA 4Q7YA 4ZAEA 4ASHA 4GLYA 2ZNKH 2ESTE 2QCYA 1BTYA 1P0SH 1G3BA 1ARCA 3BEUA 1BQYA 5FHTA 3ATLA 1PPZA 3U98H 2ZU1A 2PW8H 2WV5A 1ABIH 1XVOA 2SGDE 1WTHD 4AFSA 1TBZH 5HKKD 3V0XA 1MUEB 3MWIU 1DX5M 2AIPA 1AI8H 4OS4A 4YLUA 3PWBA 1FAKH 3HATH 3Q3KA 4AYYB 1C5QA 1T8NA 3DSOA 1G36A 2GCTC 3T26A 1CGHA 1Q2WA 3TGIE 2KZ4A 2ANKH 1O38A 2V6NA 1BBRK 4UFGH 3AAUA 1BHXB 1N1LA 1O2KA 1A7SA 1RXPA 3V13A 2FS9A 5AFZH 1ZMJA 3P8OA 5C0TA 2WPLS 2FOMB 1AB9B 2W7UA 2OINA 1BIOA 3F9GA 3U8RH 4AGKA 1DOJA 1AVWA 3LIWA 2A7JA 1DUAA 3U28C 1P2NA 3UR6A 1CGIE 2ANYA 2GMTC 1VITF 5EQQA 3RMLH 1DANH 1C1MA 2VJ1A 1D4PB 3TJUA 1C5OH 1ELCA 2FI4E 3MHWU 6CHAC 2BY9X 2FOBA 2RA0A 4GSOA 5DO4H 1EAWA 1QGFA 1GI0A 1O3PB 4ZHMU 1ACBE 2VINA 3PTBA 3DCLA 5BRRE 1ZTLA 2JIZD 1VCQA 1JBUH 1C5ZB 1D3DB 3SU1A 1O3FA 1K1NA 2I6QA 3A7ZA 1O36A 2H9EH 3TGKE 3T27A 4DIHH 1P06A 5HM2A 3RDZA 3BEFB 4SGAE 1SOZA 1L4ZA 4XD7D 1LHCH 1W12U 2RDEA 2B9LA 1EZUC 1C2JA 3S69A 2VVCA 1TNGA 5JB9S 4KKDA 3UFAA 2BQWB 3MI4A 1MH0A 1MQ5A 1HAVA 1GI9B 1O2NA 2Z3EA 2ANMH 3M7UA 3HKIB 2CJIA 2KCOA 3QN7A 4NZQA 3KL6A 5CHAB 1NFXA 1AFQC 2W7SA 5A2MH 2FTMA 1VR1H 4FOUC 1F2SE 1ELGA 1O2TA 1V2TT 1MBQA 2D26C 4JYTA 1IQKA 1GJ6A 4ISLA 2YMSC 3GCHC 1SLWB 2ZDKA 5TCAA 1KXFA 1ZHRA 1KSNA 4ABFA 1F0TA 2HALA 3UIRA 4GHQA 4D9RA 1J16A 2XXLA 1RJXB 3U69H 3EA7A 3O8CA 1C5VA 1YPHE 4D7FA 3R3GB 1QTFA 1GGDC 3QTOH 3PLPA 1BTPA 2NWNA 4UE7H 2J34A 1G9IE 1ESTA 3T5FH 1O3OA 1MABB 2ZFPH 2TGPZ 2FXRA 2VIVA 1O2PA 2RCEA 3TIUA 2BDIA 2V3HH 2FP7B 4Y8XA 2OQUA 2VIQA 5T1VA 2HOBA 2Y80A 1BMAA 2Y81A 3CP7A 3W1EA 1C5RA 5C1UA 3NRLA 2F3CE 2ZTZA 1XKBC 2KCAA 1S83A 1KXEA 4ISHH 5GCHG 1NESE 2EI8A 2GGVB 1K1OA 1UTKA 1EX3A 4FUDA 4E05H 3MO9A 4Y8YA 1KY9A 1CBWB 1MTNB 3CNRA 1JMOH 2G8TA 1C1WH 2TPIZ 3S0NA 5LH8A 