2SGQE

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
b'ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgqE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgqE01
1W7XH 3A87A 3ZZ5A 3RXPA 4CR9A 1GI6A 3OYPA 1IQKA 3BN9A 3BTFE 1CA8B 4ISLA 4Y76A 5FCRA 5LH8A 2W3KA 2WINI 5DJ7A 1C5YB 4D76A 1O3KA 4AOQA 1AKSB 2G52A 3RXCA 1K22H 2PKAB 3STJA 3LC5A 1A0LA 1S6HA 2BQ7B 4JK5A 3PMHB 4KELA 1O3BA 1FAXA 1P2KA 3A7ZA 5AFYH 3EA9A 4K5ZA 5DPAA 1EATA 1NRNH 2VVVA 3SNCA 1GCTC 2F9UA 1F0RA 3F9GA 1O5EH 1Y8TA 3HKJB 1F2SE 1EJNA 3MH7A 2PGBB 2GZ8A 5B6OA 1GJBB 1J16A 4BOHA 4XBCA 1AUTC 2XC0A 4IC5A 2GD4B 2BDAA 1ZJKA 4K1TA 5GJ4B 3V13A 1N8OC 4GCHF 1EOJA 1KLJH 3ZV9A 1BHXB 1IQFA 3EAJA 1BRBE 1OP0A 1MTUA 1ZTJA 2TRMA 3TPIZ 4X6NA 1Z1JA 3EE0B 4WMEA 3F68H 2AEIH 2QXIA 3S9AA 1GBMA 1TPSA 2SGDE 1WAYB 1VGCC 1C1TA 4Y8XA 2B9LA 1T7CA 2EI6A 1S6FA 5C5NA 1ANCA 4MNVA 1TNJA 1XUKA 1IHSH 1W3CA 1UTPA 2AMPA 5FCKA 5JPMH 3PWCA 1HAVA 2OD3B 1FY8E 2BD9A 3SOSA 1UVPA 3NWUA 1ZMJA 4X0WU 3TGJE 3TH2H 1EAUA 2ZEBA 2VIOA 2QF3A 5TCAA 4ZHMU 4BAQB 2VVCA 2VIQA 1AI8H 3SJ8A 4IN1A 2HPQH 4B2BA 1QQ4A 4AG1A 1P3EA 4Y7BA 4RKOB 4B71A 1Q31A 3M5OA 5GIBA 1G2MA 3BG8A 1ZRBA 3PMAB 2J95A 1KXEA 3PMJA 1C5NH 1P0SH 1VCPA 3B9FH 1P05A 1AUJA 1DS2E 4Y10E 2VWOA 1XUHA 4I8KA 2BQ6B 1TRYA 2QYIA 1IQNA 1KDQA 2OC1A 2ZDMA 2XCFA 1UHBB 4JCNA 1LVBA 2BY6X 3GYLB 3UOPA 2BMGB 1YCPH 2Y6TA 4MDSA 1QBNA 1JIMA 1K1IA 1T8MA 3RXEA 4CH8B 2OC7A 1GI4A 2O8TA 1HXEH 1ZTKA 2BYAX 2OBQA 3LT3A 1OS8A 1C1UH 5DP8A 1GHBF 4WXIA 3V12A 3TJOA 1PPZA 3GY8A 3DA9B 4Y79A 3VGCB 1IQMA 1MU8B 3Q3XA 3BEFB 3B23B 7ESTE 3ATWA 3RM2H 3PO1B 3QZRA 1BMAA 1EAIA 1IQHA 2AGEX 1S5SA 1GI9B 1QBVH 3QTOH 4WWYA 3S9CA 1Z8JB 2VIDA 4Z0KA 2ZP0H 1AKSA 1O31A 4E7NA 1HPGA 1O3OA 2BDGA 2ZGXH 2PKAA 3ZZ3A 1SR5C 4FUGA 1ANEA 1GHXH 1TB6H 3TGIE 4O03A 1N1LA 1UVUH 3RC6A 1NRPH 2BD3A 3NXPA 2A31A 4CHAB 3A89A 1BTXA 2PGQB 5C1UA 4J2YB 1TNIA 2Z7FE 2VWNA 3QO6A 4DIIH 1YPLH 1QJ1B 1AIXH 5E8EH 3HPTB 4FUEA 1GMDF 1ZHMA 1RTFB 2W7UA 4CR5A 2J92A 5GXPA 2EEKA 1WCZA 1NRSH 1GJ8B 1MUEB 1J15A 3LGWA 3SNEA 3FANA 1C2MA 3BG4B 5JYIA 2IPHA 1BB0B 5A2MH 1C4V2 2CN0H 4WJG2 3WY8A 2F9NA 1NPMA 1YKTA 4I8LA 1TA2A 1GMHF 4BXSA 1RS0A 1GJDB 1QJ6B 3RU4D 3TJUA 1XMNB 3DUXH 1V2UT 2P8OC 1DX5M 3A7VA 3UWJH 1FPCH 2ZO3H 3LOXA 3PTNA 1QR3E 1EOLA 4XE4A 1GHWH 3PMBB 2ZDAH 3TVJB 4YOJA 1H9IE 5DK1A 3A8BA 3Q76A 2CXVA 1ZYOA 3BIVH 3SHAH 1O3AA 4X6PA 2D8WA 2ZDNA 3HGNA 3RXQA 3V0XA 1H9LB 1O2PA 1O2QA 3BTQE 2ODPA 1K1MA 1P11E 5SGAE 1QRZA 2FOBA 8LPRA 4MPUA 1OWDA 2BLQA 4MG3A 4X8TH 3SU5A 4B75A 4AG2A 4IMZA 1QJ7B 5EG4A 1JMOH 4KTSA 1EQ9A 1BUIA 1NRRH 1KXDA 1UK3A 2BTCE 5HGGA 5C2ZA 3GY4A 3MMGA 1SMFE 1CT0E 1MBMA 4GLYA 1A5GH 1EJMA 3L6PA 1UHBA 1SGIB 3ENSB 5AVDA 4X8VH 1L1GA 1S82A 1BOQA 5F8TA 5GCHG 4ISOA 1KLIH 1ELCA 2FYRA 1LHGH 1BJUA 1C1RA 1NY22 1BTYA 1W2KH 4TPIZ 1TA6A 1YPHE 3AVZA 1E38B 2JH6D 2SGQE 1YPJH 3LGVA 2BD2A 1GVKB 1LKAA 4TY6A 5F6MA 1EKBB 3MU5A 1HAIH 1V2QT 1DANH 1XUFA 2STBE 3KF2A 4ZAEA 2FO9A 2HNTC 4QT8C 3LIWA 4ABEA 2Z94A 2Y5HA 1K1LA 2ZHQH 1O0DH 4FUJA 2F9VA 5GWZA 1MQ5A 3GDSA 3SN8A 3JZ2B 4CRBA 1O5CB 3VB7A 1SGRE 1Z6EA 3UR6A 2R2WU 1O5DH 4X1RU 1MD7A 3MTYA 1HLTH 2W7SA 1SI5H 1HAOH 4CRCA 1TMBH 3O8RA 2VB0A 4NSVA 2B0FA 4GVUA 1GL0E 5LPEA 3T26A 3VXEH 4H42U 1YPMH 3Q00A 2UUYA 4CBNA 1W13U 1O2WA 2RA3A 1O33A 1ANDA 2O8MA 2O9QA 4K69A 3SU6A 2ZPSA 1PYTC 1V2WT 3GDVA 2FIRH 2H9EH 1C5UA 1RXPA 1WUNH 2ZI2H 1GBBA 2R0LA 4K3JA 4NIYA 8ESTE 1C5RA 2GZ7A 3TK5A 3O8CA 1UO6A 5E2PA 3TH3H 3URDA 1GMCF 2SGAA 2ZDKA 3MO9A 1GGDC 4AGJA 5ETXA 1C5MD 2XNIA 3E8LA 5C3NA 1CHOG 3KCGH 1SLVB 2GMTB 3SGAE 2XWAA 1FV9A 2FYQA 2GV7A 4IS5A 2F9BH 4JZIA 3L33A 2V6NA 3P8NA 2BDCA 1O34A 3U69H 4ABAA 4DGJA 1UVSH 1OWHA 1S83A 1SG8B 1AE5A 1SQAA 2BY7X 2ZFFH 1K1OA 2AGGX 2UUFB 1Z7KA 3OTJE 4D7GA 1ETRH 2GZ9A 4GSOA 3PB1E 1SSXA 1BRUP 3OSYA 1GI1A 3CP7A 1MBQA 2FZZA 4Y71A 1W0YH 1YCPM 4DJZB 1O30A 3H5CB 5JBTA 4AFZA 4FU7A 2TGDA 3ZVAA 1AO5A 5L2YH 3E0NB 3SZNA 5F8XA 2WPIS 2ZCKP 3P8GA 4Y0YE 2Y7ZA 1OXGA 2JH0D 1O39A 1HNEE 1A4WH 5EOKA 4IBLH 4WY3A 1TPOA 2C8XB 2ZFTA 3SORA 1A5HA 4ABJA 3AASA 3DHKH 4YZUA 1GBHA 1KXBA 1KTSB 3TIUA 3E6PH 2B7DH 1LVMA 3KHVA 4GPGA 4HGCA 5L2ZH 3UREA 3MH6A 1S81A 5EU8A 2C3SA 1G9IE 4I8JA 9LPRA 2VIWA 2BZAA 1OP2A 2F9PA 1H4WA 4R8TB 1MMJN 3U8TH 4FUIA 1D3TB 2OUAA 3LDXH 1C2JA 1UTNA 3M3TA 1NM6A 1EX3A 3A81A 4ESTE 1BMLA 4HZHA 2NU3E 4M7GA 4ZMAH 3AW0A 1SGPE 2ZU5A 3E90B 1OSSA 1BQYA 2GX4A 4MVNA 2ZDLA 2PSYA 8KME2 2FODA 1DWDH 4LZ4B 1O3DA 5JB8S 1CVWH 4WF8A 1OKXA 1KY9A 2VIPA 2ODQA 1C4U2 2D26C 2ZGBH 3HK3B 3EGKH 1TQ7B 2Z9JA 2GTBA 4NWLA 1TAWA 1B0FA 1ELBA 4FVBA 1MTVA 4TPYA 3SO3A 1G3EA 2VIVA 1P01A 4O3UA 3UY9A 1Y5UT 5I46H 1F5LA 1C5XB 1UCYE 1AB9B 1UTJA 2BY5X 4ZXYH 4F49A 1DFPA 3M35A 4AB8A 3LGYA 1DSTA 1P06A 4J1YA 1LQEA 1SGDE 1BBRH 1CBWC 2ALPA 3RLYH 1GBEA 2PFEA 2FTMA 5EXLA 3NPSA 1SGCA 2Z9KA 3LH1A 1O2UA 1CT2E 4CRGA 2P94A 4D8NA 3RP2A 3W95A 2QAAA 1XXDA 1W10U 2BM2A 3MNBA 1CHGA 1O3GA 1HDTH 5LPRA 1V2VT 3ATKA 1SQOA 3URCA 5TCCA 2BX4A 1A0JA 4DOQA 2F3CE 4RSPA 2ZZUH 3D62A 2ZNKH 5E2OA 5C67A 4X2YA 3M3SA 2F91A 3SV2H 4K8YA 2ZHFH 1DY8A 2AMDA 1DXWA 2P93A 2QXGA 