2SNVA

The refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
151
structure length
151
Chain Sequence
RLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS COAT PROTEIN
publication title Refined structure of Sindbis virus core protein and comparison with other chymotrypsin-like serine proteinase structures.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 27
structure length 151
sequence length 151
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1992-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2snvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2snvA01
1MTWA 2FLRH 1O3LA 3A8DA 5AFZH 1KIGH 1AVGH 4IS5A 1NO9H 2PSXA 1HXFH 3TITA 1ZR0A 3A8CA 2PKSB 1P09A 1ABIH 4YTAA 1SVPA 2B7DH 1MZDA 1IQEA 2WPKS 1H1BA 4KTCA 3TK5A 5H4IB 1DSTA 1WYKA 2ZGHA 2H1UA 4F49A 2P3UB 2HWLB 3PLKA 1DWDH 2VWLA 1ZJKA 1V2PT 1T31A 2PKSC 3HK6B 3BEIB 1F5RA 3SI4H 1ETTH 1O2LA 3NXPA 1JRTA 1A1RA 5EW2H 3DT0H 3ODFA 2DE8A 1EX3A 3SV2H 4Q7XA 2CXVA 3MH5A 1E0FD 1FPCH 1F5KU 1AFQB 2GDEH 1C5NH 3P6ZB 2BQ7B 2VIQA 1MZAA 2IN2A 2STAE 1TFXA 3RU4T 3Q3YA 3TIUA 1O3FA 2ZHFH 3F9GA 4WMDA 3M5LA 4DVAU 1DXWA 1UJ1A 3RXIA 1AFQC 2GTBA 3RXDA 3LGTA 1HYLA 4BAQB 1TNKA 1Z1IA 3GY4A 1GGDC 1GMDF 2SFAA 3GY3A 2ZFSA 1KYNA 1D6WA 1GJ6A 2J95A 4FUFA 2G5NA 3MOCA 2P94A 3IG6B 1DWEH 1DITH 1DX5M 1H8IH 4JZEH 1S81A 3HGPA 3RXCA 3ZV8A 3QGNB 3U1JB 1ZZZA 2WYJA 3ZZCA 3TK6A 3QZQA 2UWOA 2FOEA 3LJOA 1VJ9U 3SQEE 3TGIE 2ZHEH 1AWHB 2EI6A 5FCKA 1VITG 1O2YA 5HXFA 1RFNA 3RLWH 2QXHA 2ZC9H 1CHGA 2Y80A 4IBLH 1BIOA 4Y6DA 2VH6A 1JXPA 4YOGA 3SU0A 3RXTA 1QA0A 3H7TA 3K65B 1HPGA 5A09A 1O3EA 3MNSA 4Y7BA 3SW2B 2H6MA 1UK3A 4U2WA 1Y3UA 1THSH 3E0PB 4U01A 4D9QA 3GCNA 3MH6A 3SZNA 2BY9X 4Y8ZA 7KMEH 2H9HA 4LK4A 1O0DH 1K1JA 1LHDH 3FFGA 1GL0E 2HLCA 3ZYEA 1AIXH 1QB6A 3SV9A 4E7NA 4TWWA 3QTOH 1Z8JB 1GCDA 2BLOA 1TGNA 3HPTB 1TALA 1LQDB 2C4FH 1GDUA 1C4Y2 1OP0A 1ZHMA 4U32A 3U8TH 4X6MA 2Z3DA 2FM2A 2AMPA 2GZ9A 3RU4E 2NU1E 1C1NA 1WQSA 3TJVA 1TGBA 4A5TS 1FAXA 1K1IA 3RXSA 3PTNA 1V2ST 5AHGH 1DDJA 1QQ4A 2PKAA 1HAHH 1TONA 2W7UA 2ZFRH 4CRCA 2A2XH 4NZLA 2EEKA 5G4BA 1LHCH 3S9BA 4NSYA 2Z94A 4BAOB 1JWTA 4FVBA 1HV7A 1HNEE 1UHBB 3PB1E 1SGFG 3RC4A 1TOCB 4X8SH 1SQOA 1IAUA 1EKBB 2A0QB 1YPHC 2Y7ZA 3QZRA 4Y79A 4ASHA 1HCGA 5E2PA 5EU8A 3GDVA 3HATH 3LC3A 1D4PB 3VEQB 2FDAA 4QT8C 5DJ7A 4Q2KA 1MBMA 3BV9B 5JBTA 3P8NA 4R8TB 4WH6A 3AAVA 1P57B 3PTBA 2VIVA 2H9TH 2P3TB 2RCEA 4BANB 2PW8H 5DP9A 5JYIA 1AE5A 1V3XA 3A7YA 1MCTA 1VITH 3BTQE 5F8ZA 2GT7A 2FWWA 5EPNA 1VCWA 5C2ZA 3GCOA 2J94A 5K7RA 1B7XB 4GUXA 1HJ8A 1YGCH 1SLVB 5EW1H 1AMHA 4X1QU 1C2EA 5FX6A 2OC8A 1BJUA 2ZDLA 5HMAA 4BXWA 2J2UA 3SNBA 4XBDA 4WXVA 1L4ZA 4YO9A 3BEUA 1EP6A 2Z9KA 1GI1A 1MBQA 2SGPE 3ZZDA 4UEHH 1TNJA 2ZDMA 1O3NA 1EZQA 4O3UA 5HYOA 1MKWH 3EA8A 3C27B 2OBQA 3LONA 1P2JA 2M5TA 1SGYE 1O5BB 1HAPH 4RKOB 3ITIA 4SGBE 1GBBA 3RUOA 3AW0A 1FY4A 3BTTE 2SGDE 1SR5C 1O39A 3V0XA 2OQUA 3SUEA 3LGIA 1C5LH 1GBIA 4X1RU 2GMTB 1RS0A 2BTCE 5SGAE 2BD9A 1OSSA 1JIRA 1Y5UT 2FO9A 3IWMA 3SI3H 3UOPA 4AFUA 2BY8X 3TPIZ 1MU8B 1Y3WA 3SGBE 3FP8E 1GBTA 2AEIH 3GDSA 2UWLA 3TNTA 4ABFA 1UCYK 3RLYH 4E7RG 2GMTC 2WV4A 3DD2H 3E16B 4X8UH 1C1WH 4OS4A 1LPZB 2HRVA 1MAYA 3RMOH 2ZF0H 1ZGVA 3RXRA 2FIRH 1MTVA 1BRCE 2XNIA 5FBIA 3ZZAA 2V3HH 1QB1A 2WYGA 3LGYA 2BQWB 1Y8TA 1BUIA 1GBCA 4B76A 1F0RA 1CHOG 1KSNA 2WPLS 5DG6A 1QJ6B 1G2MA 3LT3A 2ZNKH 1BOQA 5EQRA 1C2JA 1EZUC 3S7HB 1ZRBA 3PO1B 3M3SA 1TRNA 2FOMB 3ZZ7A 4WJG2 1KXCA 2THFB 5AVDA 3P17H 1V6DA 1YLDA 1QTFA 1BJVA 3A7TA 1T7CA 2BLQA 2VJ1A 4FU7A 4XOJA 2GKVE 1A3BH 3GY2A 3ESTA 2O8LA 1S85A 1ORFA 1ABJH 1GJAB 3IITA 3PO1C 1SBWA 1HAGE 3MFJA 1GBEA 1W2KH 2BDYA 4JZDH 5E2OA 1J17T 1B0EA 3NWUA 4I31A 1O34A 4KTSA 4E06H 2GV6A 1YPKH 1MUEB 8KME2 5K0HA 5GPIB 4MG3A 4MVNA 1DANH 2PV9B 4ISHH 3MNCA 2P59A 1G36A 2Q6DA 2P16A 4CH8B 5TCAA 2VIDA 1P10A 2GP9B 3K9XB 2O8TA 1EJAA 3VB5A 1EOJA 4RN6A 5J4SA 1A5HA 4OS7A 4B2CA 3BIUH 1QBVH 7LPRA 2A7CA 3LGUA 3SU6A 3RXBA 3A8AA 3PLPA 1HB0B 5EXLA 1LKAA 3SNDA 1OXGA 3KQBA 3A85A 3V3MA 2NU2E 1O3OA 3VB7A 4A7IB 1GHAF 4R0IA 1O37A 5GWZA 1ZYOA 3VB6A 1GBDA 1L0ZA 1P03A 1SLWB 1P05A 3Q3XA 1V2OT 1TYNA 5A8XA 2OUAA 3S9AA 7GCHG 2SGAA 5C1YA 2XWBI 1V2WT 3M7QA 1T8NA 1QCPA 5C1UA 1KTSB 1NS3A 3CP7A 4K8BA 1TA6A 2G51A 1Y59T 2F3CE 5EGMA 5JDUB 3LH3A 4XFQA 3F6UH 1PFXC 1TNHA 2GCHG 3TJUA 3GYMA 1YPGH 1UCYE 1T8LA 2FI4E 5DK1A 2P8OB 5B6OA 3LGVA 1HFDA 1S0QA 1SLXB 2G55A 4UE7H 1GBJA 2ZZUH 4FU9A 3KQCA 1BRBE 1KXAA 3UNSA 2AH4X 3CS0A 1PQ8A 2ZFTA 1JMOH 2ZGJA 5PTPA 3W94A 2BOHB 2P8OC 5EXNA 1ZMNA 2VWMA 3NUMA 2FI3E 1BA8B 1D3TB 4XSKU 3VXEH 1E37B 1C5YB 1G3BA 2SGQE 4ZXXH 4GHTA 2XYAA 1EAWA 3U9AH 1TGCA 4Y71A 4DGJA 2BDHA 1FONA 3SJKA 1TQ0B 2ZTYA 2VVUA 1FY3A 2FXRA 2HPQH 3FANA 3VXFH 5GXPA 3UQOA 4D8NA 1PPFE 3UUZA 3MO9A 3UNRA 1DLEA 2ODYB 3SN8A 5DKMA 1OWJA 3RXAA 5C1XA 3NZIA 1UVTH 1FUJA 2D26C 1BCUH 2Z7FE 3B8JA 3B9FH 2VH0A 4NA7A 1OS8A 1GI3A 4D76A 3GICB 3ZYDA 1E38B 2AYWA 3T26A 3BTFE 4ABDA 4BAMB 3D49H 1CT0E 2YNAA 4K1SA 3BTEE 2AMQA 2ZEBA 1BZXE 2FOCA 2ANMH 1UTOA 1C4V2 1PYTD 1NFUA 1BTUA 4GSOA 1D9IA 1C5QA 2ZCLP 4O03A 1GI5A 1HXEH 1EJMA 4BTIB 1VGCB 1HAOH 2FOFA 3D65E 1MTNB 1S6HA 2NU3E 4BOHA 1O2RA 