2SGQE

Gln 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pH's
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgqE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgqE01
1TOMH 1J14A 1P02A 4IGDA 3QTVH 2ZDVH 3RU4E 2VJ1A 2FOHA 1QBVH 1SSXA 1LVYA 1HGTH 1HV7A 1TA2A 1C4Y2 1OYQA 2BYAX 2OBOA 4OS1A 2WYJA 4D9RA 3MNSA 2VIOA 1EZQA 4IMZA 2GMTB 1N1LA 1SPJA 2VIWA 4CRCA 2F9NA 2YOLA 1LVMA 2V3OH 2VWMA 1TMBH 3A7VA 4J1YA 2BD7A 1BZXE 2FI4E 2AIQA 3M5NA 2ZQ2A 1WOFA 2FS9A 3F9HA 1L1JA 1XUGA 1CT0E 5GXPA 3QO6A 1TPPA 3P8FA 1ABJH 2TIOA 1PQ8A 1SGFA 4OS7A 1N6XA 8ESTE 2ZWLH 3B8JA 5C67A 1SGYE 2HLCA 2ESTE 3ATWA 1L0ZA 5A09A 1DE7H 1SBWA 3ATKA 3MFJA 1Z1JA 4YLQH 4X1RU 4AFQA 2RDLA 3BV9B 1GBFA 3F9GA 4CRGA 2ZECA 1C5VA 3F1SB 1JXPA 1K1PA 2BDYA 4QT8C 1V2KT 2CF9H 2V0BA 1UTJA 2C93B 4ZKSU 1EJNA 1D4PB 1ZOMA 4UFDH 2A7JA 1S6HA 5H4IB 2RG3A 2VH0A 1UCYK 2QAAA 4AORA 4X6MA 2WUCA 3T27A 1UTKA 4VGCC 3V0XA 3SBKA 3STIA 1O5CB 3KQEA 3MMGA 4R0IA 1W11U 4ZHMU 4B2AA 1O39A 2A32A 3M7TA 2Y5GA 1GGDB 1TNHA 1YKTA 2VWNA 4NSVA 2ZHDA 2ZCKP 1FY8E 3E3TA 4XFQA 3UNSA 4ZXXH 1HDTH 5HM2A 1FNIA 1GJBB 3GY6A 4BXSA 2GKVE 2HGTH 5B6OA 1K21H 2Z9JA 4X8TH 1Z71A 3PM3A 4K1SA 3KNXA 4WXVA 5T3HA 1HAHH 2XBYA 5J4SA 1O30A 4WF8A 3LKWA 1BOQA 3I29A 2AYWA 3LGVA 4R8TB 5JYIA 2NWNA 1DY9A 1PQAA 1KDQB 1AKSA 1WU1A 1B0FA 2IPHA 3URCA 3RXSA 1T8LA 1MTUA 2AIPA 1EASA 4NGAH 3O8DA 3A7ZA 1C1SA 1HRTH 4ZHAA 5FBIA 4AN7A 3D49H 2WYGA 4ABJA 3E91A 4X8VH 5ESBA 1GHAF 2P95A 3PWBA 3URDA 2DE9A 1EOLA 1FZZA 5F6MA 2VGCB 1QB9A 1S5SA 4O9VA 4Y7BA 3STJA 3BTME 1CGHA 1DPOA 1O2NA 1ZTLA 3AAUA 3RXPA 1HAZB 4AFZA 1HAYB 3P70B 1H8IH 4MPUA 4JYUH 5E2OA 2BLQA 2F9BH 2QCYA 3BTTE 2AMDA 4YTAA 5JB8S 2O9QA 2P16A 3SU6A 1S85A 1C1QA 1TPAE 3ZZCA 1NFUA 1ACBE 1O5AB 1FJSA 2GCTC 3EA8A 1C4V2 2FZZA 3O8CA 1W0ZU 4HI3A 4GHQA 3VXFH 1NM6A 4YESB 2CF8H 5GDSH 2TGAA 1JOUB 2BX4A 1GJ7B 2D8WA 4MVNA 1PJPA 4D9QA 2BD9A 2ZU3A 1QCPA 1GJ9B 2FX6A 1C9PA 3MH6A 4IS5A 3W95A 3CP7A 1EPTA 1AD8H 1PPZA 1C2IA 5A8XA 1MH0A 4BAQB 1SG8B 1HAOH 1NO9H 4AZ2B 2HPQH 3A7WA 1A5HA 2UUKB 2PKSC 3HKIB 2Z3EA 2QXIA 1H4WA 1V2WT 2W5EA 1P0SH 4RSPA 2A1DB 3UWIA 1ELEE 3SORA 7KMEH 2NU3E 1O38A 5I46H 2WPKS 2F9OA 5DPAA 4NIWA 3A88A 2A31A 1LHEH 1SFQB 4MNWA 1QRXA 1HBTH 1A5GH 3SV9A 1FPHH 2YNAA 1TOCB 2F3CE 5LH8A 1MTNC 2BY6X 1JIMA 3U9AH 4FXGH 3M3TA 4Q7YA 1C1UH 3A7TA 2Z3CA 3Q3YA 2FYRA 2GZ7A 1DXPA 1GBMA 1SQTA 1K1MA 2Z7FE 1IQNA 3ZZBA 1G37A 4NA9H 1DWDH 1C2FA 2AMPA 3SQHE 4HFPB 2XBWA 3GDSA 2ZTZA 1EJAA 1TQ0B 1O2WA 4Q7ZA 1QL9A 1H9HE 1MAXA 2J4IA 2QC2A 1SR5C 1J9CH 1A0LA 3MO3A 1FN6A 1HAVA 1EPTC 3ELAH 4NFEA 1IHTH 1CVWH 1TBRH 5K7RA 2ZKSA 1TRYA 4AYYB 2GCHF 5EQRA 2HOBA 1DSUA 3NK8A 2BQ7B 1EX3A 5IDKA 5A8ZA 1GCTC 3BIVH 5HXFA 2R2WU 1Y5BT 4AX9H 1DT2A 1W13U 1HAGE 1C5SA 4FUGA 4GVUA 3TITA 5JDUB 2QF3A 2OP9A 2SGPE 4NWLA 5C3NA 2PR3A 1SGCA 2FYQA 1L4DA 1LHFH 1C4U2 1OWEA 1AFQC 1UVSH 1E38B 1PPEE 4ISIH 4RKJB 4VGCB 3PROA 3SNDA 1EJMA 1HUTH 4BXWA 3LOXA 4JYTA 1BITA 1W10U 1AE8H 2GX4A 1C5RA 1ZHPA 1YPKH 2ZCLP 3T2NA 3HK3B 3ZVFA 1HXFH 3FP8E 1EQ9A 2FP7B 1XKBC 1TNIA 2H9HA 1ZRKA 3OU0A 1P3CA 1HJAC 2QGRA 5JB9S 3ZV9A 1OWHA 3V7TA 1MQ5A 4K3JA 2BX3A 3MU5A 1VCQA 1TFXA 3JZ2B 1GI2A 2J9NA 1O3JA 4K69A 2W7SA 4H42U 1C5MD 5SGAE 1QQUA 1V2LT 3QUMP 1TYNA 5A8YA 3SUGA 5J4QA 1EAWA 2VIDA 2BLOA 5DP3A 3SW2B 5DP7A 3TK6A 1TGSZ 1C1VH 1O3HA 3GYLB 1NRSH 1WUNH 2OINA 1BHXF 1SLWB 1NROH 1C1WH 5DP4A 5C1XA 3EYDA 4IW4E 3UR6A 4MNXA 3SUEA 1GG6C 1JIRA 4U30A 1SC8U 4B75A 2OC8A 4MDSA 1LQDB 3BEUA 1MBMA 1UHBB 1EAUA 4A6LA 1RGQA 3ZZ9A 1XUHA 1IQGA 1QQ4A 1O2UA 2PKAA 2LNCA 1GJCB 1C5LH 2FIRH 1KTTB 1NRPH 1QRZA 3RP2A 2FM2A 3RXUA 2V6NA 1FUJA 1W7XH 1YPMH 1L1NA 2PSYA 4LXBH 1MD7A 2BTCE 2BM2A 4A1TA 1YPJH 3QZRA 1GI3A 5G4BA 5C2ZA 5FX5A 4NIXA 3SHCH 1HNEE 4A1VA 1G32B 5EU8A 3UPEA 5EXMA 3TGJE 2GZ8A 2ZF0H 1BUIA 2GCTB 4X1SU 1J15A 1YPLH 3Q3XA 3RXTA 5FPSA 2VWLA 1UTPA 3BTEE 4B2BA 2BLWA 3GCHC 4NSYA 1OP2A 1O5DH 2XNIA 3KGPA 3MU8A 5FCRA 5FPYA 4DY7B 4IN1A 2OLGA 4YOJA 2ZFTA 2THFB 4JK5A 3HATH 2R3YA 1Y3VA 1AKSB 2P59A 3RXCA 1XVMA 4O03A 3RXVA 1EZSC 1DANH 2FI5E 1MQ6A 2BDGA 2UUFB 4JZEH 3EQ0H 2PKSB 2ZPRA 3CENA 1DLEA 2BDCA 3CS7A 4UD9H 5LGOA 1H9LB 1P2NA 4IBLH 1IQFA 1O2QA 3SV8A 1GJ8B 1O3FA 1OOKB 3EA9A 1TNLA 3A85A 2SGDE 4MPWA 1O3NA 3LGTA 4JZ1A 5E0JA 1C2DA 3BEFB 2GV6A 1FY3A 4BTUB 2PLXA 5K0HA 4X0WU 2DE8A 1UTQA 5EPYA 1V2OT 4A1XA 1GHWH 3LGYA 2FMJA 4CR9A 1BDAA 4ISNA 3UUZA 3RXOA 3UOPA 4WMDA 1DLKB 3T26A 3RM2H 3C1KA 1KLIH 3TNSA 1S81A 1ZGVA 5F03A 3OY5U 4KGAA 4UE7H 1QA0A 2BQ6B 3GY5A 1OWKA 2WPIS 3DUXH 4NA7A 2NU4E 3Q00A 1WBGB 2WV4A 2ZI2H 1O2RA 4ZHLU 3P8GA 5AHGH 3SU1A 1C5WB 3S7HB 1QL8A 2BY7X 1DWEH 1EPTB 1BMAA 4YOGA 5JBCS 1P8VC 2UWOA 1FDPA 2ZU4A 1IQEA 1ELBA 1ELVA 1S84A 1DX5M 1WQSA 4FVBA 1TPSA 3RXDA 2STBE 2A7CA 3GY2A 3K9XB 3UOUA 4Y10E 4XBCA 1GCTB 2GT8A 1DWCH 1CO7E 1TQ7B 5EG4A 2JETC 3DA9B 3EDXB 2Q6GA 1IOEA 2FOEA 1ELDE 3SHAH 2ZTXA 5L2YH 1G3DA 1Q31A 4ISLA 4CRAA 1AFQB 2VINA 2CMYA 5DP5A 4X8UH 1AU8A 2WPHS 1AB9C 3PB1E 4MNYA 3Q76A 1VITG 3LONA 1KXEA 4DJZB 4CBNA 2XBXA 4I8GA 4JMYA 1BBRH 4CHAC 1L2EA 1O2MA 2GD4B 2ZDNA 3HKJB 3QX5H 4DIIH 1BB0B 1O3MA 1O0DH 