2BX3A 3BTME 1MKXH 4FU8A 5EGMA 4FU9A 1TGCA 5FPSA 4X1PU 3UQVA 3NKKA 2GT7A 3MO3A 2C8ZB 4FUFA 1MAYA 3D23A 3KQEA 3I29A 3MYWA 2XBVA 1EXFA 3U1JB 1QIXB 1AWHB 1A46H 1AD8H 3PLKA 2A4QA 2C8YB 3VGCC 3RXRA 1GBKA 3S7HB 4ABFA 3PO1C 2J9NA 2R9PA 1ARCA 1JRTA 4U2WA 4UFDH 2YOLA 1GBTA 1TNHA 3RXAA 3BF6H 1FDPA 4KKDA 1V2PT 4ABIA 1C5SA 3E3TA 1DDJA 1L1JA 4YT6H 3MNCA 3UQOA 4UFFH 1GJ5H 5FXLA 2GCTB 3MWIU 4XFQA 1BTUA 1P9UA 1W7GH 3TK6A 4B76A 1SBWA 1F5RA 2W3IA 3W94A 1L0ZA 2BVSH 4CHAC 1GJ4H 1HYLA 4BNRA 3OU0A 4O3TA 3SUFA 1GHYH 4NIXA 4B1TA 1DT2A 4ZHLU 1KTTB 1AQ7A 1DLEA 2BB4A 3LKWA 5AF9H 1NT1A 1E37B 3ZZBA 5FHTA 2IJOB 1PPHE 1UMAH 2RA0A 4YOIA 3ZVGA 4OS2A 3BTKE 1ESTA 4OS7A 2BOHB 1V2LT 3ZZ6A 3RXKA 3BG4C 1K28D 1DM4B 5T6GA 4XOJA 2FI5E 3A86A 1G2LA 3LC3A 4THNH 2Y81A 1GVLA 1A0HB 2WV5A 2ZCLP 6CHAB 4YESB 1D9IA 2Q6DA 2OINA 3CENA 3F1SB 5CE1A 2ZC9H 1WTGH 1GVZA 1ZGVA 4LXBH 3S9BA 3KL6A 1C2GA 1GDQA 4Y6DA 5E0JA 5DP9A 1YGCH 1IAUA 2BDBA 2FDAA 1WQSA 1EP6A 1ZTLA 4D9QA 2OLGA 4F4OC 2VNTA 2A1DB 3FFGA 1QHRB 3V3MA 1IQLA 1EP5A 1CBWB 5IDKA 4DIHH 1KXCA 2FOCA 1VITF 1PQ5A 3TU7H 2FPZA 1P2JA 2FOAA 8GCHG 3RMNH 2A2XH 1H8DH 2ZIQH 2FOHA 2TGPZ 5GCHF 3GCHB 3VFEA 3RXGA 2ZECA 1TNKA 3SJ9A 1QRWA 1F0UA 1NC6A 3BEUA 3ZVBA 4AORA 4NWKA 1IQIA 1MCVA 2ZU1A 3TJNA 3ZZ8A 4H4FA 1DXPA 3SNDA 2ZA5A 1QRXA 2ZTYA 5EQRA 1SC8U 4IN2A 4AFUA 1RTLA 3DT0H 3AW1A 2Y80A 3KQBA 1JOUB 1TNLA 2A7HA 1GG6B 1RRKA 4I33A 4DT7B 5EQQA 1SGTA 1ETSH 4JYUH 1O2KA 4H6SB 5FX5A 2A45B 4NIWA 3BSQA 1SGNE 3MHWU 1DLKB 4ABHA 2Q6GA 1T32A 1D6RA 1K21H 4DURA 1TFXA 1PPGE 4AGKA 4A6LA 1L4DA 2ZPRA 3BTHE 2ODYB 1GBIA 3QK1A 2OXSA 1ID5H 2ASUB 1TOMH 1DWCH 2GV6A 1P2OA 3A7YA 7GCHF 4WH6A 1E35B 4E06H 1CE5A 4CRAA 1J9CH 3KEEA 1C5LH 1BMMH 1HV7A 2FWWA 2ZHEH 1F92A 2G4UA 1ZSJA 1NS3A 3P95A 2H9TH 4NFFA 3RLWH 2GT8A 2HVXA 1CU1A 1TOCB 1B5GH 3GDUA 1EPTB 3ELAH 5FBIA 4WH8A 1T4UH 1TWXB 2YNAA 2VU8E 1O2SA 1UTMA 5DGJA 1CHOF 4Y8YA 2FX6A 3SUDA 1HUTH 1GBFA 2XTTB 9ESTA 4B2AA 3VB6A 2BD5A 1YM0A 2QCYA 1ABJH 1QURH 4X2XA 1ANBA 4X6OA 1O3NA 2ZU4A 2G5VA 4OGYA 6GCHG 1XUJA 2HNTF 1O2RA 2KAIB 3F9FA 1BIOA 1TPAE 4E05H 1BJVA 3P8OA 5F8ZA 1C5ZB 2GMTC 2LNCA 2Z6BD 1AN1E 4WMDA 5L6NH 1UVOA 1TBZH 3QZQA 1GBAA 1YYY1 2XBXA 1C1VH 1E36B 2BD4A 2BLOA 1K2I1 2PW8H 4BAHB 3UR9A 1THPB 1FIZA 3BIUH 3NK8A 5K7RA 2ESTE 4NGAH 1G3DA 1VJAU 1XVOA 1TQ0B 1GI0A 1Y5AT 3RMLH 3ZZAA 3SUEA 1HAGE 1O38A 2PUXB 3SNBA 1EASA 3KIDU 2H6MA 1W0ZU 2EI8A 1EZUC 5BPEA 1MKWH 1A5IA 1C5WB 5C20A 2XW9A 3FP7E 3QN7A 1ELFA 1VITG 1SHHB 1QQUA 4XBBA 1FZZA 5HMAA 1ZSLA 4NZQA 1GDNA 4YLUA 4ISIH 1TBRH 3E16B 3RMMH 4Y8ZA 1AFEH 1RIWB 5T6FA 3LGUA 1SLUB 4CBOA 3A84A 2P3UB 1V3XA 3IG6B 1QB6A 2QN5T 1BA8B 4DY7B 1P04A 4E7RG 5IYTA 1YP9A 4DW2U 3S69A 1AWFH 4UE7H 2P95A 1NROH 2F9OA 1ZJDA 1QCPA 1GBCA 1T8NA 1XX9A 3SQHE 3E91A 1JRSA 3GCTG 5T3HA 1C1PA 1HFDA 4H6TA 2BXUH 1ZMLA 3RXTA 3V7TA 4TYDA 4B2CA 2HNTE 1C4Y2 1QL8A 1ELGA 3PROA 2PR3A 1A3BH 1DE7H 2PKSB 1H1BA 1P02A 2ZCHP 3UFAA 1HBTH 4X1QU 1OWIA 4K1EA 3P92A 3VB5A 4FUCA 1XKBC 3ZVFA 1Y3XA 3Q3KA 4XDEA 2AIPA 3SJKA 4SGAE 3U8RH 1IQEA 1FIWA 1EPTA 1CSOE 1SGYE 2Z9IA 1V2ST 1NU9A 3H7OA 2Z9GA 1FN6A 2BD7A 2H5DA 1TLDA 1LTOA 2Y5GA 3O8BA 7GCHG 1AB9C 4NIVA 2AYWA 1C2DA 3VEQB 3HGPA 1S85A 1C5OH 1S0QA 5A09A 2RCEA 2D2DA 3B8JA 2VINA 1C2HA 2A4GA 3SJIA 2AFQB 4BANB 1UVTH 3QDZB 3M36A 4FUBA 3SJOA 3ATLA 4OS6A 5AHGH 1C5VA 4ZKOU 2KAIA 1TMUH 4IGDA 1YCPK 5EODA 3RXDA 1O2MA 2FP7B 1RFNA 1Q2WA 3EA7A 4GUXA 1PQAA 2ZGCA 1TBQH 1GI5A 2C93B 3ZZDA 2UWOA 4Q7YA 1T8OA 1C2LA 3GY7A 1QBOA 3SGQE 1GJ9B 1O2TA 1C2KA 3T5FH 1ZR0A 1C1QA 3ZZ4A 3QGJA 2AGIX 1O5BB 1O2VA 3M5LA 4UFGH 1BHXF 2QXJA 1O5AB 3QLPH 3LONA 2EA3A 1ZRKA 2VH6A 5EW2H 3A7XA 3SV8A 1LHCH 1NESE 4NCYA 4MQAA 1O3IA 2WYJA 3KGPA 3S0NA 4ZH8A 4ZKRU 3OY6U 1F5KU 5LPFA 4MNWA 2GVFA 1TGSZ 2Y82A 1GL1A 1AZZA 1HJ8A 1H8IH 1AVXA 1O37A 1HAXB 1F7ZA 1GJCB 2TPIZ 5C5OA 3TH4H 2HOBA 4HFPB 1P2IA 4FUHA 2NU4E 7LPRA 4CH2B 2P3TB 1NFWA 3I77A 1G37A 1FXYA 3VPKA 3ZVDA 1HAZB 2PTCE 2WPKS 1Y59T 2WYGA 1U6QA 2CGAA 2O8WA 2F83A 5ESBA 1WBGB 3MOCA 2GCTC 1VZQH 3SGBE 1AVGH 1SLXB 1P8VC 3NCLA 1AU8A 2G4TA 1ZZZA 1P09A 1BMNH 1RD3B 4JZDH 4IW4E 3A85A 4NA9H 2BY8X 4K2YA 3TITA 3RXJA 6LPRA 4B74A 1UK2A 5EPYA 3BTDE 3AAUA 2WPHS 4RKJB 3RXSA 4R0IA 1G3CA 1MTWA 1Z8IB 1CO7E 2NWNA 2XBWA 2FLBH 2OC8A 2QXHA 3P17H 3RMOH 3M3VA 1ESAA 2SNWA 6CHAC 2YNBA 1ORFA 4ZKNU 1K1PA 4X6MA 2V3HH 5TJXA 3ZZ7A 1WTHD 2D1JA 3MU8A 1HXFH 3C27B 4NA8A 1BTWA 4NSYA 4BAOB 2BLWA 4TY7A 3FP6E 4PROA 2I6QA 5K0HA 2OQ5A 3LJJA 4ISNA 1OX1A 2SGPE 8GCHF 1LO6A 2RDLA 3STIA 2C8WB 2WPJS 4NA7A 1ETTH 1P3CA 3RDZA 4XBDA 1C2IA 5CHAB 1Y3WA 1UJ1A 1NRQH 1TNGA 3MNXA 2FESH 4I7YH 3RC5A 1SFQB 1GI7B 3RXVA 2FI3E 1EB1H 3EQ0H 2M5TA 1FAKH 1IOEA 2BY9X 2Y7XA 2QC2A 5J4QA 4BAKB 3SU0A 1ZPZA 2ZU2A 3GCHC 2DE8A 1TRNA 2ALVA 1TX8A 1YBWA 5A8YA 3M7QA 1BZXE 1O2ZA 5DP5A 3EDXB 3P6ZB 1E34B 3PTBA 1KXAA 4K8BA 4BXWA 1LPKB 2BDHA 2ZGHA 4AN7A 1FPHH 4Q80A 3RXFA 2OP9A 2BD8A 1L2EA 1DUAA 5DP3A 2BOKA 4NG9H 4INHA 1Z8GA 1HAYB 3TNTA 2VH0A 3GICB 1GG6C 3LGTA 1O2LA 2A4OA 1P57B 1GJ6A 1UCYH 3MI4A 4NZLA 1BTZA 1D3QB 4RN6A 3TK9A 3OY5U 1WOFA 3RXLA 1Z1IA 1F0TA 2ZHDA 1AFQB 