5EQSA 3S69A 1TX6A 1WV7H 1OYTH 1VCPA 3AAUA 1LKBA 1XVMA 3RC6A 1LHEH 1XUHA 2ZFQH 1INCA 1VGCC 2ZTXA 4GLYA 1MTNC 2OLGA 1CGIE 3HKJB 5A0BA 2Z3CA 1GJ7B 1NZQH 1W10U 1Z8GA 1TA2A 1BTXA 4MNYA 2J4IA 1SGFA 1V2MT 1P04A 1C5MD 4Y0ZE 4ZMAH 1WAYB 3RXUA 3KF2A 1AKSB 1DFPA 5FBEA 4ESTE 2XCFA 5C3NA 1DXPA 1M9UA 1EAIA 1EAXA 3EAJA 1NU7B 3L3TA 5CHAB 1WTGH 1A7SA 1H8DH 1S6FA 2ULLA 1Z8IB 4JZFH 2FI5E 4HI3A 1QURH 3DFLA 3F9EA 1NC6A 1PPEE 4YLUA 1IOEA 1EOLA 5CHAC 2HNTE 1BT7A 1P0SH 1TPOA 2F91A 2O8UA 1EXFA 1BHXF 1FI8A 1C2DA 1VITF 3R0FA 5CE1A 2ZHWH 2PWXA 3TJOA 1Z1JA 1QB9A 4ABAA 2ZGXH 3OY5U 2Y82A 4NG9H 2O9QA 3EQ0H 1IQLA 1V2JT 4FUJA 3NPSA 2RG3A 6GCHF 4M7GA 2XWAA 1ZPCA 1NRRH 3GDUA 1V2VT 2GDDA 4WXIA 1RXPA 1DY8A 1C1RA 1O2VA 3BEFB 4ABBA 3PV4A 5T6DA 3I77A 1C2FA 1L1GA 2A1DB 2VIPA 1RIWB 4ABGA 2QY0B 3ATLA 3A82A 1FXYA 3AVZA 3MWIU 2BZAA 1HJAB 3BF6H 2ZU1A 4I33A 1EP5A 2A7JA 1GGDB 3T62A 4AORA 5C5OA 3QX5H 1C5OH 1ZRKA 3MO6A 1RIWC 1P9SA 4I8KA 4MNVA 4NFFA 4NWLA 4RSPA 1C2IA 4IC6A 3M3TA 3MH7A 3O8RA 2Z6BD 3E91A 2AFQB 2PUQH 1O3CA 3PWBA 3TK9A 2AGGX 1B0FA 1DICA 1HJAC 1KLJH 1AVXA 1LVOA 1A0HB 2PGQB 4X8TH 2R0LA 1AUTC 5JPMH 5JBAS 3K2UA 1CSOE 2ALVA 3OX7U 1TWXB 5F8TA 1L4DA 1FN8A 2H2ZA 1V2LT 2BOKA 5JB8S 3TJNA 1XKAC 3SU3A 4XE4A 1O33A 4YOIA 2G5VA 3ZVEA 1GI4A 4TWYA 4YT7H 1LVBA 6CHAB 2ZU2A 4BXSA 5F03A 1ELTA 1P11E 1CA8B 2FOBA 2TGAA 1DS2E 2TPIZ 2QF0A 2EI7A 1W0ZU 3A8BA 3QDZB 1A46H 1GWAA 1CQQA 1FZZA 1G2LA 3H5CB 1GBHA 2CGAA 1SGQE 1O2GH 6GCHG 5C67A 6CHAC 3ZVDA 2H9EH 1G32B 2B0FA 2STBE 4ZAEA 4X0WU 1MTSA 1TBZH 4AFQA 4D7GA 1THPB 1C5WB 3ZVCA 1ZGIA 1UVSH 1C1TA 3DUXH 1P2IA 1ZMLA 1YPMH 4INHA 3TH3H 2C8XB 1UTKA 4X1NU 3QGJA 5C20A 5F6MA 2ZDKA 1UVPA 3MU0A 1CGHA 2QXJA 1AKSA 1RTKA 1GHXH 2ZQ2A 3B23B 3SJIA 2JH0D 1GHVH 4JYTA 5GDSH 1GBLA 1NPMA 1W3CA 4OS2A 2FTLE 1ESAA 1TGTA 3LJJA 1HAVB 1T4UH 1Y5AT 5E0GA 5EXMA 4WH8A 3TU7H 1LO6A 4ZROA 3W95A 4WMEA 5IYTA 1AU8A 5I25A 5JB9S 1LPGB 1C1UH 1PPZA 1C1SA 3SV6A 4NSVA 1O2JA 3E90B 3ZVGA 1LCYA 2IOTA 1OOKB 2FZZA 3F1SB 1CVWH 4AG2A 5E8EH 4PROA 2C8WB 2XC4A 4YESB 4CREA 1AB9B 2OC0A 1QHRB 1UTQA 1SGNE 2GD4B 3P8OA 1DPOA 1NTPA 3HK3B 4B2BA 3VGCC 4ISIH 5T3HA 2ANYA 4ISLA 5LH8A 1TAWA 1GMHG 1W13U 2Z9JA 4IN2A 4I8JA 1AB9C 5TJXA 3RXOA 3G01A 2H5DA 1UK2A 1BMNH 1FN6A 1O3HA 2PSYA 2HPPH 2Y5GA 1QY6A 4WF8A 1JIMA 1H9IE 3PMJA 1YM0A 1GDNA 4AYYB 3BTDE 1HUTH 3OU0A 2JETC 1KXDA 3SHCH 1P2QA 1GPZA 1CBWB 3RMMH 4FUBA 4I8LA 4DIHH 1C5SA 1GJ9B 5DP5A 2Z9GA 2GVFA 3M35A 3QO6A 2Z9IA 3TGJE 1Z8RA 2XTTB 2K1QA 3T29A 1CBWC 1GI6A 4INLA 1ELFA 4MLFB 1H9LB 1J14A 3SGAE 3JZ1B 1DSUA 4ABIA 3URDA 1S84A 4FXGH 1CHOF 4HZHA 1ZLRA 2F9PA 1WU1A 2UUJB 2W7SA 1PQAA 4I32A 4TYDA 3PM3A 1P06A 2FTMA 4NIVA 2KAIB 4BAKB 1ANBA 4UONA 1Q3XA 1O2PA 2FOGA 2SGEE 1O2QA 1LPKB 3M7TA 1KXBA 4UFFH 5EODA 4ZKSU 3VPKA 1PQ5A 1GI7B 2ASUB 4B73A 1ZTJA 4Y76A 1AN1E 1QJ1B 3KGPA 5FPTA 1GCTB 2A4GA 1NFXA 1ESTA 1HLTH 1ETRH 1YCPK 3MYWA 1L2EA 4DIIH 4B71A 1FY5A 1NRQH 3UPEA 2BD8A 1P8VC 1MH0A 2G4TA 2AMDA 1ZTKA 1GCTC 1EZSC 3AW1A 1YPEH 3LIWA 3KL6A 3QK1A 1XKBC 1HAZB 1RGQA 2TGTA 1AWFH 1GG6B 1W7GH 4K2YA 2F9UA 1TB6H 2YOLA 1N1LA 1SQTA 1UK4A 3UR6A 4ZHLU 1WBGB 1DT2A 2A5IA 4TY6A 3QWCH 2BZ6H 2ILNA 4WWYA 1BHXB 3DHKH 5IDKA 1Z71A 4BAHB 1ELAA 1KXFA 4MNXA 2WINI 1WSSH 3MHWU 4MPWA 4ZKNU 3I29A 3O8CA 1GG6C 5A2MH 1PPBH 4HTCH 3M3VA 4SGAE 4U30A 3RXMA 1TQ7B 4IC5A 1ZPBA 1C9PA 4ZUHA 4CRGA 1LHFH 1D6RA 4OGYA 1YPJH 5A8ZA 1HAVA 5L2YH 3UFAA 1AFEH 1SGDE 1O2ZA 3U1IB 2A5AA 1C1VH 4O3TA 1L1JA 2PLXA 2OQ5A 1XMNB 1O2SA 2CN0H 2QA9E 2VNTA 2ZCKP 1AHTH 2UUYA 1F0TA 7GCHF 4FU8A 2B9LA 1DLKB 4JK5A 5FX5A 2FOHA 2FOAA 3M61U 4HFPB 1SOTA 4O97A 5ESTE 1EASA 1SFIA 1FDPA 4CH2B 1IQIA 2W26A 2ZU3A 1FAKH 1TRYA 1OP8A 4MPXA 4ZHAA 3ZZ4A 2W3IA 2ZHDA 2CMYA 1Q2WA 2RA3A 2NWNA 5LPFA 1AD8H 1LDTT 1UHBA 2GX4A 1QFKH 2GCHF 4JZ1A 1XUGA 2YNBA 1DM4B 1QL7A 8ESTE 2BVRH 3PROA 1P2OA 1YKTA 2FX6A 1UVOA 1TBRH 2F83A 2C8YB 1GHBF 1G9IE 1DY9A 2WPJS 1CA0B 1SB1H 4CRFA 4NIXA 1C1PA 3U8OH 3DA9B 2BVSH 1O2MA 1VZQH 2ANKH 3MO3A 1ZSJA 4Y7AA 1SHYA 3UIRA 1VCQA 2ZDNA 4Q80A 2CJIA 1AO5A 4UDWH 3P95A 1CA0C 1O2WA 3LGWA 3D62A 4FVDA 1HAYB 4MPVA 1QIXB 2TRMA 2VGCC 3CS7A 4OGXA 2BDBA 4AX9H 2Q6FA 1UTMA 4D7FA 1FQ3A 2KAIA 1O2OA 2CF8H 3P8GA 1P2NA 2PHBA 2ZPQA 1E36B 4KTUA 3A83A 2QXGA 1F7ZA 1Y3YA 1QGFA 2QV1A 3RXQA 2J34A 1PQ7A 1O2NA 2BY6X 4KP0A 1XXDA 4AOQA 2QAAA 3TH2H 5JBCS 1O5GH 2AGEX 2P3FH 1O5FH 2P93A 3OYPA 2SNWA 3EGKH 2BM2A 3RXPA 3M36A 1IQFA 4Q7ZA 2XC5A 2W5EA 1F0UA 1FLEE 1XXFA 4X8VH 5DGJA 1MKXH 3BTHE 1QRZA 1MU6B 1O5EH 1F5LA 2DE9A 1W11U 1GHBG 3RXJA 2ZU4A 3SORA 2ZCHP 3UTUH 1GBAA 4MDSA 1AY6H 3DFJA 3I78A 4OS6A 4X6NA 4UD9H 1PJPA 4BNRA 1AUJA 2Q6GA 1GVZA 1QL9A 3KEEA 2FLBH 4GAWA 4WY3A 3RXLA 2FMJA 4VGCB 5T6FA 1TE0A 1UTJA 3PLBA 4A92A 1GJDB 3KCGH 1ZJDA 1XVOA 1YBWA 6ESTA 3SU2A 4LZ1H 5HGGA 2PTNA 3F9FA 1EB1H 1GL1A 1WUNH 3GY7A 3RC5A 2DUCA 3MNXA 1AZ8A 2ESTE 4GHQA 4VGCC 5LGOA 1BTYA 3MMGA 1D3PB 3RMLH 3A81A 3M5NA 3F68H 2EA3A 4NFEA 3NCLA 4BTTB 3LOXA 1O32A 2ZQ1A 2A31A 4IMZA 1EZXC 3GISB 2HNTC 5EQQA 1OPHB 1CE5A 1DVAH 4IMQA 2IJOB 1ZHRA 3O8DA 3SHAH 4NWKA 3ATKA 1RJXB 1TOMH 4JK6A 3UWIA 4Q7YA 1JOUB 5J4QA 4NIYA 3SGQE 4NGAH 3SNEA 3RXGA 1QNJA 4K5ZA 4DY7B 