4RKJB 1W0ZU 2FYQA 1QRZA 1TIOA 2JETB 1SLXB 4GVUA 5E0HA 1Y5AT 1O5GH 3KEEA 2BD7A 4X2YA 2OC0A 1MKWH 1YCPH 1GI1A 4JYUH 1S6FA 1GPZA 3RMOH 9ESTA 3LT3A 1TA6A 3D62A 1BITA 4Y6DA 1AKSB 1DWDH 1T4VH 1HGTH 1KXCA 2J95A 2Z6BD 4CRBA 1AVXA 1C2DA 4OGXA 1ZOMA 1UK3A 1O2OA 2YOLA 2BOKA 4TT3D 2WPDD 1UJ1A 1HAXB 2XRCA 1ELVA 3FOAA 2F83A 1SQTA 3TK6A 2AGIX 1JIRA 3A85A 4ZMAH 1DSUA 1Z6EA 4TSFD 2KCYA 5EXLA 1IQFA 1O3CA 4NIVA 1AB9C 1L0ZA 1QBVH 1ZSLA 1AE8H 1K1LA 4WH8A 2CF8H 1ZSKA 3ZYEA 5GWZA 1TPPA 1LPKB 2TIOA 2XTTB 1GI7B 4FVDA 2I6SA 3BIUH 1S5SA 4GAWA 3ZZCA 1EUFA 1F0UA 1OS8A 3E16B 5C20A 1EJNA 1A5IA 1EAXA 1TOMH 1TPSA 1Y5BT 1Z8IB 2BB4A 2CF9H 4Q7XA 3M37A 3WY8A 2HNTC 4KELA 3K2UA 2A0QB 3S9CA 1ESBA 2HWLB 3F6UH 1IOEA 1C5TA 2FLBH 1O39A 3LH3A 2P94A 5C5OA 1AE5A 1TBQH 2RA3A 4NFEA 3ZVGA 1YCPM 3JZ1B 2RFKC 4U01A 1L1NA 2DUCA 3E91A 4HTCH 4M7GA 1ZJKA 5C3NA 1HB0B 2Z9LA 1BOQA 1YC0A 1GJCB 1B7XB 3SV8A 3D23A 1CT4E 2OC8A 3H7TA 1IQNA 1JRSA 1VITH 2PTCE 5JB8S 3H5CB 1TNLA 2GCHG 3VG8A 3TGJE 1DICA 2O8LA 3F2HA 3UNSA 2LP6A 2ZFFH 2GKVE 4IBLH 4TPIZ 4D9QA 3TPIZ 1LKAA 1O3GA 2RG3A 5H4IB 5CHAC 5F03A 1YPLH 4X6MA 2GV7A 2XWBI 3ZYDA 4GCHF 3RU4D 4DIIH 5F6MA 1GI5A 1G2MA 1TYNA 4I86A 1MCVA 1CT2E 1KXAA 1BT7A 3I29A 1LVMA 3IG6B 1YP9A 1GBBA 2A1DB 2BMGB 3SJ9A 3KQEA 1UO6A 4MNVA 5HGGA 3DFLA 4XRNA 1GG6B 1DLKB 3LC5A 2TGTA 3F2GA 1GBIA 3W95A 4JMYA 1HBTH 1GCDA 5AVDA 2ZDAH 1F92A 4P02A 4YOJA 4THNH 2SGAA 1GHXH 2Y5HA 5FL7D 4DY7B 1GWAA 1D6WA 3B9FH 4X8UH 3PYHA 4U2WA 3BTTE 1C5SA 2G00A 3OSYA 1HXEH 1AUTC 1C2EA 1FY1A 2ZGCA 1OWIA 4ABIA 1QL7A 4B1TA 1ETTH 1ARBA 1O2ZA 8ESTE 1EB1H 4O03A 4BOHA 1O2YA 2IPQX 5T6DA 1W8BH 1VCPA 2PWXA 2UUKB 1V2RT 4I32A 4MPUA 3S9BA 1CHOG 1O3JA 2OP9A 4WJG2 2G51A 3AK5A 5HMAA 1C9TA 3MNCA 1HIAB 2FDAA 