1IQGA 4A1XA 2XBYA 1QL9A 1JIRA 4A5TS 2NU0E 1KIGH 2V3OH 3RC4A 3TJVA 1MQ6A 3GY2A 2FX4A 3ZVCA 1XUIA 2OQUA 2B8OH 1XUGA 1VCQA 2BDYA 2GCHG 2IN2A 2PSXA 3PLBA 1V2MT 3KQDA 5A0AE 1FY4A 1ZSKA 4KP0A 1PPFE 1P12E 2OBOA 2OC0A 4YOGA 5EPNA 1DVAH 2STAE 1Y5BT 2JETB 4GHTA 4Q7ZA 3RXUA 1O5GH 1EAXA 4U01A 4ASHA 4CREA 3EA8A 4Q2KA 1T31A 3UWIA 3ZVEA 2J2UA 4AFQA 4BTUB 1ZMNA 3QTVH 2P59A 2PUQH 3SV6A 3T25A 2GGVB 3UPEA 1BRAA 1ABIH 3LH3A 4CRDA 1MZAA 1EPTC 3BEIB 5A8XA 4JK6A 1DY9A 6GCHF 3T2NA 1O35A 1CGIE 2P3FH 1OWEA 2ANYA 1PPBH 4FUDA 1FY1A 4OS1A 2ZFRH 4Q7XA 2FEQH 3BTGE 1O3PB 5F03A 1S0RA 3BTTE 3PM3A 2CMYA 1V2NT 1O3FA 2FOGA 1C1WH 3PV4A 1GHAG 4VGCB 2CV3A 2VWLA 1HJAB 2AS9A 4WMFA 1J17T 1NFUA 2GKVE 1GBLA 3ZYEA 1PQ8A 3SHCH 1PFXC 2Z3EA 1TONA 5DKMA 1G32B 1GBDA 5FX6A 1LVOA 1HIAB 1C5PA 1O32A 2CHAB 1ELVA 7KMEH 1JWTA 1W14U 5HM9A 3MU0A 1EZXC 4MNYA 2SGFE 4BTIB 2A2QH 5PTPA 2A5IA 2OTVA 4JZFH 5J4SA 3RM0H 1QB9A 1C5QA 3C1KA 2PLXA 1LMWB 2ZG0H 2J38A 3RXOA 3SU2A 5HYOA 1ZPBA 2ZFSA 1RJXB 3E0PB 2H1UA 1O3LA 1LHEH 2AERH 1ZPCA 2A5AA 3P70B 2V0BA 1K1NA 2Z9LA 2BHGA 3MU1A 1C2FA 3D49H 1O3MA 2R3UA 3GCOA 1INCA 1Q3XA 1YPGH 2A32A 1UK4A 4FVDA 1QL7A 1AVWA 1FLEE 1GI8B 3MO6A 1KYNA 3F9EA 4Y0ZE 2ANKH 4UONA 2BVXH 1X7AC 4MTBA 5GPIB 1ELAA 1FN8A 3MU4A 4ISHH 1O3EA 4JMYA 1OWKA 3MNSA 4X1SU 3UNSA 1TE0A 1RIWC 3F9HA 3GCTF 2CF8H 4I8HA 2HLCA 4AZ2B 3SV9A 4HI3A 1DSUA 1ZHRA 2QF0A 2W26A 1THSH 4INLA 1NN6A 2UUJB 1IQJA 1C1SA 1TALA 3T27A 3U1IB 2FI4E 3M61U 4D7FA 2TIOA 3RXMA 3FVFB 4X8SH 1A61H 2R2MB 1XM1A 2HRVA 3SU4A 3A8AA 3LJOA 4BTTB 3M37A 3UTUH 1OP8A 1O3CA 1MTNB 1ZHPA 1AGJA 1D6WA 1UTKA 1O2JA 4AFSA 2Q6FA 3A7WA 1NFXA 2G81E 1GBJA 5A0CA 1EAWA 1O2XA 4BAMB 2AMQA 5EW1H 2A7CA 1AZ8A 1LHDH 2PKSC 2TGAA 1WV7H 1FI8A 1G36A 1TMTH 1YF4A 4ZKSU 1V2JT 4A92A 2GDDA 2VVUA 1BBRK 5GDSH 2OCVB 1OYTH 2XC4A 1D4PB 4UEHH 1EUFA 1PYTD 2G5NA 2WUCA 1O2HA 3LU9B 1MCTA 1K9OE 5DP4A 1MAXA 1QA0A 1SL3A 1BCUH 5JBCS 3MFJA 2XXLA 3ITIA 1SB1H 1THRH 1A2CH 2FOEA 3GOVB 1K1JA 2XC5A 1KXFA 2PTNA 1GDUA 4INKA 1EB2A 5DG6A 3QUMP 4ZXXH 1V2TT 5A8ZA 3QX5H 1QA7A 4GAWA 1FY3A 3K6ZA 3SNAA 1XVMA 4B73A 1D3PB 3N7OA 4Y7AA 2SGEE 1GPZA 1MKXK 1O36A 1GCTB 1LPGB 3A83A 4K1SA 1FUJA 1UCYK 1HIAA 1L4ZA 2BVRH 3KN2A 1MZDA 1UTOA 4I32A 5EQSA 2J94A 1C1MA 4MPXA 1LQDB 3FP8E 1CQQA 2UWLA 4U32A 2CF9H 5BRRE 1N8OB 1YLDA 3DFJA 1EJAA 1C5TA 1YPKH 3GY5A 2AIQA 4X2WA 2EC9H 3ATMA 1CT4E 1C1OA 1VITH 1VGCB 2R0KA 4I31A 2J4IA 3DFLA 3FZDA 4X1NU 4LK4A 1UTLM 4ZROA 1Z71A 4GCHG 1BTPA 2IOTA 2LPRA 1O2GH 3ZZCA 3SI4H 2HPPH 1JBUH 2ZDVH 3LPRA 5DP6A 1NO9H 2FS8A 5H4IB 1QB1A 4ABBA 2RG3A 1WYKA 2Z3CA 3BTEE 5C1XA 5EXMA 1F0SA 1HJ9A 3BTWE 1TGTA 1A1RA 3O8DA 1PQ7A 3ZYDA 3SW2B 3ESTA 2UWPA 1B0EA 2JH5D 4YO9A 1SGFG 1D3DB 3ZZ9A 2FXRA 2I6SA 2GP9B 3AAVA 4DG4A 3GY6A 1C9TA 3ODDA 4U30A 1GHVH 2QA9E 2JKHA 1O2IA 3S7KB 1RTKA 3MH5A 4YLQH 2G00A 4X8UH 1WSSH 2A4RA 3SU3A 3CS0A 4MLFB 5FPTA 1BTHH 1P2NA 3P8FA 3GY3A 1DITH 1YPHC 5EXNA 3VXFH 2ZTZA 1TYNA 1YPEH 1EZSC 1QTFA 3E1XB 4GHQA 1SFIA 4UFEH 1BDAA 3HATH 1V2OT 2FS9A 4WXVA 1Z6JH 2H2ZA 3H7TA 2Y5FA 1OWJA 1CGHA 5JB9S 5FPYA 1H9HE 1HB0B 1Y3UA 1TGNA 5C1YA 4TWYA 2TGTA 1MU6B 1XKAC 3U9AH 4KTUA 2ULLA 2B5TB 1TX7A 1PPEE 3A82A 4JYVH 1BITA 3T29A 3U98H 2FOFA 4NFEA 1KLTA 5G4BA 4YM9A 1E0FD 4OS4A 1GHBG 1XXFA 1A3EH 4I8GA 1GHZA 3TLOA 1V6DA 1AY6H 2A0QB 1ELEE 5CHAC 2C4FH 4AYVB 1GJ7B 3FAOA 1P2MA 3G01A 1SPJA 1SHYA 1W8BH 2A5KA 2SFAA 3A8DA 3KNXA 4O9VA 2BQWB 2QY0B 1DUEA 5FAHA 3T62A 2WPLS 1LVYA 1ARBA 1CA0C 1OOKB 3PLPA 3F6UH 4MPVA 1BRCE 1C9PA 2HALA 5FBEA 4ZUHA 2FMJA 1GJAB 2FTLE 4DVAU 1N6XA 1A7SA 1W12U 5JBBS 1LDTT 4IMQA 1BT7A 1AHTH 3NZIA 1MTSA 3GCNA 3VB4A 1P03A 1DICA 1YLCA 1VR1H 2ZGJA 2VGCC 1LPZB 4YTAA 4JYTA 3I78A 3TGKE 2Q1JA 2XRCA 5HXFA 3GYMA 3SUGA 1GMDG 1IHTH 1HAPH 3IWMA 1TIOA 1QGFA 2AH4X 1O2YA 2VJ1A 3UNRA 2P8OB 4AX9H 3SI3H 1L1NA 2NU1E 2GCHF 2EI7A 1ESBA 4A7IB 1M9UA 3U8OH 4TWWA 1GMHG 5AFZH 1FONA 1G3BA 2BXTH 2R3YA 1AFQC 3UOUA 3ZV8A 1O3JA 2O8UA 1P9SA 1RGQA 4MPWA 5DP7A 4A1VA 4D9RA 2CJIA 3RU4E 5A0BA 1FY5A 3IITA 1LHFH 5E0HA 3LGIA 1S84A 3EYDA 1N6YA 3PYHA 1Y3YA 1GI2A 2G55A 3QGNB 4O97A 4IC6A 1TPPA 5JDUB 3SBKA 1PPCE 1Y3VA 1VCWA 2QGRA 1O2OA 2JETC 3K9XB 1GWAA 2V35A 3A88A 4JZEH 1LKBA 2PWXA 2ZPQA 3MH4A 1P10A 4UDWH 2XWBI 2TBSA 4JZ1A 2WUBA 1TRMA 3FZZA 2ZKSA 1C2EA 4ABGA 2DUCA 4SGBE 2BLVA 1TABE 3RXBA 1GHAF 2FLRH 1SGQE 1TX6A 1WU1A 3UNQA 3R3GB 3M7TA 1DOJA 1O5FH 1GCDA 1O3HA 4XSKU 1EZQA 1ZLRA 1BBRE 3TNSA 5ESTE 2HGTH 5ABWA 1DPOA 3A8CA 4OGXA 1C1NA 1AE8H 1NZQH 3R0FA 2H5CA 1HRTH 1SLWB 2SNVA 4OS5A 4ABDA 2ANWA 2ZF0H 4CRFA 4KTCA 4VGCC 4UD9H 1HJAC 3HKIB 2BDIA 2P16A 1VJ9U 1SGFA 3SU1A 3KQCA 1QFKH 1TGBA 3ATIA 4ZHAA 1OYQA 1DWEH 5JBAS 1NU7B 1MKWK 2WPMS 2CHAC 3RU4T 2XYAA 4Z6AH 1GI3A 1HGTH 3Q3YA 3K2UA 3HK6B 1B7XB 1QNJA 1QY6A 3A80A 1ZOMA 3OX7U 3QWCH 4Y11E 1FMGA 2ZTXA 2DE9A 2QIQA 1UTQA 2H9HA 1ZGIA 4LOYH 4HTCH 1CA0B 5LGOA 2XCNA 2FOMB 1J14A 3K65B 3UUZA 1G30B 1SVPA 3SQEE 3M5NA 2C90B 5L30H 1HAHH 3BV9B 3ODFA 3VB3A 3JZ1B 1V2RT 5CMXH 3L3TA 2ZFPH 1HCGA 1ELDE 4KGAA 1HAVB 2VGCB 1GGDB 1SOTA 2PHBA 4YT7H 1OPHB 3RUOA 1FNIA 4DCDA 1PJPA 4AYYB 1WQVH 3M5MA 5E0GA 2QV1A 1SGEE 3K6YA 3A7TA 1ELTA 2ZQ1A 3NUMA 1DWBH 5HM2A 5T6DA 1NFYA 2A7JA 2ZU3A 2THFB 1GMCG 1KSNA 1YC0A 1T8LA 3GISB 3DD2H 1J8AA 4A1TA 1FJSA 1W11U 2Z3DA 1LCYA 2ZQ2A 2NU2E 1ACBE 4AB9A 5DO4H 1MTNC 2UUKB 3SV7A 1O2NA 2WV4A 1FQ3A 1CGJE 3D65E 2J34A 3CS7A 3UIRA 2O8LA 2HWLB 2PV9B 1KDQB 2ILNA 2ZFQH 3RXIA 5I25A 2ANMH 1AMHA 2W5EA 1NTPA 3PWBA 3RXHA 2BZ6H 2ZWLH 1T4VH 1MD8A 4LZ1H 2FM2A 3T28A 1V2KT 4FXGH 2GDEH 4X2VA 2K1QA 3Q77A 4MNXA 2G51A 3M7UA 4K60A 1MH0A 1P2QA 1JXPA 2ZHWH 6ESTA 1Z8RA 4WVPE 1SOZA 2G8TA 2VWMA 1SQTA