2QN5T 4GCHG 2ZO3H 1PPGE 4TPYA 4X2YA 1SQAA 3BTME 4DW2U 2VIOA 1FIZA 1YPLH 3ENSB 1TNLA 1BMMH 3GCHC 2P95A 3T5FH 2ZTZA 1GBMA 1SPJA 1LHGH 3MI4A 3SU5A 1NU9A 4MTBA 3P92A 3A87A 2F9NA 2BDGA 2A2QH 3KNXA 4OS1A 2QYIA 3ZV9A 4A1TA 1NESE 1SL3A 3STJA 3FVFB 5LPRA 2BDAA 5HM2A 4YLQH 3U98H 1SI5H 2GV7A 1ANEA 4JYVH 1QR3E 3M7UA 2G52A 1C2LA 1TNGA 4K1EA 2WPIS 1C9TA 1HRTH 1TABE 1GMCF 2TGDA 2B8OH 9LPRA 2PGBB 2ZPSA 3KHVA 2BQ6B 4FUIA 1FPHH 2H5CA 4BTUB 3EDXB 1TMBH 2W3KA 1BBRK 3BSQA 1W0YH 3H7OA 1IQHA 2FODA 1MD8A 2RA0A 3A7XA 3GOVB 3MTYA 1Q31A 3RXFA 6LPRA 1JBUH 5T6GA 2FX4A 3RM0H 4YT6H 3S9CA 4AN7A 1D3DB 2EI8A 3STIA 2XC0A 2ZIQH 1QBNA 2BVXH 5DP7A 1BQYA 1ZSKA 3ZZ9A 4K8YA 1C5XB 3ZZ6A 1IQNA 1E35B 1C5VA 4UFDH 3RDZA 5HM9A 1S82A 4O9VA 1C5UA 3A89A 2Q1JA 1O3GA 3BTKE 3MU5A 1QRWA 2C3SA 2HVXA 2PKAB 3QN7A 2ZG0H 1YP9A 1EJNA 3CENA 1P01A 3Q77A 3RXKA 1SOZA 4KKDA 1TBQH 5EOKA 1O2HA 2GCTB 4Y11E 1ARCA 1N8OB 3FZDA 3KQDA 4RKJB 4UFEH 3OSYA 1J16A 2R3UA 1L1NA 2SGFE 2TBSA 1Z7KA 1SHHB 2VINA 2VIWA 3P70B 4MNWA 4OS5A 1TGSZ 1C5TA 2PFEA 3GYLB 1H9HE 1GDQA 3BN9A 4LZ4B 5GCHG 4Y8XA 4NZQA 5ETXA 1ID5H 2GCTC 4FUHA 1PPCE 1N8OC 1NROH 2OCVB 1XUJA 1C1QA 1VJAU 4XBCA 7ESTE 1IQKA 1GMCG 4JMYA 2XRCA 1P2MA 3KIDU 3SQHE 2QXIA 4MQAA 3LC5A 4DOQA 1BTZA 3RXVA 3WY8A 5FXLA 1SFQB 2EC9H 5JBBS 5A8YA 1NM6A 1T32A 2A4RA 1IQGA 4KELA 1O2TA 2NU0E 2C90B 1C2KA 4XDEA 1O3BA 1UTLM 3SU4A 1PPHE 1TMUH 2D1JA 4ABEA 2V6NA 2CF9H 1IQJA 4AGJA 1N6XA 1SGRE 4B2AA 3UQVA 1GMHF 1P3CA 2WPMS 1IHTH 1HAXB 1WOFA 2A32A 1NN6A 1O5CB 1LVMA 3R3GB 1FMGA 1GI0A 4YOJA 2VVCA 4TY7A 5ESBA 2BB4A 1FIWA 3FAOA 2GT8A 1AI8H 3JZ2B 2ZI2H 1NT1A 1S83A 1SGIB 3A80A 1UTPA 1K1PA 3LDXH 1CT4E 1O3PB 1LMWB 9ESTA 1LTOA 1SG8B 4A1XA 3MH4A 1BBRE 1O5AB 3KN2A 4AYVB 2LNCA 2WV5A 3S7KB 1GI2A 1MTUA 2HALA 1LQEA 4H4FA 1NFYA 1LVYA 1GBKA 1ANDA 1SGEE 1BITA 2AIQA 2FEQH 3VB3A 4CHAB 1MAXA 3M5OA 5AFYH 4HGCA 1SSXA 1ELBA 5TCCA 4X2VA 3FZZA 8GCHF 1K22H 5E0JA 1V2TT 2BHGA 4GPGA 1ELDE 1QQUA 2R3YA 4B75A 1UVUH 4CBOA 3VGCB 3TGKE 1K1NA 1IQMA 2LPRA 4DG4A 3URCA 4CHAC 3U8RH 1BB0B 2XXLA 1QJ7B 2V35A 1U6QA 3OY6U 1C2HA 1GMDG 1B5GH 4WMFA 1MQ6A 1V2NT 1BRAA 2ZA5A 1TRMA 4YM9A 4NA8A 5DP6A 1A5IA 2JETB 1CO7E 3KQEA 3UWJH 2HOBA 2HNTF 3EA7A 1V2QT 3A7VA 3P8FA 1OWHA 1VR1H 2JKHA 3SUGA 1FY1A 1RRKA 1A2CH 2VB0A 3MU4A 4I8HA 4IW4E 2VU8E 1JRSA 1C1OA 1BMLA 1HBTH 2G00A 1FNIA 2OTVA 3UREA 2A45B 4KGAA 1OYQA 1A4WH 3TLOA 1S5SA 3LKWA 2OC7A 1OX1A 2BY5X 1SGPE 1HAIH 2BX4A 1V2RT 1WCZA 1OWKA 3PMBB 3GY8A 4F4OC 1YCPH 1HIAB 1C2GA 1XM1A 4AZ2B 1Y3XA 1GJ5H 1OKXA 2V0BA 2XBXA 2ZDAH 3BG8A 4YZUA 3V7TA 1BTWA 1CU1A 5L2ZH 1DWCH 1F0SA 5CMXH 3PWCA 1SMFE 2XW9A 3BTGE 3ELAH 3MU1A 1SLUB 1RTFB 1S0RA 1Z6EA 2B5TB 1MCVA 1NFWA 5FPSA 8GCHG 3UR9A 1EUFA 1WQVH 3T2NA 3EYDA 1YYY1 1UCYH 5DP4A 1EPTB 1SC8U 1P9UA 3ZZ8A 4I7YH 3Q3KA 1KLIH 5L6NH 4K69A 5FHTA 4A1VA 1Z6JH 1T4VH 4X1SU 4X2WA 1W7XH 4ISOA 4TPIZ 5BPEA 3VB4A 1KDQB 3F9HA 5LPEA 2I6SA 1MQ5A 4CR9A 1ELGA 1PYTC 1EPTC 3C1KA 1MMJN 1O3JA 1A3EH 1TX7A 1QL8A 2O8MA 2J9NA 4AFZA 2BY7X 1ZPZA 2A4QA 1BTHH 3EE0B 1G3CA 2F9OA 1J9CH 2WPHS 3SUDA 1YF4A 2UUKB 2ZU5A 3SUFA 2O8WA 1YC0A 3NK8A 2OP9A 5FAHA 1O3KA 2C93B 4DT7B 4AB8A 1CT2E 3ZVBA 1C4U2 1XUKA 4B74A 1TPPA 1V2UT 1P2KA 3PYHA 1K2I1 1EQ9A 2OINA 1T8OA 5DP3A 4JYUH 1G37A 1YPHE 2V3OH 1W8BH 1O2KA 3E6PH 4IN1A 2ZGCA 3FP7E 3L6PA 3ZVFA 3RMNH 1ZTLA 1O30A 5L30H 4INKA 2WUBA 4I8GA 1TIOA 1ELVA 4X6OA 3TVJB 1DUAA 1FJSA 1HDTH 1MKWK 4FUCA 1F92A 2A7HA 4H6TA 1UO6A 3O8BA 2Y7XA 1W14U 2R2WU 3ZZ5A 1QRXA 1XX9A 1GJBB 1FV9A 2ALPA 1H4WA 1GBFA 3PMAB 1T8MA 2BXTH 3RU4D 1O38A 2RDLA 3SNAA 5A0AE 2AERH 5A0CA 1TX8A 3HGNA 4CBNA 3S0NA 1RD3B 4JCNA 3UY9A 3V12A 1ZSLA 1BDAA 3E3TA 2Z3EA 1DUEA 2AGIX 2QCYA 3A84A 5DP8A 2SNVA 1YCPM 2OD3B 3T28A 1V2KT 2R2MB 1O3IA 3N7OA 2BX3A 1ZMJA 3M37A 2FS8A 2G81E 3TNSA 2ZFPH 1GVKB 1K21H 2AS9A 1OWEA 2XBWA 1OWIA 4LOYH 4FUDA 3Q00A 2BD2A 1WTHD 2TIOA 4NCYA 4B1TA 2VVVA 2BLWA 2IPHA 2ZHQH 1Y3VA 2TGPZ 2VGCB 1SGCA 3K6ZA 2XBVA 1KXEA 4ZKRU 4K60A 1AE8H 5EG4A 4NA9H 1O3DA 8LPRA 1HIAA 1NRSH 4FUGA 5EPYA 2Y6TA 3GY6A 2J92A 2VWNA 3ZZBA 1O2XA 3FP6E 4E05H 4Y10E 1F2SE 1P02A 2CV3A 1A5GH 4ZXYH 1ZHPA 1C1MA 1N6YA 5I46H 1TMTH 3SJ9A 3E0NB 3LPRA 2JH5D 4FUEA 3QUMP 2PTCE 3Q76A 1K1LA 4ZKOU 1QBOA 1O2IA 1KY9A 2Y5HA 2BDIA 1EPTA 2ZPRA 3HKIB 1CGJE 1D3QB 5FPYA 1ELEE 1K9OE 1ZOMA 3UOUA 1EB2A 3SBKA 3ATWA 3BIVH 1RTLA 2ODPA 5E0HA 1BTPA 1KDQA 3OTJE 1DE7H 2QIQA 3E1XB 3NKKA 2FPZA 1X7AC 4CR5A 4ZH8A 4DURA 2XBYA 1KTTB 4UFGH 1BRUP 2QF3A 1ANCA 4GCHF 4DJZB 2A4OA 2QC2A 4AFSA 3QTVH 1GJ8B 2NU4E 3D23A 2BLVA 2R0KA 1O2UA 2WUCA 3L33A 4H42U 2Y5FA 3A7WA 1UTNA 4K3JA 2Y81A 2UUFB 3SOSA 1K1OA 3GCTF 1ACBE 1DOJA 4ISNA 1HGTH 2ZFFH 2FS9A 4CRDA 1YLCA 2OBOA 2UWPA 2PR3A 4J2YB 1GHWH 1TNIA 5GIBA 2JH6D 3A86A 1GHZA 1K1MA 3A88A 1GI9B 1A0LA 4THNH 2GGVB 4ABJA 2D8WA 3VFEA 2GZ7A 4MPUA 1G30B 1O36A 4K1TA 1TPSA 1O31A 4X1PU 1EAUA 2BDCA 2FYQA 1C5PA 4CRAA 4IGDA 3T25A 3ZZ3A 5F8XA 2QGRA 4AGKA 1G3EA 1O5DH 1QA7A 2ANWA 4Z0KA 3A7ZA 1DWBH 1ESBA 1EATA 2A5KA 2G8TA 4WVPE 1OWDA 1O3AA 2BYAX 1C5ZB 3RXEA 2BXUH 1KLTA 2J38A 1FY8E 3UNQA 1ARBA 3K6YA 1ETSH 2ZKSA 1AGJA 1GHAG 4AG1A 4DCDA 2ZDVH 1P12E 1SGTA 3GCHB 1MKXK 4Y8YA 2CHAB 1A61H 