5LPRA 4X2WA 1ELAA 2JH6D 3K9XB 1D3TB 3A86A 1CBWC 1MTNC 2ZQ2A 1D6RA 2GT8A 1H9IE 1MZDA 1K1JA 2Y6TA 1C4V2 3Q00A 1W2KH 2GV6A 2JH5D 1C1TA 3ESTA 1SHHB 2M2AA 1NBMD 2ODYB 1ESAA 2Q6DA 3F1SB 1O5FH 3WWBA 3SORA 1GHWH 1AGJA 1SB1H 2AH4X 2JETC 2THFB 3BF6H 4P00A 1C2FA 1Z8JB 1AMHA 4AOQA 3LGYA 2BXTH 4CRCA 1LQEA 2Q6FA 3V12A 2Y7XA 4F55A 2A4RA 5TCCA 1DWBH 3FZZA 3RC5A 3N7DA 4MNYA 2HVYB 3E90B 4NA7A 1O3DA 1O5BB 4D7GA 4YT7H 4F48B 4ZHAA 2XNIA 2BX4A 2ZHQH 3SHCH 1CSOE 1XUKA 3RU4T 3M5LA 1PQ7A 2SGFE 1G32B 1G2LA 2R2WU 2WV9A 2RDLA 2ZI2H 5EJLA 1RFNA 1HAZB 1ZR0A 1V2OT 4WMDA 3SU6A 1EB2A 1EAIA 4A1VA 2QF0A 2AYWA 4YOGA 3NWUA 2EC9H 3ATMA 1WCZA 5L30H 3ZIAD 3SV7A 1SGQE 3RXLA 1TNIA 2ZFSA 6ESTA 1SGFG 1NU9A 1YY3A 7GCHF 2KX4A 1UTQA 3NXPA 4X1PU 1SGCA 1TQ0B 3W94A 1P3EA 1ANEA 3G01A 1O3MA 4X1RU 3RXKA 5AFYH 3EYDA 1EOLA 5CDFE 1TRYA 2TBSA 1C2GA 3MO3A 2C93B 4X0WU 1T8LA 4CBOA 2C3SA 4YZUA 4FU8A 4BANB 1HCGA 2PV9B 5AF9H 4WMEA 2GDEH 3SV9A 3B23B 4NIYA 1A0LA 1T7CA 2XBXA 3BTFE 1AKSA 3A7TA 1C1SA 1IQGA 1GVKB 3MO6A 5FBIA 3PMJA 1WQVH 3I78A 5DP8A 1J8AA 2XBYA 3GY6A 2WUCA 1C5UA 1YF4A 1QQ4A 1BRBE 1DDJA 4AG1A 3OX7U 2HPPH 3LGUA 4YM9A 2BYAX 3P95A 1EJMA 5C94A 1DXWA 1DWEH 5A8ZA 1CQQA 3Q77A 3A8BA 1W14U 4RN6A 4X6OA 3VB4A 1P2KA 2V3MA 1OYQA 3GDSA 1NRNH 1GG6C 5F8TA 1LHEH 1CVWH 2Z9IA 1CGJE 5L6NH 1SGFA 2K0QA 3PRDA 1C1OA 2O9QA 2F9PA 1BDAA 1CT0E 1XUHA 3A7YA 4A5TS 3A8AA 3Q3XA 1H4WA 1LVOA 2W6JD 2SNWA 1MKXK 3ODFA 4X2XA 3GOVB 1XX9A 2A31A 1SQAA 2VU8E 2ZFTA 4MPWA 1FNIA 1P8VC 2TGAA 2EI6A 5ESBA 2J92A 3AW1A 3STJA 2WPKS 1GBJA 1H8HD 2QYIA 3PO1B 4Y7AA 5F53A 3GICB 3SUEA 5EW1H 1TQ7B 2Y7ZA 1RIWB 2GVFA 3VEQB 3MYWA 2D8WA 3ZZ4A 3ODDA 2QGRA 5LPFA 1G3DA 1BA8B 2P3FH 3VB7A 3DD2H 3M3SA 1ZSJA 1QJ6B 2BD5A 1TRMA 1IQIA 