chains in the Genus database with same CATH superfamily
1W7XH 3A87A 3ZZ5A 3RXPA 4CR9A 1GI6A 3OYPA 1IQKA 3BN9A 3BTFE 1CA8B 4ISLA 4Y76A 5FCRA 5LH8A 2W3KA 2WINI 2F43B 5DJ7A 5KGOA 1C5YB 4D76A 1O3KA 4AOQA 1AKSB 2G52A 3RXCA 1K22H 2PKAB 3STJA 3LC5A 1A0LA 1S6HA 2BQ7B 4JK5A 3PMHB 4KELA 1O3BA 1FAXA 1P2KA 3A7ZA 4RI0A 1H8HD 5AFYH 3EA9A 4K5ZA 5DPAA 1EATA 1NRNH 2VVVA 3SNCA 1GCTC 2F9UA 1F0RA 3F9GA 1O5EH 1Y8TA 3HKJB 1F2SE 1EJNA 3MH7A 2PGBB 2GZ8A 5B6OA 1GJBB 1J16A 4BOHA 4XBCA 1AUTC 2XC0A 4IC5A 2GD4B 2BDAA 1ZJKA 3F3BA 4K1TA 5GJ4B 3V13A 1N8OC 4GCHF 1EOJA 1KLJH 3ZV9A 1BHXB 2L74A 1IQFA 3EAJA 1BRBE 1OP0A 1MTUA 1ZTJA 2TRMA 3TPIZ 4B6FA 4X6NA 1Z1JA 3EE0B 4WMEA 3F68H 2AEIH 2QXIA 3S9AA 1GBMA 1TPSA 2SGDE 1WAYB 1VGCC 1C1TA 4Y8XA 2B9LA 1T7CA 2EI6A 1S6FA 3PRBA 5C5NA 1ANCA 4MNVA 1TNJA 1XUKA 1IHSH 1W3CA 1UTPA 2AMPA 5FCKA 5JPMH 3PWCA 4OM9A 1HAVA 2OD3B 3OEHD 1FY8E 2BD9A 3SOSA 1UVPA 3NWUA 1ZMJA 4X0WU 3TGJE 2EY4C 1EAUA 2ZEBA 2VIOA 3TH2H 2QF3A 5TCAA 4ZHMU 4BAQB 2VVCA 2VIQA 1AI8H 3SJ8A 4IN1A 2HPQH 2WZQA 4B2BA 1QQ4A 4AG1A 1P3EA 4Y7BA 4RKOB 4B71A 1Q31A 3M5OA 5GIBA 1G2MA 3BG8A 1ZRBA 2QF4A 3PMAB 2J95A 1KXEA 3PMJA 1C5NH 1P0SH 1VCPA 3B9FH 1P05A 1AUJA 1DS2E 4Y10E 2VWOA 1XUHA 4I8KA 2BQ6B 1TRYA 2QYIA 1IQNA 1KDQA 2OC1A 2ZDMA 2XCFA 1UHBB 4JCNA 1LVBA 2BY6X 3GYLB 3UOPA 2BMGB 1YCPH 2Y6TA 4MDSA 1QBNA 1JIMA 1K1IA 1T8MA 3RXEA 4CH8B 1S6LA 4TSFD 2OC7A 1GI4A 2O8TA 1HXEH 1ZTKA 2BYAX 2OBQA 3LT3A 1OS8A 1C1UH 5DP8A 1GHBF 4WXIA 3V12A 3TJOA 1PPZA 3GY8A 3DA9B 4Y79A 3VGCB 1IQMA 1MU8B 5CDFE 3Q3XA 3BEFB 3B23B 7ESTE 2K8IA 2YMSB 3ATWA 3RM2H 3PO1B 3QZRA 1BMAA 1EAIA 1IQHA 2AGEX 1S5SA 1GI9B 1QBVH 3QTOH 4WWYA 3S9CA 1Z8JB 2VIDA 4Z0KA 2ZP0H 1AKSA 1O31A 4E7NA 5F53A 1HPGA 1O3OA 2BDGA 2ZGXH 2PKAA 3ZZ3A 1SR5C 4FUGA 1ANEA 1GHXH 1TB6H 3TGIE 4O03A 1N1LA 1UVUH 3RC6A 1NRPH 2BD3A 3NXPA 2A31A 4CHAB 3A89A 1BTXA 2PGQB 5C1UA 4J2YB 1TNIA 4RT1A 2Z7FE 2VWNA 3QO6A 4DIIH 1YPLH 1QJ1B 1AIXH 5E8EH 3HPTB 4FUEA 1GMDF 1ZHMA 1RTFB 2W7UA 4CR5A 2J92A 5GXPA 2EEKA 1WCZA 1NRSH 1GJ8B 1KMHB 1MUEB 1J15A 3LGWA 3SNEA 3FANA 1C2MA 3BG4B 5JYIA 2IPHA 1BB0B 5A2MH 1C4V2 2CN0H 4WJG2 3WY8A 2F9NA 1NPMA 1YKTA 4I8LA 1TA2A 1GMHF 4BXSA 1RS0A 1GJDB 1QJ6B 3RU4D 3TJUA 1XMNB 3DUXH 1V2UT 2P8OC 1DX5M 3A7VA 3UWJH 1FPCH 2ZO3H 3LOXA 3PTNA 1QR3E 1EOLA 4XE4A 1GHWH 3PMBB 2ZDAH 3TVJB 4YOJA 1H9IE 5DK1A 3A8BA 3Q76A 2CXVA 1ZYOA 3BIVH 3SHAH 1O3AA 4X6PA 2D8WA 2ZDNA 3HGNA 3RXQA 3V0XA 1H9LB 1O2PA 1O2QA 3BTQE 2ODPA 1K1MA 1P11E 5SGAE 1QRZA 2FOBA 8LPRA 4MPUA 5HIYA 1OWDA 2BLQA 4MG3A 4X8TH 3SU5A 4B75A 4AG2A 4IMZA 1QJ7B 5EG4A 1JMOH 4KTSA 1EQ9A 1BUIA 3FOAA 1NRRH 1KXDA 1UK3A 2BTCE 4Q63A 5HGGA 5C2ZA 3GY4A 3MMGA 1SMFE 1CT0E 3NRLA 1MBMA 4GLYA 1A5GH 1EJMA 3L6PA 1UHBA 1SGIB 3ENSB 5AVDA 4X8VH 1L1GA 1S82A 1BOQA 5F8TA 5GCHG 4ISOA 1KLIH 1ELCA 2FYRA 1LHGH 1BJUA 1C1RA 1NY22 1BTYA 1W2KH 4TPIZ 1TA6A 1YPHE 3AVZA 1E38B 2JH6D 2SGQE 1YPJH 3LGVA 2BD2A 1GVKB 1LKAA 4TY6A 5F6MA 1EKBB 3MU5A 1XUFA 1HAIH 1DANH 1V2QT 2STBE 3KF2A 4ZAEA 2FO9A 2HNTC 1W0JD 4QT8C 3LIWA 4ABEA 2Z94A 2Y5HA 1K1LA 2JJ1D 2ZHQH 1O0DH 4FUJA 2F9VA 5GWZA 1MQ5A 3GDSA 3SN8A 3JZ2B 4CRBA 1O5CB 3VB7A 1SGRE 1Z6EA 3UR6A 3F0PA 2R2WU 1O5DH 4X1RU 1MD7A 3MTYA 1HLTH 2W7SA 1SI5H 1HAOH 4CRCA 3SYJA 1TMBH 3O8RA 2VB0A 4NSVA 2B0FA 4GVUA 1GL0E 5LPEA 3T26A 4XRNA 3VXEH 4H42U 1YPMH 3Q00A 2UUYA 4CBNA 1W13U 1O2WA 2RA3A 1O33A 1ANDA 4FOUC 2O8MA 4F55A 2O9QA 4K69A 3SU6A 2ZPSA 1PYTC 1V2WT 3GDVA 3UB0A 2FIRH 2H9EH 1C5UA 1RXPA 1WUNH 2ZI2H 1GBBA 2R0LA 4K3JA 4NIYA 8ESTE 1C5RA 2GZ7A 3TK5A 3O8CA 1UO6A 5E2PA 3TH3H 3URDA 1GMCF 2SGAA 2ZDKA 3MO9A 1GGDC 4AGJA 5ETXA 1C5MD 2XNIA 3E8LA 5C3NA 1CHOG 3H09A 3KCGH 1SLVB 2GMTB 3SGAE 2XWAA 1FV9A 2FYQA 2GV7A 4IS5A 2F9BH 4JZIA 3L33A 2V6NA 3P8NA 2BDCA 1O34A 3U69H 4ABAA 4DGJA 1UVSH 1OWHA 1S83A 1SG8B 1AE5A 1SQAA 2BY7X 2ZFFH 1K1OA 2AGGX 2UUFB 1Z7KA 3OTJE 4D7GA 1ETRH 2GZ9A 4GSOA 3PB1E 1COWD 1SSXA 1BRUP 3OSYA 1GI1A 3CP7A 1MBQA 2FZZA 2J97A 4Y71A 1W0YH 1YCPM 4DJZB 1O30A 3H5CB 5JBTA 4AFZA 4FU7A 2TGDA 3ZVAA 1AO5A 5L2YH 3E0NB 3SZNA 5F8XA 2WPIS 2ZCKP 3P8GA 4Y0YE 2Y7ZA 1OXGA 2JH0D 1O39A 1HNEE 1A4WH 5EOKA 4IBLH 4WY3A 1TPOA 2C8XB 2ZFTA 3SORA 1A5HA 4ABJA 3AASA 3DHKH 4YZUA 1GBHA 1KXBA 1KTSB 3TIUA 3E6PH 2B7DH 1LVMA 3KHVA 4GPGA 4HGCA 5L2ZH 3UREA 3MH6A 1S81A 5EU8A 2C3SA 1G9IE 4I8JA 9LPRA 2VIWA 5B6LA 2BZAA 1OP2A 2F9PA 1H4WA 4R8TB 1MMJN 3U8TH 4FUIA 1D3TB 2OUAA 3LDXH 1C2JA 1UTNA 3M3TA 5T1VA 1NM6A 1EX3A 3A81A 4ESTE 1BMLA 4HZHA 2NU3E 4M7GA 4ZMAH 3AW0A 1SGPE 2ZU5A 3E90B 1OSSA 1BQYA 2GX4A 4MVNA 2ZDLA 2PSYA 8KME2 3OFND 2FODA 1DWDH 