2Z9LA 4JZIA 5ABWA 1BMAA 1W12U 2OXSA 1C5RA 2BD3A 2ZECA 3TH4H 1K28D 2BD7A 2HGTH 1C2MA 2C8ZB 3BG4B 3E8LA 2GZ8A 3QLPH 2FESH 3RP2A 2FP7B 3LU9B 5DO4H 3ATMA 1GJCB 3ODDA 1HJ9A 3AASA 4ABHA 1NRNH 2CHAC 2XCNA 4A6LA 1J15A 4CRBA 4X2XA 1BBRH 3SV8A 3T27A 3ATIA 2BD4A 3GCTG 1XUIA 3BG4C 1GVLA 4Y0YE 1XUFA 1OP2A 1Y5BT 2ZP0H 1THRH 1NY22 3BTWE 4H6SB 1NRPH 3GY5A 1AZZA 3PMHB 2AIPA 1AVWA 3LH1A 1TLDA 1MD7A 1GI8B 4J1YA 5C5NA 4D9RA 3SJOA 5GCHF 3SO3A 1AQ7A 2I6QA 1O3MA 4X6PA 2BD5A 3MNBA 3SJ8A 2ZWLH 2VWOA 1G3DA 2ODQA 3M5MA 4LXBH 3RM2H 1GJ4H 4GVUA 2R9PA 5AF9H 3SU1A 1P3EA 3MU8A 2OC1A 3SV7A 2F9BH 4AB9A 2D2DA 3RXHA 5FCRA 5GJ4B 1TPAE 5BRRE 1ELCA 1IHSH 3V13A 2PUXB 1A0JA 1J8AA 5DPAA 2G4UA 4ZHMU 2BMGB 1GHYH 2FYRA 1O35A 3ZVAA 4Z6AH 3U69H 3EA9A 2ZGBH 1UMAH 1E34B 4NIWA 2F9VA 4XBBA 3SNCA
chains in the Genus database with same CATH superfamily
1MTWA 2FLRH 1O3LA 3A8DA 5AFZH 1KIGH 1AVGH 4IS5A 1NO9H 2PSXA 1HXFH 3TITA 1ZR0A 3A8CA 2PKSB 1P09A 1ABIH 2QF5A 4YTAA 1SVPA 2B7DH 1MZDA 1IQEA 2WPKS 1H1BA 4KTCA 3TK5A 5H4IB 1DSTA 1WYKA 2ZGHA 2H1UA 4F49A 2P3UB 2HWLB 3PLKA 1DWDH 2VWLA 1ZJKA 1V2PT 1T31A 2PKSC 3HK6B 3BEIB 1F5RA 3SI4H 1ETTH 1O2LA 3NXPA 1JRTA 1A1RA 5EW2H 3DT0H 3ODFA 2DE8A 1EX3A 1OHHD 3SV2H 4Q7XA 2CXVA 1VKYA 3MH5A 1E0FD 1FPCH 1F5KU 1AFQB 2GDEH 1C5NH 3P6ZB 2BQ7B 2VIQA 1MZAA 2IN2A 2STAE 1TFXA 3RU4T 3Q3YA 3TIUA 1O3FA 3OEED 2ZHFH 5FL7D 3F9GA 4WMDA 3M5LA 4DVAU 1DXWA 1UJ1A 2EQNA 3RXIA 1AFQC 2GTBA 3RXDA 3LGTA 1HYLA 4BAQB 1TNKA 1Z1IA 3GY4A 1GGDC 1GMDF 2SFAA 3GY3A 2ZFSA 1KYNA 1D6WA 1GJ6A 2J95A 4FUFA 2G5NA 3MOCA 2P94A 3IG6B 1DWEH 1DITH 2CK3D 1DX5M 1H8IH 4JZEH 1S81A 3HGPA 3RXCA 3ZV8A 3QGNB 3U1JB 1ZZZA 2WYJA 3ZZCA 3TK6A 3QZQA 2UWOA 2FOEA 3LJOA 1VJ9U 3SQEE 3TGIE 2ZHEH 1AWHB 2EI6A 5FCKA 1VITG 2KZ4A 1O2YA 5HXFA 1RFNA 3RLWH 2QXHA 2ZC9H 1CHGA 2Y80A 4IBLH 1BIOA 4Y6DA 1SQRA 1JXPA 2VH6A 4YOGA 3SU0A 3RXTA 1QA0A 3H7TA 3K65B 1HPGA 5A09A 1O3EA 3MNSA 4Y7BA 3SW2B 2H6MA 1UK3A 4U2WA 1Y3UA 1THSH 3E0PB 4U01A 4D9QA 3GCNA 3MH6A 3SZNA 3SYJA 2BY9X 4Y8ZA 7KMEH 2H9HA 4LK4A 1O0DH 1K1JA 1LHDH 3FFGA 1GL0E 2HLCA 3ZYEA 1AIXH 1QB6A 3SV9A 4E7NA 4TWWA 3QTOH 1Z8JB 1GCDA 2BLOA 1TGNA 3HPTB 1TALA 1LQDB 2C4FH 1GDUA 1C4Y2 1OP0A 1ZHMA 4U32A 3U8TH 4X6MA 2Z3DA 2FM2A 2AMPA 2GZ9A 3F2FA 3RU4E 2NU1E 1C1NA 1WQSA 3TJVA 1TGBA 4A5TS 1FAXA 1K1IA 3RXSA 3PTNA 1V2ST 5AHGH 1DDJA 1QQ4A 2PKAA 1HAHH 2J97A 1TONA 2WSSD 2W7UA 2ZFRH 4CRCA 2A2XH 1COWD 4NZLA 2EEKA 5G4BA 1LHCH 3S9BA 4NSYA 2Z94A 4BAOB 1JWTA 4FVBA 1HV7A 1HNEE 1UHBB 3PB1E 1SGFG 3RC4A 1TOCB 4X8SH 1SQOA 1IAUA 1EKBB 2A0QB 1YPHC 2Y7ZA 3QZRA 4Y79A 4ASHA 1HCGA 5E2PA 5EU8A 3GDVA 3HATH 1NBME 3LC3A 1D4PB 3VEQB 2FDAA 4QT8C 5DJ7A 4Q2KA 5HIZA 1MBMA 3BV9B 5JBTA 3P8NA 4R8TB 4WH6A 3AAVA 1P57B 3PTBA 2VIVA 2H9TH 2P3TB 2RCEA 4BANB 4RT1A 2AHME 2PW8H 3NRLA 5DP9A 5JYIA 1AE5A 1V3XA 3A7YA 1MCTA 1VITH 3BTQE 5F8ZA 2GT7A 2FWWA 5EPNA 1VCWA 3PRDA 5C2ZA 3GCOA 2J94A 5K7RA 1B7XB 4GUXA 1HJ8A 1YGCH 1SLVB 5EW1H 1AMHA 2QF4A 4X1QU 1C2EA 5FX6A 2OC8A 1BJUA 2ZDLA 5HMAA 5DSFA 4BXWA 2J2UA 3SNBA 3AK5A 4XBDA 4WXVA 1L4ZA 4YO9A 3BEUA 1EP6A 2Z9KA 1GI1A 1MBQA 2SGPE 3ZZDA 4UEHH 1TNJA 2ZDMA 1O3NA 1EZQA 4O3UA 5HYOA 1MKWH 2F43B 3EA8A 3C27B 4B6FA 2OBQA 3LONA 1P2JA 2M5TA 1SGYE 1O5BB 1HAPH 4RKOB 3ITIA 4SGBE 1GBBA 3RUOA 3AW0A 1FY4A 3BTTE 2SGDE 1SR5C 1O39A 3V0XA 2OQUA 3SUEA 3LGIA 1C5LH 1GBIA 4X1RU 2GMTB 1RS0A 2BTCE 5SGAE 2BD9A 1OSSA 1JIRA 1Y5UT 2FO9A 3IWMA 3SI3H 3UOPA 4AFUA 2BY8X 3TPIZ 1MU8B 1Y3WA 3SGBE 3FP8E 1GBTA 2AEIH 3GDSA 2UWLA 3TNTA 4ABFA 1UCYK 3RLYH 4E7RG 2GMTC 2WV4A 3DD2H 3E16B 4X8UH 1C1WH 4OS4A 1LPZB 2HRVA 1MAYA 3RMOH 2ZF0H 1ZGVA 3RXRA 2FIRH 1MTVA 1BRCE 3EE7A 1QZ8A 2XNIA 5FBIA 3ZZAA 5C94A 2V3HH 1QB1A 2WYGA 3LGYA 2BQWB 1Y8TA 1BUIA 1GBCA 4B76A 1F0RA 1CHOG 1KSNA 2WPLS 5DG6A 1QJ6B 1G2MA 3LT3A 2ZNKH 1BOQA 5EQRA 1C2JA 1EZUC 3S7HB 1YY3A 1ZRBA 3PO1B 3M3SA 1TRNA 2FOMB 3ZZ7A 4WJG2 1KXCA 2THFB 2YMSB 3P17H 5AVDA 1V6DA 1YLDA 2K8IA 1QTFA 1BJVA 3A7TA 1T7CA 2BLQA 2VJ1A 4FU7A 4XOJA 2GKVE 1A3BH 3GY2A 1FX0B 3ESTA 2O8LA 1S85A 1ORFA 5C0TA 1ABJH 1GJAB 3IITA 3PO1C 1SBWA 1HAGE 3MFJA 1GBEA 2YMSC 1W2KH 2BDYA 4JZDH 5E2OA 1J17T 1B0EA 3NWUA 4I31A 1O34A 4KTSA 4E06H 2GV6A 1YPKH 1MUEB 8KME2 5K0HA 5GPIB 4MG3A 4MVNA 1DANH 2PV9B 4ISHH 3MNCA 2P59A 1G36A 2Q6DA 2P16A 4CH8B 5TCAA 2VIDA 1P10A 2GP9B 3K9XB 2O8TA 1EJAA 1BMFD 1EOJA 3VB5A 4RN6A 5J4SA 1A5HA 2W6ID 1WDIA 4OS7A 4B2CA 3BIUH 1QBVH 7LPRA 2A7CA 3LGUA 3SU6A 3RXBA 3A8AA 3PLPA 1HB0B 5EXLA 1LKAA 3SNDA 1OXGA 3KQBA 3A85A 3V3MA 2NU2E 1KMHB 1O3OA 3VB7A 4A7IB 1GHAF 4R0IA 1O37A 5EJ1A 5GWZA 1ZYOA 3VB6A 1GBDA 1L0ZA 1P03A 1SLWB 3F2GA 4TSFD 1P05A 3Q3XA 1V2OT 1TYNA 5A8XA 2OUAA 3S9AA 7GCHG 2SGAA 3N7EA 5C1YA 2XWBI 1V2WT 3M7QA 1T8NA 1QCPA 5C1UA 1KTSB 1NS3A 3CP7A 4K8BA 1TA6A 2G51A 1Y59T 2F3CE 5EGMA 5JDUB 3LH3A 4XFQA 3F6UH 1PFXC 3GS9A 1TNHA 2GCHG 3TJUA 3GYMA 1YPGH 1UCYE 1T8LA 2FI4E 5DK1A 2P8OB 5B6OA 3LGVA 1HFDA 1S0QA 1SLXB 2G55A 4UE7H 1GBJA 5T1VA 2ZZUH 4FU9A 3KQCA 1BRBE 1KXAA 3UNSA 2AH4X 3CS0A 1PQ8A 2ZFTA 1JMOH 2ZGJA 5PTPA 3W94A 2BOHB 2P8OC 5EXNA 1ZMNA 2VWMA 3NUMA 2FI3E 1BA8B 1D3TB 4XSKU 3VXEH 1E37B 1C5YB 3DSGA 1G3BA 2SGQE 4ZXXH 4GHTA 4XD7D 2XYAA 1EAWA 