2STBE

Anionic salmon trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor ii)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of three new trypsin-squash-inhibitor complexes: a detailed comparison with other trypsins and their complexes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (TRYPSIN)
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2stbE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2stbE02
1YPKH 4Y10E 1L0ZA 4BTUB 3VGCC 2JH0D 2PTCE 4DGJA 1HJAC 3M35A 1KLTA 1GI8B 1SSXA 1C2FA 2BLOA 1PQ8A 3D65E 3WY8A 4FUIA 1T4UH 3RXQA 1S81A 3G01A 3SGAE 1ELAA 3AAVA 2V3OH 2WPIS 2H9HA 4OS1A 4UEHH 5C2ZA 1O2OA 1TABE 1O2ZA 1VJAU 3DUXH 2ZP0H 4BOHA 1O2WA 1EOLA 1QRZA 2GT7A 1G32B 1O2VA 1KY9A 1PYTC 3TJNA 1O5DH 3BN9A 4IN1A 3SV9A 3P70B 4MLFB 2KAIA 3A83A 4AG2A 5GCHG 2HPPH 2BB4A 5ETXA 1N8OC 1SI5H 1P2IA 2GTBA 3L6PA 1GJ7B 1RIWC 4NCYA 2FOBA 2C8ZB 1C2EA 1KDQB 1DWCH 1BHXF 1O2LA 1NU9A 2FX6A 4JCNA 1MU6B 3OY5U 2F83A 1UCYK 5LPRA 1H9IE 1LCYA 3TNTA 3QUMP 3SNCA 2P3UB 3BF6H 1WUNH 1O5GH 2W3KA 1KXEA 3KHVA 1K1NA 2AEIH 2G4UA 2SGDE 1GG6B 1SGFG 3PM3A 1DANH 2GX4A 2CV3A 1TGNA 1EAWA 1GMCF 3V3MA 3U1JB 4E06H 1GHXH 4ZMAH 1MKXK 4YESB 3ODFA 1K1JA 3MYWA 1IQFA 1TA2A 3W95A 3A8DA 1YPHC 3UR6A 1CA0C 1Z6EA 2F9VA 1K9OE 1LVYA 3SNAA 4IMZA 3RDZA 3LGUA 2F9UA 2WUCA 1GMDF 2R0KA 1GMCG 4NWLA 2ESTE 4K60A 3UTUH 5LGOA 1OOKB 3SW2B 4JZEH 2ZGBH 2OBOA 1V6DA 3RC5A 2Z6BD 3IITA 2Z9JA 1EAIA 2PLXA 2FOFA 2XCFA 2OQUA 1RIWB 1ZHMA 2SGPE 4FU9A 1QJ6B 3I77A 1XXDA 3AW0A 2ZCLP 1BQYA 2IJOB 1O37A 4ISIH 3ZZ9A 1O3OA 1VCQA 3RXAA 1Z8RA 2V0BA 3NK8A 4THNH 4K3JA 4NIVA 3CS0A 3SOSA 1O0DH 1SQOA 2WUBA 3ZYDA 1TRYA 3PMJA 2GGVB 2OCVB 1TPSA 1UTMA 4KELA 1O3BA 3KQCA 1EOJA 4IBLH 4TWWA 4VGCB 3ZZ6A 8GCHG 2TIOA 1VITF 3DT0H 3EA8A 1B0EA 4KTUA 1O3CA 1O2IA 3GYLB 3MH4A 1GJ4H 4I8KA 1Y59T 1KTSB 2BM2A 2JH5D 2XC5A 1DY9A 2R3UA 1IQNA 1UVTH 1SGEE 3KQEA 1D9IA 1QB6A 1CA0B 3K9XB 1T8OA 3Q3KA 3ZVEA 2VU8E 4CHAC 5FHTA 