2SNVA

The refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
151
structure length
151
Chain Sequence
RLFDVKNEDGDVIGHALAMEGKVMKPLHVKGTIDHPVLSKLKFTKSSAYDMEFAQLPVNMRSEAFTYTSEHPEGFYNWHHGAVQYSGGRFTIPRGVGGRGDSGRPIMDNSGRVVAIVLGGADEGTRTALSVVTWNSKGKTIKTTPEGTEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINDBIS VIRUS COAT PROTEIN
publication title Refined structure of Sindbis virus core protein and comparison with other chymotrypsin-like serine proteinase structures.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Viral protein
total genus 27
structure length 151
sequence length 151
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1992-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2snvA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2snvA01
2ESTE 1QQUA 1LHCH 1Z6EA 1VCQA 1O3BA 2EI8A 1B0EA 3QTOH 1J16A 4XBBA 3TIUA 4FUEA 3AAVA 1W2KH 2HNTC 4TYDA 4B2AA 2A5AA 1IHTH 3VB4A 2ZCLP 1MBMA 2XW9A 1O3GA 7ESTE 4BAHB 3EYDA 1GCDA 4FU9A 1LPZB 5EGMA 1QL9A 2Z9GA 1CQQA 2CXVA 1XVOA 2OXSA 3V13A 2Z94A 2BTCE 1V2KT 3P6ZB 4H42U 2PHBA 1ZRKA 5GCHF 3E1XB 4AORA 2FZZA 3NPSA 1MZDA 5DKMA 1BOQA 3SUDA 5JB8S 5E0HA 1UO6A 2C93B 2I6SA 3SJKA 2P3FH 1C9PA 2STBE 4K69A 4X1RU 1Q3XA 1V2JT 3CS7A 4MNYA 4BNRA 1YBWA 3NUMA 3U8RH 5C1YA 3FP7E 3F9GA 2BVSH 4FU8A 3DT0H 4CHAB 1K2I1 3MO3A 4OS6A 1A1RA 1Z8GA 3A8BA 4JZDH 1P03A 2O8UA 4M7GA 4A1VA 1PFXC 1GPZA 4MLFB 1H1BA 1D3TB 1FN8A 1MD7A 1Y59T 1S0QA 1W3CA 5E8EH 3RXDA 4VGCC 1NC6A 1KSNA 1OWIA 2VH6A 3FANA 1ZJKA 1GBJA 1O3MA 2O9QA 3PMAB 2BY6X 3U98H 4X2WA 4UD9H 2NWNA 2FYQA 1GVLA 2BDIA 1V2ST 2ZFPH 3MWIU 1Y3UA 3KQCA 3V12A 4JYTA 1C2DA 5E0GA 1DITH 4CRDA 1C2GA 1O2TA 4I7YH 1NPMA 3D23A 1CHGA 4LOYH 1QFKH 3PLPA 4J1YA 1UTKA 1YPMH 2VWMA 2Z6BD 2ZZUH 1BHXF 1C1PA 2BDYA 1GBMA 1IAUA 3H7TA 1DY9A 1U6QA 3RC4A 3ENSB 3ZZCA 4ABJA 1JWTA 2ZP0H 4K8YA 4OS4A 4DW2U 3DUXH 2ZC9H 1NO9H 1IQLA 1S5SA 1T8MA 3DHKH 1C5PA 4WY3A 1SL3A 2QCYA 1P0SH 1NRQH 1ZPZA 2PTNA 3KEEA 3MNBA 1BCUH 5FXLA 3SU1A 1LKBA 1NRRH 1QNJA 4MPXA 1DANH 3ZYEA 4BAQB 4X1NU 1LVBA 3LGWA 5TCCA 2KAIA 3SNEA 2VINA 2PUXB 2R3YA 4KTUA 3RLYH 2A0QB 1VZQH 2JETB 2A2QH 2BHGA 4YT7H 1SG8B 1YC0A 1ARCA 4JK5A 4ASHA 4Y10E 4ZKOU 3FP8E 1V3XA 1ABJH 1JBUH 4GCHF 3A80A 4ISIH 3VPKA 4ZMAH 5EOKA 4B74A 4TY7A 1GJDB 4FVDA 1FY8E 1T8OA 1EZQA 3PMBB 3GISB 2WV5A 1MTUA 4IN2A 2R0LA 3FFGA 1YPEH 3PLKA 5EPNA 2PV9B 1W10U 1UVOA 3RXRA 3RM2H 5L2YH 1W0YH 3BTHE 3M61U 1GHYH 1T8LA 2DE8A 1V2LT 2BDGA 2VIQA 1TGCA 3E6PH 4NA7A 1SC8U 1CGJE 1K1LA 2G8TA 1O5BB 2JH6D 1Z1JA 2ZQ1A 5J4QA 2V0BA 1F2SE 2EA3A 2GP9B 2JH0D 1TPAE 1E34B 2G4UA 2H2ZA 2D26C 1ELVA 4CRAA 1GBCA 1G37A 1HAXB 2ZFSA 2H9TH 1PPGE 2J95A 4AB8A 1ESBA 1UHBA 1QB1A 4Y79A 2HALA 2WPMS 3PTBA 2Y5FA 1MKXK 4X6MA 1KXBA 4Y0YE 1MTNC 3M7TA 1BRUP 4FUCA 3BTDE 2BM2A 4Y76A 1ZLRA 2SGDE 1GCTB 1D4PB 1SBWA 4MQAA 4OGYA 1HAIH 3SU0A 1C2HA 1XMNB 3RXSA 3U1IB 2O8WA 1YGCH 1BZXE 1N8OB 3RDZA 1SMFE 1C1WH 1C2EA 2PUQH 3HK3B 3PMHB 3LH3A 2VIWA 6ESTA 5EG4A 2AS9A 1C1MA 4MNXA 1SLXB 4AGJA 1P9UA 1E36B 1DLKB 1GGDB 1GBEA 2ZHEH 3OSYA 1WYKA 1HDTH 3TJOA 3ESTA 1CSOE 4WXIA 1MBQA 2WUCA 1A2CH 1BRCE 1RTKA 2FTLE 2QIQA 2UUJB 2OUAA 3ZZ3A 4HFPB 3BEIB 2ZU1A 2LNCA 2YOLA 1DICA 5FCRA 1K21H 2R9PA 3URCA 5JBTA 1HB0B 1P2OA 1ZTKA 4KELA 4WVPE 1O3AA 1A3EH 1KTTB 4X1SU 3LOXA 4DJZB 1IQJA 1NESE 3PB1E 3SJIA 4JZFH 2FIRH 2LPRA 4K3JA 1S83A 2BQ7B 2ZHWH 1GL0E 3ZVDA 3TH4H 3RXKA 2ZECA 2STAE 1QJ7B 2FOHA 1TYNA 1TNJA 2XC0A 3BTKE 1GJ5H 4ISLA 1W12U 3Q3XA 1GHVH 3NK8A 3SI3H 4MNWA 1EB2A 1OYTH 2F9NA 4R0IA 3PO1B 2P8OB 2GKVE 2ZDVH 3A83A 1BTWA 3OY6U 3LPRA 3OTJE 3C1KA 1O5AB 2AFQB 4B75A 4E06H 2GVFA 3TK5A 3F1SB 4CHAC 2C4FH 4MPUA 5I46H 3RXAA 2J92A 3GY5A 1G3CA 2BY7X 4AYVB 5EXMA 1AHTH 1AU8A 2B7DH 2R2WU 3P8NA 2PWXA 3C27B 3HATH 2Q6DA 1YPHE 3I78A 2F9BH 1DLEA 1P57B 3NZIA 3EGKH 4IC6A 3M5MA 1L4ZA 4NFFA 2Z7FE 3RU4D 2B9LA 2THFB 1FI8A 3VEQB 1ZSJA 1S0RA 1K9OE 1CHOF 4WJG2 2PKAB 1W7XH 3RLWH 2FOFA 1NRPH 1SPJA 3BIUH 1TWXB 2PR3A 4I33A 1DT2A 2H5CA 2XTTB 7GCHG 2PKSC 1AQ7A 1EAWA 4CRGA 4SGAE 2EEKA 1PPEE 3MHWU 1SGCA 2BZ6H 4YO9A 1RJXB 3ZZ9A 1NTPA 1KLIH 3A8AA 3SU6A 2P59A 3TU7H 2A32A 3SW2B 4ZKNU 3SNAA 3RXTA 5GWZA 3QLPH 1GJBB 2Y5HA 3QX5H 2F91A 4Y6DA 1RXPA 1LPKB 1AUJA 2FPZA 4Y7AA 3IWMA 2AIPA 4OS7A 1C2FA 2ZKSA 1EOLA 1O2VA 2XCNA 4GHTA 2IOTA 4MNVA 1FV9A 3JZ2B 3BTTE 2ZGJA 1NFYA 1WU1A 1O2PA 1YLDA 1S81A 1TALA 3BG4B 2RA3A 2C8WB 1DWEH 3GICB 5C1XA 1YPGH 1SQTA 2ZGXH 2BY8X 1KYNA 3UUZA 2BVRH 4Q7XA 4CR5A 2ANWA 2J4IA 4NZLA 4UONA 1VITG 1G9IE 1E38B 4ZROA 2BOKA 2QN5T 2WV4A 1ETRH 3GY8A 1V2QT 5GIBA 2HOBA 4MTBA 1DWCH 1J9CH 1FQ3A 4ABGA 3SNDA 1GVKB 1EPTC 4NG9H 5EW2H 5A0CA 5C2ZA 2Z9JA 2VVCA 4DIHH 1ELTA 3E0PB 3NWUA 3TK6A 3O8RA 1CA0B 3HKJB 4RKJB 3T2NA 1O2ZA 2A2XH 3CP7A 3RMLH 4TWYA 3BTGE 2FS8A 5AF9H 2HRVA 1QB6A 1O3LA 1W11U 3PLBA 4ABFA 4D9QA 2I6QA 1CU1A 2C8ZB 1FPHH 2TGAA 3P8GA 1A5GH 1GI9B 4XBDA 4HTCH 4NCYA 1DUAA 1FY5A 1NN6A 1LO6A 5GJ4B 2ZDAH 1H9LB 3MU1A 2IPHA 1EOJA 1THPB 2BY9X 5DK1A 1OSSA 3TGIE 1QBVH 4MVNA 2QC2A 1K1NA 1BBRH 1AWHB 2A4OA 2TBSA 4Y8XA 1XX9A 1P2KA 2VVUA 1C1NA 3UOUA 1DM4B 1GMCG 2ZNKH 4X1PU 3TLOA 4UFDH 1SLVB 4TY6A 1SGYE 2F9VA 1NS3A 1YPLH 1C5TA 4U01A 1QL8A 1ARBA 2FEQH 