1C1RA 2C8WB 2ZPSA 2GVFA 4UFGH 6GCHG 2XCNA 1Z6EA 1FIWA 2QXJA 3OTJE 1O2IA 1TBQH 5A2MH 3U1IB 5BRRE 4AB9A 3U1JB 1IQMA 2HNTF 3SJ9A 1HJAB 2RA3A 3SV7A 3Q77A 2XC0A 1CGJE 1DOJA 1YM0A 2O8LA 2Y5HA 4E7RG 4YT7H 2JH5D 1QIXB 1HAVB 1RTLA 1UTNA 5L2ZH 1ZHMA 3KQBA 2SNVA 1WYKA 3UREA 1CGIE 2Z3DA 2QY0B 1CT4E 1O2XA 2EC9H 2ZU5A 3SU2A 1P2OA 2FWWA 3SZNA 3HPTB 1Z8IB 1QBOA 4K5ZA 2O8MA 1BBRE 1OYTH 1UVPA 1XX9A 4U32A 1C5QA 4X8SH 2OC7A 3BTHE 1W2KH 1GG6B 1D3QB 4BAMB 1VITF 4ABBA 1A4WH 1GBCA 4ZAEA 3U8TH 2Z9KA 4MPXA 1GCDA 6GCHF 2M5TA 4OS5A 3BTFE 1PQ5A 3UNQA 1O3AA 4HTCH 3RMNH 3GCNA 3AW0A 1TAWA 3V13A 4RKOB 2WPJS 1GMCG 1DM4B 4FU9A 2BY9X 1ELTA 2ZFSA 2WPMS 1P2KA 1HFDA 1K9OE 1Q2WA 1GMDG 4Y8XA 2TRMA 1GBBA 4DT7B 3M7QA 1AVWA 2RA0A 1KXAA 3GY3A 1A1RA 3PMJA 5A0CA 1AQ7A 3GCHB 2TBSA 1TMTH 2HWLB 1AMHA 3IITA 4FUDA 4X2YA 5C1YA 1K1NA 1CA8B 5CHAC 1LVBA 1YCPH 4B76A 2A0QB 4KP0A 2Y6TA 3QWCH 1G3EA 4Y8ZA 2BD5A 3AAVA 4J2YB 1SOTA 1INCA 2QIQA 3B23B 4X1PU 2BXUH 3BN9A 5JPMH 1BRAA 3A81A 4X6PA 1C2LA 3KL6A 3M3SA 3NUMA 3UY9A 4YOIA 2TGDA 1SHYA 3KCGH 4Y79A 2EA3A 1THSH 1OXGA 2AGEX 4WMFA 1C5NH 1N8OC 1LHDH 2EI6A 3S0NA 2J92A 1UTOA 4CR5A 5GWZA 2UUYA 1AVGH 1EAXA 1ELGA 2PKAB 2BDHA 1PPBH 1GMDF 1EKBB 1UTLM 2BVXH 1QY6A 1TNKA 1LPZB 2Y80A 1DS2E 1WSSH 4Y76A 3UQOA 1YCPK 2DUCA 2ZU1A 1C2JA 4D76A 1E36B 4THNH 1C5PA 1SQOA 1CU1A 2ILNA 3MU0A 2BD3A 1C1NA 2J2UA 3VB6A 4NIYA 2Y81A 1O2YA 3TJOA 5E0GA 1ELCA 2GGVB 3PLBA 1KXFA 1QB6A 3D23A 2P3TB 3RLWH 4IMQA 3P8OA 1MCTA 1P11E 2ZQ1A 3ZZ4A 1NU7B 3SNEA 3IG6B 8LPRA 1AIXH 2B7DH 4UEHH 2TGPZ 1ZJKA 3BTKE 2PWXA 5GPIB 5BPEA 5T6DA 2ZHEH 1B0EA 2J38A 2ZA5A 2A2XH 4Y0ZE 4K2YA 4INLA 1AWHB 3BSQA 3P6ZB 3U8RH 1HIAB 2NU1E 4SGBE 3LJOA 3ZZAA 1O3KA 1IQLA 4HGCA 3S9AA 1MZAA 4BNRA 4ABEA 3MH7A 3QLPH 1NZQH 3F68H 4FUBA 4JZFH 1P2MA 2FS8A 2AERH 3LH3A 2BDIA 2BMGB 4E05H 1VCWA 1GI0A 1C1PA 2GZ9A 1FN8A 1O35A 2PUXB 1O37A 1FY5A 2BD2A 5GIBA 1OPHB 1O2VA 3RLYH 5LPRA 4CHAB 3S7KB 2QV1A 1TONA 3LGWA 3BTQE 4CRDA 1ZRBA 2I6QA 3MO9A 4FU7A 3LIWA 2AMQA 2OCVB 3VFEA 1GVKB 1HJ9A 1MKWH 3K65B 2P93A 5CMXH 2ALPA 1TGTA 1VGCC 2JH0D 3AVZA 1NY22 3SV6A 2IN2A 1KTSB 4IC6A 4TPIZ 5GCHG 1NTPA 3MU4A 2QA9E 2A5AA 1GJ4H 2OTVA 4ABIA 4YM9A 4E06H 4JK6A 1BMNH 2F9VA 4X2VA 1W7GH 1SLVB 1MU6B 4WY3A 1V2PT 2ZP0H 4NG9H 1CHOG 5TCAA 5PTPA 3QN7A 1M9UA 2Y7XA 1GJ5H 3ESTA 3LT3A 4Q80A 2HPPH 1V2MT 2STAE 2ZCHP 2YNBA 3SGAE 2F9PA 3GCTG 3LH1A 3M37A 3TK5A 2CJIA 1K28D 2XRCA 3SU4A 2VNTA 5JBTA 1KY9A 1RFNA 2BDBA 2G51A 2VIPA 1KXDA 5C5NA 1ZTKA 2XTTB 1LO6A 1A0JA 2FXRA 5EXNA 3QTOH 4GCHG 1BJVA 1C1OA 1OP8A 4CREA 1AO5A 4DGJA 1K1JA 4FUCA 3BG8A 4B71A 4AGKA 4Y6DA 1XMNB 1JRTA 2ANYA 1YPGH 1RIWC 5DKMA 1Z8GA 4NWKA 6CHAC 3E0PB 2W7UA 5E0HA 4INKA 4MLFB 1Y3UA 2SGQE 3KQCA 4A92A 1CHGA 4O3TA 1BA8B 1BTYA 1CHOF 1F5LA 4ZMAH 1QA7A 1BMMH 1ZMJA 3SI4H 1HJ8A 3SNBA 1ANDA 2BB4A 4WJG2 3NZIA 1WQVH 1P2QA 3OX7U 1PYTC 2GTBA 3ZVDA 3I77A 1KXBA 1SHHB 2C8XB 5CHAB 1W14U 2I6SA 2OC1A 2XWBI 2FTMA 1P2IA 3D65E 4TYDA 1G9IE 2PV9B 4UDWH 1O34A 4OS2A 1RRKA 4FVDA 5F8ZA 4ABDA 4ESTE 1XXDA 3F9EA 4WMEA 2CN0H 1ID5H 3LJJA 3VXEH 1UK3A 1CT2E 3K2UA 4GCHF 1OKXA 3KEEA 1IQKA 3GY7A 3RMLH 1MZDA 1P57B 1CBWC 1TGCA 1PFXC 4BAKB 1BMLA 1A7SA 1FQ3A 1N8OB 1GBDA 1BJUA 1EXFA 1JMOH 1IHSH 1MUEB 3OY6U 1NRNH 4X1QU 3RXGA 3ODDA 3TGKE 1G36A 3OYPA 3BTWE 2BVSH 1H9IE 4MQAA 1HB0B 1ETTH 4IC5A 1CA0C 3A7YA 2C8ZB 1CSOE 2C90B 2VVVA 1Z1IA 2QYIA 4DOQA 1GI4A 3GDUA 1GHYH 4MTBA 2XBVA 3UNRA 3ATIA 1SGDE 3QDZB 1FY1A 1P10A 2VVUA 3RUOA 1SL3A 1LTOA 2OUAA 3P92A 3ZZ3A 1C2MA 3PTBA 4GSOA 1L4ZA 2ZDKA 1EZUC 1W8BH 4ISOA 2ALVA 1ZGIA 3BG4C 4I8LA 3ATMA 1NESE 3E6PH 2ULLA 3SO3A 4X2XA 1DUEA 1QGFA 1GBHA 4Y7AA 2ZG0H 2GDEH 3C27B 1ZTJA 3MYWA 3TJUA 5AVDA 1NU9A 1SGTA 3RXMA 5HM9A 3N7OA 3A7XA 2GMTC 3A8CA 5CE1A 3T28A 2PHBA 4RN6A 1OWIA 2Z9LA 4I8HA 2G5VA 1TX6A 2B0FA 3S9BA 2PGBB 3K6YA 3MWIU 2UWPA 5F8XA 1V2JT 5JBAS 1MTSA 4CH8B 1OS8A 4CRFA 1A3BH 2FOMB 2IJOB 3P17H 2H6MA 4AFUA 2J94A 4AGJA 3H5CB 5E2PA 1HPGA 1O2HA 1C2HA 2C3SA 1KDQA 4K8BA 2ZFQH 1VGCB 2PSXA 3U98H 1D6RA 1GI5A 2ODPA 1ARCA 1Z8JB 3V12A 1GHXH 1YC0A 3RDZA 4XSKU 5T6FA 3TJVA 1V3XA 3E16B 1TGBA 3RXAA 1K1IA 4AG1A 3RXRA 1GBJA 2D2DA 4XDEA 1GVZA 2Q1JA 4NFFA 4ZXYH 3HGPA 3M35A 3GOVB 1C2KA 1Y3YA 2UUJB 1O36A 1E0FD 2A4RA 2FEQH 1RS0A 3HGNA 3PLPA 4AG2A 1GHZA 1GI9B 1JRSA 2D1JA 3BF6H 3RXEA 1MTNB 1O3BA 1HYLA 2GT7A 5GJ4B 4BTIB 1N6YA 5DG6A 4KTUA 1F0SA 1C1MA 3T62A 4KELA 1S83A 2EI7A 1P9SA 3R3GB 1YF4A 1P2JA 3ZZ8A 4AOQA 4XE4A 1ETRH 2CHAC 2KAIA 1MTWA 1AWFH 1DY8A 1AZZA 3ZYDA 1F0TA 1YGCH 1O3GA 3SJ8A 1D3TB 3EE0B 1LHGH 1ANBA 1EAIA 1P06A 4ZKNU 1A2CH 1C5ZB 3TVJB 1PYTD 1EZXC 1V2NT 5C5OA 3O8RA 1Z6JH 3RC5A 2WUBA 6CHAB 3MH5A 3DFLA 1BTXA 1ABIH 4XBDA 5AFYH 1UVTH 3SU3A 1EATA 2IOTA 3MU1A 1QNJA 3I78A 5DK1A 3RXFA 1PPGE 1TMUH 3LPRA 2Z9GA 1K2I1 1GI1A 3A8BA 4U2WA 1GDNA 3MHWU 1MKXH 2JH6D 5EQSA 1T7CA 5EGMA 2BDAA 4CBOA 2ZGHA 1O33A 1UK4A 1W0YH 2A4GA 3A87A 1AUTC 1BTWA 3PMAB 4ZUHA 4NA8A 3E90B 1K22H 3GCOA 1BTUA 1T31A 3F6UH 4DW2U 3SV2H 3FZDA 1WAYB 3ENSB 3FP7E 2ODQA 3M61U 4GHTA 3A82A 5EXLA 4D7GA 1THRH 1NRQH 4B74A 1EP5A 1F5RA 2ZDMA 3RXQA 3SQEE 4YT6H 2FODA 1K1OA 