1C4V2 1D6RA 1NM6A 4Y79A 2AH4X 1P09A 3GDSA 4WMDA 2Q6DA 2OC1A 1INCA 1MZDA 2G5NA 1RXPA 2ZPRA 1Q3XA 1YPGH 2VJ1A 5JYIA 1AI8H 2ZIQH 1P57B 1YCPH 3MH7A 2GZ9A 3ZV9A 1MTNB 3KCGH 3M7UA 4O03A 3S7HB 3NWUA 3S7KB 1TX6A 1K28D 2WYJA 4U01A 1GBFA 1AB9B 1QFKH 2A4QA 4NA8A 1CT2E 4DW2U 1NESE 1X7AC 3PV4A 3SJOA 1KIGH 4FUDA 2ANKH 2TGTA 3B23B 3DFLA 1NRRH 5FBEA 2R2WU 1F5LA 3RXFA 2UWPA 1WU1A 2ZFFH 5E2OA 1K2I1 1GVZA 4JK5A 3RXOA 1H1BA 1S0QA 3N7OA 5BPEA 4GHTA 3STIA 3BTFE 2Z9GA 3UPEA 1C5LH 4UD9H 1GMHF 1HAPH 1B7XB 2AYWA 3C1KA 4GUXA 4FVDA 4J2YB 1QA0A 3UQOA 3ATIA 5J4SA 1NZQH 1G2LA 5EGMA 2O8TA 4HFPB 3F9FA 1SLWB 1GVLA 1BBRH 2HLCA 3LH3A 1G9IE 1GL0E 4FXGH 1LPGB 2YNAA 1NRSH 1AD8H 1A5HA 1HAYB 5DGJA 1TGTA 1Z8GA 5HGGA 2ZDLA 4JZDH 4I8JA 2BD9A 3TPIZ 3JZ2B 1O34A 3TJOA 3GCHB 1AKSA 2AMDA 2HNTC 2QXGA 4I33A 4ABDA 1OWIA 1ZZZA 2QA9E 1TPAE 1O5BB 4H6TA 3FP8E 5TCAA 1O2HA 2BD8A 3RXLA 1S6HA 1Y5BT 3R0FA 3E8LA 3M61U 1BJUA 2TPIZ 2P8OB 4ZKRU 3GY6A 3E90B 1UVUH 1KXDA 4DURA 4UONA 1C1NA 5DP7A 2VVVA 1J17T 3M5MA 4XSKU 2XXLA 4A1TA 1W7XH 2G51A 4XDEA 2ZQ2A 1AVXA 2P94A 4HTCH 4Y0ZE 2BY7X 3TITA 1UTKA 1WSSH 4BAQB 1P05A 1YPJH 2BX4A 2ZDKA 1UHBA 1QB9A 1EJMA 2BDBA 2PWXA 3SV7A 5JPMH 3TNSA 1VCPA 3PMAB 2EA3A 2GVFA 1HRTH 3KNXA 1EJAA 3STJA 1GHAF 1O38A 2GKVE 2RG3A 2FP7B 1P2JA 2AIPA 1D6WA 1O3IA 4AORA 1W11U 2SGFE 3SUGA 1ELTA 2FZZA 2BDIA 5F8TA 4CH2B 1SQTA 1TOCB 1GI6A 1IAUA 2BQ6B 1YPHE 1HYLA 1P02A 2Q1JA 1HCGA 1A5IA 3KN2A 3PMBB 3TU7H 1YPEH 1O2YA 3TLOA 4WMFA 1HAOH 1UCYE 3QX5H 1D3PB 5F8XA 3RLYH 3MO3A 4I8GA 4AFUA 1CGIE 4AYVB 3FZDA 2QF0A 1WQSA 2Z9KA 4GHQA 1P3CA 4FVBA 1F92A 2ZHQH 1BUIA 1DVAH 4CRAA 2ZF0H 1C1TA 2P3TB 5HM2A 4WF8A 1HAVA 3SNBA 3SUFA 4DOQA 4CRDA 2BVRH 4ZROA 3Q77A 2DUCA 4ZHMU 3A8BA 3VXEH 2XC0A 1OP0A 4Y0YE 1V2PT 1G3CA 1XUJA 2GCHF 3SZNA 2J4IA 3UUZA 2BQWB 2A1DB 1PPGE 2SGAA 3T2NA 3ZZ8A 3FZZA 1V2ST 1FONA 2ZDMA 2PKSB 1GJ9B 1P9UA 1AY6H 1W7GH 4ZHLU 1HPGA 1BZXE 5JBCS 1C2JA 1PPEE 5ABWA 4JK6A 3SO3A 4JZ1A 1O2TA 