4LZ4B 1O3DA 5JB8S 1CVWH 4WF8A 1OKXA 1KY9A 2VIPA 2ODQA 1C4U2 2D26C 2ZGBH 3HK3B 3EGKH 1TQ7B 2Z9JA 2GTBA 4NWLA 1TAWA 1B0FA 1ELBA 4FVBA 1MTVA 4TPYA 3SO3A 1G3EA 2J98A 2VIVA 1P01A 4O3UA 3UY9A 1Y5UT 5I46H 1F5LA 1C5XB 1UCYE 1AB9B 1UTJA 2BY5X 2GJGA 4ZXYH 4F49A 1DFPA 3M35A 4AB8A 3LGYA 1DSTA 1P06A 4J1YA 1LQEA 1SGDE 1BBRH 3OE7D 1CBWC 2ALPA 3RLYH 1GBEA 2PFEA 2FTMA 2JIZD 5EXLA 3NPSA 1SGCA 2Z9KA 3LH1A 1O2UA 2PP6A 1CT2E 4CRGA 2P94A 4D8NA 3RP2A 3W95A 2QAAA 1XXDA 1W10U 2BM2A 3MNBA 1CHGA 1O3GA 1HDTH 5LPRA 1V2VT 3ATKA 1SQOA 3URCA 5TCCA 2BX4A 1A0JA 4DOQA 2F3CE 4RSPA 2ZZUH 3D62A 2ZNKH 5E2OA 5C67A 4X2YA 3MQKC 3M3SA 2LELA 2EQNA 2F91A 3SV2H 4K8YA 2ZHFH 1DY8A 2AMDA 1DXWA 2P93A 2QXGA 2BX3A 3BTME 1MKXH 4FU8A 5EGMA 4FU9A 1TGCA 3PV5A 5FPSA 4X1PU 3UQVA 3NKKA 2GT7A 2K0QA 3MO3A 2C8ZB 4FUFA 1MAYA 3D23A 3KQEA 3I29A 3MYWA 2XBVA 1EXFA 3U1JB 2IPQX 1QIXB 5HKKD 1AWHB 1A46H 1AD8H 3PLKA 2A4QA 2C8YB 3VGCC 3RXRA 1GBKA 3S7HB 4ABFA 3PO1C 1UW7A 2J9NA 2KCOA 2R9PA 1ARCA 1JRTA 4U2WA 4UFDH 2YOLA 1GBTA 1TNHA 3RXAA 3BF6H 1FDPA 4KKDA 1V2PT 4ABIA 1C5SA 3E3TA 2VBCA 1DDJA 1L1JA 4YT6H 3MNCA 3UQOA 4UFFH 1GJ5H 5FXLA 2GCTB 3MWIU 4XFQA 1BTUA 1NBMD 1P9UA 1W7GH 2KCYA 3TK6A 4B76A 1SBWA 1F5RA 2W3IA 3CNRA 3W94A 1L0ZA 2BVSH 4CHAC 1GJ4H 1HYLA 4BNRA 3OU0A 4O3TA 3SUFA 1GHYH 4NIXA 4B1TA 1DT2A 4ZHLU 1KTTB 3WWBA 1AQ7A 5HIZA 1DLEA 2BB4A 3LKWA 5AF9H 1NT1A 1E37B 3ZZBA 5FHTA 2IJOB 1PPHE 1UMAH 2RA0A 4YOIA 3ZVGA 4OS2A 3BTKE 1ESTA 4OS7A 2BOHB 1V2LT 3ZZ6A 3RXKA 3BG4C 1K28D 1DM4B 5T6GA 4XOJA 2FI5E 3A86A 1G2LA 3LC3A 4THNH 2Y81A 1GVLA 1A0HB 2WV5A 2ZCLP 6CHAB 4YESB 1D9IA 2Q6DA 2OINA 3CENA 3F1SB 5CE1A 2ZC9H 1WTGH 1GVZA 1ZGVA 4LXBH 3S9BA 3KL6A 1C2GA 1GDQA 4Y6DA 2CK3D 5E0JA 5DP9A 1YGCH 1H8ED 1IAUA 2BDBA 2FDAA 1WQSA 1EP6A 1ZTLA 4D9QA 2OLGA 4F4OC 2VNTA 2A1DB 3FFGA 1QHRB 3V3MA 1IQLA 1EP5A 1CBWB 5IDKA 5CHBA 4DIHH 1KXCA 2FOCA 1VITF 2XOKD 1PQ5A 3TU7H 2FPZA 1P2JA 2FOAA 8GCHG 3RMNH 2A2XH 1H8DH 2ZIQH 4ACBA 2FOHA 1SQRA 2TGPZ 5GCHF 3GCHB 3VFEA 3RXGA 4HG6A 2ZECA 1TNKA 3SJ9A 5DSFA 1QRWA 1F0UA 1NC6A 3BEUA 3ZVBA 4AORA 4NWKA 1IQIA 1MCVA 2ZU1A 3TJNA 3ZZ8A 4H4FA 1DXPA 3SNDA 2ZA5A 1QRXA 2ZTYA 5EQRA 1SC8U 4IN2A 4AFUA 2HVYB 1RTLA 3DT0H 3AW1A 2Y80A 3KQBA 1JOUB 1TNLA 2A7HA 1GG6B 1RRKA 4I33A 4DT7B 5EQQA 1SGTA 1ETSH 4JYUH 1YY3A 1O2KA 4H6SB 5FX5A 2A45B 4NIWA 3BSQA 5GNDA 1SGNE 3MHWU 3OEED 1DLKB 4ABHA 2Q6GA 1T32A 1D6RA 1K21H 4DURA 1TFXA 1WDIA 1PPGE 4AGKA 4A6LA 1L4DA 2ZPRA 3BTHE 2ODYB 1GBIA 3QK1A 2OXSA 1ID5H 2ASUB 1TOMH 1DWCH 2GV6A 3F2FA 1P2OA 3A7YA 7GCHF 4WH6A 1E35B 4E06H 1CE5A 4CRAA 1J9CH 3KEEA 1C5LH 1BMMH 1HV7A 2FWWA 2ZHEH 1F92A 2G4UA 1ZSJA 1NS3A 3P95A 2H9TH 4NFFA 3RLWH 3ZIAD 2GT8A 2HVXA 1CU1A 1TOCB 1B5GH 3GDUA 1EPTB 3ELAH 5FBIA 4WH8A 1T4UH 1TWXB 2YNAA 2VU8E 1O2SA 1UTMA 5DGJA 1CHOF 4Y8YA 2FX6A 3SUDA 1HUTH 1GBFA 2XTTB 9ESTA 4B2AA 3DCLA 3VB6A 2BD5A 1YM0A 2QCYA 1ABJH 1QURH 4X2XA 1ANBA 4X6OA 1O3NA 2ZU4A 2G5VA 4OGYA 6GCHG 1XUJA 2HNTF 1O2RA 2KAIB 3F9FA 1BIOA 1TPAE 3UAIC 4E05H 1BJVA 3P8OA 5F8ZA 1C5ZB 2GMTC 2OK5A 2LNCA 2Z6BD 1AN1E 4WMDA 5L6NH 1UVOA 1TBZH 3QZQA 1GBAA 1YYY1 2XBXA 1C1VH 1E36B 2BD4A 2BLOA 1K2I1 2PW8H 4BAHB 3UR9A 1THPB 1FIZA 3BIUH 3NK8A 5K7RA 2ESTE 4NGAH 1G3DA 1VJAU 1XVOA 1E1RD 1TQ0B 1GI0A 1Y5AT 3RMLH 3ZZAA 3SUEA 1HAGE 1O38A 2PUXB 3SNBA 2WSSD 1EASA 3KIDU 2H6MA 1W0ZU 2EI8A 1EZUC 5BPEA 1MKWH 1A5IA 1C5WB 5C20A 2XW9A 3FP7E 1EFRD 3QN7A 1ELFA 1VITG 1SHHB 2WV9A 1QQUA 4XBBA 1FZZA 5HMAA 1ZSLA 5KEDA 4NZQA 1GDNA 4YLUA 4ISIH 1TBRH 3E16B 2WHXA 3RMMH 4Y8ZA 1AFEH 1RIWB 5T6FA 3LGUA 1SLUB 4CBOA 3A84A 2P3UB 1V3XA 3IG6B 1QB6A 2QN5T 1BA8B 4DY7B 1P04A 4E7RG 5IYTA 1YP9A 4DW2U 3S69A 1AWFH 4UE7H 2P95A 2M2AA 3EE7A 1NROH 2F9OA 1ZJDA 1QCPA 1GBCA 1T8NA 1XX9A 3SQHE 3E91A 1JRSA 3GCTG 5T3HA 1C1PA 1HFDA 4H6TA 2BXUH 1ZMLA 3RXTA 4ZCNA 3V7TA 4TYDA 4B2CA 2HNTE 1C4Y2 1QL8A 1ELGA 3PROA 2PR3A 1A3BH 1DE7H 2PKSB 1H1BA 2LP6A 1P02A 1E79D 2ZCHP 3UFAA 1HBTH 4X1QU 1OWIA 4K1EA 3P92A 3VB5A 4FUCA 1XKBC 3ZVFA 1Y3XA 3Q3KA 4XDEA 2AIPA 3SJKA 4SGAE 3U8RH 5C94A 1IQEA 4P02A 1FIWA 1EPTA 1CSOE 1SGYE 3VG8A 2Z9IA 1V2ST 1NU9A 3H7OA 2Z9GA 1FN6A 2BD7A 2H5DA 1TLDA 5C0TA 1LTOA 2Y5GA 3O8BA 7GCHG 2J5UA 1AB9C 4NIVA 2AYWA 1C2DA 3VEQB 3HGPA 1S85A 1C5OH 1S0QA 2KFWA 5A09A 2RDEA 2RCEA 2D2DA 3B8JA 2HLDD 2VINA 1C2HA 2A4GA 3SJIA 2AFQB 4BANB 1UVTH 3QDZB 3M36A 4FUBA 3SJOA 3ATLA 4OS6A 5AHGH 1C5VA 4ZKOU 2KAIA 1TMUH 4IGDA 1YCPK 5EODA 3RXDA 1O2MA 2FP7B 1RFNA 1Q2WA 3EA7A 4GUXA 1PQAA 2ZGCA 1TBQH 1GI5A 1K0HA 2C93B 3ZZDA 2UWOA 4Q7YA 1T8OA 1C2LA 3GY7A 1QBOA 3SGQE 4TT3D 1GJ9B 1O2TA 1C2KA 3FN8A 3T5FH 5EJZA 1ZR0A 1C1QA 3ZZ4A 3QGJA 2W6JD 2AGIX 1O5BB 1O2VA 3M5LA 4UFGH 1BHXF 2QXJA 1O5AB 3QLPH 3LONA 2EA3A 1ZRKA 2VH6A 5EW2H 3A7XA 3SV8A 1LHCH 1NESE 4NCYA 4MQAA 1O3IA 2WYJA 3KGPA 3S0NA 4ZH8A 4ZKRU 3OY6U 1F5KU 5LPFA 4MNWA 2GVFA 1TGSZ 2Y82A 1GL1A 1AZZA 1HJ8A 1H8IH 1AVXA 1O37A 1HAXB 1F7ZA 1GJCB 2TPIZ 5C5OA 3TH4H 2HOBA 4HFPB 1P2IA 4FUHA 2NU4E 7LPRA 4CH2B 2WPDD 4DT4A 2P3TB 1NFWA 3I77A 1G37A 1FXYA 3VPKA 3ZVDA 1HAZB 2PTCE 2WPKS 1Y59T 2WYGA 1U6QA 2CGAA 2O8WA 2F83A 5ESBA 1WBGB 3MOCA 2GCTC 1VZQH 3SGBE 