2SGAA 1RXPA 1GBLA 1ZZZA 6LPRA 3RU4T 1F2SE 1C5XB 2P8OC 1AGJA 1GBIA 3TGIE 3DD2H 1QJ6B 1SGFG 1EUFA 1O5EH 3SJOA 3V3MA 1ZJDA 4K8YA 3WY8A 2PUQH 4TWWA 2ZFPH 1EB2A 1QBNA 5FPTA 1THPB 2FI3E 3A84A 4Z6AH 3GY8A 1O32A 1WV7H 5DO4H 1V2UT 1QR3E 1TIOA 1CA0B 1BQYA 5ETXA 1A5IA 4IN2A 3SNAA 2PGQB 2AGGX 1MCVA 2GP9B 3KIDU 2OXSA 2G00A 2XXLA 2EI8A 1Y59T 5FX6A 2J95A 5FCKA 3A80A 1BBRK 3MNCA 1RJXB 1DUAA 1KLTA 2Q6FA 4FUEA 2G8TA 4ZH8A 3GY4A 2SNWA 4WH8A 1SGRE 1NC6A 4ABAA 5FBEA 3VB4A 1AZ8A 3BG4B 1VITH 4JZDH 3P8NA 3UQVA 1QHRB 2ANMH 2K1QA 4WVPE 1QURH 3ZVEA 3H7OA 1D3PB 1FLEE 2BQWB 1O5FH 1Z8RA 1VR1H 1AE5A 2HNTE 1FMGA 3M5OA 3A8AA 4I8KA 1YYY1 7GCHG 3RXBA 1O2OA 4NZQA 5LPFA 1NFWA 1YPEH 4JYVH 3RM0H 4FUIA 2FOFA 2ZHFH 1S6FA 1XM1A 5TCCA 1AVXA 1PPFE 2BY8X 2B8OH 2BHGA 2VH6A 1UCYH 4X2WA 2VIVA 1F5KU 1C1TA 1YLDA 3SGQE 2O8TA 3EAJA 4TY6A 2ZDAH 1P9UA 1VCPA 1XUIA 1ESTA 2A4QA 1H1BA 1HAXB 4Y8YA 1NPMA 1DVAH 1O2SA 1WTHD 1LQEA 1O3CA 1UK2A 4I7YH 1DFPA 1O2ZA 1K1LA 1V2ST 4KTCA 5DP9A 3M5MA 3MNBA 4Z0KA 3A83A 2ZC9H 1S0RA 4GPGA 1H8DH 4CH2B 2A5KA 5T6GA 5ABWA 1G3CA 1TNJA 1TX7A 1OP0A 2HNTC 1P3EA 1E34B 1GJ6A 2R0KA 1T8MA 4F4OC 7ESTE 1UHBA 1P03A 3TNTA 7GCHF 4JZIA 3L33A 1G2MA 2B9LA 1ORFA 3M36A 1GMCF 1GL1A 2FLRH 1GHAG 1GBAA 1UCYE 3BIUH 4Q2KA 1NS3A 1D6WA 4YZUA 2G55A 1P04A 3NWUA 9ESTA 5DP6A 5EW2H 4BOHA 1FONA 1ETSH 3FAOA 1PPCE 2A4OA 1P09A 4B2CA 1BHXB 2Z94A 1HLTH 1ZSKA 1BRUP 4O3UA 1T8OA 5HYOA 2NU2E 1RTFB 3S69A 2H2ZA 2CHAB 3RC6A 1JBUH 1TRNA 2BLVA 2OC0A 3H7TA 5A0BA 4B1TA 3ZZ7A 3A89A 1KSNA 3VEQB 1VJ9U 1O2TA 2H1UA 3ZZDA 4MPVA 4ZKOU 4X6OA 5HMAA 1IQIA 1BTPA 2WV5A 2BOKA 1ANEA 1GJAB 2QXGA 1SOZA 1SGQE 2SGFE 2XYAA 1TABE 1XUFA 2Y82A 2A7HA 3O8BA 1O5BB 4BTTB 3MI4A 4GLYA 1D9IA 3GISB 3M5LA 4B73A 1J17T 3RXHA 2R9PA 1LCYA 1BCUH 2XC4A 3TJNA 1GL0E 1Y3WA 1FV9A 2FOBA 2VB0A 3SUFA 2JETB 1LVOA 4YO9A 1ZSJA 2R3UA 3GYMA 2ZHQH 1PQ7A 2ASUB 2OQUA 1LHCH 2G4UA 2FDAA 2WPLS 2P94A 2ZZUH 2ZGCA 1QFKH 2AH4X 4OS4A 1AB9B 3SNCA 2Q6DA 1C5TA 1GHBG 1O3IA 1SLUB 3ODFA 2H5DA 4AB8A 1CQQA 1V6DA 2P3FH 1T32A 3MNXA 1FAKH 2P8OB 1Z7KA 3PLKA 5I25A 3KN2A 1NRRH 5ESTE 2KAIB 1E35B 2GV7A 3SN8A 4BAOB 2PTNA 1TB6H 1ARBA 1B7XB 1F0RA 2FO9A 1O3PB 3RXLA 1QL7A 3UFAA 1HCGA 1BRBE 1EB1H 2Y5FA 4FUJA 4DVAU 1J8AA 1GWAA 3PMBB 1GI7B 3ZVBA 1B5GH 1BTHH 1NT1A 5EQQA 1QJ7B 2D26C 3RXJA 1C9TA 3SI3H 4ABFA 2FOGA 2JKHA 5C1UA 3LC3A 1YP9A 5EOKA 3NPSA 3VPKA 3PO1C 1UJ1A 5C20A 2ANWA 1AN1E 1ZSLA 1MKWK 1SVPA 1SLXB 4CRBA 2GCHG 1FY4A 1TA6A 1GHBF 3TPIZ 4AFSA 1MU8B 4D8NA 4OGXA 1GHVH 3L6PA 1AI8H 2GDDA 5DGJA 3TIUA 2QXHA 2FESH 5L6NH 1ZPBA 3VGCC 2OD3B 1NFXA 1O3LA 2J34A 3AW1A 2ZEBA 2FTLE 1HAPH 1UVOA 1BIOA 5GCHF 3TK9A 3T29A 1TNGA 1V2VT 1OX1A 5TJXA 3GICB 1ELAA 1PPHE 1MAYA 1G30B 1DWBH 5L30H 1T4VH 1BTZA 1AUJA 4ABHA 1AHTH 1ANCA 5FHTA 4KKDA 3GDVA 2H9TH 3G01A 3RU4D 2TPIZ 4K60A 1LPGB 4ZROA 3PV4A 3PYHA 1MBQA 3E0NB 2BD4A 4JCNA 3VB5A 1T4UH 4X1NU 3EA7A 3GCTF 1UTMA 3L3TA 2PTCE 3VB3A 1HXEH 1O2KA 1SB1H 1LPKB 2R2MB 3TH4H 5HGGA 1Y5AT 4NIVA 1S82A 3F9FA 1A61H 1FI8A 3SOSA 1NFYA 1O2JA 2LPRA 3W94A 2ZFRH 2XCFA 1DDJA 4OGYA 4PROA 3SJIA 1KYNA 2O8WA 3D62A 7LPRA 3M3VA 3DHKH 3PTNA 1P12E 3KHVA 4FUFA 3RXKA 2ZTYA 1GVLA 4F49A 1YPHE 3FP6E 2Y7ZA 2ZU2A 3VB7A 3RC4A 1SMFE 4U01A 1SGNE 3A86A 4DIHH 2FOAA 1TBZH 2CV3A 4BANB 4DCDA 2NU0E 1ELFA 1DSTA 3DFJA 5FXLA 1P05A 3ZYEA 3EGKH 5EPNA 1C5YB 2H9EH 1D3DB 4UONA 1EOJA 3FZZA 1LKBA 1P01A 4H4FA 1GBEA 4TWYA 4H6SB 2CXVA 3ZV8A 2FOCA 3PWCA 2VVCA 1LKAA 2XC5A 3LC5A 1A0HB 3SU0A 4FU8A 1QRWA 1CE5A 5A0AE 3RMOH 1JWTA 1DXWA 1QJ1B 3K6ZA 2SFAA 3ATLA 3AASA 1G3BA 1YBWA 4O97A 1VZQH 1GI6A 4KTSA 1AY6H 2VU8E 1XKAC 3T25A 2ZFFH 3ZZ6A 1O3EA 1KIGH 1HAIH 4DURA 2V3HH 3UTUH 1RTKA 2QN5T 3UR9A 2AEIH 2OQ5A 5IYTA 2BVRH 1YPHC 2Z6BD 4GUXA 5F8TA 1O2PA 3CS0A 4Y11E 1X7AC 4DG4A 2W3KA 2ZIQH 3TU7H 1V2RT 1O3OA 2G81E 3Q3KA 1OSSA 4UFFH 1XUJA 3B9FH 1UVUH 2FPZA 2FX4A 4K1EA 2G5NA 1J16A 2AFQB 4SGAE 1TPOA 4I8JA 3BEIB 3LDXH 1E37B 4ABGA 5E8EH 1SGEE 2P3UB 5DP8A 3RMMH 1ZMLA 3FFGA 1O2LA 4INHA 1T8NA 3SGBE 3NKKA 2ZHWH 1FPCH 4MNVA 2BZ6H 2PFEA 2VWOA 3DT0H 1A3EH 2ZPQA 3MTYA 2BD8A 2SGEE 4WXIA 3LGUA 3OSYA 2PW8H 1F92A 2BOHB 2VIQA 2ZGBH 1TWXB 4GAWA 1TGNA 3A8DA 4D7FA 3PMHB 4X6NA 1TRMA 1VJAU 1F7ZA 4Y71A 1O3DA 1ESAA 2WINI 1BRCE 3IWMA 2ZNKH 3QGJA 2F9UA 8KME2 2C4FH 2W26A 2V35A 1Q3XA 1O31A 2ZDLA 2G4TA 1F0UA 1DICA 3TH3H 3E1XB 1ZYOA 4E7NA 2C8YB 1HIAA 3MH4A 2BY5X 3BTDE 1YCPM 3ZVCA 3PO1B 4XOJA 4LZ4B 5FAHA 4ZKRU 3M7UA 1GGDC 2F91A 5LPEA 2A5IA 1MMJN 1ESBA 3UIRA 2B5TB 3SU5A 4AYVB 2ZGJA 2W3IA 1S0QA 2ANKH 3QGNB 3FANA 2AGIX 3U69H 1W3CA 1LDTT 1FAXA 3VGCB 2EEKA 8GCHG 5EW1H 1W12U 1SGIB 3LGIA 1NN6A 3ZVGA 1OWDA 2F83A 5JBBS 1ZR0A 1OWJA 4Q7XA 1RIWB 3NCLA 2TGTA 1FIZA 4YLUA 2ZGXH 1MD8A 3QZQA 1BT7A 1G2LA 1GDUA 4LK4A 1C2GA 2AS9A 3KQDA 1XVOA 1Y5UT 4A7IB 1ZMNA 1WCZA 4NZLA 1GPZA 1GMHG 4K1TA 1KXCA 3P95A 3QK1A 1FXYA 2CGAA 1XUKA 2ZO3H 6ESTA 3BTGE 1ZPCA 3U8OH 1AFEH 1SI5H 2VGCC 4ASHA 2Z9IA 2XW9A 3HK6B 3JZ1B 3LU9B 1TE0A 2A2QH 4UFEH 1GBTA 3ZZ5A 1GJDB 3MO6A 1SQAA 1IQHA 1C2EA 1GBKA 3SUDA 2OBQA 3ZVAA 1ZPZA 1C5OH 3SJKA 2RCEA 4XBBA 1LMWB 2G52A 3T5FH 1V2TT 2HRVA 4I33A 3MOCA 4MG3A 1MTVA 1CBWB 4HZHA 8GCHF 1V2QT 4WH6A 1QB1A 2XWAA 3ITIA 4NCYA 3R0FA 3TH2H 4BAHB 1GDQA 1TLDA 1XXFA 4TPYA 4LOYH 1Y3XA 3KF2A 1YLCA 2BZAA 1MKXK 1O2GH 1RD3B 2QF0A 4LZ1H 1QTFA 1SGPE 3FVFB 3TLOA 2O8UA 2R0LA 4I31A 4OS6A 1Y8TA 2HVXA 1GMHF 5AF9H 1SFIA 1KLJH 2ODYB 5DJ7A 1IAUA 1U6QA 3UWJH 1O5GH 5AFZH 4H6TA 2FLBH 1EP6A 1ZLRA 4ISHH 2A45B 2UWLA 4FUHA 4Y0YE 4M7GA 1C5UA 2BXTH 3RXIA 3NXPA 1GI8B 4I32A 4A5TS 1TX8A 1IQJA 2H5CA 1UO6A 1WTGH 1A46H 4TY7A 1L1GA 4WWYA 5EODA 2HALA 1ZHRA 3S9CA 1DITH 1TALA 1UMAH 3E8LA 9LPRA
