2SGEI

Glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 10.7
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
51
structure length
51
Chain Sequence
VDCSEYPKPACTEEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Water molecules participate in proteinase-inhibitor interactions: crystal structures of Leu18, Ala18, and Gly18 variants of turkey ovomucoid inhibitor third domain complexed with Streptomyces griseus proteinase B.
pubmed doi rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 14
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00050 Kazal_1 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2sgeI00
2XRCA 1LR8A 2KMOA 5DAEA 2SGFI 1TIHA 1CT0I 1IY5A 1CHOI 2QQCA 1SGEI 1R0RI 1BMOA 2KMPA 2KMRA 2SGEI 1SGDI 1OMTA 1TUSA 2KCXA 2NU0I 2NU1I 2V53A 1KMAA 1TBQR 1TBRR 2KMQA 1FYBA 2JZMA 2GKRI 4HGUA 2N17A 1IY6A 1SGQI 2SGPI 1BUSA 1N13A 5JHWC 1HPTA 1TURA 1PJUA 1OYVI 2OVOA 1UVFA 3OVOA 1YTPA 3HH2C 1TGSI 1CSOI 3SEKC 1Z7KB 1SGYI 1OVOA 2LEOA 1AN1I 1MT1A 2SGDI 2NU3I 1CT4I 4OVOA 4GI3C 2N52A 2F3CI 2P6AC 1M8BA 1HDLA 1IW4A 1OMUA 2BUSA 1PPFI 1SGRI 2JXDA 3QTLD 2ERWA 1SGNI 2GKVA 3SGBI 1PCEA 4SGBI 1H0ZA 2ARPF 1UUCA 2M5XA 2QQDA 1Y1CA 2N71A 3B4VC 1Y1BA 1UVGA 2SGQI 1M8CA 1CE3A 1CGII 1LR7A 3TJQA 1LR9A 1YU6C 1CGJI 2NU4I 2WCYA 1CT2I 3SGQI 2GKTI 1HJAI 2JYYA 1DS2I 2NU2I 1DS3I 1SGPI 1NUBA 2B0UC
chains in the Genus database with same CATH superfamily
2XRCA 1LR8A 1WGCA 2KMOA 3D00A 5DAEA 3TOAA 2FNFX 1XX6A 4WP4A 2SGFI 1TIHA 3TO7A 1CT0I 3VDPA 1IY5A 2DB6A 1CHOI 7WGAA 2QQCA 1SGEI 2PQ8A 5E3RA 1R0RI 1FARA 1BMOA 5FUYA 1TBNA 2KMPA 2KMRA 2SGEI 1SGDI 3GOXA 3KY9A 1FY7A 2J87A 1OMTA 5CCMA 1PTRA 1MJBA 1TUSA 1ULKA 2KCXA 2NU0I 2NU1I 2V53A 2W0TA 5E3PA 1KMAA 2J9RA 2E5RA 3CXLA 1W3SA 3VDUA 1TBQR 2CWHA 1TBRR 2KMQA 4FKDA 2DIPA 4E1PA 1Q9BA 2JZMA 2UZ3A 1FYBA 2GKRI 1K7UA 3FC3A 4HGUA 4E1RA 2N17A 1IY6A 1Z2IA 1SGQI 3E59A 5CCLA 2QPOA 2SGPI 1W4RA 3R5CA 5E3QA 1BUSA 2GIVA 2X52A 1N13A 2ROWA 4JCVE 1X4SA 1X74A 3UFFA 5JHWC 3R5BA 4MPIA 1U5KA 2YUUA 3FSYA 2X3TA 1HPTA 3OXGA 1TURA 1TBOA 1PJUA 2VRWB 3BJIA 1ULMA 1WTJA 1OYVI 2LB7A 