1AVGH 1SLXB 1P8VC 3NCLA 1AU8A 2G4TA 1ZZZA 1P09A 1BMNH 1RD3B 4JZDH 4IW4E 3A85A 4NA9H 2BY8X 4K2YA 3OTPA 3TITA 3RXJA 6LPRA 4B74A 1UK2A 5EPYA 3BTDE 3AAUA 2WPHS 4RKJB 3RXSA 4R0IA 1G3CA 1MTWA 1Z8IB 1CO7E 2NWNA 2XBWA 2FLBH 2OC8A 2QXHA 3P17H 3RMOH 3M3VA 1ESAA 2SNWA 6CHAC 2YNBA 1ORFA 4ZKNU 1K1PA 4X6MA 2V3HH 5TJXA 3ZZ7A 1WTHD 2D1JA 3MU8A 1HXFH 3C27B 4NA8A 1BTWA 4NSYA 4BAOB 2BLWA 4TY7A 3FP6E 4PROA 2I6QA 5K0HA 2OQ5A 3LJJA 4ISNA 1OX1A 2SGPE 8GCHF 1LO6A 2RDLA 3STIA 2C8WB 2WPJS 4NA7A 3WW7A 1ETTH 1P3CA 3RDZA 4XBDA 1C2IA 5CHAB 1Y3WA 1UJ1A 4I86A 1NRQH 1TNGA 3MNXA 2FESH 4I7YH 3RC5A 1SFQB 1GI7B 3RXVA 2FI3E 1EB1H 3EQ0H 2M5TA 1FAKH 1IOEA 2BY9X 4AC9A 2Y7XA 2QC2A 5J4QA 4BAKB 3SU0A 1ZPZA 2ZU2A 3GCHC 2DE8A 1TRNA 2ALVA 1TX8A 1YBWA 5A8YA 3M7QA 1BZXE 1O2ZA 5DP5A 3EDXB 3P6ZB 1E34B 3PTBA 1KXAA 4K8BA 4BXWA 1LPKB 2BDHA 2ZGHA 4AN7A 1FPHH 4Q80A 3RXFA 2OP9A 2BD8A 3DSOA 1L2EA 1DUAA 5DP3A 2BOKA 4NG9H 4INHA 1Z8GA 2JDID 1HAYB 3TNTA 2VH0A 3GICB 1GG6C 3LGTA 1O2LA 2A4OA 1P57B 1GJ6A 1UCYH 3MI4A 5EJ1A 4NZLA 1BTZA 1D3QB 4RN6A 3TK9A 3OY5U 1WOFA 1E1QD 3RXLA 1Z1IA 1F0TA 2ZHDA 1AFQB 1IQGA 4A1XA 2XBYA 1QL9A 1JIRA 4A5TS 2KM0A 2NU0E 1KIGH 2V3OH 3RC4A 3TJVA 1MQ6A 3GY2A 2FX4A 3ZVCA 1XUIA 2OQUA 2B8OH 4ACAA 1XUGA 1VCQA 2BDYA 2GCHG 2IN2A 2PSXA 3PLBA 1V2MT 3KQDA 5A0AE 1FY4A 1ZSKA 4KP0A 1PPFE 1P12E 2OBOA 2OC0A 4YOGA 5EPNA 1DVAH 2STAE 3SZEA 1Y5BT 2QF5A 2JETB 4GHTA 4Q7ZA 3RXUA 1O5GH 1EAXA 4U01A 4ASHA 4CREA 3EA8A 4Q2KA 1T31A 1YLNA 3UWIA 3ZVEA 1W0KD 2J2UA 4AFQA 4BTUB 1ZMNA 3QTVH 4B6EA 2P59A 4YXWD 2PUQH 3SV6A 3T25A 2GGVB 3UPEA 1BRAA 1ABIH 3LH3A 4CRDA 1MZAA 1EPTC 3BEIB 5A8XA 4JK6A 1DY9A 6GCHF 3T2NA 1O35A 2JJ2D 1CGIE 2P3FH 1OWEA 2ANYA 1PPBH 4FUDA 1FY1A 5EIYA 4OS1A 2ZFRH 4Q7XA 2FEQH 3BTGE 1O3PB 5F03A 4Q4LA 1S0RA 3BTTE 3PM3A 2CMYA 1V2NT 1O3FA 2FOGA 1C1WH 3PV4A 1GHAG 4VGCB 2CV3A 2VWLA 1HJAB 2AS9A 4WMFA 1J17T 1NFUA 2GKVE 1GBLA 3ZYEA 1PQ8A 3SHCH 1PFXC 2Z3EA 1TONA 5DKMA 1G32B 1GBDA 5FX6A 1LVOA 1HIAB 1C5PA 1O32A 1QZ8A 2CHAB 1ELVA 7KMEH 2KR7A 1JWTA 1W14U 5HM9A 3MU0A 1EZXC 4MNYA 2SGFE 4BTIB 2A2QH 5PTPA 2A5IA 2OTVA 4JZFH 5J4SA 3RM0H 1QB9A 1C5QA 3C1KA 2PLXA 1LMWB 2ZG0H 2J38A 3RXOA 3SU2A 5HYOA 1ZPBA 2ZFSA 1RJXB 3E0PB 2H1UA 1O3LA 1LHEH 2AERH 1ZPCA 2A5AA 3P70B 2V0BA 1K1NA 2Z9LA 2BHGA 3MU1A 1C2FA 2KX4A 3D49H 1O3MA 2R3UA 3GCOA 1INCA 3DSPA 1Q3XA 1YPGH 2A32A 1UK4A 4FVDA 1QL7A 1AVWA 1FLEE 1GI8B 3MO6A 1KYNA 3KYFA 3F9EA 4Y0ZE 2ANKH 4UONA 2BVXH 1X7AC 4MTBA 5GPIB 1ELAA 1FN8A 3MU4A 4ISHH 1O3EA 4JMYA 1OWKA 3MNSA 4X1SU 3UNSA 4M9FA 1TE0A 1RIWC 3F9HA 3GCTF 2CF8H 4I8HA 2HLCA 4AZ2B 3SV9A 4HI3A 1DSUA 1ZHRA 2QF0A 2W26A 1THSH 4INLA 1NN6A 2UUJB 1IQJA 1C1SA 1TALA 3T27A 3U1IB 2FI4E 3M61U 4D7FA 2TIOA 3RXMA 3FVFB 4X8SH 1A61H 2R2MB 1XM1A 2HRVA 3SU4A 3A8AA 3LJOA 4BTTB 3M37A 3UTUH 1OP8A 1O3CA 1MTNB 1ZHPA 1AGJA 1D6WA 1UTKA 2AHME 1O2JA 4AFSA 2Q6FA 3A7WA 1NFXA 2G81E 1GBJA 5A0CA 1EAWA 1O2XA 4BAMB 2AMQA 5EW1H 2A7CA 1AZ8A 1LHDH 2PKSC 2KCPA 1WV7H 2TGAA 1FI8A 1G36A 1TMTH 4P00A 1YF4A 4ZKSU 1V2JT 4A92A 2GDDA 2VVUA 1BBRK 5GDSH 1OYTH 2OCVB 2V7QD 2XC4A 1D4PB 4UEHH 1EUFA 1PYTD 2G5NA 2WUCA 1O2HA 3LU9B 1MCTA 1K9OE 5DP4A 1MAXA 1QA0A 1SL3A 1BCUH 5JBCS 3MFJA 2XXLA 3ITIA 1SB1H 1THRH 1A2CH 2FOEA 3GOVB 1K1JA 2XC5A 1KXFA 2PTNA 1GDUA 4INKA 1EB2A 5DG6A 3QUMP 4ZXXH 1V2TT 5A8ZA 3QX5H 1QA7A 3F0OA 3FO8D 4GAWA 1FY3A 3K6ZA 3SNAA 1XVMA 4B73A 3PRDA 1D3PB 3N7OA 4Y7AA 2V3MA 2SGEE 1GPZA 3KYGA 1MKXK 3N99A 1O36A 1GCTB 1LPGB 3A83A 4K1SA 1FUJA 1UCYK 1HIAA 1L4ZA 2BVRH 3KN2A 1MZDA 1UTOA 4I32A 5EQSA 2J94A 1C1MA 4MPXA 1LQDB 3FP8E 1CQQA 1NBME 2UWLA 4U32A 2CF9H 5BRRE 1N8OB 1YLDA 3DFJA 1EJAA 4RT0A 1C5TA 1YPKH 3GY5A 2AIQA 4X2WA 2EC9H 3ATMA 1CT4E 1C1OA 1VITH 4F48B 1VGCB 2R0KA 4I31A 2J4IA 3DFLA 4Z1MD 3FZDA 4X1NU 4LK4A 1UTLM 4ZROA 1Z71A 4GCHG 1BTPA 2IOTA 2LPRA 1O2GH 3ZZCA 5C17A 3SI4H 2HPPH 1JBUH 2ZDVH 3LPRA 5DP6A 1NO9H 2FS8A 5H4IB 1QB1A 4ABBA 3AK5A 1YWUA 2RG3A 1WYKA 2Z3CA 4ASUD 3BTEE 5C1XA 5EXMA 1F0SA 1HJ9A 3BTWE 3PV2A 1TGTA 1A1RA 3O8DA 1PQ7A 3ZYDA 3SW2B 3ESTA 2UWPA 1B0EA 2JH5D 4YO9A 1SGFG 1D3DB 3WWFA 3ZZ9A 2FXRA 2I6SA 2GP9B 3AAVA 4DG4A 3GY6A 1C9TA 3ODDA 4U30A 1GHVH 2QA9E 2JKHA 1O2IA 3S7KB 1RTKA 3MH5A 4YLQH 2G00A 4X8UH 1WSSH 2A4RA 3SU3A 3CS0A 4MLFB 5FPTA 1BTHH 1P2NA 3P8FA 3GY3A 1DITH 1YPHC 5EXNA 3VXFH 2ZTZA 1TYNA 1YPEH 1EZSC 1QTFA 3E1XB 4GHQA 1SFIA 4UFEH 2F4LA 1BDAA 3HATH 1V2OT 2FS9A 4WXVA 1Z6JH 2H2ZA 3H7TA 2Y5FA 1OWJA 1CGHA 5JB9S 5FPYA 3F2GA 1H9HE 1HB0B 1Y3UA 1TGNA 5C1YA 4TWYA 2TGTA 1MU6B 1XKAC 3U9AH 4KTUA 2ULLA 2B5TB 1TX7A 1PPEE 3A82A 4JYVH 1BITA 3DSGA 3T29A 3U98H 2FOFA 4NFEA 1KLTA 5G4BA 4YM9A 1E0FD 2RFKC 4OS4A 1GHBG 1XXFA 1A3EH 4I8GA 1GHZA 3TLOA 1V6DA 1AY6H 2A0QB 1ELEE 5CHAC 2C4FH 4AYVB 1GJ7B 3FAOA 1P2MA 3G01A 1SPJA 1SHYA 1W8BH 2A5KA 2SFAA 3A8DA 3KNXA 4O9VA 2BQWB 2QY0B 1DUEA 5FAHA 3T62A 2WPLS 1LVYA 1ARBA 1CA0C 1OOKB 3PLPA 4FETA 3F6UH 4MPVA 1BRCE 1C9PA 2HALA 2J98B 3KQ5A 5FBEA 4ZUHA 2FMJA 2XNDD 1GJAB 2FTLE 4DVAU 1N6XA 1A7SA 1W12U 5JBBS 1LDTT 4IMQA 1BT7A 1AHTH 3NZIA 1MTSA 3GCNA 3VB4A 1P03A 2KZ4A 1DICA 1YLCA 1VR1H 2ZGJA 2VGCC 1LPZB 4YTAA 4JYTA 