chains in the Genus database with same CATH superfamily
1TOMH 1J14A 1P02A 4IGDA 3QTVH 1E79D 2ZDVH 3RU4E 2VJ1A 2FOHA 1QBVH 3F2HA 1SSXA 1LVYA 1HGTH 1HV7A 1TA2A 1C4Y2 1OYQA 2BYAX 2OBOA 4OS1A 2WYJA 4D9RA 3MNSA 4TT3D 2VIOA 1EZQA 4IMZA 2GMTB 3F0PA 1N1LA 1SPJA 2VIWA 3DSPA 2F9NA 4CRCA 2YOLA 1LVMA 2V3OH 2VWMA 1TMBH 3A7VA 4J1YA 2BD7A 1BZXE 2FI4E 2AIQA 1W0KD 3M5NA 2ZQ2A 1WOFA 3PV5A 2FS9A 3F9HA 1L1JA 1XUGA 1CT0E 5GXPA 3QO6A 1TPPA 3P8FA 1ABJH 2TIOA 1PQ8A 1SGFA 2W6JD 4OS7A 1OHHD 1N6XA 8ESTE 2ZWLH 3B8JA 5C67A 1SGYE 2HLCA 2ESTE 3ATWA 1L0ZA 5A09A 1DE7H 1SBWA 3ATKA 3MFJA 1Z1JA 4YLQH 4X1RU 4AFQA 2RDLA 3BV9B 1GBFA 3F9GA 4CRGA 2KFWA 2ZECA 1C5VA 3F1SB 1JXPA 1K1PA 2BDYA 4QT8C 1V2KT 2CF9H 2V0BA 1UTJA 2C93B 4ZKSU 1EJNA 1D4PB 1ZOMA 4UFDH 2A7JA 1S6HA 5H4IB 2RG3A 2VH0A 1UCYK 2QAAA 4AORA 4X6MA 2WUCA 3T27A 1UTKA 4VGCC 3V0XA 3SBKA 3STIA 1O5CB 3KQEA 3MMGA 2KZ4A 4R0IA 1W11U 4ZHMU 4B2AA 1O39A 2A32A 3M7TA 2Y5GA 1GGDB 4Z1MD 1TNHA 1YKTA 2VWNA 4NSVA 2ZHDA 2ZCKP 1FY8E 3E3TA 4XFQA 3UNSA 4ZXXH 1HDTH 5HM2A 1FNIA 1GJBB 3GY6A 4BXSA 2GKVE 2HGTH 5B6OA 1K21H 2WPDD 2Z9JA 4X8TH 1Z71A 3PM3A 2WHXA 4K1SA 3KNXA 3FN8A 3OAAD 1HAHH 2XBYA 4WXVA 5T3HA 5J4SA 1O30A 4WF8A 3LKWA 1BOQA 3I29A 2AYWA 3LGVA 4R8TB 2KM0A 5JYIA 2NWNA 1DY9A 5FL7D 1PQAA 2F4LA 1KDQB 1AKSA 1WU1A 1B0FA 2IPHA 3URCA 3RXSA 1T8LA 1MTUA 2AIPA 1EASA 3F0OA 4NGAH 3O8DA 3A7ZA 1C1SA 1HRTH 4ZHAA 5FBIA 4AN7A 3D49H 2WYGA 4ABJA 3E91A 4X8VH 5ESBA 1GHAF 2P95A 3PWBA 3URDA 2DE9A 1EOLA 1FZZA 5F6MA 2VGCB 1QB9A 1S5SA 4O9VA 4Y7BA 3STJA 3BTME 1CGHA 1DPOA 1O2NA 1ZTLA 3AAUA 3RXPA 1HAZB 4AFZA 1HAYB 3P70B 4B6FA 1H8IH 4MPUA 4JYUH 5E2OA 2BLQA 2F9BH 2QCYA 3BTTE 2AMDA 4YTAA 5JB8S 2O9QA 2P16A 3SU6A 1S85A 1C1QA 2KX4A 1TPAE 3ZZCA 1NFUA 1ACBE 1O5AB 1UW7A 1FJSA 2GCTC 3EA8A 1C4V2 2FZZA 3O8CA 1W0ZU 4HI3A 4GHQA 3VXFH 3KYGA 1NM6A 4YESB 2CF8H 5GDSH 2TGAA 1JOUB 2BX4A 1GJ7B 2D8WA 4MVNA 1PJPA 4D9QA 2BD9A 2ZU3A 1QCPA 1GJ9B 2FX6A 1C9PA 3MH6A 4IS5A 3W95A 3CP7A 1EPTA 1AD8H 1PPZA 1C2IA 5A8XA 1MH0A 4BAQB 1SG8B 1HAOH 1NO9H 4AZ2B 2HPQH 3A7WA 1A5HA 2UUKB 2PKSC 3HKIB 2Z3EA 2QXIA 1H4WA 1V2WT 2W5EA 1P0SH 4RSPA 2A1DB 3UWIA 1ELEE 3SORA 7KMEH 2NU3E 1O38A 4Q63A 2WPKS 5I46H 2F9OA 5DPAA 4B6EA 4NIWA 3A88A 5C0TA 5KEDA 2A31A 1LHEH 1SFQB 4MNWA 1QRXA 1HBTH 1A5GH 3SV9A 1FPHH 2YNAA 1TOCB 2F3CE 5LH8A 1MTNC 2BY6X 1JIMA 3U9AH 4RI0A 4FXGH 3M3TA 4Q7YA 1C1UH 3A7TA 2Z3CA 3Q3YA 2FYRA 2GZ7A 1DXPA 1GBMA 1SQTA 1K1MA 2Z7FE 1IQNA 1EFRD 3ZZBA 1G37A 4NA9H 1DWDH 1C2FA 2AMPA 3SQHE 4HFPB 2XBWA 3GDSA 2ZTZA 1EJAA 1TQ0B 1O2WA 4Q7ZA 1QL9A 1H9HE 1MAXA 2J4IA 2QC2A 1SR5C 1J9CH 1A0LA 3MO3A 1FN6A 1HAVA 1EPTC 3ELAH 4NFEA 1IHTH 2IJD1 1CVWH 1TBRH 5K7RA 2ZKSA 3PV2A 1TRYA 4AYYB 2GCHF 5EQRA 2HOBA 1DSUA 3NK8A 2BQ7B 1EX3A 5IDKA 5A8ZA 1GCTC 3BIVH 5HXFA 2R2WU 1Y5BT 4AX9H 1DT2A 1W13U 1HAGE 1C5SA 4FUGA 4GVUA 3TITA 5JDUB 2QF3A 2OP9A 2SGPE 4NWLA 5C3NA 2PR3A 1SGCA 2FYQA 4XD7D 1L4DA 1LHFH 1C4U2 1OWEA 1AFQC 1UVSH 1E38B 1PPEE 4ISIH 4RKJB 4VGCB 3PROA 3SNDA 1EJMA 1HUTH 4BXWA 3LOXA 4JYTA 1BITA 1W10U 1AE8H 2GX4A 1C5RA 1ZHPA 1YPKH 2ZCLP 4I86A 3T2NA 3HK3B 3ZVFA 1HXFH 3FP8E 1EQ9A 2FP7B 1XKBC 1TNIA 2H9HA 1ZRKA 2JIZD 3OU0A 1P3CA 2RDEA 5CHBA 1HJAC 2QGRA 5JB9S 3ZV9A 1OWHA 3V7TA 1MQ5A 4K3JA 2BX3A 3MU5A 1VCQA 1TFXA 3JZ2B 1GI2A 2J9NA 1O3JA 4K69A 2W7SA 4H42U 1C5MD 5SGAE 1QQUA 1V2LT 4YXWD 3QUMP 1TYNA 5A8YA 3SUGA 5J4QA 1EAWA 2VIDA 2BLOA 5DP3A 3SW2B 5DP7A 3TK6A 1TGSZ 1C1VH 1O3HA 3GYLB 1NRSH 1WUNH 2OINA 1BHXF 1SLWB 1NROH 1C1WH 5DP4A 5C1XA 3EYDA 4IW4E 3UR6A 4MNXA 3SUEA 1GG6C 1JIRA 4U30A 1SC8U 4B75A 2OC8A 4MDSA 1LQDB 3BEUA 1MBMA 1UHBB 1EAUA 4A6LA 1RGQA 3ZZ9A 1XUHA 1IQGA 1QQ4A 3UB0A 1O2UA 2PKAA 2LNCA 1GJCB 1C5LH 2FIRH 1KTTB 1NRPH 1WDIA 1QRZA 3RP2A 2FM2A 3RXUA 2V6NA 1FUJA 1W7XH 1YPMH 1L1NA 2PSYA 4LXBH 2RFKC 1MD7A 2BTCE 2BM2A 4A1TA 1YPJH 3QZRA 1GI3A 5G4BA 5C2ZA 5FX5A 4NIXA 3SHCH 1HNEE 4A1VA 1G32B 5EU8A 1H8ED 3UPEA 5EXMA 3TGJE 2GZ8A 2ZF0H 1BUIA 2GCTB 2J98B 4X1SU 1J15A 1YPLH 3Q3XA 3RXTA 5FPSA 2VWLA 1UTPA 3BTEE 4B2BA 2BLWA 3GCHC 4NSYA 1OP2A 1O5DH 2XNIA 3KGPA 3MU8A 5FCRA 5FPYA 4DY7B 4IN1A 2OLGA 4YOJA 2ZFTA 2THFB 5KECA 4JK5A 3HATH 2R3YA 1K0HA 1Y3VA 1NBME 1AKSB 2P59A 3RXCA 1XVMA 4O03A 2OK5A 3RXVA 1EZSC 1DANH 2FI5E 3KQ5A 1MQ6A 2BDGA 2UUFB 4JZEH 3EQ0H 2PKSB 2ZPRA 3CENA 1DLEA 2BDCA 3CS7A 4UD9H 5LGOA 1H9LB 1P2NA 2J97A 4IBLH 1IQFA 1O2QA 3SV8A 1GJ8B 1COWD 1O3FA 1OOKB 3EA9A 1TNLA 3A85A 2SGDE 4MPWA 1O3NA 3LGTA 4JZ1A 2HLDD 5E0JA 1C2DA 3BEFB 2GV6A 1FY3A 4BTUB 2PLXA 5K0HA 4X0WU 2DE8A 1UTQA 5EPYA 1V2OT 4A1XA 1GHWH 3LGYA 2FMJA 4CR9A 