1XA6A 1UVFA 1RFHA 2LUYA 2OVOA 3OVOA 1YTPA 5FUVA 1K7TA 2ENNA 1V1HA 2QQEA 3HH2C 1TGSI 2A20A 1CSOI 1XBTA 1WKXA 3UGIA 2YQPA 2RC4A 3SEKC 3R5DA 2L7XA 1Z7KB 2WVJA 1SGYI 1OVOA 2JA1A 2LEOA 1P9GA 1AN1I 2B0UC 2ORWA 1MT1A 2OZUA 3OL0A 2SGDI 2NU3I 1CT4I 1R79A 4OVOA 2V1CC 3E2IA 3UGLA 4GI3C 1MJAA 9WGAA 2N52A 1UHAA 2F3CI 2CWFA 2DKVA 2N1AB 2WGCA 3RU0A 1FAQA 1V1IA 2P6AC 4UXIA 1M8BA 3UEYA 1HDLA 1IW4A 1OMUA 2BUSA 1PPFI 1SGRI 2JXDA 3OXLA 3QTLD 4A24A 4AMLA 2ERWA 4B6DA 2Y0MA 1SGNI 1ULNA 3TO6A 2GKVA 2OD1A 3UGDA 5EX3A 2E73A 5HQ8A 5FUXA 4L9MA 3TOBA 1KBFA 1HEVA 1K7VA 3UOEA 5FUWA 2JW6A 3UEJA 1WGTA 5J8CA 3SGBI 1PCEA 2V1CA 4SGBI 2ARPF 1H0ZA 2CJSC 2L8EA 1UUCA 2M5XA 2OU2A 2QQDA 5J8FA 1Y1CA 2QQ0A 2N71A 3B4VC 1Y1BA 2ORVA 5EX0A 1UVGA 2SGQI 1M8CA 2RIJA 3TO9A 1NXUA 2ELIA 1CE3A 1CGII 1LR7A 3TJQA 2B8TA 2UVOA 1LR9A 1YU6C 1CGJI 1S20A 1Y8FA 2NU4I 2ODDA 2WCYA 2ENZA 1KBEA 3QWPA 5HI7A 1CT2I 3SGQI 2GKTI 1PTQA 3MEKA 1HJAI 2CWGA 3R5AA 1MJ9A 2JYYA 2GVIA 1DS2I 4UXHA 1P9ZA 3VE5A 1VDDA 2NU2I 2K9HA 3PDNA 1DS3I 3FSXA 1SGPI 1NUBA 1TOTA 3QAHA 4DNCA 4UXJA 3OXFA
chains in the Genus database with same CATH topology
2XRCA 1LR8A 2KMOA 3D00A 5DAEA 2FNFX 1XX6A 2SGFI 1TIHA 1CT0I 3VDPA 1IY5A 2DB6A 1CHOI 2QQCA 1SGEI 1R0RI 1FARA 1BMOA 5FUYA 1TBNA 2KMPA 2KMRA 2SGEI 1SGDI 3GOXA 3KY9A 2J87A 1OMTA 5CCMA 1PTRA 1TUSA 2KCXA 2NU0I 2NU1I 2V53A 2W0TA 1KMAA 2J9RA 2E5RA 3CXLA 1W3SA 3VDUA 1TBQR 1TBRR 2KMQA 1TOTA 2DIPA 4FKDA 2UZ3A 2JZMA 4E1PA 1FYBA 2GKRI 3FC3A 4HGUA 4E1RA 2N17A 1IY6A 1SGQI 3E59A 5CCLA 2QPOA 2SGPI 1W4RA 1BUSA 1N13A 2ROWA 4JCVE 1X4SA 1X74A 3UFFA 5JHWC 1U5KA 2YUUA 1HPTA 3OXGA 1TURA 1TBOA 1PJUA 2VRWB 3BJIA 2LUYA 1OYVI 2OVOA 1XA6A 1UVFA 1RFHA 3OVOA 5FUVA 1YTPA 2QQEA 2ENNA 1V1HA 3HH2C 1TGSI 2A20A 1CSOI 1XBTA 3UGIA 2YQPA 3SEKC 2L7XA 1Z7KB 2WVJA 1SGYI 1OVOA 2JA1A 2LEOA 3OL0A 1AN1I 2ORWA 1MT1A 2SGDI 2NU3I 1CT4I 1R79A 4OVOA 2V1CC 3E2IA 3UGLA 4GI3C 2N52A 2F3CI 2N1AB 3RU0A 1FAQA 1V1IA 2P6AC 4UXIA 1M8BA 3UEYA 1HDLA 1IW4A 1OMUA 2BUSA 1PPFI 1SGRI 2JXDA 3OXLA 3QTLD 4A24A 2ERWA 4B6DA 1SGNI 2GKVA 2OD1A 3UGDA 5EX3A 2E73A 5HQ8A 5FUXA 4L9MA 1KBFA 5FUWA 