1ELDE 2A5AA 5C1XA 2FTLE 1FDPA 1DWDH 2ZNKH 2FOAA 4Y8ZA 1P0SH 3MOCA 1MKXH 2QIQA 3E91A 4I32A 4B74A 5A0AE 5DO4H 3ZV8A 3SV6A 5L30H 1Q31A 3RP2A 2GV7A 1ZLRA 1GVKB 3KIDU 4DT7B 3M3VA 2SGQE 4GSOA 1VGCB 1TBZH 2A2QH 3UNSA 4LK4A 5EG4A 2BQ7B 3ZVBA 1B0FA 4X1SU 4ESTE 1QTFA 1S85A 4A6LA 1C1VH 1DWEH 1F0SA 4HZHA 1KSNA 1IQKA 3GISB 2P93A 1EB1H 2ZG0H 2STAE 1LPKB 1TALA 3SUEA 1KTTB 1C5VA 2Z7FE 4AGJA 1LO6A 3I29A 2HALA 4TYDA 1OYTH 3ZVDA 1N6XA 1VITH 9LPRA 4INHA 2VVCA 2R9PA 4UFDH 1FY5A 2J92A 2G81E 1T7CA 5C1UA 4XBDA 4RSPA 5FCKA 4Y7AA 1SL3A 1RS0A 3BIUH 4KKDA 2OTVA 3RMOH 2FWWA 2PHBA 1FUJA 4X1PU 1ZPBA 1ABIH 5EQSA 1Y3YA 1MKWH 3K6ZA 3BTQE 2BDCA 1GI0A 2A31A 3PTBA 1WYKA 1XXFA 3D62A 3GDUA 4XE4A 1C1PA 4GCHF 1YCPK 1NC6A 2FYRA 2J95A 3FFGA 2FPZA 1P2QA 2ZHWH 1FIZA 3RMMH 1WOFA 4BAKB 1K21H 3RXUA 1O3NA 4X2XA 1CE5A 4B71A 2EEKA 3F1SB 1TE0A 1IQEA 5GXPA 3ZZ4A 1IQMA 2GMTC 3GCNA 1FZZA 1A5GH 1GWAA 1SB1H 3U9AH 5A0BA 1DXPA 3GY8A 1GBJA 1DS2E 5GCHF 1KXAA 3FANA 2B9LA 5K0HA 1AE5A 1DWBH 1C5MD 8GCHF 1MAYA 1TOMH 3A89A 1HUTH 2ZWLH 1BITA 1JRSA 1AUJA 1SGCA 2UWOA 3PO1B 1SBWA 3O8BA 1E36B 2SFAA 4Z0KA 2FI5E 2HRVA 1HJ9A 1LDTT 5DK1A 3SGBE 3T5FH 1NS3A 1RTFB 1Y3XA 3GY4A 1AZ8A 1GJBB 2V6NA 3ATWA 2PGQB 1TFXA 1P2NA 4BAHB 2FESH 2GP9B 1ETSH 3LGWA 1V2VT 1KDQA 2FOGA 5A0CA 4ABIA 2BDHA 1F7ZA 2W7UA 4X1NU 5T6GA 3PLBA 3ZZ7A 1H8IH 4ZUHA 1BA8B 3QTOH 1W13U 2NU2E 2ZU5A 1BMLA 1YBWA 4AB9A 4D76A 1J14A 2DE9A 1AGJA 1ESTA 5IDKA 1EP5A 2OBQA 1FY4A 1ZSKA 1TGCA 3GYMA 1FAKH 2D2DA 3A7TA 3S9AA 4BTTB 3PWCA 3LPRA 3ZYEA 3ZZBA 1NO9H 1JBUH 3RMLH 1A0HB 3SQEE 4A7IB 2BLQA 3SHCH 1FIWA 1HXEH 2PFEA 4YZUA 1TONA 5FX5A 5ESTE 2ZTXA 2WPJS 1O2PA 2VINA 2WPKS 3QGNB 4R8TB 1AKSB 4ZHAA 1TMTH 4JYVH 1Y3VA 4CRFA 4BAMB 1O3JA 2XWAA 1AIXH 1P03A 4JZFH 2WPMS 4O3TA 2ILNA 1OS8A 1PPBH 3RU4E 1CO7E 1EPTB 1LHEH 5C1YA 1JOUB 2ODQA 2BXUH 1BTPA 2VIDA 3KGPA 2XRCA 2VIVA 3U69H 1QRWA 2C3SA 2ANWA 3Q76A 1C5RA 2PSYA 1TNIA 2W5EA 3EDXB 4YTAA 5GJ4B 1BIOA 3MU4A 