4U32A 2GT7A 5L2ZH 1GI7B 1NFWA 2BD5A 7GCHF 3BTME 2GV7A 1GG6B 4IMZA 1TNHA 2QF0A 3MNCA 4K1EA 1HGTH 1J17T 1TQ0B 3LJJA 1MU6B 3F6UH 1DS2E 3ZZ6A 4SGBE 3S9CA 1AFEH 3ZZ7A 4Z0KA 3TVJB 4HI3A 4ZHAA 1GBTA 1O5EH 5DP5A 5FPSA 3BF6H 3D65E 2V3OH 3AW1A 3SJ8A 4B2CA 1ZHRA 3O8BA 2J2UA 1QURH 4BXSA 3SOSA 4H6TA 5EU8A 1C1OA 3ZV8A 1SGNE 3RC6A 9ESTA 1UK4A 2M5TA 4D7GA 2HNTF 1QRXA 4BXWA 1AO5A 1C1RA 3E90B 3LU9B 2Z9KA 3BTWE 4I8GA 3TH3H 1DE7H 2BY5X 4I31A 1FJSA 1BTPA 2OC1A 1FIZA 3U9AH 1P01A 1ZRBA 4WWYA 2ODYB 3RXMA 1GHAG 1PQAA 2QY0B 1GMHF 3A7TA 3GDVA 2SGPE 1Y3YA 1QBOA 4K8BA 2G4TA 3FVFB 4BAMB 1O2NA 2ALPA 5I25A 2ANYA 4IBLH 1IQIA 2A4GA 1BDAA 2Q1JA 1XKBC 1MKWH 1TX6A 4YESB 1KDQB 1P9SA 2ZA5A 2ZEBA 1AB9B 5T6FA 1QRWA 1S6HA 5FHTA 2VIPA 3RXVA 1F0SA 1WUNH 1YF4A 3U1JB 3RXCA 1HIAB 1GJ7B 5A09A 1O30A 3LKWA 3TK9A 1W7GH 1ANCA 1P05A 1UTLM 2CHAC 1P02A 1V2OT 2GMTC 3MH5A 1FDPA 3PYHA 4BAKB 3UR9A 4AYYB 2AH4X 1MH0A 2GCHG 1V2NT 1TONA 3PV4A 1G3BA 1HJ9A 2CF8H 1C5VA 1F92A 1GDNA 3OYPA 1GDUA 2NU3E 4X0WU 4Y71A 1C2JA 1AVGH 3SBKA 3E0NB 3BSQA 3SORA 1B0FA 4YOJA 2K1QA 1QIXB 1OOKB 1TA2A 3VB5A 2VIDA 1W14U 2SFAA 1QTFA 3RXGA 4IN1A 2G52A 3TITA 1FIWA 3MU4A 4HZHA 4D7FA 1ANDA 4B2BA 1QBNA 1INCA 3QGJA 1O2SA 3LONA 1RS0A 1QY6A 2SGFE 4XFQA 1AFQB 1ZGVA 3E8LA 3NCLA 1GL1A 2UWPA 3TJUA 5L6NH 3G01A 1YPKH 2V3HH 2Z3DA 3T62A 3UOPA 1GI0A 2WYJA 5C5OA 2Y7ZA 3D49H 3ITIA 3RXJA 1PPZA 3AW0A 1ELBA 1SGFG 8ESTE 4TPIZ 2FM2A 2GGVB 3I29A 1G2MA 1ELAA 1O5FH 1V2VT 2BZAA 3RXBA 1TGBA 2H1UA 1T32A 3MI4A 4FUDA 1RIWC 1EAUA 2GDDA 3W95A 1C1SA 4ABEA 2QXHA 1OYQA 3DA9B 4ZKRU 2XBWA 4BAOB 4E05H 4NA9H 3UWIA 3LGTA 4UFGH 2CV3A 2ZFQH 1C2IA 1HXFH 3UY9A 2VGCB 4X1QU 4XBCA 2ZGHA 4Y8ZA 3VB3A 2ALVA 4F4OC 4CRCA 1BMAA 3GY7A 4BTUB 1F7ZA 1GMDG 3MO6A 4NIVA 1Z71A 1GHAF 4A6LA 1PQ5A 1ZSLA 1ELCA 3RC5A 3SJOA 1C5UA 1AKSA 1E37B 5C20A 1K1OA 1TAWA 3R0FA 3IG6B 1O2KA 5C67A 1MD8A 3PROA 2OTVA 1L0ZA 1HAVB 1FY1A 1V2WT 5LH8A 1RGQA 1WV7H 5C1UA 1A0JA 3ZZ5A 2P3TB 1HAGE 3STJA 5EQQA 3MU8A 1ZTLA 1NT1A 1PPHE 1O33A 5GDSH 1TBRH 6GCHG 2ODQA 1GBDA 5FX5A 5AHGH 2C8YB 4ABBA 3M5NA 2PSXA 5FPTA 5ESTE 2FXRA 3ATLA 2XXLA 2BDHA 3KHVA 1BBRE 1D3QB 2VIOA 4B1TA 2FP7B 3EA8A 3IITA 1UTPA 3KF2A 1O2RA 3E3TA 4YLUA 4AG1A 4JK6A 4OS2A 1ELFA 4GPGA 1O2HA 1CO7E 1SQOA 5DP7A 1TIOA 4AG2A 2OQ5A 2QXIA 3MU0A 5LPFA 2TGTA 1FY4A 4FUFA 2F3CE 3P8OA 4CBOA 4B73A 3DFJA 4Y7BA 1YLCA 3F9HA 1BRAA 5CE1A 9LPRA 1UTOA 3MH6A 1A5HA 2Y81A 4NWLA 3A87A 2AIQA 4UFEH 1JIMA 2FI4E 2GTBA 1X7AC 1JIRA 1GJ6A 1VGCC 3WY8A 2BMGB 3ATIA 1BTUA 3PMJA 2ZU2A 6CHAC 4KGAA 4FUHA 3M7QA 1Y5BT 1TABE 1Q31A 2SGAA 5CHAB 3D62A 1IQMA 2D2DA 4Q80A 4NIYA 5F03A 1PYTC 1Z8RA 2R2MB 1C5ZB 2A7HA 3SV2H 1TPOA 2BLVA 4FXGH 2C3SA 1HAHH 2BD8A 2ZU4A 2SNWA 1WQVH 4GHQA 2AEIH 2HLCA 1Z8JB 1CBWB 3ODDA 1OS8A 3QK1A 4I32A 1S85A 1C2MA 4ZHMU 1IQGA 2HPPH 2UUKB 1Y3WA 3K6ZA 4H4FA 4FU7A 4THNH 2BLWA 4X2YA 2B0FA 1LQDB 1QR3E 3RXOA 2R3UA 1O37A 1UVUH 1ZMJA 4J2YB 3LGUA 4ABIA 5CMXH 1A46H 1P2MA 1SOTA 1HJ8A 3A7ZA 3T28A 8GCHG 3SJ9A 3EDXB 3RXUA 4AFSA 1FUJA 1EAXA 2AGIX 2ZPSA 1XUKA 4K60A 1JMOH 1ORFA 4A1XA 1SGEE 2W26A 1MQ6A 1O2OA 4LXBH 3VB7A 2FDAA 3HK6B 1BJUA 3LC3A 1BA8B 1EX3A 5EODA 4DY7B 2FOBA 3ZZ4A 1O38A 3ZVFA 3F68H 1HJAC 5JB9S 3SN8A 4O3TA 2W5EA 1EQ9A 4RSPA 4AGKA 4ISOA 3RP2A 3TPIZ 8LPRA 2AMPA 1QRZA 3GDUA 3ZZBA 3S7HB 3MU5A 1NRSH 1YCPK 1PJPA 1ID5H 5JDUB 1MKXH 2FWWA 1Y3XA 3S69A 2GX4A 2ZWLH 4NGAH 2XC5A 3RMOH 5T6DA 1C9TA 2XNIA 2DUCA 4ISNA 3KCGH 4YOGA 2GCTB 2ZDKA 5JPMH 1O3FA 1HIAA 1TNIA 3DFLA 1GJ8B 4AN7A 1EP5A 2UUYA 2Z9LA 3U8TH 1DY8A 1WAYB 2WPHS 3BIVH 1BRBE 1WQSA 2C8XB 3BTFE 1P3CA 1O5GH 1SGFA 2ZFFH 1MUEB 1ELGA 2TIOA 4X8SH 1TNGA 1VCPA 2F9OA 3U8OH 3GDSA 1WOFA 1GBLA 5EXNA 5B6OA 1O3OA 2C90B 1F5LA 4X2XA 1O5CB 3H5CB 2OP9A 1NU7B 1T4UH 1IQNA 3JZ1B 4UEHH 2PFEA 3A7XA 2A31A 1LVYA 1V2PT 2J9NA 1EZSC 4I8HA 2XWAA 1N1LA 3SQHE 1KLTA 4KP0A 3LGVA 4IC5A 1HXEH 1CA8B 3Q00A 1T31A 3OX7U 5K7RA 2VGCC 2ZDLA 7KMEH 5K0HA 2WYGA 4K2YA 4O97A 4BANB 2PLXA 1A0LA 3RU4E 5LPRA 2OC0A 3A82A 1P09A 2OC8A 1OP8A 4CH8B 2OINA 4INLA 1O39A 1ZJDA 3K9XB 1GBHA 2PSYA 3S7KB 1J14A 2R0KA 4NIXA 1BB0B 1Y8TA 1DDJA 5FX6A 1TX8A 2ZTZA 4DURA 2WPKS 2PW8H 2CN0H 8GCHF 4JYUH 1O3NA 4BOHA 1OPHB 1CT4E 2J34A 2BD7A 2H5DA 2OBQA 2F83A 1AI8H 1AWFH 3UNQA 4ZAEA 2Q6GA 3GYLB 4O9VA 1XUGA 3L6PA 1QA0A 4R8TB 2HPQH 1J15A 4DT7B 3FAOA 1O3KA 2DE9A 1GBKA 1MMJN 2BDAA 1K1IA 1NRNH 4GUXA 1JRTA 1FMGA 2CJIA 7LPRA 2P93A 1NFXA 1YKTA 3GCTG 2YNBA 1LCYA 4MPVA 5HM2A 5LGOA 1DXWA 1Y5UT 3SUGA 1E0FD 1P3EA 1UTQA 4Y0ZE 2JETC 4VGCB 1H9HE 2GV6A 3MH4A 4E7NA 2H9EH 2BX3A 4LZ1H 3KQEA 5EQSA 5ESBA 5F6MA 4YM9A 2QF3A 1G36A 4AFUA 1TGTA 2GZ7A 2ZQ2A 2H9HA 3A7VA 1QB9A 1SFIA 2FI3E 1TLDA 5HGGA 4DGJA 1A61H 1MTVA 2VJ1A 1C2KA 1NZQH 4RN6A 1EKBB 3RXFA 2KAIB 3FZZA 3RU4T 4X8UH 1RRKA 4Q7ZA 5AVDA 2BOHB 3UNSA 3F9EA 3M37A 2GZ9A 2WPIS 1XVMA 2J38A 2BDBA 1SGIB 1D6WA 1AE5A 1XM1A 4CRBA 6LPRA 1O2LA 1C4U2 1ANBA 3EQ0H 1K1PA 1TPSA 2FOGA 3SGBE 1KY9A 3EAJA 2ZHQH 5L30H 3A8DA 3LIWA 4TWWA 3I77A 3ZVCA 1LQEA 1GI5A 2ASUB 2PGBB 3SV6A 1TRYA 1HPGA 2FOAA 2QXGA 2ZU3A 1GWAA 5AFZH 4YT6H 1C1TA 2BB4A 1MAYA 1PQ8A 1THSH 2EC9H 1DUEA 3KIDU 1C4V2 5HMAA 4MPWA 1UVPA 5E2OA 1GCTC 4AOQA 1ZZZA 3KL6A 1SLUB 4D8NA 3ZZDA 