3U9AH 1TGCA 4Y71A 4DGJA 2BDHA 1FONA 3SJKA 1TQ0B 2ZTYA 2VVUA 1FY3A 2FXRA 2HPQH 3FANA 3VXFH 2EY4C 5GXPA 3UQOA 4D8NA 1PPFE 3UUZA 3MO9A 3MQKC 3UNRA 1DLEA 2ODYB 3SN8A 5DKMA 1OWJA 3RXAA 2J98B 5C1XA 3NZIA 1UVTH 1FUJA 2D26C 1BCUH 4XRNA 2Z7FE 3B8JA 3B9FH 2VH0A 4NA7A 1OS8A 1GI3A 4D76A 3GICB 3ZYDA 1E38B 2AYWA 3T26A 3BTFE 4ABDA 4BAMB 3D49H 1CT0E 2YNAA 5IK2D 4K1SA 3BTEE 2AMQA 2ZEBA 1BZXE 2FOCA 2ANMH 1UTOA 1C4V2 1PYTD 1NFUA 1BTUA 4GSOA 1D9IA 1C5QA 2ZCLP 4O03A 1GI5A 1HXEH 4ACBA 1EJMA 4BTIB 1VGCB 1HAOH 2FOFA 3D65E 1MTNB 1S6HA 2NU3E 4BOHA 1O2RA 5EQSA 3S69A 1TX6A 1WV7H 1OYTH 1VCPA 3AAUA 1YLNA 1LKBA 1XVMA 3RC6A 1LHEH 1XUHA 2ZFQH 1INCA 1VGCC 2ZTXA 4GLYA 1MTNC 2OLGA 1CGIE 3HKJB 5A0BA 2Z3CA 1GJ7B 1NZQH 1W10U 1Z8GA 1TA2A 1BTXA 4MNYA 2J4IA 1SGFA 1V2MT 1P04A 1C5MD 4Y0ZE 4ZMAH 1WAYB 3RXUA 3KF2A 1AKSB 1DFPA 5FBEA 4ESTE 2XCFA 5C3NA 1DXPA 1M9UA 1EAIA 2V7QD 1EAXA 3EAJA 1NU7B 3L3TA 5CHAB 1WTGH 1A7SA 1H8DH 1S6FA 2ULLA 1Z8IB 2WV9A 4JZFH 2FI5E 4HI3A 3DCLA 1QURH 3DFLA 3F9EA 1NC6A 1PPEE 4YLUA 1IOEA 1EOLA 5CHAC 2HNTE 1BT7A 3WWFA 1P0SH 1TPOA 2F91A 2O8UA 2WHXA 1EXFA 1BHXF 1FI8A 1C2DA 1VITF 3R0FA 5CE1A 2ZHWH 2JJ2D 2PWXA 3TJOA 1Z1JA 1QB9A 4ABAA 2ZGXH 2F4LA 3OY5U 2Y82A 4NG9H 2O9QA 3EQ0H 4I86A 1IQLA 1V2JT 4FUJA 3NPSA 2RG3A 6GCHF 4M7GA 2XWAA 1ZPCA 1NRRH 3GDUA 1V2VT 2GDDA 4WXIA 1RXPA 1DY8A 1C1RA 1O2VA 3BEFB 4ABBA 3PV4A 5T6DA 3I77A 1C2FA 1L1GA 2A1DB 2VIPA 1RIWB 2YMSD 4ABGA 2QY0B 3ATLA 3A82A 1FXYA 3AVZA 3MWIU 2BZAA 1HJAB 3BF6H 2ZU1A 4I33A 1EP5A 2A7JA 1GGDB 3T62A 4AORA 5C5OA 3QX5H 1C5OH 1ZRKA 3MO6A 1RIWC 1P9SA 4I8KA 4MNVA 4NFFA 4NWLA 4RSPA 1C2IA 4IC6A 3M3TA 3MH7A 3O8RA 2Z6BD 3E91A 2AFQB 2PUQH 1O3CA 3PWBA 3TK9A 2AGGX 1B0FA 4AC9A 1DICA 1HJAC 1KLJH 1AVXA 2J98A 1LVOA 1A0HB 2PGQB 4X8TH 2R0LA 1AUTC 5JPMH 5JBAS 3K2UA 1CSOE 2ALVA 3OX7U 3UAIC 5EIYA 1TWXB 5F8TA 1L4DA 1FN8A 4DT4A 2H2ZA 1V2LT 2BOKA 5JB8S 3TJNA 1XKAC 3SU3A 4XE4A 1O33A 4YOIA 2G5VA 3ZVEA 1GI4A 4TWYA 4YT7H 1LVBA 6CHAB 2ZU2A 4BXSA 5F03A 4HG6A 1ELTA 1P11E 1CA8B 2L74A 2FOBA 4Z1MD 2TGAA 1DS2E 2TPIZ 2QF0A 2EI7A 1W0ZU 3A8BA 3QDZB 1A46H 1GWAA 1CQQA 1FZZA 1G2LA 3H5CB 1GBHA 2CGAA 3OEHD 1SGQE 1O2GH 6GCHG 5C67A 6CHAC 2IPQX 3DSPA 3ZVDA 2H9EH 1G32B 2B0FA 2STBE 4ZAEA 4X0WU 1MTSA 1TBZH 4AFQA 4D7GA 1THPB 1C5WB 3W1EA 3ZVCA 1ZGIA 1UVSH 1C1TA 3DUXH 1P2IA 2PP6A 3FOAA 1ZMLA 1YPMH 4INHA 3TH3H 2C8XB 1UTKA 4X1NU 3QGJA 5C20A 5F6MA 2ZDKA 1UVPA 3MU0A 1CGHA 2QXJA 1AKSA 1RTKA 2OK5A 1GHXH 1UW7A 3OFND 2ZQ2A 3B23B 3SJIA 2JH0D 1GHVH 4JYTA 5GDSH 1GBLA 2LELA 1NPMA 1W3CA 4OS2A 2FTLE 1ESAA 1TGTA 3LJJA 1HAVB 1T4UH 1Y5AT 5E0GA 5EXMA 3KYGA 4WH8A 3TU7H 1LO6A 4ZROA 3W95A 4WMEA 5IYTA 1AU8A 5I25A 5JB9S 1LPGB 1C1UH 1PPZA 1C1SA 3SV6A 4NSVA 1O2JA 3E90B 4RI0A 3ZVGA 1LCYA 2IOTA 1OOKB 2FZZA 3F1SB 1CVWH 4AG2A 5E8EH 4PROA 2C8WB 2XC4A 4YESB 4CREA 1AB9B 2OC0A 1QHRB 1UTQA 3F0PA 1SGNE 2GD4B 3P8OA 2HLDD 1DPOA 1NTPA 3HK3B 4B2BA 3VGCC 4ISIH 5T3HA 2ANYA 4ISLA 5LH8A 1TAWA 1GMHG 1W13U 2Z9JA 4IN2A 4I8JA 1AB9C 2K0QA 5TJXA 3RXOA 3G01A 2H5DA 1UK2A 1BMNH 1FN6A 1O3HA 2PSYA 2HPPH 2Y5GA 1QY6A 4WF8A 1JIMA 1H9IE 3PMJA 1YM0A 1GDNA 4AYYB 3BTDE 1HUTH 3OU0A 2JETC 1KXDA 3SHCH 1P2QA 2IJD1 1GPZA 1CBWB 3RMMH 4FUBA 4I8LA 4DIHH 1C5SA 1GJ9B 5DP5A 2Z9GA 2GVFA 3M35A 3QO6A 2Z9IA 3TGJE 1Z8RA 2XTTB 2K1QA 3T29A 1CBWC 1GI6A 4INLA 1ELFA 4MLFB 1H9LB 3FO8D 1J14A 3SGAE 3JZ1B 1DSUA 4ABIA 3URDA 1S84A 4FXGH 1CHOF 4HZHA 1ZLRA 2F9PA 1WU1A 2UUJB 2W7SA 1PQAA 4I32A 4TYDA 3PM3A 1P06A 2RFKC 2FTMA 4NIVA 2J5UA 2KAIB 4BAKB 1ANBA 4UONA 1Q3XA 1O2PA 2FOGA 2SGEE 1O2QA 1LPKB 3M7TA 1KXBA 1E1QD 4UFFH 5EODA 4ZKSU 3VPKA 1PQ5A 1GI7B 2ASUB 4B73A 1ZTJA 4Y76A 1AN1E 1QJ1B 4TT3D 3KGPA 5FPTA 1GCTB 2A4GA 1NFXA 1ESTA 3PRBA 1HLTH 1ETRH 1YCPK 3MYWA 1L2EA 4DIIH 4B71A 1FY5A 1NRQH 3UPEA 2BD8A 1P8VC 1MH0A 2G4TA 2AMDA 1WXRA 1ZTKA 1GCTC 1EZSC 3AW1A 1YPEH 3LIWA 3KL6A 3QK1A 1XKBC 1HAZB 1RGQA 2TGTA 1AWFH 1E79D 1GG6B 1W7GH 4K2YA 2F9UA 3OTPA 1TB6H 2YOLA 1N1LA 1SQTA 1UK4A 3UR6A 4ZHLU 1WBGB 1DT2A 2A5IA 4TY6A 3QWCH 2ILNA 2BZ6H 4WWYA 1EFRD 1BHXB 3DHKH 5IDKA 2M2AA 1Z71A 4BAHB 1ELAA 1KXFA 4MNXA 2KX4A 1WSSH 2WINI 3MHWU 4MPWA 3I29A 4ZKNU 1GG6C 3O8CA 5A2MH 1PPBH 5KECA 4HTCH 3M3VA 4SGAE 4U30A 3RXMA 1TQ7B 4IC5A 1ZPBA 1C9PA 4ZUHA 1SKYE 4CRGA 1LHFH 1D6RA 2KCAA 4OGYA 1YPJH 5A8ZA 1HAVA 5L2YH 3UFAA 1AFEH 1SGDE 4P00A 1O2ZA 3U1IB 2A5AA 1C1VH 4O3TA 1L1JA 2PLXA 2OQ5A 1XMNB 1O2SA 2CN0H 2QA9E 2VNTA 2ZCKP 1AHTH 2UUYA 1F0TA 7GCHF 4FU8A 2B9LA 1DLKB 4JK5A 5FX5A 2FOHA 4P02A 2FOAA 2KCPA 3ZIAD 3M61U 4HFPB 1SOTA 4O97A 5ESTE 1EASA 1SFIA 1FDPA 4CH2B 1IQIA 2W26A 2ZU3A 1FAKH 1TRYA 1OP8A 4MPXA 4ZHAA 3ZZ4A 2W3IA 2ZHDA 2CMYA 2KR7A 1Q2WA 2RA3A 2NWNA 4ACAA 5LPFA 1AD8H 1LDTT 1UHBA 2GX4A 2RDEA 1QFKH 2GCHF 4JZ1A 1XUGA 2YNBA 1DM4B 1QL7A 8ESTE 2BVRH 3PROA 1P2OA 1YKTA 2FX6A 1UVOA 1TBRH 2F83A 2C8YB 1GHBF 1G9IE 1DY9A 2WPJS 1CA0B 1SB1H 4CRFA 4NIXA 1C1PA 3U8OH 3DA9B 2BVSH 1O2MA 1VZQH 2ANKH 3MO3A 1ZSJA 4Y7AA 1SHYA 3UIRA 1VCQA 2ZDNA 4Q80A 2CJIA 1AO5A 2LP6A 4UDWH 3P95A 1CA0C 1O2WA 5HKKD 3LGWA 3D62A 4FVDA 1HAYB 4MPVA 1QIXB 2TRMA 2VGCC 3CS7A 4OGXA 2BDBA 4AX9H 2Q6FA 1UTMA 4D7FA 1FQ3A 2KAIA 1O2OA 2CF8H 3P8GA 1P2NA 2PHBA 2ZPQA 