3QLPH 3H7TA 3SU4A 3KL6A 4F4OC 2Z3DA 4A5TS 1TNLA 2NU1E 3ATMA 4D9RA 1ZMLA 2K1QA 1XUHA 1CQQA 3PO1C 3DD2H 2A4RA 1GHZA 3CS7A 4Y8YA 1AVGH 3SHAH 1UTPA 3MNSA 2XYAA 4NIXA 3SQHE 2EI7A 4Q7ZA 2PW8H 4B2BA 4U30A 1DUAA 1C2MA 1FY1A 1XMNB 3MU8A 3D23A 4U32A 4F49A 2G4TA 3ZVCA 1MD8A 5EW2H 3ITIA 3NPSA 2BY9X 1RFNA 4MNYA 3LH1A 5CE1A 3MFJA 1PPZA 1PPCE 1XUGA 1E34B 1OWEA 1WCZA 2C93B 2F9BH 4IC6A 3T29A 1JIMA 5E0GA 1GBTA 3S9CA 2GCTC 2YNBA 1DX5M 5E0JA 3VB5A 2BD4A 1ZHRA 4UDWH 1G36A 2PUXB 4BNRA 2GMTB 1MQ5A 4FU7A 5GPIB 1K1LA 4CHAB 1GHBF 1O5CB 2RCEA 3U8RH 4GVUA 3BEIB 3LU9B 1SLUB 1GHBG 1AFQC 1OWKA 4DIHH 1O39A 5L6NH 4TWYA 1C2DA 1ELCA 2VWNA 1SHYA 2OC7A 4AOQA 1MTSA 1C1OA 4X8UH 3V12A 1S82A 1YKTA 5J4QA 2QAAA 1EQ9A 3HK6B 3A85A 2VB0A 3EE0B 1GI2A 1A7SA 1SMFE 3IG6B 4X6MA 1G37A 3BG4B 3MMGA 2WV4A 3UNQA 2TGDA 2QXHA 4MTBA 1GHWH 1ZTJA 5JB8S 1ABJH 5L2ZH 1NFYA 2XBVA 1HJAB 3DHKH 2BDAA 4AGKA 1EUFA 1A1RA 2RDLA 2ZU1A 3RLWH 1C2HA 4WH6A 1Z1IA 2PKAB 5K7RA 1UTLM 1KLIH 2IOTA 2BX3A 1QL8A 1SPJA 5AFYH 3GCTF 2NWNA 4Q80A 1TPOA 1FI8A 4X0WU 1AVWA 2PSXA 2VIWA 1HAHH 2BZAA 2WYGA 3RM0H 1U6QA 3ZZ5A 3SI4H 2BDYA 3E0PB 1ANEA 1GGDB 1LQEA 2YOLA 1H4WA 1UJ1A 4XFQA 4WY3A 5CMXH 3M37A 1GJ5H 3U1IB 2ZECA 2XNIA 3UR9A 1O2GH 5FPSA 2QN5T 2JETB 2XBXA 1S6FA 5C3NA 1AZZA 4AFSA 2ANYA 4FUHA 4XBCA 1EZSC 1VZQH 9ESTA 4ISHH 1ANDA 2H5CA 3TGIE 1GCDA 6ESTA 3U98H 3RMNH 1TA6A 1ZSLA 2QXIA 1ELGA 3GY3A 1MTNC 1EZXC 3RXPA 2QCYA 4OGXA 2BDGA 1BTYA 1YCPM 2AIQA 3OYPA 1K1IA 2ZU2A 2O8WA 1SHHB 5TCCA 2QXJA 1CA8B 3ENSB 1QBVH 2XW9A 1UTQA 1J8AA 1YC0A 4WWYA 1N1LA 1TLDA 1BBRE 1QJ7B 1BDAA 1P2OA 3QDZB 1O3LA 2VH6A 1O33A 1M9UA 4Z6AH 1W10U 2DE8A 2XTTB 3MU0A 2H2ZA 3P6ZB 4K8BA 4ZXYH 1BMMH 1TNHA 2J38A 3QZQA 1Y8TA 1GI3A 1LHFH 4AZ2B 6GCHF 1AHTH 1C9TA 1IQHA 3ZVAA 2NU0E 3AW1A 1VJ9U 4CR9A 3RXCA 2ZFRH 1A4WH 4PROA 1LMWB 3ELAH 3RC4A 1YGCH 3MNBA 5C5OA 1NRQH 1MTVA 1SGYE 1ZOMA 1GJDB 1ZHPA 1KXCA 3GCHC 3SN8A 1AO5A 4AN7A 1MH0A 1YM0A 4Y6DA 4X1QU 1NFUA 