2JW6A 3UEJA 3SGBI 1PCEA 2V1CA 4SGBI 2ARPF 1H0ZA 2CJSC 2L8EA 1UUCA 2M5XA 2QQDA 1Y1CA 2QQ0A 2N71A 3B4VC 1Y1BA 2ORVA 5EX0A 1UVGA 2SGQI 1M8CA 2ELIA 1CE3A 1CGII 1LR7A 3TJQA 2B8TA 1LR9A 1YU6C 1CGJI 2NU4I 1Y8FA 2ODDA 2WCYA 3QWPA 2ENZA 1KBEA 5HI7A 1CT2I 3SGQI 2GKTI 1PTQA 3MEKA 1HJAI 2JYYA 2GVIA 1DS2I 3VE5A 1VDDA 2NU2I 2K9HA 3PDNA 1DS3I 1SGPI 1NUBA 2B0UC 4UXHA 4UXJA 3OXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRC A;  1LR8 A;  2KMO A;  5DAE A;  2SGF I;  1TIH A;  1CT0 I;  1IY5 A;  1CHO I;  2QQC A;  1SGE I;  1R0R I;  1BMO A;  2KMP A;  2KMR A;  2SGE I;  1SGD I;  1OMT A;  1TUS A;  2KCX A;  2NU0 I;  2NU1 I;  2V53 A;  1KMA A;  1TBQ R;  1TBR R;  2KMQ A;  1FYB A;  2JZM A;  2GKR I;  4HGU A;  2N17 A;  1IY6 A;  1SGQ I;  2SGP I;  1BUS A;  1N13 A;  5JHW C;  1HPT A;  1TUR A;  1PJU A;  1OYV I;  2OVO A;  1UVF A;  3OVO A;  1YTP A;  3HH2 C;  1TGS I;  1CSO I;  3SEK C;  1Z7K B;  1SGY I;  1OVO A;  2LEO A;  1AN1 I;  1MT1 A;  2SGD I;  2NU3 I;  1CT4 I;  4OVO A;  4GI3 C;  2N52 A;  2F3C I;  2P6A C;  1M8B A;  1HDL A;  1IW4 A;  1OMU A;  2BUS A;  1PPF I;  1SGR I;  2JXD A;  3QTL D;  2ERW A;  1SGN I;  2GKV A;  3SGB I;  1PCE A;  4SGB I;  1H0Z A;  2ARP F;  1UUC A;  2M5X A;  2QQD A;  1Y1C A;  2N71 A;  3B4V C;  1Y1B A;  1UVG A;  2SGQ I;  1M8C A;  1CE3 A;  1CGI I;  1LR7 A;  3TJQ A;  1LR9 A;  1YU6 C;  1CGJ I;  2NU4 I;  2WCY A;  1CT2 I;  3SGQ I;  2GKT I;  1HJA I;  2JYY A;  1DS2 I;  2NU2 I;  1DS3 I;  1SGP I;  1NUB A;  2B0U C; 
#chains in the Genus database with same CATH topology
 2XRC A;  1LR8 A;  1WGC A;  2KMO A;  3D00 A;  5DAE A;  3TOA A;  2FNF X;  1XX6 A;  4WP4 A;  2SGF I;  1TIH A;  3TO7 A;  1CT0 I;  3VDP A;  1IY5 A;  2DB6 A;  1CHO I;  7WGA A;  2QQC A;  1SGE I;  2PQ8 A;  5E3R A;  1R0R I;  1FAR A;  1BMO A;  5FUY A;  1TBN A;  2KMP A;  2KMR A;  2SGE I;  1SGD I;  3GOX A;  3KY9 A;  1FY7 A;  2J87 A;  1OMT A;  5CCM A;  1PTR A;  1MJB A;  1TUS A;  1ULK A;  2KCX A;  2NU0 I;  2NU1 I;  2V53 A;  2W0T A;  5E3P A;  1KMA A;  2J9R A;  2E5R A;  3CXL A;  1W3S A;  3VDU A;  1TBQ R;  2CWH A;  1TBR R;  2KMQ A;  4FKD A;  2DIP A;  