3SNBA 4B76A 3NZIA 4I33A 1BBRE 1U6QA 2ZHDA 1O2XA 4INKA 5DP4A 1QBNA 4BAOB 1QY6A 2H5DA 5GPIB 3KYGA 1C1QA 4FUJA 4WH6A 1FY8E 2QXJA 1HJAB 2G55A 1QRXA 2AIQA 2PR3A 1J14A 1W11U 1ZPBA 1P57B 1BB0B 1TPOA 1QRWA 1O3AA 2AGGX 3VB6A 1WTGH 2HRVA 2YNAA 3ATIA 3DSPA 5BPEA 3BTDE 2DE9A 3KF2A 3SO3A 1TMTH 3E8LA 3GYMA 1ZYOA 8GCHF 3A80A 2KR7A 1MAXA 4JZ1A 1HJ9A 1ANBA 1S85A 4LOYH 3PB1E 1EAUA 1NT1A 3N99A 1FXYA 3UAIC 1C5MD 3MTYA 2J38A 1YLDA 1KXBA 4B74A 3FP7E 1NFWA 2AMDA 4KGAA 4Y11E 1GHZA 1HIAA 1QURH 5HYOA 4IMQA 2VIOA 1PJPA 3RXQA 1TX6A 1T8OA 1Q3XA 3EA8A 3FAOA 2NU3E 1J9CH 4WXVA 1GCTB 4H6TA 2R3YA 1P09A 1S0QA 4AB9A 5DPAA 4I8KA 1KYNA 2ZU3A 4Y71A 3LGVA 2BD2A 4JZIA 5EXNA 3P8NA 1RGQA 5ESTE 3ZZ8A
chains in the Genus database with same CATH topology
1IAUA 1O2MA 1L1GA 3BG4B 3SNEA 4AFZA 3ZZ9A 1MZAA 3SJIA 4XE4A 2BDHA 2ZTXA 4MNWA 1O31A 2AEIH 2NU4E 1NU7B 3MU1A 1A4WH 3OY6U 5IDKA 1O5DH 4YT6H 1MU6B 2W3IA 1P04A 1MTVA 3SU4A 4NWLA 2PTNA 3QGJA 1THSH 5FX5A 1NO9H 1GBKA 3TNTA 1DITH 3Q3YA 2VVVA 2BD9A 2Y5FA 1Y3WA 3M3TA 3GY5A 4F49A 3HGPA 2BXUH 3Q76A 1GHAF 1FN6A 1AU8A 1L2EA 3RXRA 1V2JT 4K8BA 4X1NU 1EATA 1QCPA 1V2UT 1YPHC 2WINI 1XXDA 3DT0H 1NS3A 2QXHA 2ZDMA 4NG9H 1P05A 5IYTA 1KTSB 1B0FA 2BQ6B 4INHA 4D76A 1OP0A 2ZU4A 5B6OA 3QK1A 1ZRBA 4ABHA 4E7NA 4RSPA 1IQLA 1CO7E 3GCTF 3PO1C 4UD9H 1O5EH 3MU8A 4K69A 2VWLA 4Y0ZE 1SR5C 1RIWC 2Z7FE 3GCOA 1GI8B 3MOCA 5J4QA 1GL1A 2PSXA 4HFPB 1UMAH 4FU7A 2QA9E 2C8WB 1SPJA 1JWTA 1ABJH 4JCNA 3M35A 4X6NA 1CU1A 2GP9B 4MPXA 1LTOA 1TBRH 2Z9GA 3ITIA 3RXBA 1V2PT 4BXWA 2FX6A 2WPMS 3STIA 1LO6A 1ZPZA 3L3TA 3RLYH 1AWFH 1BTZA 1S84A 2A4QA 3GDVA 3O8BA 3RUOA 2D1JA 1O0DH 3RLWH 1G37A 4ISOA 2LPRA 2FM2A 1NN6A 1QJ1B 3SI3H 1LHFH 5L2ZH 4FU9A 2V35A 2VIDA 2AMQA 4WWYA 4U32A 