2FLRH 1S84A 4F49A 3QZQA 1BUIA 1N8OC 3AAUA 3B8JA 1EASA 3W94A 2OD3B 2NU2E 3LH1A 2Y6TA 1K1JA 4K1TA 2HNTE 1UHBB 2PTCE 3SO3A 1EUFA 1O2GH 2O8MA 1GGDC 5GCHG 1TA6A 2ZO3H 1V2UT 4AB9A 4K5ZA 5JBAS 1P2IA 3KQBA 5DP4A 4UE7H 2BDCA 3M36A 2OC7A 1L2EA 1GJAB 1CGHA 3MTYA 3MMGA 4JMYA 1LVMA 2W3IA 1AVXA 2PGQB 3L33A 3SU5A 2TPIZ 1TMUH 1HAYB 1PPBH 1TNKA 3SQEE 2BLOA 2ZHFH 1GBIA 1BHXB 4MDSA 5FCKA 5A8XA 4LK4A 1TOMH 3S0NA 3L3TA 4GLYA 1C5QA 3HGNA 1ZHMA 1VITF 2RG3A 4WMDA 2G55A 4RKOB 1UCYH 3E16B 1TB6H 4CREA 1DVAH 1JRSA 4A92A 2ZTXA 2ZCKP 2XBYA 4YZUA 3RUOA 4ESTE 4JZEH 2BD2A 4PROA 1MTNB 3B23B 2VWOA 2G81E 4U2WA 1AMHA 4ZHLU 1GI2A 2EI6A 1WSSH 3GY2A 3SNBA 1WTGH 3DD2H 1SGRE 4DOQA 1M9UA 1GHWH 5FPYA 3PO1C 1Y3VA 2P8OC 2FX6A 2FMJA 3SUEA 4JZ1A 1TBQH 2ZGBH 3TNTA 2SGQE 4NWKA 1NROH 3V7TA 1C5SA 2QAAA 3A84A 3RMMH 1L4DA 5SGAE 4WMEA 1SGDE 3PWCA 2WUBA 1C1UH 2P94A 3GY4A 1D9IA 2FI5E 3A8CA 1XXFA 2ULLA 1AGJA 3A7YA 5DG6A 5BRRE 2OCVB 3VB6A 3MNXA 5TJXA 3A81A 5AFYH 1ESAA 1MAXA 3LDXH 4ZH8A 1GMCF 1NU9A 2ZTYA 5HYOA 2BQWB 1BMMH 2RDLA 2ZDNA 5E0JA 1DWBH 1O2YA 5T3HA 1A5IA 3SGQE 1THRH 3RXHA 3MH7A 2JH5D 3QGNB 4X8VH 4B71A 1TX7A 4FUBA 1KXEA 1TOCB 3Q3KA 3EA9A 1O3JA 2ZGCA 1YCPM 4ZXYH 1EJAA 1F0RA 3B9FH 2V35A 1TPPA 1NY22 1VJ9U 3RXEA 4GSOA 2FTMA 4MG3A 1TGSZ 1F5RA 5A8YA 1ZSKA 4IMQA 4YLQH 3P8FA 4GCHG 1P10A 1C5RA 1ZR0A 1FZZA 2GZ8A 1UVSH 2FX4A 3LGIA 1HLTH 4BTTB 1RTFB 3RXIA 1Z7KA 1OP2A 2VVVA 3LC5A 1AZZA 1Y5AT 3BV9B 1AN1E 3A7WA 1QJ1B 1MTSA 2H6MA 3ZVBA 1RFNA 1D6RA 3E91A 1C5NH 3LT3A 4X6NA 1W0ZU 3VFEA 3SV8A 5GXPA 1G30B 1H8IH 2A1DB 3GY6A 2PKAA 3BG4C 5A8ZA 1AY6H 4XSKU 4B76A 5BPEA 3ODFA 1PYTD 2G51A 2D1JA 1XUJA 2XC4A 3BN9A 3LGYA 4FUJA 4NSVA 1BTHH 2A4RA 1UTMA 1VCWA 1LMWB 4UFFH 1ABIH 5C3NA 4UDWH 3QO6A 4H6SB 1C2LA 2VH0A 5T6GA 1L1JA 1O3EA 2OBOA 5F8XA 1XUIA 1WCZA 1LTOA 1TRMA 3GY3A 1AZ8A 4E7RG 1C1VH 1NM6A 3MYWA 3SV9A 2HVXA 1VR1H 5JYIA 1ZTJA 3QWCH 3BEFB 2QGRA 1KTSB 5E2PA 1CA0C 1T7CA 3SZNA 1P06A 2PKSB 3ZVEA 3M3TA 4O3UA 5DP9A 3QZRA 3PWBA 1MTWA 3QDZB 2Y5GA 1OXGA 1BITA 1O3CA 2XBXA 1C5LH 2GCHF 1O2IA 1LVOA 3VGCB 1S6FA 1ETSH 1FNIA 1SR5C 1LHEH 1GI1A 1O32A 2VB0A 3V3MA 2A4QA 2BVXH 5EXLA 4U30A 2O8TA 5DPAA 4NZQA 1AD8H 2ZG0H 2XBVA 1SOZA 2WPLS 3UQOA 5A2MH 2FLBH 3OY5U 1OWDA 1FAKH 1GBBA 1HBTH 1O36A 2AYWA 5GPIB 5H4IB 5DGJA 3H7OA 4IGDA 1KXFA 3QUMP 2ZPQA 1P2QA 4ZUHA 3O8DA 3T29A 1GI8B 1OWKA 5HM9A 1XKAC 5DO4H 1GG6C 2B8OH 4ISHH 4Z6AH 1BTZA 3FZDA 1AUTC 3TJNA 1LHDH 3AASA 1RD3B 1BIOA 4FUGA 4DG4A 2ILNA 4CR9A 1O31A 4Y8YA 4JYVH 1KXAA 3R3GB 4NIWA 1RTLA 1EPTB 3ZYDA 1C5WB 4DVAU 2ANKH 4GVUA 4Y11E 4FVBA 5IDKA 3ZVAA 4A1TA 1AIXH 2CF9H 3OU0A 4INHA 3LJOA 2F9PA 2VNTA 2BX4A 1NFUA 2ZI2H 2J94A 2A7CA 2ZIQH 5DP3A 1HAZB 2RA0A 1CVWH 1ZHPA 2W7SA 2UWOA 3HKIB 1GMDF 3STIA 4X6OA 1ZYOA 1O3HA 1UCYE 1C5YB 3NKKA 1O35A 2NU4E 2BYAX 1BJVA 2QYIA 1AVWA 4Q2KA 3VXEH 2FOCA 3UWJH 4TPYA 5TCAA 1HYLA 1O3IA 2FODA 1EJMA 1KXCA 3BTEE 3M3VA 1UK2A 1CHOG 1AB9C 4ABDA 1P12E 3M5OA 1ZMNA 1OP0A 1LDTT 4XOJA 1P11E 1YPJH 2WINI 1TMBH 3P92A 2OLGA 3GCHB 3T5FH 4BTIB 1XXDA 4D9RA 6GCHF 1LHGH 2ZCHP 4WXVA 1V2RT 2Z3EA 5EPYA 1O2QA 1LHFH 3M35A 1SFQB 1IHSH 2BD4A 1VITH 3ATMA 4I8KA 2O8LA 1KLJH 1SB1H 2ZFTA 3Q3YA 2A45B 1ZGIA 1QHRB 4NFEA 2ZDMA 1HUTH 1GHXH 1BMLA 1HCGA 8KME2 1UTJA 1GJCB 1EZXC 2ODPA 1SHHB 5DP8A 1IQKA 1BTXA 1KDQA 1UJ1A 1P2NA 2SNVA 2VWNA 2D8WA 5ABWA 3SGAE 1AFQC 1ESTA 2QV1A 4DCDA 1BMNH 3MOCA 1GHZA 1GVZA 1UVTH 3BG8A 2GT8A 3GCNA 1H4WA 3UPEA 3UFAA 4X6PA 2VU8E 4WH6A 1MZAA 5IYTA 1ETTH 1F0UA 3MNSA 3ATWA 1L1NA 1MCVA 3P70B 4YTAA 1C4Y2 1HAPH 1MQ5A 2P16A 3URDA 2NU0E 5HXFA 1GI6A 1G32B 5EW1H 1ZPBA 2FOEA 2W3KA 4KKDA 1XUFA 5ETXA 3SNCA 2FOMB 3PM3A 2Y82A 2HGTH 1GI4A 2TGPZ 2XWBI 1C5OH 1OX1A 2ANMH 2QXJA 3MFJA 3ELAH 3ZZAA 1IQFA 3M5LA 1SGQE 2CHAB 3GOVB 1GBFA 2GMTB 5DP6A 4ZKSU 5G4BA 1S82A 1GHBG 1TNLA 2VIVA 2BQ6B 1BT7A 3SUFA 1YCPH 4ABHA 1EATA 1PQ7A 4KTCA 1ZPCA 1FONA 1JOUB 2RCEA 1UMAH 3TNSA 1O3DA 1D3DB 1A3BH 4Q7YA 1FY3A 5JBBS 1TBZH 1B5GH 1O2JA 4INKA 5FBEA 4WF8A 2FO9A 3UNRA 1DXPA 2SGEE 1O2UA 3KGPA 5JBCS 3AVZA 5DJ7A 1SHYA 4LZ4B 1PPFE 4JCNA 1O2XA 4XDEA 2ZPRA 1DX5M 1DSUA 2G5VA 3T27A 3RXQA 1K22H 1H9IE 4YOIA 3GYMA 1G3DA 2BLQA 2AERH 4NA8A 4I8JA 2W7UA 1AKSB 3VGCC 1SLWB 1L1GA 4FUIA 1A0HB 1V2TT 1OWJA 2OQUA 3M7UA 1QA7A 1G2LA 1FN6A 1CGIE 3Q77A 4A5TS 1O0DH 3A85A 3T25A 1V2MT 1O2MA 1K28D 2IN2A 1KXDA 1V6DA 1BQYA 3BEUA 3UTUH 1RIWB 1CE5A 3UIRA 2HWLB 1N6YA 1VJAU 4O03A 3F9FA 1GI3A 4WH8A 3U69H 2IJOB 2V6NA 1K1MA 1HAVA 3CENA 1ELDE 1GJ9B 2BXTH 1BBRK 2ZHDA 2P95A 1TFXA 1IQEA 3UQVA 1ZMLA 3EE0B 5EQRA 2P3UB 1UK3A 4AFQA 1QGFA 4D76A 1WTHD 3VXFH 1O34A 1HNEE 3RXPA 1ELEE 4OGXA 2UUFB 1GMHG 3A89A 3HGPA 3KNXA 3TJVA 2XRCA 3SV7A 1FPCH 4IS5A 1Z1IA 3S9BA 4GAWA 1F0TA 1C5MD 1C5XB 1ANEA 3A88A 1YPHC 1QCPA 5FAHA 5CHAC 1QQ4A 4XE4A 1JXPA 1AE8H 3K6YA 3GCOA 3SHCH 1TMTH 1TE0A 1O5DH 1ZOMA 1O3PB 2Y80A 2XYAA 1GHBF 3KN2A 4IW4E 3A86A 2A5IA 4OS1A 1CBWC 1BTYA 1EXFA 3KQDA 3P17H 2EI7A 2JKHA 3Q76A 2G00A 3TGKE 3K2UA 3PTNA 1MCTA 2Z3CA 1QJ6B 3QTVH 5J4SA 2ZFRH 2VWLA 2BXUH 1LPGB 1O2WA 1SGPE 4JZIA 3UREA 3EA7A 4ZXXH 2AGGX 1PPCE 1P04A 1QL7A 1SGTA 1XUHA 1TQ7B 2Q6FA 2ZU5A 2ZF0H 1FLEE 1KIGH 1CT0E 3SI4H 4DIIH 2FYRA 1H8DH 4AFZA 2A5KA 1OWHA 