5C17A 1E36B 4KTUA 3A83A 2QXGA 1F7ZA 1Y3YA 1QGFA 2QV1A 3RXQA 2J34A 1PQ7A 1O2NA 5CHBA 2BY6X 4KP0A 1XXDA 4AOQA 2QAAA 3TH2H 5JBCS 1O5GH 2AGEX 2JJ1D 2P3FH 1O5FH 2P93A 3OYPA 2SNWA 3EGKH 2BM2A 3RXPA 3M36A 1IQFA 4Q7ZA 2XC5A 2W5EA 2KCYA 1F0UA 1FLEE 1XXFA 4X8VH 5DGJA 1MKXH 3PV5A 3BTHE 5B6LA 1QRZA 1MU6B 1O5EH 1F5LA 2DE9A 1W11U 1GHBG 3RXJA 2ZU4A 3SORA 2ZCHP 3F3BA 3UTUH 1GBAA 4MDSA 1AY6H 3DFJA 3I78A 4OS6A 3KYFA 4X6NA 4UD9H 1PJPA 4BNRA 1AUJA 2Q6GA 1GVZA 1QL9A 3FKSD 3KEEA 1E1RD 2FLBH 4GAWA 4WY3A 2XOKD 3RXLA 2FMJA 4VGCB 5T6FA 1TE0A 1W0KD 1UTJA 3PLBA 4A92A 1GJDB 3KCGH 1ZJDA 1XVOA 1YBWA 6ESTA 3SU2A 4LZ1H 5HGGA 3SZEA 2PTNA 2V3MA 3F9FA 1EB1H 1GL1A 1WUNH 3GY7A 2L6OA 3RC5A 2DUCA 3MNXA 1AZ8A 2ESTE 4GHQA 3F0OA 1K0HA 4VGCC 5LGOA 1BTYA 3MMGA 1D3PB 3RMLH 3A81A 3M5NA 3F68H 2EA3A 4NFEA 3NCLA 4BTTB 3LOXA 1O32A 2ZQ1A 2A31A 4IMZA 1EZXC 3GISB 2HNTC 5EQQA 1OPHB 1CE5A 1DVAH 4IMQA 2IJOB 1ZHRA 3O8DA 3SHAH 4NWKA 3ATKA 1RJXB 1TOMH 4JK6A 3UWIA 4Q7YA 1JOUB 5J4QA 4NIYA 3SGQE 4NGAH 3SNEA 3RXGA 1QNJA 4K5ZA 4DY7B 2QN5T 4GCHG 2ZO3H 1PPGE 4TPYA 4X2YA 1SQAA 3BTME 4DW2U 2VIOA 1FIZA 1YPLH 3ENSB 2VBCA 1TNLA 1BMMH 3GCHC 2P95A 3T5FH 2ZTZA 1GBMA 1SPJA 1LHGH 3MI4A 3SU5A 1NU9A 4MTBA 3P92A 3A87A 2F9NA 2BDGA 2A2QH 3KNXA 4OS1A 2QYIA 3ZV9A 4A1TA 1NESE 1SL3A 3STJA 3FVFB 5LPRA 2BDAA 5HM2A 4YLQH 3U98H 1SI5H 2GV7A 1ANEA 4JYVH 1QR3E 3M7UA 2G52A 1C2LA 1TNGA 4K1EA 2WPIS 1C9TA 1HRTH 1TABE 1GMCF 2TGDA 2B8OH 9LPRA 2PGBB 2ZPSA 3KHVA 2BQ6B 4FUIA 1FPHH 2H5CA 4BTUB 3EDXB 1TMBH 2W3KA 1BBRK 3BSQA 1W0YH 3H7OA 1IQHA 2FODA 1MD8A 2RA0A 3A7XA 3GOVB 3MTYA 1Q31A 3RXFA 6LPRA 1JBUH 5T6GA 2FX4A 3RM0H 4YT6H 3S9CA 4AN7A 1D3DB 2EI8A 3STIA 2XC0A 2ZIQH 1QBNA 2BVXH 5DP7A 1BQYA 1ZSKA 3ZZ9A 4K8YA 1C5XB 3ZZ6A 1IQNA 1E35B 1C5VA 1S6LA 4UFDH 3RDZA 3F2HA 5HM9A 1S82A 4O9VA 1C5UA 3A89A 2Q1JA 1O3GA 3BTKE 3MU5A 1QRWA 2C3SA 2HVXA 2PKAB 3QN7A 2ZG0H 1YP9A 1EJNA 3CENA 1P01A 3Q77A 3RXKA 1MABB 1SOZA 4KKDA 1TBQH 5EOKA 1O2HA 2GCTB 4Y11E 1ARCA 1N8OB 3FZDA 5DN6D 3KQDA 4RKJB 4UFEH 3OSYA 1J16A 2R3UA 1L1NA 2SGFE 2TBSA 1Z7KA 1SHHB 2VINA 2VIWA 3P70B 4MNWA 4OS5A 5F53A 1TGSZ 1C5TA 2PFEA 3GYLB 1H9HE 1GDQA 3BN9A 4LZ4B 5GCHG 4Y8XA 4NZQA 5ETXA 1ID5H 2GCTC 4FUHA 1PPCE 1N8OC 1NROH 2OCVB 1XUJA 3PV2A 1C1QA 1VJAU 4XBCA 7ESTE 1IQKA 1GMCG 4JMYA 2XRCA 1P2MA 3KIDU 3SQHE 2QXIA 4MQAA 3LC5A 4DOQA 1BTZA 3RXVA 3WY8A 5FXLA 1SFQB 2EC9H 5JBBS 5A8YA 1NM6A 1T32A 2A4RA 1IQGA 4KELA 1O2TA 2NU0E 2C90B 1C2KA 4XDEA 1O3BA 1UTLM 3SU4A 1PPHE 1TMUH 2D1JA 4ABEA 2V6NA 2CF9H 1IQJA 4AGJA 1N6XA 1SGRE 4B2AA 3UQVA 1GMHF 1P3CA 2WPMS 4M9FA 1IHTH 1HAXB 1WOFA 2A32A 1NN6A 1O5CB 1LVMA 3R3GB 1FMGA 1GI0A 4YOJA 2JDID 2VVCA 4TY7A 5ESBA 2BB4A 1FIWA 3FAOA 2GT8A 1AI8H 3JZ2B 2ZI2H 1NT1A 1S83A 3CNRA 1SGIB 3A80A 1UTPA 1K1PA 3LDXH 1CT4E 1O3PB 4FOUC 1LMWB 9ESTA 1LTOA 1SG8B 4A1XA 3MH4A 1BBRE 1O5AB 3KN2A 4AYVB 2LNCA 2WV5A 3S7KB 1GI2A 1MTUA 2HALA 1LQEA 4H4FA 1NFYA 1LVYA 1GBKA 1ANDA 1SGEE 1BITA 2AIQA 2FEQH 5EJLA 3VB3A 4CHAB 4OM9A 1MAXA 3M5OA 5AFYH 4HGCA 1SSXA 1ELBA 5TCCA 4X2VA 3FZZA 8GCHF 1K22H 5E0JA 1V2TT 2BHGA 3VG8A 5C0UA 4GPGA 1ELDE 1QQUA 2R3YA 5GNDA 4B75A 1UVUH 4CBOA 2KFWA 3VGCB 1K1NA 3TGKE 1IQMA 2LPRA 4DG4A 3URCA 4CHAC 3U8RH 1BB0B 2XXLA 1QJ7B 2V35A 1U6QA 3OY6U 1C2HA 1GMDG 1B5GH 4WMFA 1MQ6A 1V2NT 1BRAA 2ZA5A 1TRMA 4YM9A 4NA8A 5DP6A 1A5IA 2JETB 1CO7E 3KQEA 3UWJH 2HOBA 2HNTF 3EA7A 1V2QT 3A7VA 3P8FA 1OWHA 1VR1H 2JKHA 3SUGA 1FY1A 1RRKA 1A2CH 2VB0A 3MU4A 4I8HA 4IW4E 2VU8E 1JRSA 1C1OA 1BMLA 1HBTH 2G00A 4Q4LA 1FNIA 2OTVA 3UB0A 3UREA 2A45B 4KGAA 1OYQA 1A4WH 3TLOA 1S5SA 3LKWA 2OC7A 1OX1A 2BY5X 1SGPE 1HAIH 2BX4A 1V2RT 1WCZA 1OWKA 3PMBB 3GY8A 4F4OC 1YCPH 1HIAB 1C2GA 1XM1A 4AZ2B 1Y3XA 1GJ5H 1OKXA 3FN8A 2V0BA 2XBXA 2ZDAH 3BG8A 4FETA 4YZUA 1BTWA 1CU1A 3V7TA 5L2ZH 1DWCH 1F0SA 5CMXH 3PWCA 1SMFE 2XW9A 3BTGE 3ELAH 3MU1A 1SLUB 1RTFB 1S0RA 1Z6EA 2B5TB 1MCVA 1NFWA 5FPSA 8GCHG 3UR9A 1EUFA 1WQVH 3T2NA 3EYDA 1YYY1 1UCYH 5DP4A 1EPTB 1SC8U 1P9UA 3ZZ8A 4I7YH 3Q3KA 1KLIH 5L6NH 4K69A 5FHTA 4A1VA 1Z6JH 3KQ5A 1T4VH 4X1SU 4X2WA 1W7XH 4ISOA 4TPIZ 5BPEA 3VB4A 3N7DA 1KDQB 3F9HA 5LPEA 2I6SA 1MQ5A 5KEDA 4CR9A 1ELGA 1PYTC 1EPTC 3C1KA 1MMJN 1O3JA 1A3EH 1TX7A 1QL8A 2O8MA 2J9NA 4AFZA 2BY7X 1ZPZA 2A4QA 1BTHH 3EE0B 1G3CA 2F9OA 1J9CH 2WPHS 3SUDA 2KM0A 1YF4A 2UUKB 2ZU5A 3SUFA 3WWBA 2O8WA 1YC0A 3NK8A 2OP9A 5FAHA 1O3KA 2C93B 4DT7B 4AB8A 1CT2E 3ZVBA 1C4U2 1XUKA 4B74A 1TPPA 1V2UT 1P2KA 3PYHA 1K2I1 1EQ9A 2OINA 1T8OA 4RT0A 5DP3A 4JYUH 1G37A 1YPHE 2V3OH 1W8BH 1O2KA 3E6PH 4IN1A 2ZGCA 3FP7E 3L6PA 3ZVFA 3RMNH 1ZTLA 1O30A 2JIZD 5L30H 4F55A 4INKA 4ZCNA 2WUBA 4I8GA 1TIOA 1ELVA 4X6OA 3TVJB 1DUAA 1FJSA 1HDTH 1MKWK 4FUCA 1F92A 2A7HA 4H6TA 1UO6A 3O8BA 2Y7XA 1W14U 2R2WU 3ZZ5A 5EJZA 2KCOA 1QRXA 1XX9A 1GJBB 1FV9A 2ALPA 1H4WA 1GBFA 3PMAB 1T8MA 2BXTH 3RU4D 1O38A 2RDLA 3SNAA 5A0AE 2AERH 5A0CA 1TX8A 3HGNA 4CBNA 3S0NA 1RD3B 4JCNA 3UY9A 3V12A 1ZSLA 1BDAA 3E3TA 2Z3EA 1DUEA 2AGIX 2QCYA 3A84A 5DP8A 2SNVA 4F48B 1YCPM 2OD3B 3T28A 1V2KT 2R2MB 1O3IA 3N7OA 2BX3A 1ZMJA 3M37A 2FS8A 2G81E 3OE7D 3TNSA 2ZFPH 1GVKB 1K21H 2AS9A 1OWEA 2XBWA 1OWIA 4LOYH 4FUDA 3Q00A 2BD2A 1WTHD 2TIOA 4NCYA 2QE7D 4B1TA 