3HK6B 3OYPA 4ABGA 1HJAC 3BSQA 3MH6A 1O2JA 3SUGA 2CGAA 1XKAC 1GL0E 4YTAA 2Y5GA 4DG4A 3V3MA 3SV2H 1HNEE 4KTSA 1A5HA 3SBKA 1VZQH 4ZXYH 1K1PA 1O3BA 3VPKA 1E37B 3QZRA 5PTPA 1Y59T 2PUXB 3UY9A 3SV6A 3QO6A 1BJVA 2WV4A 4Y10E 2Z3DA 1BTHH 1JRTA 1O3EA 2EA3A 2FOCA 4CH8B 1O3IA 3FFGA 1JXPA 2ZPSA 1DFPA 1XMNB 3T62A 1ORFA 4O3TA 3RXMA 2BY6X 2GZ9A 1O3KA 1GDNA 4ZKSU 3RC6A 3K6YA 4UFFH 1O35A 3HKJB 4BAHB 7ESTE 5AHGH 3SGBE 1TA2A 4GPGA 1UCYK 2B7DH 1YYY1 1GMHG 3LPRA 3LONA 1ELFA 1DY9A 5FX6A 3BIVH 4ISNA 1C2LA 3GCNA 1MKXH 5FAHA 1GJ4H 1P9SA 2G4UA 1C5LH 3LJOA 3EDXB 1ZZZA 1GCTC 5EQSA 4CRGA 3FZDA 1XUGA 4B2BA 1KLIH 2BOHB 3RM0H 1K2I1 1BRUP 1QFKH 3D65E 4XSKU 1GMDG 1QB6A 3MH4A 3LGWA 1QNJA 4DJZB 4I8HA 1THRH 3BG4C 1FI8A 1AIXH 2JH0D 1N6XA 6GCHG 1FV9A 2NU2E 2Y82A 3ZVAA 1O32A 3OTJE 2GTBA 4MNXA 1IQJA 2P8OB 3NUMA 4K1EA 3AASA 2ZA5A 2VNTA 1DT2A 1NY22 3UR9A 2ZIQH 1C5WB 4FUBA 4NA9H 1EZSC 1T8MA 2BM2A 1C1PA 1F5RA 2ZECA 1XXFA 2P3TB 5SGAE 3SQEE 5DP7A 5EPNA 2FEQH 3SGAE 1A61H 3F68H 3UUZA 1GMCG 1H8IH 4K5ZA 1S0RA 2FPZA 1DVAH 3T25A 2QY0B 2FS8A 2M5TA 4ABEA 4UFDH 1ZMNA 5A09A 3LJJA 3MMGA 1K1MA 1PPFE 4LK4A 2ZDNA 3ZVEA 3SGQE 3K65B 1GBAA 2Z9KA 4NIWA 3T29A 1AN1E 4WF8A 2FOEA 4CREA 2O8WA 1UVPA 3MU4A 4O9VA 1ZTJA 2BDGA 4ZXXH 1UTMA 1UK2A 1XUFA 2XBVA 1GHBG 2UWLA 1XM1A 1NM6A 5DGJA 1X7AC 3E0PB 5CE1A 1A1RA 3QTVH 1BTXA 1GBDA 4ZKOU 1A2CH 6LPRA 1F5KU 2SGPE 1ZJDA 2B0FA 3KQBA 3SW2B 2W5EA 3LGIA 3FP6E 4I8JA 1ZGVA 1TGNA 2A4GA 3LKWA 5A8YA 3ZZDA 3S9AA 1LVBA 5GCHF 1BBRH 2BD3A 1V2QT 4UDWH 2ALPA 3PLKA 1O30A 3GY7A 5A0CA 1BJUA 1OXGA 4HZHA 1AY6H 3BTWE 3ZV8A 1A3BH 1OWKA 1ZLRA 1TRNA 3LC3A 3VXFH 4H6SB 2FI5E 2QV1A 3PMBB 2A7CA 3AVZA 3BTKE 1C5YB 1O2SA 3H7OA 2A2XH 1K9OE 1MD7A 4X6PA 4Z6AH 4XBBA 2BX3A 2W3KA 