3P95A 1OWEA 4K1SA 1P2JA 2BD3A 1HAOH 3M3SA 1EPTA 1FAXA 2BD9A 3ZV9A 1ACBE 3SHAH 1B7XB 1W13U 1DSTA 2AGEX 4CBNA 1D3PB 1UCYK 4X2VA 1WBGB 5F8ZA 1HV7A 2AMQA 5A0BA 1SSXA 3ZZ8A 1MKWK 3RM0H 1DFPA 3RXLA 3RMNH 3GCHC 4CRFA 1W8BH 2GDEH 3UR6A 1GBAA 1VGCB 5PTPA 4AX9H 2F9UA 2NU1E 4AZ2B 1EAIA 6CHAB 2B5TB 3GCTF 3FP6E 1FXYA 2FESH 1SI5H 2Y7XA 2AMDA 3TGJE 3NXPA 1TRNA 1UTNA 4OS5A 1A4WH 3BTQE 4ABAA 2UWLA 4HGCA 1EZUC 4WMFA 3O8CA 1DOJA 1TGNA 1C1QA 1P8VC 1EJNA 5LPEA 2WPJS 4I8LA 2TRMA 1IOEA 1DPOA 5F8TA 1Z8IB 2GCTC 1EP6A 3T26A 5C5NA 3ATKA 2FS9A 2QA9E 3TH2H 2YNAA 1YP9A 1OKXA 1EB1H 3SU3A 1IQHA 2XCFA 1N6XA 3CS0A 3S9AA 1MU8B 1Q2WA 4A7IB 1G3EA 5A0AE 3V0XA 4CH2B 1Z6JH 3K65B 2TGDA 2G5NA 1J8AA 4KTSA 2CGAA 3QN7A 1T8NA 1YM0A 3MO9A 1DWDH 3HPTB 1F5KU 1HRTH 4X8TH 3SU4A 2CMYA 2Z9IA 1HFDA 5FBIA 1SQAA 1YYY1 1CT2E 3ZVGA 1SVPA 1T4VH 4NSYA 2GD4B 1A7SA 2A7JA 1GJ4H 3SU2A 1HJAB 1GDQA 1LKAA 1E35B 4QT8C 3N7OA
chains in the Genus database with same CATH superfamily
2ESTE 1QQUA 1LHCH 1Z6EA 1VCQA 1O3BA 2EI8A 1B0EA 3QTOH 1J16A 4XBBA 3TIUA 4FUEA 3AAVA 1W2KH 2HNTC 4TYDA 4B2AA 2A5AA 1IHTH 3VB4A 2ZCLP 1MBMA 2XW9A 1O3GA 7ESTE 4BAHB 3EYDA 1GCDA 4FU9A 1LPZB 5EGMA 1QL9A 2Z9GA 1CQQA 2CXVA 1XVOA 2OXSA 3V13A 2Z94A 2BTCE 1V2KT 3P6ZB 4H42U 2PHBA 1ZRKA 5GCHF 3E1XB 4AORA 2FZZA 3NPSA 1MZDA 5DKMA 1BOQA 3SUDA 5JB8S 5E0HA 1UO6A 2C93B 2I6SA 3SJKA 2P3FH 1C9PA 2STBE 2WZQA 4K69A 4X1RU 1Q3XA 1V2JT 3CS7A 4MNYA 4BNRA 1YBWA 3NUMA 3U8RH 5C1YA 3FP7E 3F9GA 2BVSH 4FU8A 3DT0H 4CHAB 5EIYA 1K2I1 3MO3A 4OS6A 1A1RA 1Z8GA 3A8BA 4JZDH 1P03A 2O8UA 3NRLA 4M7GA 1PFXC 1GPZA 4MLFB 4A1VA 1H1BA 1D3TB 1FN8A 1MD7A 1Y59T 1S0QA 1W3CA 5E8EH 3RXDA 4VGCC 1NC6A 4DT4A 1KSNA 1OWIA 2VH6A 3FANA 1ZJKA 1GBJA 1O3MA 3FOAA 2O9QA 3PMAB 2KFWA 2BY6X 3U98H 4X2WA 4UD9H 2NWNA 3OEHD 2FYQA 1E79D 1GVLA 2BDIA 1V2ST 4ASUD 2ZFPH 3MWIU 1Y3UA 3KQCA 2YMSD 3V12A 4JYTA 1C2DA 5E0GA 1DITH 4CRDA 1C2GA 1O2TA 5EJZA 4I7YH 1NPMA 3D23A 1CHGA 4LOYH 1QFKH 3PLPA 4J1YA 1UTKA 1YPMH 2VWMA 1WDIA 2Z6BD 2ZZUH 1BHXF 1C1PA 2BDYA 4F48B 1GBMA 1IAUA 3H7TA 3PRBA 1DY9A 1U6QA 3RC4A 3ENSB 3ZZCA 4ABJA 1JWTA 2ZP0H 4K8YA 4OS4A 4P02A 4DW2U 3DUXH 2ZC9H 1NO9H 1IQLA 1S5SA 1E1QD 1T8MA 1COWD 3DHKH 1C5PA 4WY3A 1SL3A 2QCYA 1P0SH 1NRQH 1ZPZA 2PTNA 3KEEA 3MNBA 1BCUH 5FXLA 3SU1A 1LKBA 1NRRH 1QNJA 4MPXA 1DANH 3ZYEA 2LELA 4BAQB 4X1NU 1LVBA 3LGWA 5TCCA 2KAIA 3SNEA 2VINA 2PUXB 2R3YA 4KTUA 3RLYH 2A0QB 1VZQH 2JETB 2A2QH 2BHGA 4YT7H 1SG8B 1YC0A 1ARCA 4JK5A 4ASHA 4Y10E 4ZKOU 3FP8E 1V3XA 1ABJH 1JBUH 4GCHF 5HKKD 3A80A 4ISIH 3VPKA 4ZMAH 5EOKA 4B74A 4TY7A 1GJDB 4FVDA 1FY8E 1T8OA 1EZQA 3PMBB 3GISB 2WV5A 3KYGA 1MTUA 4IN2A 2R0LA 3WWFA 3FFGA 1YPEH 3PLKA 5EPNA 2PV9B 1W10U 1UVOA 3RXRA 3RM2H 5L2YH 1W0YH 3BTHE 3M61U 1GHYH 1T8LA 2DE8A 1V2LT 2BDGA 2VIQA 1TGCA 3E6PH 1YLNA 4NA7A 1SC8U 1CGJE 1K1LA 2G8TA 1O5BB 2JH6D 1Z1JA 2ZQ1A 5J4QA 2V0BA 1F2SE 2EA3A 2GP9B 2JH0D 1TPAE 1E34B 2G4UA 2H2ZA 2D26C 1ELVA 4CRAA 1GBCA 1G37A 1HAXB 2JIZD 2ZFSA 2H9TH 1PPGE 2J95A 4AB8A 1ESBA 1UHBA 1QB1A 4Y79A 2HALA 2WPMS 3PTBA 2Y5FA 1MKXK 4X6MA 1KXBA 4Y0YE 1MTNC 1SKYE 3M7TA 1BRUP 4FUCA 3BTDE 2BM2A 4Y76A 1ZLRA 2SGDE 1GCTB 1D4PB 1SBWA 4MQAA 4OGYA 1HAIH 3SU0A 1C2HA 1XMNB 3RXSA 3U1IB 2O8WA 1YGCH 1BZXE 1N8OB 3RDZA 1SMFE 5GNDA 1C1WH 1C2EA 2PUQH 3HK3B 3PMHB 3LH3A 2VIWA 6ESTA 5EG4A 2AS9A 1C1MA 4MNXA 1SLXB 4AGJA 1P9UA 1E36B 1DLKB 2W6JD 1GGDB 1GBEA 2ZHEH 3OSYA 1WYKA 1HDTH 3TJOA 3ESTA 1CSOE 4WXIA 1MBQA 2WUCA 1A2CH 1BRCE 1RTKA 1FX0B 2FTLE 2QIQA 2UUJB 2OUAA 3ZZ3A 4HFPB 3BEIB 2QF5A 2ZU1A 2LNCA 2YOLA 1DICA 5FCRA 1K21H 2R9PA 3URCA 5JBTA 1HB0B 1P2OA 1ZTKA 4KELA 4WVPE 1O3AA 1A3EH 3FKSD 1KTTB 4X1SU 3LOXA 4DJZB 1IQJA 3F2HA 1NESE 3PB1E 3SJIA 4JZFH 2FIRH 1QZ8A 2LPRA 2AHME 4K3JA 1S83A 2BQ7B 2ZHWH 1GL0E 3ZVDA 3TH4H 3RXKA 2ZECA 2STAE 1QJ7B 2FOHA 1TYNA 1TNJA 2XC0A 3BTKE 1GJ5H 4ISLA 1W12U 3Q3XA 1GHVH 3NK8A 3SI3H 4MNWA 1EB2A 1OYTH 2F9NA 4R0IA 3PO1B 2P8OB 2GKVE 2ZDVH 3A83A 1BTWA 3F2FA 3OY6U 3LPRA 3OTJE 3C1KA 1O5AB 2AFQB 4B75A 4E06H 2GVFA 3TK5A 3F1SB 4CHAC 2C4FH 4MPUA 5I46H 3RXAA 2J92A 3GY5A 1G3CA 2BY7X 4AYVB 5EXMA 1AHTH 1AU8A 2B7DH 2R2WU 1VKYA 3P8NA 2PWXA 3C27B 3HATH 2Q6DA 1YPHE 3I78A 2F9BH 1DLEA 1P57B 3NZIA 3EGKH 4IC6A 3M5MA 1L4ZA 4NFFA 2Z7FE 3N99A 2KM0A 3RU4D 2B9LA 2THFB 2RFKC 1FI8A 3VEQB 1ZSJA 1S0RA 1K9OE 1CHOF 4WJG2 2PKAB 1W7XH 3RLWH 2FOFA 1NRPH 1SPJA 3BIUH 1TWXB 2PR3A 4I33A 1DT2A 2H5CA 2XTTB 7GCHG 2PKSC 5CHBA 1AQ7A 1EAWA 4CRGA 4SGAE 2EEKA 1PPEE 3MHWU 1SGCA 2BZ6H 4YO9A 1RJXB 3ZZ9A 1NTPA 1KLIH 3A8AA 3SU6A 2P59A 3TU7H 2A32A 3SW2B 4ZKNU 3SNAA 3RXTA 5GWZA 3QLPH 1GJBB 2Y5HA 3QX5H 2F91A 4Y6DA 1RXPA 1LPKB 1AUJA 2FPZA 4Y7AA 3IWMA 2AIPA 4OS7A 1C2FA 2ZKSA 1EOLA 1O2VA 2XCNA 4GHTA 2IOTA 3KQ5A 4MNVA 1FV9A 3JZ2B 3BTTE 2ZGJA 1NFYA 1WU1A 1O2PA 1YLDA 1S81A 1TALA 3BG4B 2RA3A 2C8WB 1DWEH 3GICB 5C1XA 1YPGH 1SQTA 2ZGXH 2BY8X 1KYNA 3UUZA 2BVRH 4Q7XA 4CR5A 2ANWA 2J4IA 4NZLA 4UONA 4FETA 1VITG 1G9IE 1E38B 4ZROA 2BOKA 2QN5T 2WV4A 1ETRH 4ZCNA 3GY8A 1V2QT 5GIBA 2HOBA 4MTBA 1DWCH 1J9CH 1FQ3A 4ABGA 3SNDA 1GVKB 1EPTC 4NG9H 3PV2A 5EW2H 5A0CA 5C2ZA 2Z9JA 2VVCA 4DIHH 1ELTA 3E0PB 3NWUA 3TK6A 3O8RA 1CA0B 3HKJB 4RKJB 3T2NA 1O2ZA 2A2XH 3CP7A 3RMLH 1SQRA 