3I78A 3TGKE 2Q1JA 5EJLA 5IK2D 2XRCA 5HXFA 3GYMA 3SUGA 1GMDG 1IHTH 1HAPH 3IWMA 1TIOA 1QGFA 2AH4X 2YMSD 1O2YA 2VJ1A 3F2HA 3UNRA 2P8OB 4AX9H 3W1EA 3SI3H 1L1NA 2NU1E 2GCHF 2EI7A 1ESBA 4A7IB 1M9UA 3U8OH 1SKYE 4TWWA 1GMHG 5AFZH 5KECA 1FONA 1G3BA 2BXTH 2R3YA 1AFQC 3UOUA 3ZV8A 1O3JA 2O8UA 1P9SA 1RGQA 3GS9A 4MPWA 5DP7A 4A1VA 4D9RA 2CJIA 3RU4E 5A0BA 1FY5A 3IITA 1LHFH 5E0HA 2L6OA 3LGIA 1S84A 3EYDA 1N6YA 3PYHA 1Y3YA 1GI2A 2G55A 3QGNB 4O97A 4IC6A 1TPPA 5JDUB 3SBKA 1PPCE 1Y3VA 1VCWA 2QGRA 1O2OA 2JETC 3K9XB 1GWAA 2V35A 3A88A 4JZEH 1LKBA 2PWXA 2ZPQA 3MH4A 1P10A 4UDWH 2XWBI 2TBSA 4JZ1A 2WUBA 1TRMA 3FZZA 2ZKSA 1C2EA 4ABGA 2DUCA 4SGBE 2BLVA 1TABE 3RXBA 1GHAF 1OHHD 2FLRH 1SGQE 1TX6A 1WU1A 3UNQA 3R3GB 3M7TA 1DOJA 1O5FH 1GCDA 1O3HA 4XD7D 4XSKU 1EZQA 1ZLRA 2IJD1 1BBRE 3TNSA 5ESTE 5DN6D 2HGTH 5C0UA 5ABWA 1WXRA 1DPOA 3A8CA 4OGXA 1C1NA 1AE8H 1NZQH 3R0FA 2H5CA 1HRTH 1SLWB 2SNVA 4OS5A 4ABDA 2ANWA 2ZF0H 4CRFA 4KTCA 4VGCC 4UD9H 1HJAC 3HKIB 2BDIA 2P16A 1VJ9U 2KCAA 1SGFA 3SU1A 3KQCA 1QFKH 1TGBA 3ATIA 4ZHAA 1FX0B 1OYQA 1DWEH 5JBAS 1NU7B 1MKWK 2WPMS 2CHAC 3RU4T 2XYAA 2W6ID 4Z6AH 1GI3A 1HGTH 3Q3YA 3K2UA 3HK6B 1B7XB 1QNJA 1QY6A 3A80A 1ZOMA 1BMFD 3OX7U 3QWCH 4Y11E 1FMGA 2ZTXA 2DE9A 2QIQA 1UTQA 2H9HA 1ZGIA 4LOYH 4HTCH 1CA0B 5LGOA 2XCNA 2FOMB 1J14A 3K65B 3UUZA 1G30B 5FL7D 1SVPA 3SQEE 3M5NA 2C90B 5L30H 1HAHH 3BV9B 3ODFA 3VB3A 3JZ1B 1V2RT 5CMXH 3L3TA 2ZFPH 1HCGA 1ELDE 4KGAA 1HAVB 2VGCB 1GGDB 1SOTA 3N7EA 2PHBA 4YT7H 1OPHB 3RUOA 1FNIA 4DCDA 1PJPA 4AYYB 1WQVH 3M5MA 5E0GA 2QV1A 1SGEE 3K6YA 3A7TA 1ELTA 2ZQ1A 3NUMA 1DWBH 5HM2A 5T6DA 1NFYA 2A7JA 2ZU3A 1MABB 2THFB 1GMCG 3FKSD 1KSNA 1YC0A 1T8LA 3GISB 3DD2H 3OAAD 1J8AA 4A1TA 1FJSA 1W11U 2Z3DA 1LCYA 2ZQ2A 2NU2E 1ACBE 4AB9A 5DO4H 1MTNC 2UUKB 3SV7A 1O2NA 2WV4A 1FQ3A 1CGJE 3D65E 2J34A 3CS7A 3UIRA 2O8LA 2HWLB 1VKYA 2PV9B 1KDQB 2ILNA 2ZFQH 3RXIA 5I25A 2ANMH 1AMHA 2W5EA 1NTPA 3PWBA 3RXHA 2BZ6H 2ZWLH 1T4VH 1MD8A 4LZ1H 2FM2A 3T28A 1V2KT 2QE7D 4FXGH 2GDEH 4X2VA 2K1QA 3Q77A 3U28C 4MNXA 2G51A 3N7DA 3M7UA 4K60A 1MH0A 1P2QA 2YMSC 1JXPA 2ZHWH 6ESTA 1Z8RA 4WVPE 1SOZA 2G8TA 2VWMA 1SQTA
chains in the Genus database with same CATH topology
1W7XH 3A87A 3ZZ5A 3RXPA 4CR9A 1GI6A 3OYPA 1IQKA 3BN9A 3BTFE 1CA8B 4ISLA 4Y76A 5FCRA 5LH8A 2W3KA 2WINI 5DJ7A 1C5YB 4D76A 1O3KA 4AOQA 1AKSB 2G52A 3RXCA 1K22H 2PKAB 3STJA 3LC5A 1A0LA 1S6HA 2BQ7B 4JK5A 3PMHB 4KELA 1O3BA 1FAXA 1P2KA 3A7ZA 5AFYH 3EA9A 4K5ZA 5DPAA 1EATA 1NRNH 2VVVA 3SNCA 1GCTC 2F9UA 1F0RA 3F9GA 1O5EH 1Y8TA 3HKJB 1F2SE 1EJNA 3MH7A 2PGBB 2GZ8A 5B6OA 1GJBB 1J16A 4BOHA 4XBCA 1AUTC 2XC0A 4IC5A 2GD4B 2BDAA 1ZJKA 4K1TA 5GJ4B 3V13A 1N8OC 4GCHF 1EOJA 1KLJH 3ZV9A 1BHXB 1IQFA 3EAJA 1BRBE 1OP0A 1MTUA 1ZTJA 2TRMA 3TPIZ 4X6NA 1Z1JA 3EE0B 4WMEA 3F68H 2AEIH 2QXIA 3S9AA 1GBMA 1TPSA 2SGDE 1WAYB 1VGCC 1C1TA 4Y8XA 2B9LA 1T7CA 2EI6A 1S6FA 5C5NA 1ANCA 4MNVA 1TNJA 1XUKA 1IHSH 1W3CA 1UTPA 2AMPA 5FCKA 5JPMH 3PWCA 1HAVA 2OD3B 1FY8E 2BD9A 3SOSA 1UVPA 3NWUA 1ZMJA 4X0WU 3TGJE 3TH2H 1EAUA 2ZEBA 2VIOA 2QF3A 5TCAA 4ZHMU 4BAQB 2VVCA 2VIQA 1AI8H 3SJ8A 4IN1A 2HPQH 4B2BA 1QQ4A 4AG1A 1P3EA 4Y7BA 4RKOB 4B71A 1Q31A 3M5OA 5GIBA 1G2MA 3BG8A 1ZRBA 3PMAB 2J95A 1KXEA 3PMJA 1C5NH 1P0SH 1VCPA 3B9FH 1P05A 1AUJA 1DS2E 4Y10E 2VWOA 1XUHA 4I8KA 2BQ6B 1TRYA 2QYIA 1IQNA 1KDQA 2OC1A 2ZDMA 2XCFA 1UHBB 4JCNA 1LVBA 2BY6X 3GYLB 3UOPA 2BMGB 1YCPH 2Y6TA 4MDSA 1QBNA 1JIMA 1K1IA 1T8MA 3RXEA 4CH8B 2OC7A 1GI4A 2O8TA 1HXEH 1ZTKA 2BYAX 2OBQA 3LT3A 1OS8A 1C1UH 5DP8A 1GHBF 4WXIA 3V12A 3TJOA 1PPZA 3GY8A 3DA9B 4Y79A 3VGCB 1IQMA 1MU8B 3Q3XA 3BEFB 3B23B 7ESTE 3ATWA 3RM2H 3PO1B 3QZRA 1BMAA 1EAIA 1IQHA 2AGEX 1S5SA 1GI9B 1QBVH 3QTOH 4WWYA 3S9CA 1Z8JB 2VIDA 4Z0KA 2ZP0H 1AKSA 1O31A 4E7NA 1HPGA 1O3OA 2BDGA 2ZGXH 2PKAA 3ZZ3A 1SR5C 4FUGA 1ANEA 1GHXH 1TB6H 3TGIE 4O03A 1N1LA 1UVUH 3RC6A 1NRPH 2BD3A 3NXPA 2A31A 4CHAB 3A89A 1BTXA 2PGQB 5C1UA 4J2YB 1TNIA 2Z7FE 2VWNA 3QO6A 4DIIH 1YPLH 1QJ1B 1AIXH 5E8EH 3HPTB 4FUEA 1GMDF 1ZHMA 1RTFB 2W7UA 4CR5A 2J92A 5GXPA 2EEKA 1WCZA 1NRSH 1GJ8B 1MUEB 1J15A 3LGWA 3SNEA 3FANA 1C2MA 3BG4B 5JYIA 2IPHA 1BB0B 5A2MH 1C4V2 2CN0H 4WJG2 3WY8A 2F9NA 1NPMA 1YKTA 4I8LA 1TA2A 1GMHF 4BXSA 1RS0A 1GJDB 1QJ6B 3RU4D 3TJUA 1XMNB 3DUXH 1V2UT 2P8OC 1DX5M 3A7VA 3UWJH 1FPCH 2ZO3H 3LOXA 3PTNA 1QR3E 1EOLA 4XE4A 1GHWH 3PMBB 2ZDAH 3TVJB 4YOJA 1H9IE 5DK1A 3A8BA 3Q76A 2CXVA 1ZYOA 3BIVH 3SHAH 1O3AA 4X6PA 2D8WA 2ZDNA 3HGNA 3RXQA 3V0XA 1H9LB 1O2PA 1O2QA 3BTQE 2ODPA 1K1MA 1P11E 5SGAE 1QRZA 2FOBA 8LPRA 4MPUA 1OWDA 2BLQA 4MG3A 4X8TH 3SU5A 4B75A 4AG2A 4IMZA 1QJ7B 5EG4A 1JMOH 4KTSA 1EQ9A 1BUIA 1NRRH 1KXDA 1UK3A 2BTCE 5HGGA 5C2ZA 3GY4A 3MMGA 1SMFE 1CT0E 1MBMA 4GLYA 1A5GH 1EJMA 3L6PA 1UHBA 1SGIB 3ENSB 5AVDA 4X8VH 1L1GA 1S82A 1BOQA 5F8TA 5GCHG 4ISOA 1KLIH 1ELCA 2FYRA 1LHGH 1BJUA 1C1RA 1NY22 1BTYA 1W2KH 4TPIZ 1TA6A 1YPHE 3AVZA 1E38B 2JH6D 2SGQE 1YPJH 3LGVA 2BD2A 1GVKB 1LKAA 4TY6A 5F6MA 1EKBB 3MU5A 1HAIH 1V2QT 1DANH 1XUFA 2STBE 3KF2A 4ZAEA 2FO9A 2HNTC 4QT8C 3LIWA 4ABEA 2Z94A 2Y5HA 1K1LA 2ZHQH 1O0DH 4FUJA 2F9VA 5GWZA 1MQ5A 3GDSA 3SN8A 3JZ2B 4CRBA 1O5CB 3VB7A 