1EXFA 4BNRA 3KGPA 2BZ6H 1AUJA 2KAIB 1C1NA 3GYLB 4AZ2B 3UTUH 4BAMB 2BY8X 4NA8A 1KDQB 3UWIA 4B2CA 3A81A 3VGCB 3RC4A 1GDQA 4O3UA 2PUQH 1GJ5H 1P12E 1O2QA 1W7XH 2VIPA 4MTBA 2VWMA 1BTUA 1THPB 2A7HA 3C1KA 1NTPA 4J2YB 3ZVFA 1GBEA 3TITA 4MQAA 3SJOA 4MLFB 2CXVA 2J4IA 3TJVA 5DP5A 4ZKRU 4A92A 3BEIB 1L4DA 1RTLA 3KCGH 1QL8A 3I77A 4NCYA 1O37A 1P3CA 2ZHWH 3RXCA 2F91A 1IHSH 2BZAA 4X8TH 2XC0A 2PFEA 3MNSA 2VIWA 5JBBS 3S7KB 4WXIA 1TX7A 2OD3B 4X1QU 3SJ8A 2VH6A 1HV7A 3SUFA 1HAIH 4HI3A 1GJBB 4NSYA 2FOHA 3SI4H 1QIXB 3EA9A 3SU3A 1SGYE 1TONA 1XUIA 2R3UA 2ZCHP 1Z8GA 7KMEH 3RM2H 1F0SA 3RXOA 1TGSZ 4WY3A 3M5MA 4I8GA 3PLBA 3QZQA 1KTTB 3UNQA 4H4FA 3DA9B 1S81A 1D3QB 4X1SU 1WU1A 2Z3CA 4OGYA 1TGTA 2P95A 2ZCKP 4Z0KA 4MVNA 1T31A 2XWAA 1PQ8A 3KIDU 2GCHF 2P8OC 3SUDA 4DURA 3A88A 4CH2B 5FPYA 1YKTA 3CS7A 4FUEA 1OX1A 4A7IB 2UUFB 1H1BA 1WYKA 1BMMH 1EPTB 5DKMA 1P01A 3PWCA 3PROA 1CE5A 1LHDH 1NFUA 4SGBE 3NK8A 3QUMP 5EG4A 3URDA 3IWMA 1WV7H 4ISIH 5JDUB 1O2RA 1OP8A 4UFEH 1W7GH 1C1VH 2SNVA 3RXTA 1NRSH 4VGCB 1PPGE 3VB3A 4ABJA 5T6FA 2XW9A 1SGPE 3PV4A 3TVJB 3LH1A 1YPMH 4XBCA 1Q31A 2ODPA 1GBCA 2ZZUH 3RXDA 2J9NA 2QN5T 2A5KA 2WPIS 3SHAH 4X2VA 3A7WA 1VITG 2WPHS 1YGCH 2FOFA 4AN7A 4E06H 9LPRA 1BUIA 4IN1A 4A1XA 1M9UA 1O3LA 5A0AE 3RP2A 4BAKB 3M5NA 1BRAA 2UUYA 1UHBB 1GBTA 5I46H 1Y3UA 4DGJA 4TYDA 1GJ8B 5DJ7A 3VFEA 1V3XA 1QL9A 1CHOF 2OXSA 1HYLA 5JYIA 5FCRA 1NROH 3ATWA 1UCYH 1TALA 3M5OA 3CS0A 1OPHB 1TGBA 2ZC9H 4BTUB 1S6HA 2AS9A 3A89A 1UTNA 4IGDA 1CHGA 1YLCA 3D49H 2ZTYA 2FIRH 1LMWB 5EXMA 1O2HA 1FY4A 3RMMH 5JBCS 2EEKA 3E1XB 1WQSA 5FBEA 2H5CA 3E0NB 1PQ5A 1INCA 3T28A 2GZ8A 2ZWLH 1SFQB 3VGCC 1C5PA 1HAGE 1VJAU 2GD4B 2W26A 3TJNA 3URCA 1O3NA 2ZQ1A 1ZHPA 2OBQA 3ZZ5A 1A0HB 2O8UA 3LGTA 4ESTE 