2VVVA 2BLWA 2IPHA 2ZHQH 1Y3VA 5CDFE 2TGPZ 2VGCB 1SGCA 2GJGA 3K6ZA 2XBVA 1KXEA 4ZKRU 4K60A 1AE8H 5EG4A 4NA9H 1O3DA 8LPRA 1HIAA 1NRSH 4FUGA 5EPYA 1NBMD 2Y6TA 3GY6A 2J92A 2VWNA 3ZZBA 1O2XA 3FP6E 1H8ED 4E05H 4Y10E 1F2SE 1P02A 2CV3A 1A5GH 4ZXYH 1ZHPA 1C1MA 1N6YA 5I46H 1TMTH 3SJ9A 3E0NB 3LPRA 2JH5D 4FUEA 3QUMP 3OAAD 2PTCE 3Q76A 1K1LA 4ZKOU 1QBOA 1O2IA 1KY9A 2Y5HA 2BDIA 1EPTA 2ZPRA 3HKIB 1W0JD 1CGJE 1D3QB 2WPDD 5FPYA 1ELEE 1K9OE 1ZOMA 3UOUA 1EB2A 3SBKA 3ATWA 3BIVH 1RTLA 2ODPA 5E0HA 1BTPA 1KDQA 3OTJE 1DE7H 2QIQA 3E1XB 3NKKA 2FPZA 1X7AC 4CR5A 3U28C 4ZH8A 4DURA 2WZQA 2XBYA 1KTTB 4UFGH 1BRUP 2QF3A 1ANCA 4GCHF 4DJZB 2A4OA 2QC2A 4AFSA 3QTVH 1GJ8B 2NU4E 3D23A 2BLVA 2R0KA 1O2UA 2WUCA 4B6EA 3L33A 4H42U 2Y5FA 3A7WA 1UTNA 4K3JA 2Y81A 2UUFB 3SOSA 1K1OA 3GCTF 1ACBE 1DOJA 4ISNA 1HGTH 2ZFFH 2FS9A 3DSOA 2XNDD 1YLCA 2OBOA 4CRDA 2UWPA 2PR3A 4J2YB 1GHWH 1TNIA 5GIBA 2JH6D 3A86A 1GHZA 1K1MA 3A88A 1GI9B 1A0LA 4THNH 2GGVB 4ABJA 2W6JD 2D8WA 3VFEA 2GZ7A 4MPUA 1G30B 1O36A 4K1TA 1TPSA 1O31A 4X1PU 1EAUA 2BDCA 2FYQA 3WW7A 1C5PA 4CRAA 4IGDA 3T25A 3ZZ3A 5F8XA 2QGRA 4AGKA 1G3EA 1O5DH 1QA7A 2ANWA 5HIYA 4Z0KA 3A7ZA 1H8HD 1DWBH 1ESBA 1EATA 2A5KA 2G8TA 4WVPE 1OWDA 1O3AA 2BYAX 1C5ZB 3RXEA 2BXUH 1KLTA 2J38A 1FY8E 3UNQA 1ARBA 3K6YA 1ETSH 2ZKSA 1AGJA 1GHAG 4AG1A 4DCDA 2ZDVH 1P12E 1SGTA 3GCHB 1MKXK 2HVYB 4Y8YA 2CHAB 1A61H 2Z9LA 4JZIA 5ABWA 1BMAA 1W12U 2OXSA 1C5RA 2BD3A 2ZECA 3TH4H 1K28D 2BD7A 2HGTH 4YXWD 1C2MA 2C8ZB 3BG4B 3E8LA 2GZ8A 3QLPH 2FESH 3RP2A 2FP7B 3LU9B 5DO4H 3ATMA 1GJCB 3ODDA 1HJ9A 3AASA 4ABHA 1NRNH 2CHAC 2XCNA 4A6LA 1J15A 4CRBA 4X2XA 1BBRH 3SV8A 3T27A 3ATIA 2BD4A 3GCTG 4ASUD 1XUIA 3BG4C 1GVLA 4Y0YE 1XUFA 1OP2A 1Y5BT 5KGOA 2ZP0H 1THRH 3H09A 1NY22 3BTWE 4H6SB 1NRPH 3GY5A 1AZZA 3PMHB 2AIPA 1AVWA 3LH1A 1TLDA 1MD7A 4Q63A 1GI8B 4J1YA 5C5NA 4D9RA 3SJOA 5GCHF 3SO3A 1AQ7A 2I6QA 1O3MA 4X6PA 2BD5A 3MNBA 3SJ8A 2ZWLH 2VWOA 1G3DA 2ODQA 3M5MA 4LXBH 1YWUA 3RM2H 3N99A 1GJ4H 4GVUA 2R9PA 5AF9H 3SU1A 1P3EA 3MU8A 2OC1A 3SV7A 2F9BH 4AB9A 2D2DA 3RXHA 5FCRA 5GJ4B 1TPAE 5BRRE 1ELCA 1IHSH 3V13A 2PUXB 1A0JA 1J8AA 5DPAA 2G4UA 4ZHMU 2BMGB 1GHYH 2FYRA 1O35A 3ZVAA 4Z6AH 3U69H 3EA9A 2ZGBH 1UMAH 1E34B 4NIWA 2F9VA 4XBBA 3SNCA
chains in the Genus database with same CATH topology
1MTWA 2FLRH 1O3LA 3A8DA 5AFZH 1KIGH 1AVGH 4IS5A 1NO9H 2PSXA 1HXFH 3TITA 1ZR0A 3A8CA 2PKSB 1P09A 1ABIH 4YTAA 1SVPA 2B7DH 1MZDA 1IQEA 2WPKS 1H1BA 4KTCA 3TK5A 5H4IB 1DSTA 1WYKA 2ZGHA 2H1UA 4F49A 2P3UB 2HWLB 3PLKA 1DWDH 2VWLA 1ZJKA 1V2PT 1T31A 2PKSC 3HK6B 3BEIB 1F5RA 3SI4H 1ETTH 1O2LA 3NXPA 1JRTA 1A1RA 5EW2H 3DT0H 3ODFA 2DE8A 1EX3A 3SV2H 4Q7XA 2CXVA 3MH5A 1E0FD 1FPCH 1F5KU 1AFQB 2GDEH 1C5NH 3P6ZB 2BQ7B 2VIQA 1MZAA 2IN2A 2STAE 1TFXA 3RU4T 3Q3YA 3TIUA 1O3FA 2ZHFH 3F9GA 4WMDA 3M5LA 4DVAU 1DXWA 1UJ1A 3RXIA 1AFQC 2GTBA 3RXDA 3LGTA 1HYLA 4BAQB 1TNKA 1Z1IA 3GY4A 1GGDC 1GMDF 2SFAA 3GY3A 2ZFSA 1KYNA 1D6WA 1GJ6A 2J95A 4FUFA 2G5NA 3MOCA 2P94A 3IG6B 1DWEH 1DITH 1DX5M 1H8IH 4JZEH 1S81A 3HGPA 3RXCA 3ZV8A 3QGNB 3U1JB 1ZZZA 2WYJA 3ZZCA 3TK6A 3QZQA 2UWOA 2FOEA 3LJOA 1VJ9U 3SQEE 3TGIE 2ZHEH 1AWHB 2EI6A 5FCKA 1VITG 1O2YA 5HXFA 1RFNA 3RLWH 2QXHA 2ZC9H 1CHGA 2Y80A 4IBLH 1BIOA 4Y6DA 2VH6A 1JXPA 4YOGA 3SU0A 3RXTA 1QA0A 3H7TA 3K65B 1HPGA 5A09A 1O3EA 3MNSA 4Y7BA 3SW2B 2H6MA 1UK3A 4U2WA 1Y3UA 1THSH 3E0PB 4U01A 4D9QA 3GCNA 3MH6A 3SZNA 2BY9X 4Y8ZA 7KMEH 2H9HA 4LK4A 1O0DH 1K1JA 1LHDH 3FFGA 1GL0E 2HLCA 3ZYEA 1AIXH 1QB6A 3SV9A 4E7NA 4TWWA 3QTOH 1Z8JB 1GCDA 2BLOA 1TGNA 3HPTB 1TALA 1LQDB 2C4FH 1GDUA 1C4Y2 1OP0A 1ZHMA 4U32A 3U8TH 4X6MA 2Z3DA 2FM2A 2AMPA 2GZ9A 3RU4E 2NU1E 1C1NA 1WQSA 3TJVA 1TGBA 4A5TS 1FAXA 1K1IA 3RXSA 3PTNA 1V2ST 5AHGH 1DDJA 1QQ4A 2PKAA 1HAHH 1TONA 2W7UA 2ZFRH 4CRCA 2A2XH 4NZLA 2EEKA 5G4BA 1LHCH 3S9BA 4NSYA 2Z94A 4BAOB 1JWTA 4FVBA 1HV7A 1HNEE 1UHBB 3PB1E 1SGFG 3RC4A 1TOCB 4X8SH 1SQOA 1IAUA 1EKBB 2A0QB 1YPHC 2Y7ZA 3QZRA 4Y79A 4ASHA 1HCGA 5E2PA 5EU8A 3GDVA 3HATH 3LC3A 1D4PB 3VEQB 2FDAA 4QT8C 5DJ7A 4Q2KA 1MBMA 3BV9B 5JBTA 3P8NA 4R8TB 4WH6A 3AAVA 1P57B 3PTBA 2VIVA 2H9TH 2P3TB 2RCEA 4BANB 2PW8H 5DP9A 5JYIA 1AE5A 1V3XA 3A7YA 1MCTA 1VITH 3BTQE 5F8ZA 2GT7A 2FWWA 5EPNA 1VCWA 5C2ZA 3GCOA 2J94A 5K7RA 1B7XB 4GUXA 1HJ8A 1YGCH 1SLVB 5EW1H 1AMHA 4X1QU 1C2EA 5FX6A 2OC8A 1BJUA 2ZDLA 5HMAA 4BXWA 2J2UA 3SNBA 4XBDA 4WXVA 1L4ZA 4YO9A 3BEUA 1EP6A 2Z9KA 1GI1A 1MBQA 2SGPE 3ZZDA 4UEHH 1TNJA 2ZDMA 1O3NA 1EZQA 4O3UA 5HYOA 1MKWH 3EA8A 3C27B 2OBQA 3LONA 1P2JA 2M5TA 1SGYE 1O5BB 1HAPH 4RKOB 3ITIA 4SGBE 1GBBA 3RUOA 3AW0A 1FY4A 3BTTE 2SGDE 1SR5C 1O39A 3V0XA 2OQUA 3SUEA 3LGIA 1C5LH 1GBIA 4X1RU 2GMTB 1RS0A 2BTCE 5SGAE 2BD9A 1OSSA 1JIRA 1Y5UT 2FO9A 3IWMA 3SI3H 3UOPA 4AFUA 2BY8X 3TPIZ 1MU8B 1Y3WA 3SGBE 3FP8E 1GBTA 2AEIH 3GDSA 2UWLA 3TNTA 4ABFA 1UCYK 3RLYH 4E7RG 2GMTC 2WV4A 3DD2H 3E16B 4X8UH 1C1WH 4OS4A 1LPZB 2HRVA 1MAYA 3RMOH 2ZF0H 1ZGVA 3RXRA 2FIRH 1MTVA 1BRCE 2XNIA 5FBIA 3ZZAA 2V3HH 1QB1A 2WYGA 3LGYA 2BQWB 1Y8TA 1BUIA 1GBCA 4B76A 1F0RA 1CHOG 1KSNA 2WPLS 5DG6A 1QJ6B 1G2MA 3LT3A 2ZNKH 1BOQA 5EQRA 1C2JA 1EZUC 3S7HB 1ZRBA 3PO1B 3M3SA 1TRNA 2FOMB 3ZZ7A 4WJG2 1KXCA 2THFB 5AVDA 3P17H 1V6DA 1YLDA 1QTFA 