4E1P A;  1Q9B A;  2JZM A;  2UZ3 A;  1FYB A;  2GKR I;  1K7U A;  3FC3 A;  4HGU A;  4E1R A;  2N17 A;  1IY6 A;  1Z2I A;  1SGQ I;  3E59 A;  5CCL A;  2QPO A;  2SGP I;  1W4R A;  3R5C A;  5E3Q A;  1BUS A;  2GIV A;  2X52 A;  1N13 A;  2ROW A;  4JCV E;  1X4S A;  1X74 A;  3UFF A;  5JHW C;  3R5B A;  4MPI A;  1U5K A;  2YUU A;  3FSY A;  2X3T A;  1HPT A;  3OXG A;  1TUR A;  1TBO A;  1PJU A;  2VRW B;  3BJI A;  1ULM A;  1WTJ A;  1OYV I;  2LB7 A;  1XA6 A;  1UVF A;  1RFH A;  2LUY A;  2OVO A;  3OVO A;  1YTP A;  5FUV A;  1K7T A;  2ENN A;  1V1H A;  2QQE A;  3HH2 C;  1TGS I;  2A20 A;  1CSO I;  1XBT A;  1WKX A;  3UGI A;  2YQP A;  2RC4 A;  3SEK C;  3R5D A;  2L7X A;  1Z7K B;  2WVJ A;  1SGY I;  1OVO A;  2JA1 A;  2LEO A;  1P9G A;  1AN1 I;  2B0U C;  2ORW A;  1MT1 A;  2OZU A;  3OL0 A;  2SGD I;  2NU3 I;  1CT4 I;  1R79 A;  4OVO A;  2V1C C;  3E2I A;  3UGL A;  4GI3 C;  1MJA A;  9WGA A;  2N52 A;  1UHA A;  2F3C I;  2CWF A;  2DKV A;  2N1A B;  2WGC A;  3RU0 A;  1FAQ A;  1V1I A;  2P6A C;  4UXI A;  1M8B A;  3UEY A;  1HDL A;  1IW4 A;  1OMU A;  2BUS A;  1PPF I;  1SGR I;  2JXD A;  3OXL A;  3QTL D;  4A24 A;  4AML A;  2ERW A;  4B6D A;  2Y0M A;  1SGN I;  1ULN A;  3TO6 A;  2GKV A;  2OD1 A;  3UGD A;  5EX3 A;  2E73 A;  5HQ8 A;  5FUX A;  4L9M A;  3TOB A;  1KBF A;  1HEV A;  1K7V A;  3UOE A;  5FUW A;  2JW6 A;  3UEJ A;  1WGT A;  5J8C A;  3SGB I;  1PCE A;  2V1C A;  4SGB I;  2ARP F;  1H0Z A;  2CJS C;  2L8E A;  1UUC A;  2M5X A;  2OU2 A;  2QQD A;  5J8F A;  1Y1C A;  2QQ0 A;  2N71 A;  3B4V C;  1Y1B A;  2ORV A;  5EX0 A;  1UVG A;  2SGQ I;  1M8C A;  2RIJ A;  3TO9 A;  1NXU A;  2ELI A;  1CE3 A;  1CGI I;  1LR7 A;  3TJQ A;  2B8T A;  2UVO A;  1LR9 A;  1YU6 C;  1CGJ I;  1S20 A;  1Y8F A;  2NU4 I;  2ODD A;  2WCY A;  2ENZ A;  1KBE A;  3QWP A;  5HI7 A;  1CT2 I;  3SGQ I;  2GKT I;  1PTQ A;  3MEK A;  1HJA I;  2CWG A;  3R5A A;  1MJ9 A;  2JYY A;  2GVI A;  1DS2 I;  4UXH A;  1P9Z A;  3VE5 A;  1VDD A;  2NU2 I;  2K9H A;  3PDN A;  1DS3 I;  3FSX A;  1SGP I;  1NUB A;  1TOT A;  3QAH A;  4DNC A;  4UXJ A;  3OXF A; 
#chains in the Genus database with same CATH homology