1BDAA 4ISNA 3UUZA 3RXOA 3UOPA 4WMDA 1DLKB 3T26A 3RM2H 3C1KA 1KLIH 3TNSA 1S81A 1ZGVA 5F03A 3OY5U 4KGAA 4UE7H 1QA0A 2BQ6B 3GY5A 1OWKA 2WPIS 3DUXH 4NA7A 3MQKC 2NU4E 3Q00A 1WBGB 2WV4A 2ZI2H 1O2RA 4ZHLU 3P8GA 5AHGH 3SU1A 1C5WB 3S7HB 1QL8A 2BY7X 1DWEH 3N7DA 2F43B 3UAIC 1EPTB 1BMAA 4YOGA 5JBCS 1P8VC 2UWOA 1FDPA 2ZU4A 1IQEA 1ELBA 1ELVA 1S84A 1DX5M 1WQSA 4FVBA 1TPSA 3RXDA 2STBE 2V7QD 2A7CA 3GY2A 3K9XB 3UOUA 4Y10E 4XBCA 5EIYA 1GCTB 2GT8A 1DWCH 1CO7E 1TQ7B 5EG4A 2JETC 2V3MA 3DA9B 3EDXB 1IOEA 2Q6GA 2FOEA 1ELDE 3SHAH 2ZTXA 5L2YH 1G3DA 1Q31A 4ISLA 4CRAA 3VG8A 5KGOA 1AFQB 2VINA 2CMYA 5DP5A 4X8UH 1AU8A 2WPHS 1AB9C 3PB1E 4MNYA 3Q76A 1VITG 3LONA 1KXEA 4DJZB 4CBNA 2XBXA 4I8GA 4JMYA 1BBRH 4CHAC 1L2EA 1O2MA 2GD4B 2ZDNA 3HKJB 3QX5H 5HIZA 4DIIH 1BB0B 1O3MA 1O0DH 1C1RA 2C8WB 2ZPSA 2GVFA 4UFGH 6GCHG 2XCNA 1Z6EA 1FIWA 2QXJA 3OTJE 1O2IA 1TBQH 5A2MH 3U1IB 5BRRE 4AB9A 3U1JB 1IQMA 2HNTF 3SJ9A 1HJAB 2RA3A 3SV7A 3Q77A 2XC0A 1CGJE 1DOJA 1YM0A 2O8LA 3WWFA 2KCOA 2Y5HA 4E7RG 4YT7H 2JH5D 1QIXB 1HAVB 1RTLA 1UTNA 5L2ZH 1ZHMA 3KQBA 2SNVA 1WYKA 3UREA 1CGIE 2Z3DA 2QY0B 1CT4E 1O2XA 2EC9H 4M9FA 2ZU5A 3SU2A 1P2OA 2FWWA 3SZNA 3HPTB 4FETA 1Z8IB 1QBOA 4K5ZA 2O8MA 1BBRE 1OYTH 1UVPA 1XX9A 4U32A 1C5QA 4X8SH 2OC7A 3BTHE 1W2KH 1GG6B 1D3QB 4BAMB 1VITF 4ABBA 2PP6A 1A4WH 1GBCA 4ZAEA 3U8TH 4P02A 2Z9KA 4MPXA 1GCDA 6GCHF 2M5TA 4OS5A 3BTFE 3F3BA 1PQ5A 3UNQA 1O3AA 4HTCH 3RMNH 3GCNA 3AW0A 1TAWA 3V13A 4RKOB 2WPJS 1GMCG 1DM4B 4FU9A 2BY9X 1ELTA 2ZFSA 2WPMS 1P2KA 1HFDA 1K9OE 1Q2WA 3AK5A 1GMDG 4Y8XA 2TRMA 1GBBA 4DT7B 3M7QA 1AVWA 2RA0A 1KXAA 3GY3A 1A1RA 3PMJA 5A0CA 1AQ7A 3GCHB 2TBSA 1TMTH 2HWLB 1AMHA 3IITA 4FUDA 4X2YA 5C1YA 1K1NA 1CA8B 2VBCA 5CHAC 1LVBA 1YCPH 4B76A 2A0QB 4KP0A 2Y6TA 3QWCH 4F48B 1G3EA 4Y8ZA 2BD5A 3AAVA 4J2YB 1SOTA 1INCA 2QIQA 3B23B 4X1PU 2BXUH 3BN9A 5JPMH 1BRAA 3A81A 4X6PA 1C2LA 3KL6A 3M3SA 3NUMA 3UY9A 4YOIA 2TGDA 1SHYA 3KCGH 4Y79A 2EA3A 1THSH 1OXGA 2AGEX 4WMFA 1C5NH 1N8OC 1LHDH 2EI6A 3S0NA 2J92A 1UTOA 3H09A 4CR5A 5GWZA 2UUYA 1NBMD 1AVGH 1EAXA 1ELGA 2PKAB 2BDHA 1PPBH 1GMDF 1EKBB 1UTLM 2BVXH 1QY6A 1TNKA 1LPZB 2Y80A 1DS2E 1WSSH 4Y76A 3UQOA 1YCPK 2DUCA 2ZU1A 1C2JA 4D76A 1E36B 4THNH 1C5PA 1E1QD 1SQOA 1CU1A 2ILNA 3MU0A 2BD3A 1C1NA 2J2UA 3VB6A 4NIYA 2Y81A 1O2YA 2K0QA 3TJOA 5E0GA 2L6OA 1ELCA 2GGVB 3PLBA 1KXFA 1QB6A 3D23A 2P3TB 3RLWH 4IMQA 3P8OA 1MCTA 1P11E 2ZQ1A 3ZZ4A 1NU7B 3SNEA 3IG6B 8LPRA 1AIXH 2B7DH 4UEHH 2TGPZ 1ZJKA 3BTKE 3KYFA 2PWXA 5GPIB 5BPEA 5T6DA 2ZHEH 1B0EA 2J38A 2ZA5A 2A2XH 4Y0ZE 4K2YA 4INLA 1AWHB 3BSQA 5F53A 3P6ZB 3U8RH 1HIAB 2NU1E 4SGBE 3LJOA 3ZZAA 1O3KA 1IQLA 4HGCA 3S9AA 1MZAA 4BNRA 4ABEA 3MH7A 2JDID 1NZQH 3F68H 3QLPH 4FUBA 4JZFH 1P2MA 2FS8A 2AERH 3DCLA 3LH3A 3FKSD 2BDIA 2BMGB 4E05H 1VCWA 1GI0A 5B6LA 1C1PA 2GZ9A 1FN8A 1O35A 2PUXB 1O37A 1FY5A 2BD2A 5GIBA 1OPHB 1O2VA 3RLYH 5LPRA 4CHAB 3S7KB 2QV1A 1TONA 3LGWA 3BTQE 4CRDA 4ACAA 1ZRBA 2I6QA 3MO9A 4FU7A 3LIWA 2AMQA 2OCVB 3VFEA 1GVKB 1HJ9A 1MKWH 3K65B 2P93A 5CMXH 2ALPA 1TGTA 1VGCC 1E1RD 2JH0D 3AVZA 1NY22 3SV6A 2IN2A 1KTSB 4IC6A 4TPIZ 5GCHG 1NTPA 3MU4A 2QA9E 2A5AA 2WV9A 1GJ4H 2OTVA 4ABIA 4YM9A 4E06H 4JK6A 1BMNH 2F9VA 4X2VA 1W7GH 1SLVB 1MU6B 4WY3A 1V2PT 2ZP0H 2K8IA 4NG9H 1CHOG 2AHME 5TCAA 5PTPA 3F2FA 3QN7A 1M9UA 2Y7XA 1GJ5H 3ESTA 3LT3A 4Q80A 2HPPH 1V2MT 2STAE 2ZCHP 2YNBA 3SGAE 2F9PA 3GCTG 3LH1A 4P00A 3M37A 3TK5A 2CJIA 1K28D 2XRCA 3SU4A 2VNTA 5JBTA 1KY9A 1RFNA 2BDBA 2G51A 2VIPA 1KXDA 5C5NA 1ZTKA 2XTTB 1LO6A 1A0JA 2FXRA 5EXNA 2KR7A 3QTOH 5EJZA 4GCHG 1BJVA 1C1OA 1OP8A 4CREA 1AO5A 4DGJA 1K1JA 4FUCA 3BG8A 4B71A 4AGKA 4Y6DA 1XMNB 1JRTA 2ANYA 1YPGH 1RIWC 5DKMA 1Z8GA 4NWKA 6CHAC 3E0PB 2W7UA 1QZ8A 5E0HA 4INKA 4MLFB 1Y3UA 2SGQE 3KQCA 4A92A 1CHGA 4RT1A 4O3TA 1BA8B 1BTYA 1CHOF 1F5LA 4ZMAH 1QA7A 1BMMH 1ZMJA 3SI4H 1HJ8A 3SNBA 1ANDA 2BB4A 2WSSD 4WJG2 3NZIA 1WQVH 1P2QA 3OX7U 1PYTC 2GTBA 3ZVDA 3I77A 1KXBA 1SHHB 2C8XB 5CHAB 1W14U 2I6SA 2J5UA 2OC1A 2XWBI 2FTMA 1P2IA 3D65E 4TYDA 1G9IE 2PV9B 4UDWH 1O34A 4OS2A 1RRKA 4FVDA 5F8ZA 4ABDA 4ESTE 1XXDA 3F9EA 4WMEA 2CN0H 1ID5H 3LJJA 3VXEH 1UK3A 1CT2E 3K2UA 4GCHF 1OKXA 3KEEA 1IQKA 1WXRA 3GY7A 3RMLH 1MZDA 1P57B 1CBWC 1TGCA 1PFXC 4BAKB 4RT0A 1BMLA 1A7SA 1FQ3A 1N8OB 1GBDA 1BJUA 1EXFA 1JMOH 1IHSH 1MUEB 3OY6U 1NRNH 4X1QU 3RXGA 3ODDA 3TGKE 1G36A 3OYPA 3BTWE 2BVSH 1H9IE 4MQAA 1HB0B 1ETTH 2XNDD 4IC5A 1CA0C 3A7YA 2C8ZB 1CSOE 2C90B 2VVVA 1Z1IA 2QYIA 4DOQA 1GI4A 3GDUA 1GHYH 4MTBA 2XBVA 3UNRA 3ATIA 1SGDE 3QDZB 1FY1A 1P10A 2VVUA 3RUOA 4HG6A 1SL3A 1LTOA 4ZCNA 2OUAA 3P92A 2QF4A 3ZZ3A 1C2MA 2QF5A 3PTBA 4GSOA 1L4ZA 2ZDKA 1EZUC 1W8BH 4ISOA 2ALVA 1ZGIA 3BG4C 4I8LA 3ATMA 1NESE 3E6PH 2ULLA 3SO3A 4X2XA 1DUEA 1QGFA 1GBHA 4Y7AA 2ZG0H 2GDEH 3C27B 1ZTJA 3MYWA 3TJUA 1YY3A 5AVDA 1NU9A 1SGTA 3RXMA 5HM9A 3N7OA 3A7XA 2GMTC 3A8CA 5CE1A 3T28A 2PHBA 4RN6A 1OWIA 2Z9LA 4I8HA 2G5VA 1TX6A 2B0FA 3S9BA 3NRLA 2PGBB 3K6YA 2KCPA 3MWIU 2UWPA 5F8XA 1V2JT 5JBAS 1MTSA 4CH8B 1OS8A 4CRFA 1A3BH 2FOMB 2IJOB 3P17H 2H6MA 4AFUA 2J94A 4AGJA 3H5CB 5E2PA 1HPGA 1O2HA 1C2HA 2C3SA 1KDQA 4K8BA 2ZFQH 1VGCB 5CDFE 2PSXA 3U98H 1D6RA 1GI5A 