4TWYA 3BTGE 5HIYA 2FS8A 5AF9H 2HRVA 1QB6A 1O3LA 1W11U 3PLBA 4ABFA 4D9QA 2I6QA 1CU1A 2C8ZB 1FPHH 2TGAA 3P8GA 1A5GH 1GI9B 4XBDA 4F55A 4HTCH 4NCYA 1DUAA 1FY5A 1NN6A 1LO6A 5GJ4B 2ZDAH 1H9LB 3MU1A 2IPHA 1EOJA 1THPB 2BY9X 5DK1A 1OSSA 3TGIE 1QBVH 4MVNA 2QC2A 1K1NA 1BBRH 1AWHB 2A4OA 2OK5A 2TBSA 4Y8XA 1XX9A 1P2KA 1WXRA 2VVUA 1C1NA 3UOUA 1DM4B 1GMCG 2ZNKH 4X1PU 3TLOA 4UFDH 1SLVB 4TY6A 1SGYE 2F9VA 1NS3A 1YPLH 1C5TA 4U01A 1QL8A 1ARBA 2FEQH 4U32A 2GT7A 5L2ZH 1GI7B 1NFWA 2BD5A 7GCHF 3BTME 2GV7A 1GG6B 4IMZA 1TNHA 2QF0A 3MNCA 4K1EA 1HGTH 4XRNA 1J17T 1TQ0B 3LJJA 1MU6B 3F6UH 1DS2E 3ZZ6A 3UB0A 4SGBE 3S9CA 1AFEH 3ZZ7A 4Z0KA 3TVJB 4HI3A 4ZHAA 1GBTA 1O5EH 5DP5A 5FPSA 1EFRD 2K0QA 3BF6H 3D65E 2V3OH 3AW1A 3SJ8A 4B2CA 1ZHRA 3O8BA 2J2UA 1QURH 4BXSA 1MABB 3SOSA 4H6TA 5EU8A 1C1OA 3ZV8A 1SGNE 2HLDD 3RC6A 1UK4A 9ESTA 2M5TA 4D7GA 2HNTF 1QRXA 4BXWA 1AO5A 1C1RA 3E90B 3LU9B 2Z9KA 3BTWE 4I8GA 3TH3H 1DE7H 1W0KD 2CK3D 2BY5X 4I31A 1FJSA 1BTPA 2OC1A 1FIZA 3U9AH 1P01A 4ACBA 1ZRBA 4WWYA 2ODYB 3RXMA 3F2GA 1GHAG 2K8IA 1PQAA 2QY0B 1GMHF 3A7TA 3GDVA 2SGPE 1Y3YA 1QBOA 4K8BA 3MQKC 2G4TA 3FVFB 4BAMB 1O2NA 2ALPA 5I25A 2ANYA 4IBLH 1IQIA 2A4GA 1BDAA 2Q1JA 1XKBC 1MKWH 1TX6A 4YESB 4B6EA 1KDQB 1P9SA 2ZA5A 2ZEBA 1AB9B 5T6FA 1QRWA 1S6HA 5FHTA 2VIPA 3RXVA 2WV9A 1F0SA 1WUNH 1YF4A 3U1JB 3RXCA 1HIAB 1GJ7B 5A09A 1O30A 3LKWA 3TK9A 1W7GH 1ANCA 1P05A 1UTLM 2CHAC 1P02A 1V2OT 2GMTC 3MH5A 1FDPA 3PYHA 4BAKB 3UR9A 4AYYB 2AH4X 1MH0A 2GCHG 1V2NT 1TONA 3PV4A 1G3BA 1HJ9A 2CF8H 1C5VA 1F92A 1GDNA 3OYPA 1GDUA 2NU3E 4X0WU 4Y71A 1C2JA 1AVGH 3SBKA 3E0NB 3BSQA 3SORA 1B0FA 4YOJA 2K1QA 1QIXB 1OOKB 1TA2A 3VB5A 2VIDA 1W14U 2SFAA 1QTFA 3RXGA 4IN1A 2G52A 1YWUA 3TITA 1FIWA 3MU4A 5C94A 4HZHA 2F4LA 4D7FA 1ANDA 4B2BA 1QBNA 1INCA 3QGJA 1O2SA 3LONA 1RS0A 1QY6A 2SGFE 4XFQA 1AFQB 1ZGVA 3E8LA 3NCLA 1GL1A 2UWPA 3TJUA 5L6NH 3G01A 1YPKH 2V3HH 2Z3DA 3T62A 3UOPA 1GI0A 2WYJA 5C5OA 2Y7ZA 3D49H 3ITIA 3RXJA 1PPZA 3AW0A 3DSOA 1ELBA 5CDFE 1SGFG 8ESTE 3U28C 4TPIZ 2FM2A 2GGVB 3I29A 5HIZA 2JDID 1G2MA 1ELAA 1O5FH 1V2VT 2BZAA 3RXBA 1TGBA 2H1UA 1T32A 3MI4A 3PRDA 4FUDA 1RIWC 1EAUA 2GDDA 3W95A 1C1SA 4ABEA 2QXHA 1OYQA 3DA9B 4ZKRU 2XBWA 4BAOB 4E05H 4NA9H 3UWIA 3OAAD 3LGTA 4UFGH 2CV3A 2ZFQH 1C2IA 1HXFH 3UY9A 2VGCB 4X1QU 4XBCA 2ZGHA 4Y8ZA 3VB3A 4ACAA 2ALVA 4F4OC 4CRCA 2KCOA 1BMAA 3GY7A 4BTUB 2QF4A 1F7ZA 1GMDG 3MO6A 4NIVA 1Z71A 1GHAF 4A6LA 1PQ5A 1ZSLA 5DN6D 1ELCA 3RC5A 3SJOA 1C5UA 1AKSA 1E37B 5C20A 1K1OA 1TAWA 3R0FA 3IG6B 1O2KA 5C67A 1MD8A 3PROA 2OTVA 1L0ZA 1HAVB 3WW7A 2J97A 4M9FA 1YY3A 1FY1A 1H8HD 1V2WT 2KCAA 5LH8A 1RGQA 1WV7H 5C1UA 1A0JA 3ZZ5A 2P3TB 1HAGE 3STJA 5EQQA 3MU8A 4Q63A 1ZTLA 1NT1A 1PPHE 1O33A 5GDSH 1TBRH 6GCHG 2ODQA 1GBDA 5FX5A 5AHGH 2C8YB 4ABBA 3M5NA 3GS9A 2PSXA 5FPTA 5ESTE 2FXRA 3ATLA 2XXLA 2BDHA 3KHVA 1BBRE 1D3QB 2VIOA 4B1TA 2FP7B 3EA8A 3IITA 1UTPA 3KF2A 1O2RA 3E3TA 4YLUA 4AG1A 4JK6A 4OS2A 1ELFA 4GPGA 1O2HA 1CO7E 1SQOA 5DP7A 1TIOA 4AG2A 2OQ5A 2QXIA 3MU0A 5LPFA 2TGTA 1FY4A 4FUFA 2F3CE 3P8OA 4CBOA 4B73A 3DFJA 5KGOA 1BMFD 4Y7BA 1YLCA 3F9HA 1BRAA 5CE1A 9LPRA 1UTOA 3MH6A 1A5HA 2Y81A 4NWLA 3A87A 2AIQA 4UFEH 1JIMA 2FI4E 2GTBA 1X7AC 1JIRA 1GJ6A 1VGCC 3WY8A 2BMGB 3ATIA 1BTUA 3PMJA 2ZU2A 6CHAC 4KGAA 4FUHA 3M7QA 1Y5BT 1TABE 1Q31A 2SGAA 5CHAB 3D62A 1IQMA 2D2DA 4Q80A 4NIYA 5F03A 1PYTC 1Z8RA 2R2MB 1C5ZB 2A7HA 3SV2H 1TPOA 2BLVA 4FXGH 2C3SA 1HAHH 2BD8A 2ZU4A 2SNWA 1WQVH 4GHQA 2AEIH 2HLCA 1Z8JB 1CBWB 3ODDA 1OS8A 3QK1A 4I32A 1S85A 1C2MA 4ZHMU 1IQGA 2HPPH 2UUKB 1Y3WA 3K6ZA 4H4FA 4FU7A 4THNH 3WWBA 2BLWA 4X2YA 2B0FA 1LQDB 1QR3E 3RXOA 2R3UA 1O37A 1UVUH 1ZMJA 4J2YB 3LGUA 4ABIA 5CMXH 1A46H 1P2MA 1SOTA 1HJ8A 3A7ZA 3T28A 8GCHG 3SJ9A 3EDXB 3RXUA 4AFSA 1FUJA 1EAXA 2AGIX 2ZPSA 1XUKA 4K60A 1JMOH 1ORFA 4A1XA 2EY4C 2LP6A 1SGEE 2W26A 1MQ6A 1O2OA 4LXBH 3VB7A 2FDAA 3HK6B 1BJUA 3LC3A 1BA8B 1EX3A 5EODA 4DY7B 2FOBA 3ZZ4A 1O38A 3ZVFA 3F68H 1HJAC 5JB9S 3SN8A 4O3TA 2W5EA 1EQ9A 4RSPA 4AGKA 4ISOA 3RP2A 3TPIZ 8LPRA 2AMPA 2V3MA 1QRZA 3GDUA 3ZZBA 3S7HB 3EE7A 3MU5A 1NRSH 1YCPK 1PJPA 1ID5H 5JDUB 1MKXH 1NBMD 2FWWA 1Y3XA 3S69A 1S6LA 2GX4A 2ZWLH 4NGAH 2XC5A 3RMOH 5T6DA 1C9TA 2XNIA 2DUCA 4ISNA 3KCGH 4YOGA 2GCTB 2ZDKA 5JPMH 1O3FA 1HIAA 1TNIA 3DFLA 1GJ8B 4AN7A 1EP5A 2UUYA 2Z9LA 3U8TH 1DY8A 1WAYB 2WPHS 3BIVH 1BRBE 1WQSA 2C8XB 3BTFE 1P3CA 1O5GH 1SGFA 2ZFFH 1MUEB 1ELGA 2TIOA 4X8SH 1TNGA 1VCPA 2F9OA 3U8OH 3GDSA 1WOFA 1GBLA 5EXNA 5B6OA 1O3OA 2C90B 1F5LA 4X2XA 1O5CB 3H5CB 2OP9A 1NU7B 1T4UH 1IQNA 3JZ1B 4UEHH 2PFEA 3A7XA 2A31A 1LVYA 1V2PT 2J9NA 1EZSC 4I8HA 2XWAA 1N1LA 3SQHE 1KLTA 4KP0A 3LGVA 4IC5A 1HXEH 1CA8B 3Q00A 1T31A 3OX7U 5K7RA 2VGCC 2ZDLA 7KMEH 5K0HA 2WYGA 4K2YA 4O97A 4BANB 2PLXA 1A0LA 3RU4E 5LPRA 2OC0A 2XOKD 3A82A 1P09A 2OC8A 1OP8A 4CH8B 3DSGA 2OINA 4INLA 1O39A 1ZJDA 3K9XB 1GBHA 2PSYA 3S7KB 1J14A 2R0KA 4NIXA 1BB0B 1Y8TA 1DDJA 5FX6A 1TX8A 2ZTZA 4DURA 2IJD1 2WPKS 2PW8H 2CN0H 8GCHF 4JYUH 1O3NA 4BOHA 1OPHB 1CT4E 2J34A 2BD7A 2H5DA 2OBQA 2F83A 1AI8H 1AWFH 3UNQA 4ZAEA 2Q6GA 3GYLB 4O9VA 1XUGA 3L6PA 1QA0A 4R8TB 2HPQH 1J15A 4DT7B 3FAOA 3CNRA 1O3KA 2DE9A 1GBKA 1MMJN 2BDAA 1K1IA 1NRNH 4GUXA 1JRTA 1FMGA 2CJIA 7LPRA 2P93A 1NFXA 1YKTA 