 2XRC A;  1LR8 A;  2KMO A;  3D00 A;  5DAE A;  2FNF X;  1XX6 A;  2SGF I;  1TIH A;  1CT0 I;  3VDP A;  1IY5 A;  2DB6 A;  1CHO I;  2QQC A;  1SGE I;  1R0R I;  1FAR A;  1BMO A;  5FUY A;  1TBN A;  2KMP A;  2KMR A;  2SGE I;  1SGD I;  3GOX A;  3KY9 A;  2J87 A;  1OMT A;  5CCM A;  1PTR A;  1TUS A;  2KCX A;  2NU0 I;  2NU1 I;  2V53 A;  2W0T A;  1KMA A;  2J9R A;  2E5R A;  3CXL A;  1W3S A;  3VDU A;  1TBQ R;  1TBR R;  2KMQ A;  1TOT A;  2DIP A;  4FKD A;  2UZ3 A;  2JZM A;  4E1P A;  1FYB A;  2GKR I;  3FC3 A;  4HGU A;  4E1R A;  2N17 A;  1IY6 A;  1SGQ I;  3E59 A;  5CCL A;  2QPO A;  2SGP I;  1W4R A;  1BUS A;  1N13 A;  2ROW A;  4JCV E;  1X4S A;  1X74 A;  3UFF A;  5JHW C;  1U5K A;  2YUU A;  1HPT A;  3OXG A;  1TUR A;  1TBO A;  1PJU A;  2VRW B;  3BJI A;  2LUY A;  1OYV I;  2OVO A;  1XA6 A;  1UVF A;  1RFH A;  3OVO A;  5FUV A;  1YTP A;  2QQE A;  2ENN A;  1V1H A;  3HH2 C;  1TGS I;  2A20 A;  1CSO I;  1XBT A;  3UGI A;  2YQP A;  3SEK C;  2L7X A;  1Z7K B;  2WVJ A;  1SGY I;  1OVO A;  2JA1 A;  2LEO A;  3OL0 A;  1AN1 I;  2ORW A;  1MT1 A;  2SGD I;  2NU3 I;  1CT4 I;  1R79 A;  4OVO A;  2V1C C;  3E2I A;  3UGL A;  4GI3 C;  2N52 A;  2F3C I;  2N1A B;  3RU0 A;  1FAQ A;  1V1I A;  2P6A C;  4UXI A;  1M8B A;  3UEY A;  1HDL A;  1IW4 A;  1OMU A;  2BUS A;  1PPF I;  1SGR I;  2JXD A;  3OXL A;  3QTL D;  4A24 A;  2ERW A;  4B6D A;  1SGN I;  2GKV A;  2OD1 A;  3UGD A;  5EX3 A;  2E73 A;  5HQ8 A;  5FUX A;  4L9M A;  1KBF A;  5FUW A;  2JW6 A;  3UEJ A;  3SGB I;  1PCE A;  2V1C A;  4SGB I;  2ARP F;  1H0Z A;  2CJS C;  2L8E A;  1UUC A;  2M5X A;  2QQD A;  1Y1C A;  2QQ0 A;  2N71 A;  3B4V C;  1Y1B A;  2ORV A;  5EX0 A;  1UVG A;  2SGQ I;  1M8C A;  2ELI A;  1CE3 A;  1CGI I;  1LR7 A;  3TJQ A;  2B8T A;  1LR9 A;  1YU6 C;  1CGJ I;  2NU4 I;  1Y8F A;  2ODD A;  2WCY A;  3QWP A;  2ENZ A;  1KBE A;  5HI7 A;  1CT2 I;  3SGQ I;  2GKT I;  1PTQ A;  3MEK A;  1HJA I;  2JYY A;  2GVI A;  1DS2 I;  3VE5 A;  1VDD A;  2NU2 I;  2K9H A;  3PDN A;  1DS3 I;  1SGP I;  1NUB A;  2B0U C;  4UXH A;  4UXJ A;  3OXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...