2ODPA 1ARCA 1Z8JB 3V12A 1GHXH 1YC0A 3RDZA 4XSKU 5T6FA 3TJVA 1V3XA 3E16B 1TGBA 3RXAA 1K1IA 4AG1A 3EE7A 3RXRA 1GBJA 1W0JD 2D2DA 4XDEA 1GVZA 2Q1JA 4DT4A 4NFFA 4ZXYH 3HGPA 3M35A 3GOVB 1C2KA 1Y3YA 2UUJB 1O36A 1E0FD 2A4RA 2FEQH 1RS0A 3HGNA 3PLPA 4AG2A 1GHZA 1GI9B 1JRSA 2D1JA 3BF6H 3RXEA 1MTNB 1O3BA 1HYLA 2GT7A 5GJ4B 4BTIB 1KMHB 1N6YA 5DG6A 4KTUA 1F0SA 1C1MA 3T62A 4KELA 1S83A 2EI7A 1P9SA 3R3GB 1YF4A 1P2JA 3ZZ8A 4AOQA 4XE4A 1ETRH 2CHAC 2KAIA 3F2GA 1MTWA 1AWFH 1DY8A 1AZZA 3ZYDA 1F0TA 1YGCH 1O3GA 3SJ8A 1D3TB 3EE0B 1LHGH 1ANBA 1EAIA 1P06A 4ZKNU 1A2CH 1C5ZB 3TVJB 5C17A 1PYTD 1EZXC 1V2NT 5C5OA 3O8RA 1Z6JH 5DN6D 3RC5A 1YLNA 2WUBA 6CHAB 3MH5A 3DFLA 1BTXA 1ABIH 4XBDA 5AFYH 1UVTH 4OM9A 3SU3A 1EATA 2IOTA 3MU1A 1QNJA 3I78A 5DK1A 3RXFA 1PPGE 1TMUH 3LPRA 1MABB 2Z9GA 1K2I1 1GI1A 3A8BA 4U2WA 1GDNA 3MHWU 1MKXH 2JH6D 5EQSA 1T7CA 5EGMA 2BDAA 4CBOA 2ZGHA 1O33A 1UK4A 1W0YH 2A4GA 3A87A 1AUTC 1BTWA 3PMAB 4ZUHA 4NA8A 5GNDA 3E90B 1K22H 3GCOA 1BTUA 1T31A 3DSGA 3F6UH 5EJ1A 2GJGA 1S6LA 4DW2U 3SV2H 3FZDA 1WAYB 3ENSB 3FP7E 1SKYE 2ODQA 3M61U 3A82A 4GHTA 5EXLA 1THRH 1NRQH 4B74A 4D7GA 1EP5A 1F5RA 2ZDMA 3RXQA 3SQEE 4YT6H 2FODA 1K1OA 2SGAA 1RXPA 1GBLA 3CNRA 1ZZZA 6LPRA 3RU4T 1F2SE 1C5XB 2P8OC 1AGJA 1GBIA 3TGIE 3DD2H 1QJ6B 1SGFG 1EUFA 1O5EH 3SJOA 3V3MA 1ZJDA 4K8YA 3WY8A 2PUQH 4TWWA 2ZFPH 1EB2A 1QBNA 5FPTA 1THPB 2FI3E 3A84A 4Z6AH 3GY8A 1O32A 1WV7H 5DO4H 1V2UT 1QR3E 1TIOA 1CA0B 3PRDA 1BQYA 5ETXA 2WZQA 1A5IA 4IN2A 3SNAA 2PGQB 2AGGX 1MCVA 2GP9B 3KIDU 2OXSA 2G00A 2XXLA 2EI8A 1Y59T 5FX6A 2J95A 5FCKA 1YWUA 3A80A 1BBRK 3MNCA 1RJXB 1DUAA 1KLTA 2Q6FA 4FUEA 2G8TA 2KCAA 3FO8D 4ZH8A 3GY4A 2SNWA 3FOAA 4WH8A 1SGRE 1NC6A 4ABAA 5FBEA 3VB4A 1AZ8A 3BG4B 1VITH 4JZDH 5HKKD 3P8NA 2LELA 2XOKD 3UQVA 1QHRB 2ANMH 2K1QA 4WVPE 1QURH 3ZVEA 3H7OA 1D3PB 1FLEE 2BQWB 1O5FH 1Z8RA 1VR1H 1AE5A 2HNTE 1FMGA 3M5OA 3A8AA 4I8KA 1YYY1 7GCHG 3RXBA 1O2OA 4NZQA 3N99A 5LPFA 1NFWA 2YMSC 1YPEH 4JYVH 3RM0H 4FUIA 2FOFA 2ZHFH 1S6FA 1XM1A 5TCCA 1AVXA 1PPFE 2BY8X 2B8OH 2BHGA 2VH6A 1UCYH 4X2WA 2VIVA 1F5KU 1C1TA 1YLDA 4TSFD 3SGQE 2O8TA 3EAJA 4TY6A 2ZDAH 1P9UA 1VCPA 1XUIA 1ESTA 2A4QA 1H1BA 1HAXB 4Y8YA 1NPMA 1DVAH 3OEHD 1O2SA 1WTHD 1LQEA 1O3CA 1UK2A 4I7YH 1DFPA 1O2ZA 1K1LA 1V2ST 4KTCA 5DP9A 3M5MA 3MNBA 4Z0KA 1BMFD 3A83A 3SZEA 2ZC9H 1S0RA 4GPGA 1H8DH 4CH2B 2A5KA 5T6GA 5ABWA 1G3CA 1TNJA 4ACBA 1TX7A 1OP0A 2HNTC 1P3EA 1E34B 1GJ6A 2R0KA 1T8MA 5C0UA 4F4OC 7ESTE 1UHBA 1P03A 3TNTA 7GCHF 4JZIA 3L33A 1G2MA 2B9LA 1ORFA 3M36A 3SYJA 1GMCF 1GL1A 2FLRH 1GHAG 1GBAA 1UCYE 3ZIAD 3BIUH 4Q2KA 1NS3A 1D6WA 4YZUA 2G55A 1P04A 3NWUA 3W1EA 9ESTA 5DP6A 5EW2H 2EY4C 4BOHA 2JJ2D 1FONA 1ETSH 3FAOA 1PPCE 2A4OA 1P09A 4B2CA 1BHXB 2QE7D 2Z94A 1HLTH 5EJLA 1ZSKA 1BRUP 4O3UA 1T8OA 5HYOA 2NU2E 1RTFB 3S69A 2H2ZA 2J98A 2CHAB 3RC6A 1JBUH 1TRNA 2BLVA 2OC0A 3H7TA 5A0BA 4B1TA 3ZZ7A 3A89A 1KSNA 3VEQB 4XRNA 1VJ9U 1O2TA 2H1UA 3ZZDA 4MPVA 4ZKOU 4X6OA 5HMAA 1IQIA 1BTPA 2WV5A 2BOKA 1ANEA 1GJAB 2QXGA 5T1VA 1SOZA 1SGQE 2SGFE 2XYAA 1TABE 1XUFA 2Y82A 2A7HA 3O8BA 1O5BB 4BTTB 3MI4A 4GLYA 1D9IA 3GISB 3M5LA 4B73A 1J17T 3RXHA 2R9PA 1LCYA 1BCUH 2XC4A 3TJNA 1GL0E 1Y3WA 1FV9A 2FOBA 2VB0A 3SUFA 2JETB 1LVOA 4YO9A 1ZSJA 2R3UA 3GYMA 2ZHQH 1PQ7A 3GS9A 2ASUB 2OQUA 1LHCH 2G4UA 2FDAA 2WPLS 2P94A 2ZZUH 2ZGCA 1QFKH 2AH4X 4OS4A 1AB9B 3SNCA 2Q6DA 1C5TA 1GHBG 1O3IA 1SLUB 3ODFA 2H5DA 4AB8A 1CQQA 1V6DA 2P3FH 1T32A 2IPQX 3MNXA 1FAKH 2P8OB 1Z7KA 3PLKA 5I25A 3KN2A 1NRRH 5ESTE 2KAIB 1E35B 2GV7A 3SN8A 4BAOB 2PTNA 1TB6H 1ARBA 1B7XB 1F0RA 2FO9A 1O3PB 3RXLA 1QL7A 3UFAA 1HCGA 1BRBE 1EB1H 2Y5FA 4FUJA 3N7EA 2W6ID 1J8AA 4DVAU 1GWAA 3PMBB 1GI7B 3ZVBA 1B5GH 1BTHH 1NT1A 5EQQA 1QJ7B 2D26C 3RXJA 1C9TA 3SI3H 4ABFA 2FOGA 2JKHA 5C1UA 3LC3A 1YP9A 5EOKA 3NPSA 3VPKA 3PO1C 1UJ1A 5C20A 2ANWA 1AN1E 1ZSLA 1MKWK 1SVPA 1SLXB 2YMSD 4CRBA 2GCHG 5C94A 1FY4A 1TA6A 1GHBF 3TPIZ 4AC9A 1MU8B 4AFSA 4OGXA 4D8NA 1GHVH 3L6PA 1AI8H 2GDDA 5DGJA 3TIUA 2QXHA 2FESH 2HVYB 5L6NH 3OE7D 1ZPBA 3VGCC 2OD3B 1NFXA 1O3LA 2J34A 3AW1A 2ZEBA 2FTLE 1HAPH 1UVOA 1BIOA 5GCHF 3TK9A 4F55A 3T29A 1TNGA 1V2VT 1OX1A 5TJXA 3GICB 1ELAA 1PPHE 1MAYA 1G30B 1DWBH 2YMSB 3OTPA 5L30H 1T4VH 1BTZA 1AUJA 4FOUC 1AHTH 1ANCA 5FHTA 4ABHA 4KKDA 3GDVA 2H9TH 3G01A 3RU4D 2TPIZ 4K60A 1LPGB 4ZROA 3PV4A 3PYHA 1MBQA 3E0NB 2BD4A 4JCNA 3VB5A 1T4UH 4X1NU 3EA7A 3GCTF 1UTMA 3L3TA 2PTCE 3VB3A 1HXEH 1O2KA 1SB1H 1LPKB 2R2MB 3TH4H 5HGGA 1Y5AT 4NIVA 1S82A 3F9FA 1A61H 1FI8A 3SOSA 1NFYA 1O2JA 2LPRA 3W94A 2ZFRH 2XCFA 1DDJA 4OGYA 4PROA 3SJIA 1KYNA 2O8WA 3D62A 7LPRA 3M3VA 3DHKH 3PTNA 1P12E 3KHVA 4FUFA 3RXKA 2ZTYA 1GVLA 2EQNA 3OFND 4F49A 1YPHE 3FP6E 2Y7ZA 2ZU2A 3VB7A 3RC4A 1SMFE 4U01A 1SGNE 3A86A 4DIHH 2FOAA 1TBZH 2CV3A 4BANB 4DCDA 2NU0E 1ELFA 1DSTA 3DFJA 5FXLA 1P05A 3ZYEA 3EGKH 5EPNA 1C5YB 2H9EH 1D3DB 4UONA 1EOJA 3FZZA 1LKBA 1P01A 3DSOA 1GBEA 4H4FA 4TWYA 4H6SB 2CXVA 4ASUD 3ZV8A 2FOCA 3PWCA 2VVCA 1LKAA 2XC5A 3LC5A 1A0HB 3SU0A 4FU8A 1QRWA 1CE5A 5A0AE 3RMOH 1JWTA 1DXWA 1QJ1B 3K6ZA 2SFAA 3ATLA 3AASA 1G3BA 1YBWA 4O97A 1VZQH 1GI6A 4KTSA 1AY6H 2VU8E 1XKAC 3T25A 2ZFFH 3ZZ6A 