3P8FA 2ZGJA 1C5NH 5JBAS 2PKAB 3M7QA 2G52A 1QJ7B 4A6LA 1MTWA 1AWHB 3BG8A 2FTLE 1OP2A 4K1SA 2OQ5A 1V2WT 3BTEE 2F9OA 2ZPQA 4Q80A 4TWYA 1QB9A 2XBWA 1AD8H 5F8XA 1C2IA 4O97A 4ZROA 2F9BH 5E0JA 1C4U2 4BTIB 1MBMA 1ZHMA 4I8LA 2UWPA 1Y3XA 1PYTD 4NFFA 3UQVA 4IS5A 3MH7A 4B71A 4NSVA 8KME2 1ELTA 3RXFA 3E3TA 3V7TA 4IMZA 4GHTA 1ZTKA 5C67A 3FANA 1NC6A 3SU0A 1A3EH 1V2LT 1YPGH 3U1JB 1FAXA 2LNCA 1FLEE 2QXGA 1SVPA 5DP6A 2PLXA 4NGAH 1C2MA 2A32A 2STBE 1SG8B 3MU5A 1GBHA 2HLCA 4XBDA 4UONA 5CMXH 4KP0A 3RXJA 1P2OA 3MU0A 4CHAB 3RXVA 2ZHFH 1F5LA 1C1UH 3DHKH 2HGTH 2BY5X 1TNJA 5GXPA 1LQDB 1NFYA 5T6GA 1LPGB 2F9UA 2KAIA 5ETXA 3P17H 1P9UA 1EPTC 2C8ZB 1KDQA 1YM0A 2ULLA 4DT7B 3SU2A 4I31A 3TK9A 2ZCLP 1CA0B 5K7RA 1BZXE 2Z9JA 1FZZA 1SLVB 2WUBA 3NKKA 2ZHEH 2TRMA 1F7ZA 4VGCC 3ZZAA 1SGRE 1K21H 2PKSB 1AVGH 2AERH 2BDBA 3A7VA 1S82A 2P93A 3MFJA 3BV9B 3U8OH 2BDCA 5G4BA 2BHGA 2F9VA 3M3VA 2ZGHA 3PTNA 1C1RA 4FUFA 2QC2A 4OS1A 2PHBA 5FPTA 4K60A 3SNAA 4GUXA 1SL3A 1C2KA 2BLQA 1O2LA 3VXEH 4B75A 4F4OC 2BLWA 4K8YA 1DWCH 4FUGA 2BTCE 3M7TA 4H42U 4JYVH 4AB8A 1TNHA 5LGOA 2ZU2A 1QA0A 3MNXA 1AZ8A 3U1IB 3F9HA 4AGJA 1UTPA 3RXAA 4K3JA 2ZPRA 4TY7A 2ZG0H 1GDUA 1TB6H 3CENA 2FO9A 5L2YH 4ABBA 2D2DA 4U30A 1OWJA 1KIGH 1RD3B 4MPVA 3IITA 2ZP0H 2PSYA 5GIBA 1BMNH 1HPGA 3NCLA 5J4SA 4YLQH 3RXUA 2AFQB 1V2NT 5JBTA 1EPTA 1WAYB 4JZDH 3GY2A 3TH3H 1MTUA 2OUAA 3R0FA 1SGIB 2SFAA 2ZGBH 1G3EA 1H8DH 1T4UH 2QXIA 3RXEA 1NRRH 1SGDE 3M36A 2TGDA 2R0LA 2IPHA 4GCHG 3F9EA 5E0GA 2VGCB 2H2ZA 1HUTH 3BTHE 5I25A 1TOCB 1ELBA 1VJ9U 4KTUA 5DP9A 2R9PA 2F9NA 4WMFA 1N6YA 1UTJA 3A8CA 4LXBH 1UCYE 5TJXA 3RXGA 4ABDA 1SI5H 1O2VA 1EASA 1WBGB 2XC5A 2C90B 3GISB 4DOQA 5GDSH 3A8DA 1P11E 1PFXC 1QBOA 3LOXA 1MQ6A 1DLEA 5DK1A 1Z1JA 