1SGRE 1Z6EA 3UR6A 2R2WU 1O5DH 4X1RU 1MD7A 3MTYA 1HLTH 2W7SA 1SI5H 1HAOH 4CRCA 1TMBH 3O8RA 2VB0A 4NSVA 2B0FA 4GVUA 1GL0E 5LPEA 3T26A 3VXEH 4H42U 1YPMH 3Q00A 2UUYA 4CBNA 1W13U 1O2WA 2RA3A 1O33A 1ANDA 2O8MA 2O9QA 4K69A 3SU6A 2ZPSA 1PYTC 1V2WT 3GDVA 2FIRH 2H9EH 1C5UA 1RXPA 1WUNH 2ZI2H 1GBBA 2R0LA 4K3JA 4NIYA 8ESTE 1C5RA 2GZ7A 3TK5A 3O8CA 1UO6A 5E2PA 3TH3H 3URDA 1GMCF 2SGAA 2ZDKA 3MO9A 1GGDC 4AGJA 5ETXA 1C5MD 2XNIA 3E8LA 5C3NA 1CHOG 3KCGH 1SLVB 2GMTB 3SGAE 2XWAA 1FV9A 2FYQA 2GV7A 4IS5A 2F9BH 4JZIA 3L33A 2V6NA 3P8NA 2BDCA 1O34A 3U69H 4ABAA 4DGJA 1UVSH 1OWHA 1S83A 1SG8B 1AE5A 1SQAA 2BY7X 2ZFFH 1K1OA 2AGGX 2UUFB 1Z7KA 3OTJE 4D7GA 1ETRH 2GZ9A 4GSOA 3PB1E 1SSXA 1BRUP 3OSYA 1GI1A 3CP7A 1MBQA 2FZZA 4Y71A 1W0YH 1YCPM 4DJZB 1O30A 3H5CB 5JBTA 4AFZA 4FU7A 2TGDA 3ZVAA 1AO5A 5L2YH 3E0NB 3SZNA 5F8XA 2WPIS 2ZCKP 3P8GA 4Y0YE 2Y7ZA 1OXGA 2JH0D 1O39A 1HNEE 1A4WH 5EOKA 4IBLH 4WY3A 1TPOA 2C8XB 2ZFTA 3SORA 1A5HA 4ABJA 3AASA 3DHKH 4YZUA 1GBHA 1KXBA 1KTSB 3TIUA 3E6PH 2B7DH 1LVMA 3KHVA 4GPGA 4HGCA 5L2ZH 3UREA 3MH6A 1S81A 5EU8A 2C3SA 1G9IE 4I8JA 9LPRA 2VIWA 2BZAA 1OP2A 2F9PA 1H4WA 4R8TB 1MMJN 3U8TH 4FUIA 1D3TB 2OUAA 3LDXH 1C2JA 1UTNA 3M3TA 1NM6A 1EX3A 3A81A 4ESTE 1BMLA 4HZHA 2NU3E 4M7GA 4ZMAH 3AW0A 1SGPE 2ZU5A 3E90B 1OSSA 1BQYA 2GX4A 4MVNA 2ZDLA 2PSYA 8KME2 2FODA 1DWDH 4LZ4B 1O3DA 5JB8S 1CVWH 4WF8A 1OKXA 1KY9A 2VIPA 2ODQA 1C4U2 2D26C 2ZGBH 3HK3B 3EGKH 1TQ7B 2Z9JA 2GTBA 4NWLA 1TAWA 1B0FA 1ELBA 4FVBA 1MTVA 4TPYA 3SO3A 1G3EA 2VIVA 1P01A 4O3UA 3UY9A 1Y5UT 5I46H 1F5LA 1C5XB 1UCYE 1AB9B 1UTJA 2BY5X 4ZXYH 4F49A 1DFPA 3M35A 4AB8A 3LGYA 1DSTA 1P06A 4J1YA 1LQEA 1SGDE 1BBRH 1CBWC 2ALPA 3RLYH 1GBEA 2PFEA 2FTMA 5EXLA 3NPSA 1SGCA 2Z9KA 3LH1A 1O2UA 1CT2E 4CRGA 2P94A 4D8NA 3RP2A 3W95A 2QAAA 1XXDA 1W10U 2BM2A 3MNBA 1CHGA 1O3GA 1HDTH 5LPRA 1V2VT 3ATKA 1SQOA 3URCA 5TCCA 2BX4A 1A0JA 4DOQA 2F3CE 4RSPA 2ZZUH 3D62A 2ZNKH 5E2OA 5C67A 4X2YA 3M3SA 2F91A 3SV2H 4K8YA 2ZHFH 1DY8A 2AMDA 1DXWA 2P93A 2QXGA 2BX3A 3BTME 1MKXH 4FU8A 5EGMA 4FU9A 1TGCA 5FPSA 4X1PU 3UQVA 3NKKA 2GT7A 3MO3A 2C8ZB 4FUFA 1MAYA 3D23A 3KQEA 3I29A 3MYWA 2XBVA 1EXFA 3U1JB 1QIXB 1AWHB 1A46H 1AD8H 3PLKA 2A4QA 2C8YB 3VGCC 3RXRA 1GBKA 3S7HB 4ABFA 3PO1C 2J9NA 2R9PA 1ARCA 1JRTA 4U2WA 4UFDH 2YOLA 1GBTA 1TNHA 3RXAA 3BF6H 1FDPA 4KKDA 1V2PT 4ABIA 1C5SA 3E3TA 1DDJA 1L1JA 4YT6H 3MNCA 3UQOA 4UFFH 1GJ5H 5FXLA 2GCTB 3MWIU 4XFQA 1BTUA 1P9UA 1W7GH 3TK6A 4B76A 1SBWA 1F5RA 2W3IA 3W94A 1L0ZA 2BVSH 4CHAC 1GJ4H 1HYLA 4BNRA 3OU0A 4O3TA 3SUFA 1GHYH 4NIXA 4B1TA 1DT2A 4ZHLU 1KTTB 1AQ7A 1DLEA 2BB4A 3LKWA 5AF9H 1NT1A 1E37B 3ZZBA 5FHTA 2IJOB 1PPHE 1UMAH 2RA0A 4YOIA 3ZVGA 4OS2A 3BTKE 1ESTA 4OS7A 2BOHB 1V2LT 3ZZ6A 3RXKA 3BG4C 1K28D 1DM4B 5T6GA 4XOJA 2FI5E 3A86A 1G2LA 3LC3A 4THNH 2Y81A 1GVLA 1A0HB 2WV5A 2ZCLP 6CHAB 4YESB 1D9IA 2Q6DA 2OINA 3CENA 3F1SB 5CE1A 2ZC9H 1WTGH 1GVZA 1ZGVA 4LXBH 3S9BA 3KL6A 1C2GA 1GDQA 4Y6DA 5E0JA 5DP9A 1YGCH 1IAUA 2BDBA 2FDAA 1WQSA 1EP6A 1ZTLA 4D9QA 2OLGA 4F4OC 2VNTA 2A1DB 3FFGA 1QHRB 3V3MA 1IQLA 1EP5A 1CBWB 5IDKA 4DIHH 1KXCA 2FOCA 1VITF 1PQ5A 3TU7H 2FPZA 1P2JA 2FOAA 8GCHG 3RMNH 2A2XH 1H8DH 2ZIQH 2FOHA 2TGPZ 5GCHF 3GCHB 3VFEA 3RXGA 2ZECA 1TNKA 3SJ9A 1QRWA 1F0UA 1NC6A 3BEUA 3ZVBA 4AORA 4NWKA 1IQIA 1MCVA 2ZU1A 3TJNA 3ZZ8A 4H4FA 1DXPA 3SNDA 2ZA5A 1QRXA 2ZTYA 5EQRA 1SC8U 4IN2A 4AFUA 1RTLA 3DT0H 3AW1A 2Y80A 3KQBA 1JOUB 1TNLA 2A7HA 1GG6B 1RRKA 4I33A 4DT7B 5EQQA 1SGTA 1ETSH 4JYUH 1O2KA 4H6SB 5FX5A 2A45B 4NIWA 3BSQA 1SGNE 3MHWU 1DLKB 4ABHA 2Q6GA 1T32A 1D6RA 1K21H 4DURA 1TFXA 1PPGE 4AGKA 4A6LA 1L4DA 2ZPRA 3BTHE 2ODYB 1GBIA 3QK1A 2OXSA 1ID5H 2ASUB 1TOMH 1DWCH 2GV6A 1P2OA 3A7YA 7GCHF 4WH6A 1E35B 4E06H 1CE5A 4CRAA 1J9CH 3KEEA 1C5LH 1BMMH 1HV7A 2FWWA 2ZHEH 1F92A 2G4UA 1ZSJA 1NS3A 3P95A 2H9TH 4NFFA 3RLWH 2GT8A 2HVXA 1CU1A 1TOCB 1B5GH 3GDUA 1EPTB 3ELAH 5FBIA 4WH8A 1T4UH 1TWXB 2YNAA 2VU8E 1O2SA 1UTMA 5DGJA 1CHOF 4Y8YA 2FX6A 3SUDA 1HUTH 1GBFA 2XTTB 9ESTA 4B2AA 3VB6A 2BD5A 1YM0A 2QCYA 1ABJH 1QURH 4X2XA 1ANBA 4X6OA 1O3NA 2ZU4A 2G5VA 4OGYA 6GCHG 1XUJA 2HNTF 1O2RA 2KAIB 3F9FA 1BIOA 1TPAE 4E05H 1BJVA 3P8OA 5F8ZA 1C5ZB 2GMTC 2LNCA 2Z6BD 1AN1E 4WMDA 5L6NH 1UVOA 1TBZH 3QZQA 1GBAA 1YYY1 2XBXA 1C1VH 1E36B 2BD4A 2BLOA 1K2I1 2PW8H 4BAHB 3UR9A 1THPB 1FIZA 3BIUH 3NK8A 5K7RA 2ESTE 4NGAH 1G3DA 1VJAU 1XVOA 1TQ0B 1GI0A 1Y5AT 3RMLH 3ZZAA 3SUEA 1HAGE 1O38A 2PUXB 3SNBA 1EASA 3KIDU 2H6MA 1W0ZU 2EI8A 1EZUC 5BPEA 1MKWH 1A5IA 1C5WB 5C20A 2XW9A 3FP7E 3QN7A 1ELFA 1VITG 1SHHB 1QQUA 4XBBA 1FZZA 5HMAA 1ZSLA 4NZQA 1GDNA 4YLUA 4ISIH 1TBRH 3E16B 3RMMH 4Y8ZA 1AFEH 1RIWB 5T6FA 3LGUA 1SLUB 4CBOA 3A84A 2P3UB 1V3XA 3IG6B 1QB6A 2QN5T 1BA8B 4DY7B 1P04A 4E7RG 5IYTA 1YP9A 4DW2U 3S69A 1AWFH 4UE7H 2P95A 1NROH 2F9OA 1ZJDA 1QCPA 1GBCA 1T8NA 1XX9A 3SQHE 3E91A 1JRSA 3GCTG 5T3HA 1C1PA 1HFDA 4H6TA 2BXUH 1ZMLA 3RXTA 3V7TA 4TYDA 4B2CA 2HNTE 1C4Y2 1QL8A 1ELGA 3PROA 2PR3A 1A3BH 1DE7H 2PKSB 1H1BA 1P02A 2ZCHP 3UFAA 1HBTH 4X1QU 1OWIA 4K1EA 3P92A 3VB5A 4FUCA 1XKBC 3ZVFA 1Y3XA 3Q3KA 4XDEA 2AIPA 3SJKA 4SGAE 3U8RH 1IQEA 1FIWA 1EPTA 1CSOE 1SGYE 2Z9IA 1V2ST 1NU9A