3GCTG 2YNBA 1LCYA 4MPVA 5HM2A 5LGOA 1DXWA 1Y5UT 3SUGA 1E0FD 1P3EA 1UTQA 4Y0ZE 2JETC 4VGCB 1H9HE 2GV6A 3MH4A 4E7NA 2H9EH 2BX3A 4LZ1H 3KQEA 5EQSA 5ESBA 5F6MA 4YM9A 2QF3A 1G36A 4AFUA 1TGTA 2GZ7A 2ZQ2A 2H9HA 3A7VA 1QB9A 1SFIA 2FI3E 1TLDA 5HGGA 4DGJA 1A61H 1MTVA 2VJ1A 1C2KA 1NZQH 4RN6A 1EKBB 3RXFA 2KAIB 3FZZA 3RU4T 4X8UH 3F0PA 1RRKA 4Q7ZA 5AVDA 2BOHB 3UNSA 3F9EA 3M37A 4TT3D 2GZ9A 2WPIS 1XVMA 2J38A 1H8ED 2BDBA 1SGIB 1D6WA 1AE5A 1XM1A 4CRBA 6LPRA 1O2LA 1C4U2 1ANBA 3EQ0H 3UAIC 1K1PA 1TPSA 2FOGA 3SGBE 1KY9A 3EAJA 4YXWD 2ZHQH 5L30H 3A8DA 3LIWA 4TWWA 3I77A 3ZVCA 1LQEA 1GI5A 2ASUB 2PGBB 3SV6A 1TRYA 1HPGA 2FOAA 2QXGA 2ZU3A 1GWAA 5AFZH 4YT6H 1C1TA 2BB4A 1MAYA 1PQ8A 1THSH 2EC9H 1DUEA 3KIDU 1C4V2 5HMAA 4MPWA 1UVPA 5E2OA 1GCTC 4AOQA 1ZZZA 3KL6A 1SLUB 4D8NA 3ZZDA 2FLRH 1S84A 4F49A 3QZQA 1BUIA 1N8OC 3AAUA 3B8JA 1EASA 3W94A 2OD3B 2NU2E 3LH1A 2Y6TA 1K1JA 4K1TA 2HNTE 1UHBB 2PTCE 3SO3A 1EUFA 1O2GH 2O8MA 1GGDC 5GCHG 1TA6A 2ZO3H 1V2UT 1W0JD 4K5ZA 4AB9A 5JBAS 1P2IA 3KQBA 5DP4A 4UE7H 2BDCA 3M36A 2OC7A 1L2EA 1GJAB 1CGHA 3MTYA 3MMGA 4JMYA 1LVMA 2W3IA 1AVXA 2VBCA 2PGQB 3L33A 3SU5A 2TPIZ 1TMUH 2J5UA 1HAYB 1PPBH 1TNKA 3SQEE 2BLOA 2ZHFH 1GBIA 1BHXB 4MDSA 5FCKA 5B6LA 5A8XA 4LK4A 1TOMH 3S0NA 3L3TA 4GLYA 1C5QA 3HGNA 1ZHMA 1VITF 2RG3A 2YMSB 4WMDA 2G55A 4RKOB 1UCYH 3E16B 1TB6H 4CREA 1DVAH 1JRSA 4A92A 2ZTXA 2ZCKP 2XBYA 4YZUA 3RUOA 4ESTE 4JZEH 2BD2A 4PROA 1MTNB 3B23B 2VWOA 2G81E 4U2WA 1AMHA 4ZHLU 1GI2A 2EI6A 1WSSH 3GY2A 3SNBA 1WTGH 3DD2H 1SGRE 4DOQA 1M9UA 1GHWH 5FPYA 3PO1C 1Y3VA 2EQNA 2P8OC 2FX6A 2FMJA 2L6OA 3SUEA 4JZ1A 1TBQH 2ZGBH 3TNTA 2SGQE 4NWKA 1NROH 3V7TA 1C5SA 2QAAA 3A84A 3RMMH 1L4DA 1KMHB 5SGAE 4WMEA 1SGDE 3PWCA 2WUBA 5DSFA 1C1UH 2P94A 3GY4A 1D9IA 2FI5E 3A8CA 1XXFA 2ULLA 1AGJA 3A7YA 5DG6A 5BRRE 2OCVB 3VB6A 3MNXA 5TJXA 3A81A 5AFYH 1ESAA 1MAXA 3LDXH 4ZH8A 1GMCF 1NU9A 2ZTYA 5HYOA 2BQWB 1BMMH 2RDLA 4OM9A 2ZDNA 5E0JA 2WSSD 1DWBH 1O2YA 5T3HA 1A5IA 3SGQE 1THRH 3RXHA 2PP6A 3MH7A 2JH5D 3QGNB 2WHXA 4X8VH 4B71A 4XD7D 1TX7A 4FUBA 1KXEA 1TOCB 3FN8A 3Q3KA 3EA9A 1O3JA 2ZGCA 1YCPM 4ZXYH 1EJAA 1F0RA 3B9FH 2V35A 1TPPA 1NY22 1VJ9U 3RXEA 4GSOA 2FTMA 4MG3A 1TGSZ 1F5RA 5A8YA 1ZSKA 4IMQA 4YLQH 3P8FA 4GCHG 1P10A 1C5RA 1ZR0A 1FZZA 2GZ8A 1K0HA 1UVSH 2FX4A 3LGIA 1HLTH 4BTTB 1RTFB 3RXIA 1Z7KA 1OP2A 2VVVA 3LC5A 1AZZA 1Y5AT 3BV9B 1AN1E 3A7WA 1QJ1B 1MTSA 2H6MA 3ZVBA 1RFNA 1D6RA 3E91A 1C5NH 3LT3A 4X6NA 1W0ZU 3VFEA 3SV8A 5GXPA 1G30B 1H8IH 2A1DB 3GY6A 2PKAA 3BG4C 5A8ZA 1AY6H 4XSKU 4B76A 5BPEA 3ODFA 1PYTD 2G51A 2D1JA 1XUJA 2RDEA 2XC4A 3BN9A 3LGYA 4FUJA 4NSVA 1BTHH 2A4RA 1UTMA 1VCWA 1LMWB 4UFFH 3VG8A 1ABIH 5C3NA 4UDWH 3QO6A 4H6SB 5T1VA 1C2LA 2VH0A 5T6GA 1L1JA 1O3EA 2OBOA 5F8XA 1XUIA 1WCZA 1LTOA 1TRMA 3GY3A 1AZ8A 4E7RG 1C1VH 1NM6A 3MYWA 3SV9A 2HVXA 1VR1H 5JYIA 1ZTJA 3QWCH 3BEFB 2QGRA 4RT0A 1KTSB 4TSFD 5E2PA 1CA0C 1T7CA 3SZNA 1P06A 2PKSB 3ZVEA 3M3TA 4O3UA 5DP9A 3QZRA 3PWBA 1MTWA 3QDZB 3OE7D 2Y5GA 1OXGA 1BITA 1O3CA 2XBXA 5EJ1A 3W1EA 1C5LH 2GCHF 1O2IA 1LVOA 3VGCB 1S6FA 1ETSH 1FNIA 1SR5C 1LHEH 1GI1A 1O32A 2VB0A 3V3MA 2A4QA 2BVXH 5EXLA 4U30A 2O8TA 5DPAA 2L74A 4NZQA 1AD8H 2ZG0H 2XBVA 1SOZA 2WPLS 3UQOA 5A2MH 2FLBH 3OY5U 3AK5A 1OWDA 1FAKH 1GBBA 1HBTH 1O36A 2AYWA 5GPIB 5H4IB 5DGJA 3H7OA 4IGDA 1KXFA 3QUMP 2ZPQA 1P2QA 4ZUHA 3O8DA 3T29A 1GI8B 1OWKA 5HM9A 1XKAC 4HG6A 5DO4H 1GG6C 2J98B 2B8OH 4ISHH 4Z6AH 1BTZA 3FZDA 1AUTC 3TJNA 1LHDH 3AASA 1RD3B 2KR7A 1BIOA 4FUGA 4DG4A 2ILNA 4CR9A 1O31A 4Y8YA 4JYVH 1KXAA 3R3GB 4NIWA 1RTLA 1EPTB 3ZYDA 1C5WB 4DVAU 2ANKH 4GVUA 4Y11E 4FVBA 4Z1MD 2M2AA 5IDKA 3ZVAA 4A1TA 1AIXH 2CF9H 3OU0A 4INHA 3LJOA 2F9PA 2VNTA 2BX4A 1NFUA 2ZI2H 2J94A 2A7CA 5KEDA 2ZIQH 5DP3A 1HAZB 2RA0A 3H09A 1CVWH 1ZHPA 2W7SA 2UWOA 3HKIB 1GMDF 3STIA 4X6OA 1ZYOA 1O3HA 1UCYE 1C5YB 3NKKA 1O35A 2NU4E 2YMSC 2BYAX 5F53A 1BJVA 2QYIA 1AVWA 4Q2KA 3VXEH 2FOCA 2WPDD 4TPYA 3UWJH 5TCAA 1HYLA 1O3IA 2FODA 1E1RD 1EJMA 1KXCA 3BTEE 3M3VA 1UK2A 1CHOG 1AB9C 4ABDA 1P12E 3M5OA 1ZMNA 1OP0A 1LDTT 4XOJA 1P11E 1YPJH 2WINI 1TMBH 3P92A 2OLGA 3GCHB 3T5FH 4BTIB 1XXDA 4D9RA 6GCHF 4RT1A 1LHGH 2ZCHP 4WXVA 1V2RT 2Z3EA 5EPYA 2KCYA 1O2QA 1LHFH 3M35A 1SFQB 1IHSH 2BD4A 1VITH 3ATMA 4I8KA 4I86A 2O8LA 1KLJH 1SB1H 2ZFTA 3Q3YA 2A45B 1ZGIA 1QHRB 4NFEA 2ZDMA 1HUTH 1GHXH 1BMLA 4RI0A 1HCGA 2V7QD 8KME2 1UTJA 1GJCB 1EZXC 2ODPA 1SHHB 5DP8A 1IQKA 1BTXA 1KDQA 1UJ1A 1NBME 1P2NA 2SNVA 2D8WA 2VWNA 5ABWA 5KECA 3SGAE 1AFQC 1ESTA 2QV1A 4DCDA 1BMNH 3MOCA 1GHZA 1GVZA 1UVTH 3BG8A 2GT8A 3GCNA 1H4WA 3UPEA 5FL7D 3SYJA 3UFAA 4X6PA 2VU8E 4WH6A 1MZAA 4AC9A 5IYTA 1ETTH 1F0UA 3MNSA 3ATWA 1L1NA 1MCVA 3P70B 2JJ1D 1C4Y2 4YTAA 1HAPH 1MQ5A 2P16A 3URDA 2NU0E 5HXFA 1GI6A 1G32B 5EW1H 1ZPBA 2FOEA 2W3KA 4KKDA 1XUFA 5ETXA 3SNCA 2FOMB 3PM3A 2Y82A 2HGTH 1GI4A 2TGPZ 3FO8D 2XWBI 1C5OH 1OX1A 2ANMH 2QXJA 2JJ2D 3OFND 3MFJA 3ELAH 3ZZAA 1IQFA 3M5LA 1SGQE 2CHAB 3GOVB 1GBFA 2GMTB 5DP6A 4ZKSU 5G4BA 1S82A 1GHBG 1TNLA 2VIVA 2BQ6B 3ZIAD 1BT7A 3SUFA 1YCPH 4ABHA 1EATA 1PQ7A 4KTCA 1ZPCA 1FONA 1JOUB 2RCEA 1UMAH 3TNSA 1O3DA 1D3DB 1A3BH 4Q7YA 1FY3A 5JBBS 1TBZH 1B5GH 1O2JA 4INKA 5FBEA 4WF8A 2FO9A 3DCLA 1DXPA 2SGEE 1O2UA 3UNRA 3KGPA 5JBCS 3AVZA 5DJ7A 