1O3EA 1KIGH 1HAIH 2LP6A 4DURA 2V3HH 3UTUH 1VKYA 1RTKA 2QN5T 3UR9A 3WW7A 2AEIH 2OQ5A 5IYTA 2BVRH 1YPHC 2Z6BD 4GUXA 5F8TA 1O2PA 3CS0A 4Y11E 1X7AC 4DG4A 2W3KA 2ZIQH 3TU7H 1V2RT 1O3OA 2G81E 3Q3KA 1OSSA 4UFFH 1XUJA 3B9FH 1UVUH 2FPZA 2FX4A 4K1EA 2G5NA 1J16A 2AFQB 4SGAE 1TPOA 5IK2D 4I8JA 3BEIB 3LDXH 1E37B 3WWBA 4ABGA 5E8EH 1SGEE 4Q4LA 2P3UB 5DP8A 3RMMH 1ZMLA 3FFGA 1O2LA 4INHA 1T8NA 3OEED 3SGBE 3NKKA 2ZHWH 1FPCH 4MNVA 2BZ6H 2PFEA 2VWOA 3DT0H 1A3EH 2ZPQA 3MTYA 2BD8A 2SGEE 4WXIA 3LGUA 3OSYA 2PW8H 1F92A 2L74A 2BOHB 2VIQA 2ZGBH 1TWXB 4GAWA 1TGNA 3A8DA 4D7FA 3PMHB 4X6NA 1TRMA 1VJAU 1F7ZA 4Y71A 1O3DA 1ESAA 2WINI 1BRCE 3IWMA 2ZNKH 3QGJA 2F9UA 8KME2 2C4FH 2W26A 2V35A 1Q3XA 1O31A 2ZDLA 2G4TA 1F0UA 1DICA 3TH3H 3E1XB 1ZYOA 4E7NA 2C8YB 1HIAA 2JJ1D 3MH4A 1SQRA 2BY5X 3BTDE 1YCPM 3ZVCA 3PRBA 3PO1B 4XOJA 4LZ4B 5FAHA 4ZKRU 3M7UA 1GGDC 2F91A 5LPEA 2A5IA 1MMJN 1ESBA 3UIRA 2B5TB 3SU5A 4AYVB 2ZGJA 2W3IA 1S0QA 2ANKH 3QGNB 3FANA 2M2AA 2AGIX 3U69H 1W3CA 1LDTT 1FAXA 3VGCB 2EEKA 8GCHG 5EW1H 1W12U 1SGIB 3LGIA 1NN6A 3ZVGA 1OWDA 2F83A 5JBBS 1ZR0A 1OWJA 4Q7XA 1RIWB 3NCLA 2TGTA 1FIZA 4YLUA 2ZGXH 1MD8A 3QZQA 1BT7A 1G2LA 1GDUA 4LK4A 3U28C 1C2GA 2AS9A 3KQDA 1XVOA 1Y5UT 4A7IB 1ZMNA 1WCZA 4NZLA 1GPZA 1GMHG 4K1TA 1KXCA 3P95A 3QK1A 1FXYA 2CGAA 1XUKA 2ZO3H 6ESTA 3BTGE 1ZPCA 3U8OH 1AFEH 1SI5H 2VGCC 4ASHA 2Z9IA 2XW9A 3HK6B 3JZ1B 3LU9B 1TE0A 2A2QH 4UFEH 1GBTA 3ZZ5A 5HIYA 1GJDB 3MO6A 1SQAA 1IQHA 1C2EA 1GBKA 3SUDA 2OBQA 3ZVAA 1ZPZA 1C5OH 3SJKA 2KCYA 2RCEA 4XBBA 1LMWB 2G52A 3T5FH 1V2TT 2HRVA 4I33A 3MOCA 4MG3A 1MTVA 1CBWB 4HZHA 8GCHF 1V2QT 4WH6A 1QB1A 2XWAA 3ITIA 4NCYA 3R0FA 3TH2H 4BAHB 1GDQA 1TLDA 1XXFA 4TPYA 4LOYH 1Y3XA 3KF2A 1YLCA 2BZAA 1MKXK 1O2GH 1H8HD 1RD3B 2QF0A 4LZ1H 1QTFA 1SGPE 3FVFB 3TLOA 2O8UA 2R0LA 4I31A 4OS6A 1Y8TA 2HVXA 1GMHF 5AF9H 1SFIA 1KLJH 2ODYB 5DJ7A 1IAUA 1U6QA 3UWJH 5DSFA 1O5GH 5AFZH 4H6TA 2FLBH 1EP6A 1ZLRA 4ISHH 2CK3D 2A45B 2UWLA 4FUHA 4Y0YE 4M7GA 1C5UA 2BXTH 3RXIA 3NXPA 1GI8B 4I32A 4A5TS 1TX8A 1IQJA 2H5CA 1UO6A 1WTGH 1A46H 4TY7A 1L1GA 4WWYA 5EODA 2HALA 1ZHRA 3S9CA 1DITH 1FX0B 1TALA 1UMAH 3E8LA 9LPRA
chains in the Genus database with same CATH topology
1TOMH 1J14A 1P02A 4IGDA 3QTVH 2ZDVH 3RU4E 2VJ1A 2FOHA 1QBVH 1SSXA 1LVYA 1HGTH 1HV7A 1TA2A 1C4Y2 1OYQA 2BYAX 2OBOA 4OS1A 2WYJA 4D9RA 3MNSA 2VIOA 1EZQA 4IMZA 2GMTB 1N1LA 1SPJA 2VIWA 4CRCA 2F9NA 2YOLA 1LVMA 2V3OH 2VWMA 1TMBH 3A7VA 4J1YA 2BD7A 1BZXE 2FI4E 2AIQA 3M5NA 2ZQ2A 1WOFA 2FS9A 3F9HA 1L1JA 1XUGA 1CT0E 5GXPA 3QO6A 1TPPA 3P8FA 1ABJH 2TIOA 1PQ8A 1SGFA 4OS7A 1N6XA 8ESTE 2ZWLH 3B8JA 5C67A 1SGYE 2HLCA 2ESTE 3ATWA 1L0ZA 5A09A 1DE7H 1SBWA 3ATKA 3MFJA 1Z1JA 4YLQH 4X1RU 4AFQA 2RDLA 3BV9B 1GBFA 3F9GA 4CRGA 2ZECA 1C5VA 3F1SB 1JXPA 1K1PA 2BDYA 4QT8C 1V2KT 2CF9H 2V0BA 1UTJA 2C93B 4ZKSU 1EJNA 1D4PB 1ZOMA 4UFDH 2A7JA 1S6HA 5H4IB 2RG3A 2VH0A 1UCYK 2QAAA 4AORA 4X6MA 2WUCA 3T27A 1UTKA 4VGCC 3V0XA 3SBKA 3STIA 1O5CB 3KQEA 3MMGA 4R0IA 1W11U 4ZHMU 4B2AA 1O39A 2A32A 3M7TA 2Y5GA 1GGDB 1TNHA 1YKTA 2VWNA 4NSVA 2ZHDA 2ZCKP 1FY8E 3E3TA 4XFQA 3UNSA 4ZXXH 1HDTH 5HM2A 1FNIA 1GJBB 3GY6A 4BXSA 2GKVE 2HGTH 5B6OA 1K21H 2Z9JA 4X8TH 1Z71A 3PM3A 4K1SA 3KNXA 4WXVA 5T3HA 1HAHH 2XBYA 5J4SA 1O30A 4WF8A 3LKWA 1BOQA 3I29A 2AYWA 3LGVA 4R8TB 5JYIA 2NWNA 1DY9A 1PQAA 1KDQB 1AKSA 1WU1A 1B0FA 2IPHA 3URCA 3RXSA 1T8LA 1MTUA 2AIPA 1EASA 4NGAH 3O8DA 3A7ZA 1C1SA 1HRTH 4ZHAA 5FBIA 4AN7A 3D49H 2WYGA 4ABJA 3E91A 4X8VH 5ESBA 1GHAF 2P95A 3PWBA 3URDA 2DE9A 1EOLA 1FZZA 5F6MA 2VGCB 1QB9A 1S5SA 4O9VA 4Y7BA 3STJA 3BTME 1CGHA 1DPOA 1O2NA 1ZTLA 3AAUA 3RXPA 1HAZB 4AFZA 1HAYB 3P70B 1H8IH 4MPUA 4JYUH 5E2OA 2BLQA 2F9BH 2QCYA 3BTTE 2AMDA 4YTAA 5JB8S 2O9QA 2P16A 3SU6A 1S85A 1C1QA 1TPAE 3ZZCA 1NFUA 1ACBE 1O5AB 1FJSA 2GCTC 3EA8A 1C4V2 2FZZA 3O8CA 1W0ZU 4HI3A 4GHQA 3VXFH 1NM6A 4YESB 2CF8H 5GDSH 2TGAA 1JOUB 2BX4A 1GJ7B 2D8WA 4MVNA 1PJPA 4D9QA 2BD9A 2ZU3A 1QCPA 1GJ9B 2FX6A 1C9PA 3MH6A 4IS5A 3W95A 3CP7A 1EPTA 1AD8H 1PPZA 1C2IA 5A8XA 1MH0A 4BAQB 1SG8B 1HAOH 1NO9H 4AZ2B 2HPQH 3A7WA 1A5HA 2UUKB 2PKSC 3HKIB 2Z3EA 2QXIA 1H4WA 1V2WT 2W5EA 1P0SH 4RSPA 2A1DB 3UWIA 1ELEE 3SORA 7KMEH 2NU3E 1O38A 5I46H 2WPKS 2F9OA 5DPAA 4NIWA 3A88A 2A31A 1LHEH 1SFQB 4MNWA 1QRXA 1HBTH 1A5GH 3SV9A 1FPHH 2YNAA 1TOCB 2F3CE 5LH8A 1MTNC 2BY6X 1JIMA 3U9AH 4FXGH 3M3TA 4Q7YA 1C1UH 3A7TA 2Z3CA 3Q3YA 2FYRA 2GZ7A 1DXPA 1GBMA 1SQTA 1K1MA 2Z7FE 1IQNA 3ZZBA 1G37A 4NA9H 1DWDH 1C2FA 2AMPA 3SQHE 4HFPB 2XBWA 3GDSA 2ZTZA 1EJAA 1TQ0B 1O2WA 4Q7ZA 1QL9A 1H9HE 1MAXA 2J4IA 2QC2A 1SR5C 1J9CH 1A0LA 3MO3A 1FN6A 1HAVA 1EPTC 3ELAH 4NFEA 1IHTH 1CVWH 1TBRH 5K7RA 2ZKSA 1TRYA 4AYYB 2GCHF 5EQRA 2HOBA 1DSUA 3NK8A 2BQ7B 1EX3A 5IDKA 5A8ZA 1GCTC 3BIVH 5HXFA 2R2WU 1Y5BT 4AX9H 1DT2A 1W13U 1HAGE 1C5SA 4FUGA 4GVUA 3TITA 5JDUB 2QF3A 2OP9A 2SGPE 4NWLA 5C3NA 2PR3A 1SGCA 2FYQA 1L4DA 1LHFH 1C4U2 1OWEA 1AFQC 1UVSH 1E38B 1PPEE 4ISIH 4RKJB 4VGCB 3PROA 3SNDA 1EJMA 1HUTH 4BXWA 3LOXA 4JYTA 1BITA 1W10U 1AE8H 2GX4A 1C5RA 1ZHPA 1YPKH 2ZCLP 3T2NA 3HK3B 3ZVFA 1HXFH 3FP8E 1EQ9A 2FP7B 1XKBC 1TNIA 2H9HA 1ZRKA 3OU0A 1P3CA 1HJAC 2QGRA 