3EGKH 1YPJH 2CV3A 2XC4A 1A0JA 2XCNA 1UTOA 3TK5A 1F0RA 2H1UA 1WOFA 1GJAB 2ANWA 1UHBA 3SJKA 1O34A 4FXGH 1A46H 2BVXH 4TPYA 1OWDA 4XFQA 2GX4A 3MNBA 2HVXA 2V0BA 5EGMA 2OBOA 1P02A 1Z1IA 3B8JA 2ZO3H 3RU4E 1D9IA 1YBWA 1DXPA 1P2JA 1ELDE 3SN8A 4ABAA 3JZ2B 3TJOA 4Q2KA 2J2UA 1KLJH 1EZQA 2ZDVH 1SBWA 4ZHLU 1TABE 2R0KA 4IC5A 2CHAB 4OS5A 3BTQE 5A8XA 2HPQH 4CHAC 1P03A 3KN2A 2BDYA 3QWCH 1OWHA 3ZZ6A 1NPMA 2H9TH 5C1XA 2UUJB 2FOAA 3RXPA 1UVTH 1G3CA 1GBLA 2PGBB 1O3HA 2FYRA 2XYAA 4FUIA 5FPSA 1JOUB 1CA0C 1H9HE 1H9LB 3UREA 1FPCH 1LHGH 1FIWA 3P8GA 1VGCB 4CR9A 2J94A 4BAQB 2PKAA 2FODA 1LDTT 1K22H 1CA8B 1UVOA 2OLGA 1DPOA 1O2UA 1J15A 1RTFB 2PKSC 3A87A 1QA7A 3PMAB 3PM3A 1YPEH 1Y5UT 2IN2A 3HK3B 4E7RG 4K2YA 1EOJA 3P70B 1IQEA 1OOKB 4FVBA 4JK6A 1V2KT 2ZDLA 1Z6JH 2ZKSA 3NPSA 3U8TH 2IOTA 1O2IA 2BQ7B 3U9AH 1O2GH 1TNKA 1W3CA 4YO9A 4JZEH 4IN2A 1HAYB 3L33A 4PROA 3T2NA 4BXSA 1GJ7B 3QGNB 3KQDA 1HJ8A 2WPJS 1LVYA 1GI3A 3BN9A 4CR5A 1ID5H 3LDXH 2VB0A 1C4Y2 1SQOA 2FX4A 2OC1A 4Y79A 1XUJA 7GCHG 3FVFB 3PMHB 3UWJH 1EZXC 5EOKA 4DW2U 1GVZA 1FUJA 1TE0A 4ZKNU 2HNTE 1E38B 4Y76A 1QR3E 2STAE 3ZZ3A 2QF3A 2H6MA 3KHVA 2UWOA 1GHVH 3TU7H 2ILNA 2BDAA 1MU8B 1AFEH 3QLPH 4NZLA 1E0FD 1TLDA 1RRKA 2GDDA 4Y7BA 4CRDA 2G5NA 1SGTA 1RTKA 4AX9H 1PPEE 1DUEA 1ETSH 1P2MA 1C5XB 1GJ9B 4CRAA 5E8EH 3OY5U 2P16A 2WYGA 2VGCC 1LPZB 2GZ7A 4AFQA 1IHTH 4IC6A 2VVUA 5EQRA 1UK4A 1HAPH 3E6PH 5EW2H 3L6PA 3A83A 4TY6A 3GDUA 1HLTH 5FXLA 1LKBA 2BY7X 3S7HB 1HRTH 3HPTB 3DUXH 3HGNA 1LCYA 4NWKA 3EE0B 2IJOB 4DCDA 2O8MA 4MG3A 1AO5A 1GI4A 1KLTA 4ZH8A 1SGNE 1T32A 4AYVB 1OYTH 3UPEA 3GY3A 1IQMA 1B5GH 1OWEA 4OS2A 2EI7A 1DSTA 1GBMA 1GJDB 1FIZA 3UOUA 2B8OH 5C2ZA 3SNCA 2FWWA 1QHRB 5C5NA 1D3PB 4CBNA 5HXFA 3SOSA 1ANDA 1TMUH 2BVRH