1BJVA 3A7TA 1T7CA 2BLQA 2VJ1A 4FU7A 4XOJA 2GKVE 1A3BH 3GY2A 3ESTA 2O8LA 1S85A 1ORFA 1ABJH 1GJAB 3IITA 3PO1C 1SBWA 1HAGE 3MFJA 1GBEA 1W2KH 2BDYA 4JZDH 5E2OA 1J17T 1B0EA 3NWUA 4I31A 1O34A 4KTSA 4E06H 2GV6A 1YPKH 1MUEB 8KME2 5K0HA 5GPIB 4MG3A 4MVNA 1DANH 2PV9B 4ISHH 3MNCA 2P59A 1G36A 2Q6DA 2P16A 4CH8B 5TCAA 2VIDA 1P10A 2GP9B 3K9XB 2O8TA 1EJAA 3VB5A 1EOJA 4RN6A 5J4SA 1A5HA 4OS7A 4B2CA 3BIUH 1QBVH 7LPRA 2A7CA 3LGUA 3SU6A 3RXBA 3A8AA 3PLPA 1HB0B 5EXLA 1LKAA 3SNDA 1OXGA 3KQBA 3A85A 3V3MA 2NU2E 1O3OA 3VB7A 4A7IB 1GHAF 4R0IA 1O37A 5GWZA 1ZYOA 3VB6A 1GBDA 1L0ZA 1P03A 1SLWB 1P05A 3Q3XA 1V2OT 1TYNA 5A8XA 2OUAA 3S9AA 7GCHG 2SGAA 5C1YA 2XWBI 1V2WT 3M7QA 1T8NA 1QCPA 5C1UA 1KTSB 1NS3A 3CP7A 4K8BA 1TA6A 2G51A 1Y59T 2F3CE 5EGMA 5JDUB 3LH3A 4XFQA 3F6UH 1PFXC 1TNHA 2GCHG 3TJUA 3GYMA 1YPGH 1UCYE 1T8LA 2FI4E 5DK1A 2P8OB 5B6OA 3LGVA 1HFDA 1S0QA 1SLXB 2G55A 4UE7H 1GBJA 2ZZUH 4FU9A 3KQCA 1BRBE 1KXAA 3UNSA 2AH4X 3CS0A 1PQ8A 2ZFTA 1JMOH 2ZGJA 5PTPA 3W94A 2BOHB 2P8OC 5EXNA 1ZMNA 2VWMA 3NUMA 2FI3E 1BA8B 1D3TB 4XSKU 3VXEH 1E37B 1C5YB 1G3BA 2SGQE 4ZXXH 4GHTA 2XYAA 1EAWA 3U9AH 1TGCA 4Y71A 4DGJA 2BDHA 1FONA 3SJKA 1TQ0B 2ZTYA 2VVUA 1FY3A 2FXRA 2HPQH 3FANA 3VXFH 5GXPA 3UQOA 4D8NA 1PPFE 3UUZA 3MO9A 3UNRA 1DLEA 2ODYB 3SN8A 5DKMA 1OWJA 3RXAA 5C1XA 3NZIA 1UVTH 1FUJA 2D26C 1BCUH 2Z7FE 3B8JA 3B9FH 2VH0A 4NA7A 1OS8A 1GI3A 4D76A 3GICB 3ZYDA 1E38B 2AYWA 3T26A 3BTFE 4ABDA 4BAMB 3D49H 1CT0E 2YNAA 4K1SA 3BTEE 2AMQA 2ZEBA 1BZXE 2FOCA 2ANMH 1UTOA 1C4V2 1PYTD 1NFUA 1BTUA 4GSOA 1D9IA 1C5QA 2ZCLP 4O03A 1GI5A 1HXEH 1EJMA 4BTIB 1VGCB 1HAOH 2FOFA 3D65E 1MTNB 1S6HA 2NU3E 4BOHA 1O2RA 5EQSA 3S69A 1TX6A 1WV7H 1OYTH 1VCPA 3AAUA 1LKBA 1XVMA 3RC6A 1LHEH 1XUHA 2ZFQH 1INCA 1VGCC 2ZTXA 4GLYA 1MTNC 2OLGA 1CGIE 3HKJB 5A0BA 2Z3CA 1GJ7B 1NZQH 1W10U 1Z8GA 1TA2A 1BTXA 4MNYA 2J4IA 1SGFA 1V2MT 1P04A 1C5MD 4Y0ZE 4ZMAH 1WAYB 3RXUA 3KF2A 1AKSB 1DFPA 5FBEA 4ESTE 2XCFA 5C3NA 1DXPA 1M9UA 1EAIA 1EAXA 3EAJA 1NU7B 3L3TA 5CHAB 1WTGH 1A7SA 1H8DH 1S6FA 2ULLA 1Z8IB 4JZFH 2FI5E 4HI3A 1QURH 3DFLA 3F9EA 1NC6A 1PPEE 4YLUA 1IOEA 1EOLA 5CHAC 2HNTE 1BT7A 1P0SH 1TPOA 2F91A 2O8UA 1EXFA 1BHXF 1FI8A 1C2DA 1VITF 3R0FA 5CE1A 2ZHWH 2PWXA 3TJOA 1Z1JA 1QB9A 4ABAA 2ZGXH 3OY5U 2Y82A 4NG9H 2O9QA 3EQ0H 1IQLA 1V2JT 4FUJA 3NPSA 2RG3A 6GCHF 4M7GA 2XWAA 1ZPCA 1NRRH 3GDUA 1V2VT 2GDDA 4WXIA 1RXPA 1DY8A 1C1RA 1O2VA 3BEFB 4ABBA 3PV4A 5T6DA 3I77A 1C2FA 1L1GA 2A1DB 2VIPA 1RIWB 4ABGA 2QY0B 3ATLA 3A82A 1FXYA 3AVZA 3MWIU 2BZAA 1HJAB 3BF6H 2ZU1A 4I33A 1EP5A 2A7JA 1GGDB 3T62A 4AORA 5C5OA 3QX5H 1C5OH 1ZRKA 3MO6A 1RIWC 1P9SA 4I8KA 4MNVA 4NFFA 4NWLA 4RSPA 1C2IA 4IC6A 3M3TA 3MH7A 3O8RA 2Z6BD 3E91A 2AFQB 2PUQH 1O3CA 3PWBA 3TK9A 2AGGX 1B0FA 1DICA 1HJAC 1KLJH 1AVXA 1LVOA 1A0HB 2PGQB 4X8TH 2R0LA 1AUTC 5JPMH 5JBAS 3K2UA 1CSOE 2ALVA 3OX7U 1TWXB 5F8TA 1L4DA 1FN8A 2H2ZA 1V2LT 2BOKA 5JB8S 3TJNA 1XKAC 3SU3A 4XE4A 1O33A 4YOIA 2G5VA 3ZVEA 1GI4A 4TWYA 4YT7H 1LVBA 6CHAB 2ZU2A 4BXSA 5F03A 1ELTA 1P11E 1CA8B 2FOBA 2TGAA 1DS2E 2TPIZ 2QF0A 2EI7A 1W0ZU 3A8BA 3QDZB 1A46H 1GWAA 1CQQA 1FZZA 1G2LA 3H5CB 1GBHA 2CGAA 1SGQE 1O2GH 6GCHG 5C67A 6CHAC 3ZVDA 2H9EH 1G32B 2B0FA 2STBE 4ZAEA 4X0WU 1MTSA 1TBZH 4AFQA 4D7GA 1THPB 1C5WB 3ZVCA 1ZGIA 1UVSH 1C1TA 3DUXH 1P2IA 1ZMLA 1YPMH 4INHA 3TH3H 2C8XB 1UTKA 4X1NU 3QGJA 5C20A 5F6MA 2ZDKA 1UVPA 3MU0A 1CGHA 2QXJA 1AKSA 1RTKA 1GHXH 2ZQ2A 3B23B 3SJIA 2JH0D 1GHVH 4JYTA 5GDSH 1GBLA 1NPMA 1W3CA 4OS2A 2FTLE 1ESAA 1TGTA 3LJJA 1HAVB 1T4UH 1Y5AT 5E0GA 5EXMA 4WH8A 3TU7H 1LO6A 4ZROA 3W95A 4WMEA 5IYTA 1AU8A 5I25A 5JB9S 1LPGB 1C1UH 1PPZA 1C1SA 3SV6A 4NSVA 1O2JA 3E90B 3ZVGA 1LCYA 2IOTA 1OOKB 2FZZA 3F1SB 1CVWH 4AG2A 5E8EH 4PROA 2C8WB 2XC4A 4YESB 4CREA 1AB9B 2OC0A 1QHRB 1UTQA 1SGNE 2GD4B 3P8OA 1DPOA 1NTPA 3HK3B 4B2BA 3VGCC 4ISIH 5T3HA 2ANYA 4ISLA 5LH8A 1TAWA 1GMHG 1W13U 2Z9JA 4IN2A 4I8JA 1AB9C 5TJXA 3RXOA 3G01A 2H5DA 1UK2A 1BMNH 1FN6A 1O3HA 2PSYA 2HPPH 2Y5GA 1QY6A 4WF8A 1JIMA 1H9IE 3PMJA 1YM0A 1GDNA 4AYYB 3BTDE 1HUTH 3OU0A 2JETC 1KXDA 3SHCH 1P2QA 1GPZA 1CBWB 3RMMH 4FUBA 4I8LA 4DIHH 1C5SA 1GJ9B 5DP5A 2Z9GA 2GVFA 3M35A 3QO6A 2Z9IA 3TGJE 1Z8RA 2XTTB 2K1QA 3T29A 1CBWC 1GI6A 4INLA 1ELFA 4MLFB 1H9LB 1J14A 3SGAE 3JZ1B 1DSUA 4ABIA 3URDA 1S84A 4FXGH 1CHOF 4HZHA 1ZLRA 2F9PA 1WU1A 2UUJB 2W7SA 1PQAA 4I32A 4TYDA 3PM3A 1P06A 2FTMA 4NIVA 2KAIB 4BAKB 1ANBA 4UONA 1Q3XA 1O2PA 2FOGA 2SGEE 1O2QA 1LPKB 3M7TA 1KXBA 4UFFH 5EODA 4ZKSU 3VPKA 1PQ5A 1GI7B 2ASUB 4B73A 1ZTJA 4Y76A 1AN1E 1QJ1B 3KGPA 5FPTA 1GCTB 2A4GA 1NFXA 1ESTA 1HLTH 1ETRH 1YCPK 3MYWA 1L2EA 4DIIH 4B71A 1FY5A 1NRQH 3UPEA 2BD8A 1P8VC 1MH0A 2G4TA 2AMDA 1ZTKA 1GCTC 1EZSC 3AW1A 1YPEH 3LIWA 3KL6A 3QK1A 1XKBC 1HAZB 1RGQA 2TGTA 1AWFH 1GG6B 1W7GH 4K2YA 2F9UA 1TB6H 2YOLA 1N1LA 1SQTA 1UK4A 3UR6A 4ZHLU 1WBGB 1DT2A 2A5IA 4TY6A 3QWCH 2BZ6H 2ILNA 4WWYA 1BHXB 3DHKH 5IDKA 1Z71A 4BAHB 1ELAA 1KXFA 4MNXA 2WINI 1WSSH 3MHWU 4MPWA 4ZKNU 3I29A 3O8CA 1GG6C 5A2MH 1PPBH 4HTCH 3M3VA 4SGAE 4U30A 3RXMA 1TQ7B 4IC5A 1ZPBA 1C9PA 4ZUHA 4CRGA 1LHFH 1D6RA 4OGYA 1YPJH 5A8ZA 1HAVA 5L2YH 3UFAA 1AFEH 1SGDE 1O2ZA 3U1IB 2A5AA 1C1VH 4O3TA 1L1JA 2PLXA 2OQ5A 1XMNB 1O2SA 2CN0H