5JB9S 3ZV9A 1OWHA 3V7TA 1MQ5A 4K3JA 2BX3A 3MU5A 1VCQA 1TFXA 3JZ2B 1GI2A 2J9NA 1O3JA 4K69A 2W7SA 4H42U 1C5MD 5SGAE 1QQUA 1V2LT 3QUMP 1TYNA 5A8YA 3SUGA 5J4QA 1EAWA 2VIDA 2BLOA 5DP3A 3SW2B 5DP7A 3TK6A 1TGSZ 1C1VH 1O3HA 3GYLB 1NRSH 1WUNH 2OINA 1BHXF 1SLWB 1NROH 1C1WH 5DP4A 5C1XA 3EYDA 4IW4E 3UR6A 4MNXA 3SUEA 1GG6C 1JIRA 4U30A 1SC8U 4B75A 2OC8A 4MDSA 1LQDB 3BEUA 1MBMA 1UHBB 1EAUA 4A6LA 1RGQA 3ZZ9A 1XUHA 1IQGA 1QQ4A 1O2UA 2PKAA 2LNCA 1GJCB 1C5LH 2FIRH 1KTTB 1NRPH 1QRZA 3RP2A 2FM2A 3RXUA 2V6NA 1FUJA 1W7XH 1YPMH 1L1NA 2PSYA 4LXBH 1MD7A 2BTCE 2BM2A 4A1TA 1YPJH 3QZRA 1GI3A 5G4BA 5C2ZA 5FX5A 4NIXA 3SHCH 1HNEE 4A1VA 1G32B 5EU8A 3UPEA 5EXMA 3TGJE 2GZ8A 2ZF0H 1BUIA 2GCTB 4X1SU 1J15A 1YPLH 3Q3XA 3RXTA 5FPSA 2VWLA 1UTPA 3BTEE 4B2BA 2BLWA 3GCHC 4NSYA 1OP2A 1O5DH 2XNIA 3KGPA 3MU8A 5FCRA 5FPYA 4DY7B 4IN1A 2OLGA 4YOJA 2ZFTA 2THFB 4JK5A 3HATH 2R3YA 1Y3VA 1AKSB 2P59A 3RXCA 1XVMA 4O03A 3RXVA 1EZSC 1DANH 2FI5E 1MQ6A 2BDGA 2UUFB 4JZEH 3EQ0H 2PKSB 2ZPRA 3CENA 1DLEA 2BDCA 3CS7A 4UD9H 5LGOA 1H9LB 1P2NA 4IBLH 1IQFA 1O2QA 3SV8A 1GJ8B 1O3FA 1OOKB 3EA9A 1TNLA 3A85A 2SGDE 4MPWA 1O3NA 3LGTA 4JZ1A 5E0JA 1C2DA 3BEFB 2GV6A 1FY3A 4BTUB 2PLXA 5K0HA 4X0WU 2DE8A 1UTQA 5EPYA 1V2OT 4A1XA 1GHWH 3LGYA 2FMJA 4CR9A 1BDAA 4ISNA 3UUZA 3RXOA 3UOPA 4WMDA 1DLKB 3T26A 3RM2H 3C1KA 1KLIH 3TNSA 1S81A 1ZGVA 5F03A 3OY5U 4KGAA 4UE7H 1QA0A 2BQ6B 3GY5A 1OWKA 2WPIS 3DUXH 4NA7A 2NU4E 3Q00A 1WBGB 2WV4A 2ZI2H 1O2RA 4ZHLU 3P8GA 5AHGH 3SU1A 1C5WB 3S7HB 1QL8A 2BY7X 1DWEH 1EPTB 1BMAA 4YOGA 5JBCS 1P8VC 2UWOA 1FDPA 2ZU4A 1IQEA 1ELBA 1ELVA 1S84A 1DX5M 1WQSA 4FVBA 1TPSA 3RXDA 2STBE 2A7CA 3GY2A 3K9XB 3UOUA 4Y10E 4XBCA 1GCTB 2GT8A 1DWCH 1CO7E 1TQ7B 5EG4A 2JETC 3DA9B 3EDXB 2Q6GA 1IOEA 2FOEA 1ELDE 3SHAH 2ZTXA 5L2YH 1G3DA 1Q31A 4ISLA 4CRAA 1AFQB 2VINA 2CMYA 5DP5A 4X8UH 1AU8A 2WPHS 1AB9C 3PB1E 4MNYA 3Q76A 1VITG 3LONA 1KXEA 4DJZB 4CBNA 2XBXA 4I8GA 4JMYA 1BBRH 4CHAC 1L2EA 1O2MA 2GD4B 2ZDNA 3HKJB 3QX5H 4DIIH 1BB0B 1O3MA 1O0DH 1C1RA 2C8WB 2ZPSA 2GVFA 4UFGH 6GCHG 2XCNA 1Z6EA 1FIWA 2QXJA 3OTJE 1O2IA 1TBQH 5A2MH 3U1IB 5BRRE 4AB9A 3U1JB 1IQMA 2HNTF 3SJ9A 1HJAB 2RA3A 3SV7A 3Q77A 2XC0A 1CGJE 1DOJA 1YM0A 2O8LA 2Y5HA 4E7RG 4YT7H 2JH5D 1QIXB 1HAVB 1RTLA 1UTNA 5L2ZH 1ZHMA 3KQBA 2SNVA 1WYKA 3UREA 1CGIE 2Z3DA 2QY0B 1CT4E 1O2XA 2EC9H 2ZU5A 3SU2A 1P2OA 2FWWA 3SZNA 3HPTB 1Z8IB 1QBOA 4K5ZA 2O8MA 1BBRE 1OYTH 1UVPA 1XX9A 4U32A 1C5QA 4X8SH 2OC7A 3BTHE 1W2KH 1GG6B 1D3QB 4BAMB 1VITF 4ABBA 1A4WH 1GBCA 4ZAEA 3U8TH 2Z9KA 4MPXA 1GCDA 6GCHF 2M5TA 4OS5A 3BTFE 1PQ5A 3UNQA 1O3AA 4HTCH 3RMNH 3GCNA 3AW0A 1TAWA 3V13A 4RKOB 2WPJS 1GMCG 1DM4B 4FU9A 2BY9X 1ELTA 2ZFSA 2WPMS 1P2KA 1HFDA 1K9OE 1Q2WA 1GMDG 4Y8XA 2TRMA 1GBBA 4DT7B 3M7QA 1AVWA 2RA0A 1KXAA 3GY3A 1A1RA 3PMJA 5A0CA 1AQ7A 3GCHB 2TBSA 1TMTH 2HWLB 1AMHA 3IITA 4FUDA 4X2YA 5C1YA 1K1NA 1CA8B 5CHAC 1LVBA 1YCPH 4B76A 2A0QB 4KP0A 2Y6TA 3QWCH 1G3EA 4Y8ZA 2BD5A 3AAVA 4J2YB 1SOTA 1INCA 2QIQA 3B23B 4X1PU 2BXUH 3BN9A 5JPMH 1BRAA 3A81A 4X6PA 1C2LA 3KL6A 3M3SA 3NUMA 3UY9A 4YOIA 2TGDA 1SHYA 3KCGH 4Y79A 2EA3A 1THSH 1OXGA 2AGEX 4WMFA 1C5NH 1N8OC 1LHDH 2EI6A 3S0NA 2J92A 1UTOA 4CR5A 5GWZA 2UUYA 1AVGH 1EAXA 1ELGA 2PKAB 2BDHA 1PPBH 1GMDF 1EKBB 1UTLM 2BVXH 1QY6A 1TNKA 1LPZB 2Y80A 1DS2E 1WSSH 4Y76A 3UQOA 1YCPK 2DUCA 2ZU1A 1C2JA 4D76A 1E36B 4THNH 1C5PA 1SQOA 1CU1A 2ILNA 3MU0A 2BD3A 1C1NA 2J2UA 3VB6A 4NIYA 2Y81A 1O2YA 3TJOA 5E0GA 1ELCA 2GGVB 3PLBA 1KXFA 1QB6A 3D23A 2P3TB 3RLWH 4IMQA 3P8OA 1MCTA 1P11E 2ZQ1A 3ZZ4A 1NU7B 3SNEA 3IG6B 8LPRA 1AIXH 2B7DH 4UEHH 2TGPZ 1ZJKA 3BTKE 2PWXA 5GPIB 5BPEA 5T6DA 2ZHEH 1B0EA 2J38A 2ZA5A 2A2XH 4Y0ZE 4K2YA 4INLA 1AWHB 3BSQA 3P6ZB 3U8RH 1HIAB 2NU1E 4SGBE 3LJOA 3ZZAA 1O3KA 1IQLA 4HGCA 3S9AA 1MZAA 4BNRA 4ABEA 3MH7A 3QLPH 1NZQH 3F68H 4FUBA 4JZFH 1P2MA 2FS8A 2AERH 3LH3A 2BDIA 2BMGB 4E05H 1VCWA 1GI0A 1C1PA 2GZ9A 1FN8A 1O35A 2PUXB 1O37A 1FY5A 2BD2A 5GIBA 1OPHB 1O2VA 3RLYH 5LPRA 4CHAB 3S7KB 2QV1A 1TONA 3LGWA 3BTQE 4CRDA 1ZRBA 2I6QA 3MO9A 4FU7A 3LIWA 2AMQA 2OCVB 3VFEA 1GVKB 1HJ9A 1MKWH 3K65B 2P93A 5CMXH 2ALPA 1TGTA 1VGCC 2JH0D 3AVZA 1NY22 3SV6A 2IN2A 1KTSB 4IC6A 4TPIZ 5GCHG 1NTPA 3MU4A 2QA9E 2A5AA 1GJ4H 2OTVA 4ABIA 4YM9A 4E06H 4JK6A 1BMNH 2F9VA 4X2VA 1W7GH 1SLVB 1MU6B 4WY3A 1V2PT 2ZP0H 4NG9H 1CHOG 5TCAA 5PTPA 3QN7A 1M9UA 2Y7XA 1GJ5H 3ESTA 3LT3A 4Q80A 2HPPH 1V2MT 2STAE 2ZCHP 2YNBA 3SGAE 2F9PA 3GCTG 3LH1A 3M37A 3TK5A 2CJIA 1K28D 2XRCA 3SU4A 2VNTA 5JBTA 1KY9A 1RFNA 2BDBA 2G51A 2VIPA 1KXDA 5C5NA 1ZTKA 2XTTB 1LO6A 1A0JA 2FXRA 5EXNA 3QTOH 4GCHG 1BJVA 1C1OA 1OP8A 4CREA 1AO5A 4DGJA 1K1JA 4FUCA 3BG8A 4B71A 4AGKA 4Y6DA 1XMNB 1JRTA 2ANYA 1YPGH 1RIWC 5DKMA 1Z8GA 4NWKA 6CHAC 3E0PB 2W7UA 5E0HA 4INKA 4MLFB 1Y3UA 2SGQE 3KQCA 4A92A 1CHGA 4O3TA 1BA8B 1BTYA 1CHOF 1F5LA 4ZMAH 1QA7A 1BMMH 1ZMJA 3SI4H 1HJ8A 3SNBA 1ANDA 2BB4A 4WJG2 3NZIA 1WQVH 1P2QA 3OX7U 1PYTC 2GTBA 3ZVDA 3I77A 1KXBA 1SHHB 2C8XB 5CHAB 1W14U 2I6SA 2OC1A 2XWBI 2FTMA 1P2IA 3D65E 4TYDA 1G9IE 2PV9B 4UDWH 1O34A 4OS2A 1RRKA 4FVDA 5F8ZA 4ABDA 4ESTE 1XXDA 3F9EA 4WMEA 2CN0H 1ID5H 3LJJA 3VXEH 1UK3A 1CT2E 3K2UA 4GCHF 1OKXA