1SHYA 4LZ4B 1PPFE 4JCNA 1O2XA 4XDEA 2ZPRA 1DX5M 2IPQX 1DSUA 2G5VA 3T27A 3RXQA 1K22H 1H9IE 4YOIA 3GYMA 1G3DA 2BLQA 2AERH 2KX4A 4NA8A 4I8JA 2W7UA 1AKSB 3VGCC 1SLWB 1L1GA 4FUIA 5C0UA 1A0HB 1V2TT 2KCPA 1OWJA 2OQUA 3M7UA 1QA7A 1G2LA 1FN6A 1CGIE 3Q77A 4A5TS 1O0DH 3A85A 3T25A 1V2MT 1O2MA 1K28D 2IN2A 2W6ID 4Q4LA 1KXDA 1V6DA 1BQYA 3BEUA 3UTUH 1RIWB 1CE5A 3UIRA 2HWLB 1N6YA 1VJAU 4O03A 3F9FA 1GI3A 4WH8A 3U69H 2IJOB 2V6NA 3DSPA 1K1MA 1HAVA 3CENA 1ELDE 1GJ9B 2BXTH 1BBRK 2ZHDA 2P95A 1TFXA 1IQEA 3UQVA 1ZMLA 3EE0B 5EQRA 2P3UB 1UK3A 4AFQA 1QGFA 4D76A 1WTHD 3VXFH 1O34A 1HNEE 3RXPA 1ELEE 4OGXA 2UUFB 1GMHG 3A89A 3HGPA 3KNXA 3TJVA 2XRCA 3SV7A 3SZEA 1FPCH 2GJGA 4IS5A 1Z1IA 3S9BA 4GAWA 1F0TA 1C5MD 1C5XB 1ANEA 3A88A 1YPHC 1QCPA 5FAHA 5CHAC 1QQ4A 3N7DA 4XE4A 1JXPA 1AE8H 3K6YA 3GCOA 3SHCH 3OTPA 3F3BA 1TMTH 1TE0A 1O5DH 1ZOMA 1O3PB 2Y80A 2XYAA 1GHBF 3KN2A 4IW4E 3A86A 2A5IA 4OS1A 4P00A 1CBWC 1BTYA 1EXFA 5EJLA 3KQDA 3P17H 2EI7A 2JKHA 3Q76A 2G00A 2KZ4A 3K2UA 3PTNA 3TGKE 1MCTA 2Z3CA 1QJ6B 3QTVH 5J4SA 2ZFRH 2VWLA 2BXUH 5IK2D 1LPGB 1O2WA 1SGPE 4JZIA 3UREA 3EA7A 4ZXXH 2J98A 2AGGX 1PPCE 1P04A 1QL7A 1SGTA 1XUHA 1TQ7B 2Q6FA 2ZU5A 2HVYB 2ZF0H 1FLEE 1KIGH 1CT0E 3SI4H 4DIIH 2FYRA 1H8DH 4AFZA 1OHHD 1OWHA 1UW7A 2A5KA 1OWEA 3P95A 4K1SA 1P2JA 2BD3A 1HAOH 3M3SA 1EPTA 1FAXA 2BD9A 3ZV9A 1ACBE 3SHAH 1B7XB 1W13U 3PV5A 1DSTA 2AGEX 4CBNA 1D3PB 1UCYK 4X2VA 1WBGB 5F8ZA 1HV7A 2AMQA 5A0BA 1SSXA 4FOUC 3ZZ8A 1MKWK 3RM0H 1DFPA 3RXLA 3RMNH 3GCHC 4CRFA 1W8BH 2GDEH 3UR6A 1GBAA 1VGCB 5PTPA 4AX9H 2F9UA 2NU1E 4AZ2B 1EAIA 6CHAB 2B5TB 3GCTF 3FP6E 1FXYA 2F43B 2FESH 1SI5H 2Y7XA 2AMDA 3TGJE 3NXPA 1TRNA 1UTNA 4OS5A 1A4WH 3BTQE 4ABAA 2UWLA 4HGCA 1EZUC 4WMFA 3O8CA 1DOJA 1TGNA 2QE7D 1C1QA 1P8VC 1EJNA 5LPEA 5C0TA 2WPJS 4I8LA 2TRMA 1IOEA 1DPOA 5C17A 3N7EA 5F8TA 1Z8IB 2GCTC 1EP6A 3T26A 5C5NA 3ATKA 2XNDD 2FS9A 2QA9E 3TH2H 2YNAA 1YP9A 1OKXA 1EB1H 3SU3A 1IQHA 3KYFA 2XCFA 1N6XA 3CS0A 3S9AA 1MU8B 1Q2WA 4A7IB 1G3EA 5A0AE 3V0XA 4CH2B 1Z6JH 3K65B 2TGDA 2G5NA 1J8AA 4KTSA 2CGAA 3OEED 3QN7A 1T8NA 1YM0A 3MO9A 1DWDH 3HPTB 1F5KU 1HRTH 4X8TH 3SU4A 4B6FA 2CMYA 2Z9IA 1HFDA 5FBIA 1SQAA 1YYY1 1CT2E 3F0OA 3ZVGA 1SVPA 1T4VH 4NSYA 2GD4B 1A7SA 2A7JA 1GJ4H 3SU2A 1HJAB 1GDQA 1LKAA 1E35B 4QT8C 3N7OA
chains in the Genus database with same CATH topology
2ESTE 1QQUA 1LHCH 1Z6EA 1VCQA 1O3BA 2EI8A 1B0EA 3QTOH 1J16A 4XBBA 3TIUA 4FUEA 3AAVA 1W2KH 2HNTC 4TYDA 4B2AA 2A5AA 1IHTH 3VB4A 2ZCLP 1MBMA 2XW9A 1O3GA 7ESTE 4BAHB 3EYDA 1GCDA 4FU9A 1LPZB 5EGMA 1QL9A 2Z9GA 1CQQA 2CXVA 1XVOA 2OXSA 3V13A 2Z94A 2BTCE 1V2KT 3P6ZB 4H42U 2PHBA 1ZRKA 5GCHF 3E1XB 4AORA 2FZZA 3NPSA 1MZDA 5DKMA 1BOQA 3SUDA 5JB8S 5E0HA 1UO6A 2C93B 2I6SA 3SJKA 2P3FH 1C9PA 2STBE 4K69A 4X1RU 1Q3XA 1V2JT 3CS7A 4MNYA 4BNRA 1YBWA 3NUMA 3U8RH 5C1YA 3FP7E 3F9GA 2BVSH 4FU8A 3DT0H 4CHAB 1K2I1 3MO3A 4OS6A 1A1RA 1Z8GA 3A8BA 4JZDH 1P03A 2O8UA 4M7GA 4A1VA 1PFXC 1GPZA 4MLFB 1H1BA 1D3TB 1FN8A 1MD7A 1Y59T 1S0QA 1W3CA 5E8EH 3RXDA 4VGCC 1NC6A 1KSNA 1OWIA 2VH6A 3FANA 1ZJKA 1GBJA 1O3MA 2O9QA 3PMAB 2BY6X 3U98H 4X2WA 4UD9H 2NWNA 2FYQA 1GVLA 2BDIA 1V2ST 2ZFPH 3MWIU 1Y3UA 3KQCA 3V12A 4JYTA 1C2DA 5E0GA 1DITH 4CRDA 1C2GA 1O2TA 4I7YH 1NPMA 3D23A 1CHGA 4LOYH 1QFKH 3PLPA 4J1YA 1UTKA 1YPMH 2VWMA 2Z6BD 2ZZUH 1BHXF 1C1PA 2BDYA 1GBMA 1IAUA 3H7TA 1DY9A 1U6QA 3RC4A 3ENSB 3ZZCA 4ABJA 1JWTA 2ZP0H 4K8YA 4OS4A 4DW2U 3DUXH 2ZC9H 1NO9H 1IQLA 1S5SA 1T8MA 3DHKH 1C5PA 4WY3A 1SL3A 2QCYA 1P0SH 1NRQH 1ZPZA 2PTNA 3KEEA 3MNBA 1BCUH 5FXLA 3SU1A 1LKBA 1NRRH 1QNJA 4MPXA 1DANH 3ZYEA 4BAQB 4X1NU 1LVBA 3LGWA 5TCCA 2KAIA 3SNEA 2VINA 2PUXB 2R3YA 4KTUA 3RLYH 2A0QB 1VZQH 2JETB 2A2QH 2BHGA 4YT7H 1SG8B 1YC0A 1ARCA 4JK5A 4ASHA 4Y10E 4ZKOU 3FP8E 1V3XA 1ABJH 1JBUH 4GCHF 3A80A 4ISIH 3VPKA 4ZMAH 5EOKA 4B74A 4TY7A 1GJDB 4FVDA 1FY8E 1T8OA 1EZQA 3PMBB 3GISB 2WV5A 1MTUA 4IN2A 2R0LA 3FFGA 1YPEH 3PLKA 5EPNA 2PV9B 1W10U 1UVOA 3RXRA 3RM2H 5L2YH 1W0YH 3BTHE 3M61U 1GHYH 1T8LA 2DE8A 1V2LT 2BDGA 2VIQA 1TGCA 3E6PH 4NA7A 1SC8U 1CGJE 1K1LA 2G8TA 1O5BB 2JH6D 1Z1JA 2ZQ1A 5J4QA 2V0BA 1F2SE 2EA3A 2GP9B 2JH0D 1TPAE 1E34B 2G4UA 2H2ZA 2D26C 1ELVA 4CRAA 1GBCA 1G37A 1HAXB 2ZFSA 2H9TH 1PPGE 2J95A 4AB8A 1ESBA 1UHBA 1QB1A 4Y79A 2HALA 2WPMS 3PTBA 2Y5FA 1MKXK 4X6MA 1KXBA 4Y0YE 1MTNC 3M7TA 1BRUP 4FUCA 3BTDE 2BM2A 4Y76A 1ZLRA 2SGDE 1GCTB 1D4PB 1SBWA 4MQAA 4OGYA 1HAIH 3SU0A 1C2HA 1XMNB 3RXSA 3U1IB 2O8WA 1YGCH 1BZXE 1N8OB 3RDZA 1SMFE 1C1WH 1C2EA 2PUQH 3HK3B 3PMHB 3LH3A 2VIWA 6ESTA 5EG4A 2AS9A 1C1MA 4MNXA 1SLXB 4AGJA 1P9UA 1E36B 1DLKB 1GGDB 1GBEA 2ZHEH 3OSYA 1WYKA 1HDTH 3TJOA 3ESTA 1CSOE 4WXIA 1MBQA 2WUCA 1A2CH 1BRCE 1RTKA 2FTLE 2QIQA 2UUJB 2OUAA 3ZZ3A 4HFPB 3BEIB 2ZU1A 2LNCA 2YOLA 1DICA 5FCRA 1K21H 2R9PA 3URCA 5JBTA 1HB0B 1P2OA 1ZTKA 4KELA 4WVPE 1O3AA 1A3EH 1KTTB 4X1SU 3LOXA 4DJZB 1IQJA 1NESE 3PB1E 3SJIA 4JZFH 2FIRH 2LPRA 4K3JA 1S83A 2BQ7B 2ZHWH 1GL0E 3ZVDA 3TH4H 3RXKA 2ZECA 2STAE 1QJ7B 2FOHA 1TYNA 1TNJA 2XC0A 3BTKE 1GJ5H 4ISLA 1W12U 3Q3XA 1GHVH 3NK8A 3SI3H 4MNWA 1EB2A 1OYTH 2F9NA 4R0IA 3PO1B 2P8OB 2GKVE 2ZDVH 3A83A 1BTWA 3OY6U 3LPRA 3OTJE 3C1KA 1O5AB 2AFQB 4B75A 4E06H 2GVFA 3TK5A 3F1SB 4CHAC 2C4FH 4MPUA 5I46H 3RXAA 2J92A 3GY5A 1G3CA 2BY7X 4AYVB 5EXMA 1AHTH 1AU8A 2B7DH 2R2WU 3P8NA 2PWXA 3C27B 3HATH 2Q6DA 1YPHE 3I78A 2F9BH 1DLEA 1P57B 3NZIA 3EGKH 4IC6A 3M5MA 1L4ZA 4NFFA 2Z7FE 3RU4D 2B9LA 2THFB 1FI8A 3VEQB 1ZSJA 1S0RA 1K9OE 1CHOF 4WJG2 2PKAB 1W7XH 3RLWH 2FOFA 1NRPH 1SPJA 3BIUH 1TWXB 2PR3A 4I33A 1DT2A 2H5CA 2XTTB 7GCHG 2PKSC 1AQ7A 1EAWA 4CRGA 4SGAE 2EEKA 1PPEE 3MHWU 1SGCA 2BZ6H 4YO9A 1RJXB 3ZZ9A 1NTPA 1KLIH 3A8AA 3SU6A 2P59A 3TU7H 2A32A 3SW2B 4ZKNU 3SNAA 3RXTA 5GWZA 3QLPH 1GJBB 2Y5HA 3QX5H 2F91A 4Y6DA 1RXPA 1LPKB 1AUJA 2FPZA 4Y7AA 3IWMA 2AIPA 4OS7A 1C2FA 2ZKSA 1EOLA 1O2VA 2XCNA 4GHTA 2IOTA 4MNVA 1FV9A 3JZ2B 3BTTE 2ZGJA 1NFYA 1WU1A 1O2PA 1YLDA 1S81A 1TALA 3BG4B 2RA3A 2C8WB 1DWEH 3GICB 5C1XA 1YPGH 1SQTA 2ZGXH 2BY8X 1KYNA 3UUZA 2BVRH 4Q7XA 4CR5A 2ANWA 2J4IA 4NZLA 4UONA 1VITG 1G9IE 1E38B 4ZROA 2BOKA 2QN5T 2WV4A 1ETRH 3GY8A 1V2QT 5GIBA 2HOBA 4MTBA 1DWCH 1J9CH 1FQ3A 4ABGA 3SNDA 1GVKB 1EPTC 4NG9H 5EW2H 5A0CA 5C2ZA 2Z9JA 2VVCA 4DIHH 1ELTA 3E0PB 3NWUA 3TK6A 3O8RA 1CA0B 3HKJB 4RKJB 3T2NA 1O2ZA 2A2XH 3CP7A 3RMLH 4TWYA 3BTGE 2FS8A 5AF9H 2HRVA 1QB6A 1O3LA 1W11U 3PLBA 4ABFA 4D9QA 2I6QA 1CU1A 2C8ZB 1FPHH 2TGAA 3P8GA 1A5GH 1GI9B 4XBDA 4HTCH 4NCYA 1DUAA 1FY5A 1NN6A 1LO6A 5GJ4B 2ZDAH 1H9LB 3MU1A 2IPHA 1EOJA 1THPB 2BY9X 5DK1A 1OSSA 3TGIE 1QBVH 4MVNA 2QC2A 1K1NA 1BBRH 1AWHB 2A4OA 2TBSA 4Y8XA 1XX9A 1P2KA 2VVUA 1C1NA 3UOUA 1DM4B 1GMCG 2ZNKH 4X1PU 3TLOA 4UFDH 1SLVB 4TY6A 1SGYE 2F9VA 1NS3A 1YPLH 1C5TA 4U01A 1QL8A 1ARBA 2FEQH 4U32A 2GT7A 5L2ZH 1GI7B 1NFWA 2BD5A 7GCHF 3BTME 2GV7A 1GG6B 4IMZA 1TNHA 2QF0A 3MNCA 4K1EA 1HGTH 1J17T 1TQ0B 3LJJA 1MU6B 3F6UH 1DS2E 3ZZ6A 4SGBE 3S9CA 1AFEH 3ZZ7A 4Z0KA 3TVJB 4HI3A 4ZHAA 1GBTA 1O5EH 5DP5A 5FPSA 3BF6H 3D65E 2V3OH 3AW1A 3SJ8A 4B2CA 1ZHRA 3O8BA 2J2UA 1QURH 4BXSA 3SOSA 4H6TA 5EU8A 1C1OA 3ZV8A 1SGNE 3RC6A 9ESTA 1UK4A 2M5TA 4D7GA 2HNTF 1QRXA 4BXWA 1AO5A 1C1RA 3E90B 3LU9B 2Z9KA 3BTWE 4I8GA 3TH3H 1DE7H 2BY5X 4I31A 1FJSA 1BTPA 2OC1A 1FIZA 3U9AH 1P01A 1ZRBA 4WWYA 2ODYB 3RXMA 1GHAG 1PQAA 2QY0B 1GMHF 3A7TA 3GDVA 2SGPE 1Y3YA 1QBOA 4K8BA 2G4TA 3FVFB 4BAMB 1O2NA 2ALPA 5I25A 2ANYA 4IBLH 1IQIA 2A4GA 1BDAA 2Q1JA 1XKBC 1MKWH 1TX6A 4YESB 1KDQB 1P9SA 2ZA5A 2ZEBA 1AB9B 5T6FA 1QRWA 1S6HA 5FHTA 2VIPA 3RXVA 1F0SA 1WUNH 1YF4A 3U1JB 3RXCA 1HIAB 1GJ7B 5A09A 1O30A 3LKWA 3TK9A 1W7GH 1ANCA 1P05A 1UTLM 2CHAC 1P02A 1V2OT 2GMTC 3MH5A 1FDPA 3PYHA 4BAKB 3UR9A 4AYYB 2AH4X 1MH0A 2GCHG 1V2NT 1TONA 3PV4A 1G3BA 1HJ9A 2CF8H 1C5VA 1F92A 1GDNA 3OYPA 1GDUA 2NU3E 4X0WU 4Y71A 1C2JA 1AVGH 3SBKA 3E0NB 3BSQA 3SORA 1B0FA 4YOJA 2K1QA 1QIXB 1OOKB 1TA2A 3VB5A 2VIDA 1W14U 2SFAA 1QTFA 3RXGA 4IN1A 2G52A 3TITA 1FIWA 3MU4A 4HZHA 4D7FA 1ANDA 4B2BA 1QBNA 1INCA 3QGJA 1O2SA 3LONA 1RS0A 1QY6A 2SGFE 4XFQA 1AFQB 1ZGVA 3E8LA 3NCLA 1GL1A 2UWPA 3TJUA 5L6NH 3G01A 1YPKH 2V3HH 2Z3DA 3T62A 3UOPA 1GI0A 2WYJA 5C5OA 2Y7ZA 3D49H 3ITIA 3RXJA 1PPZA 3AW0A 1ELBA 1SGFG 8ESTE 4TPIZ 2FM2A 2GGVB 3I29A 1G2MA 1ELAA 1O5FH 1V2VT 2BZAA 3RXBA 1TGBA 2H1UA 1T32A 3MI4A 4FUDA 1RIWC 1EAUA 2GDDA 3W95A 1C1SA 4ABEA 2QXHA 1OYQA 3DA9B 4ZKRU 2XBWA 4BAOB 4E05H 4NA9H 3UWIA 3LGTA 4UFGH 2CV3A 2ZFQH 1C2IA 1HXFH 3UY9A 2VGCB 4X1QU 4XBCA 2ZGHA 4Y8ZA 3VB3A 2ALVA 4F4OC 4CRCA 1BMAA 3GY7A 4BTUB 1F7ZA 1GMDG 3MO6A 4NIVA 1Z71A 1GHAF 4A6LA 1PQ5A 1ZSLA 1ELCA 3RC5A 3SJOA 1C5UA 1AKSA 1E37B 5C20A 1K1OA 1TAWA 3R0FA 3IG6B 1O2KA 5C67A 1MD8A 3PROA 2OTVA 1L0ZA 1HAVB 1FY1A 1V2WT 5LH8A 1RGQA 1WV7H 5C1UA 1A0JA 3ZZ5A 2P3TB 1HAGE 3STJA 5EQQA 3MU8A 1ZTLA 1NT1A 1PPHE 1O33A 5GDSH 1TBRH 6GCHG 2ODQA 1GBDA 5FX5A 5AHGH 2C8YB 4ABBA 3M5NA 2PSXA 5FPTA 5ESTE 2FXRA 3ATLA 2XXLA 2BDHA 3KHVA 1BBRE 1D3QB 2VIOA 4B1TA 2FP7B 3EA8A 3IITA 1UTPA 3KF2A 1O2RA 3E3TA 4YLUA 4AG1A 4JK6A 4OS2A 1ELFA 4GPGA 1O2HA 1CO7E 1SQOA 5DP7A 1TIOA 4AG2A 2OQ5A 2QXIA 3MU0A 5LPFA 2TGTA 1FY4A 4FUFA 2F3CE 3P8OA 4CBOA 4B73A 3DFJA 4Y7BA 1YLCA 3F9HA 1BRAA 5CE1A 9LPRA 1UTOA 3MH6A 1A5HA 2Y81A 4NWLA 3A87A 2AIQA 4UFEH 1JIMA 2FI4E 2GTBA 1X7AC 1JIRA 1GJ6A 1VGCC 3WY8A 2BMGB 3ATIA 1BTUA 3PMJA 2ZU2A 6CHAC 4KGAA 4FUHA 3M7QA 1Y5BT 1TABE 1Q31A 2SGAA 5CHAB 3D62A 1IQMA 2D2DA 4Q80A 4NIYA 5F03A 1PYTC 1Z8RA 2R2MB 1C5ZB 2A7HA 3SV2H 1TPOA 2BLVA 4FXGH 2C3SA 1HAHH 2BD8A 2ZU4A 2SNWA 1WQVH 4GHQA 2AEIH 2HLCA 1Z8JB 1CBWB 3ODDA 1OS8A 3QK1A 4I32A 1S85A 1C2MA 4ZHMU 1IQGA 2HPPH 2UUKB 1Y3WA 3K6ZA 4H4FA 4FU7A 4THNH 2BLWA 4X2YA 2B0FA 1LQDB 1QR3E 3RXOA 2R3UA 1O37A 1UVUH 1ZMJA 4J2YB 3LGUA 4ABIA 5CMXH 1A46H 1P2MA 1SOTA 1HJ8A 3A7ZA 3T28A 8GCHG 3SJ9A 3EDXB 3RXUA 4AFSA 1FUJA 1EAXA 2AGIX 2ZPSA 1XUKA 4K60A 1JMOH 1ORFA 4A1XA 1SGEE 2W26A 1MQ6A 1O2OA 4LXBH 3VB7A 2FDAA 3HK6B 1BJUA 3LC3A 1BA8B 1EX3A 5EODA 4DY7B 2FOBA 3ZZ4A 1O38A 3ZVFA 3F68H 1HJAC 5JB9S 3SN8A 4O3TA 2W5EA 1EQ9A 4RSPA 4AGKA 4ISOA 3RP2A 3TPIZ 8LPRA 2AMPA 1QRZA 3GDUA 3ZZBA 3S7HB 3MU5A 1NRSH 1YCPK 1PJPA 1ID5H 5JDUB 1MKXH 2FWWA 1Y3XA 3S69A 2GX4A 2ZWLH 4NGAH 2XC5A 3RMOH 5T6DA 1C9TA 2XNIA 2DUCA 4ISNA 3KCGH 4YOGA 2GCTB 2ZDKA 5JPMH 1O3FA 1HIAA 1TNIA 3DFLA 1GJ8B 4AN7A 1EP5A 2UUYA 2Z9LA 3U8TH 1DY8A 1WAYB 2WPHS 3BIVH 1BRBE 1WQSA 2C8XB 3BTFE 1P3CA 1O5GH 1SGFA 2ZFFH 1MUEB 1ELGA 2TIOA 4X8SH 1TNGA 1VCPA 2F9OA 3U8OH 3GDSA 1WOFA 1GBLA