3SU5A 3EA9A 3LJOA 4Y7BA 4VGCC 4NGAH 1C5YB 1DUEA 4YLQH 3SU6A 1P04A 2F9PA 3LT3A 4WVPE 4CBOA 1C2KA 1DICA 4Y11E 1LHGH 3ZZDA 1JMOH 1KXFA 2A7JA 1HB0B 2XCNA 2ZHFH 4MNXA 2BD3A 4SGBE 4IGDA 4UFFH 3TVJB 1MTUA 5JBAS 3RXEA 1QGFA 1THRH 4MDSA 1UCYH 3VGCB 1QURH 2SNWA 3FAOA 1JWTA 4RN6A 1BOQA 2IN2A 1V2UT 2ZHEH 1FY8E 1PQ5A 3F9EA 1ELBA 4XBBA 4K5ZA 1LVBA 4E7RG 5JB9S 2XWBI 2BHGA 3BTTE 4NWKA 4BAOB 1YLDA 4X6NA 1C5XB 2FLRH 1Y3UA 8ESTE 2ZA5A 3T27A 1F0RA 2A7HA 2G5VA 4Y76A 3QO6A 3M3TA 1CHGA 1SG8B 3HGNA 4M7GA 3DFJA 2VIOA 1XVOA 3V0XA 2C8WB 4NZQA 3VB4A 1FPHH 5I25A 4SGAE 5DPAA 3I78A 1OXGA 2Z9IA 3SBKA 1FN6A 3MO6A 1HLTH 1C5ZB 5E8EH 1BRAA 2FDAA 2UUKB 1WTHD 4A1XA 3PLKA 1DSTA 1LKBA 1T4VH 5L2YH 1O3PB 3O8CA 1C5UA 3ZVGA 4H6SB 2Y5GA 3ATLA 1CGHA 3P8GA 2FOMB 2A4OA 1S0RA 3RU4T 1O3EA 2AMPA 1QJ1B 1SGFA 3BTKE 3UY9A 1YF4A 2A4GA 1OWDA 2H9TH 4ABBA 1TMUH 3TK9A 1AFQB 1QY6A 1G3DA 1V2LT 1HAGE 3A7WA 3SNDA 4I8LA 1BHXB 1GMHG 4YOJA 3A86A 3HKIB 4LOYH 1MCTA 2BOHB 3MU5A 4I8HA 4KP0A 5DP8A 2AFQB 3M5LA 4D7GA 1FMGA 1CHOG 4WXVA 1CSOE 1C1WH 2ZZUH 1SGPE 3LJJA 3R3GB 1O3HA 3A84A 3PYHA 1K1OA 1P2MA 1WAYB 3B9FH 1O32A 1TQ0B 4IS5A 1LHDH 1Q2WA 4NFFA 2J34A 4K1EA 2I6SA 2VIQA 3VFEA 1H8DH 2WPHS 4LZ4B 1NT1A 5E2PA 2FYQA 5FPTA 4ZH8A 2NU3E 1UK3A 3SI3H 4B2AA 3LDXH 1O2NA 2ZDNA 3C27B 3MH6A 2PKSC 1DY8A 3SU2A 5AFZH 3TH3H 5BRRE 5A8XA 3V7TA 1ZGVA 2HPQH 2CHAC 3OSYA 1SGDE 4O3UA 3P17H 5AVDA 3BTME 1C1SA 1P10A 1QCPA 4DJZB 5GWZA 4JZIA 1C9PA 1QNJA 4LXBH 1C5OH 1YPMH 1HGTH 4WXIA 4X6OA 4YT7H 1P06A 5EOKA 5EU8A 1ZTLA 1ZYOA 1SOZA 2C4FH 2TBSA 2Y5HA 2A5KA 2VIPA 4X6PA 4FUCA 3RC6A 1ZRBA 5IYTA 1HIAB 2FIRH 1DM4B 1GBCA 3LGTA 1T32A 3U8OH 2AERH 4MNVA 1A46H 1ZJDA 3O8DA 1IQIA 1TRNA 1HAIH 3K2UA 1FQ3A 2JETC 2ASUB 4O97A 2ZKSA 3NKKA 2SNVA 2GZ8A 2P16A 2ZO3H 6CHAC 1C1RA 1QR3E 1DT2A 5LPEA 4X8TH 2BTCE 2OLGA 1SGNE 2PTNA 3LKWA 3M7QA 1L1NA 1L4ZA 6LPRA 1CVWH 2BY6X 3A7YA 3M5NA 5CHAC 3HGPA 2WPLS 3T62A 3HPTB 1BTZA 2BMGB 1AB9C 3OY6U 1GBLA 3LOXA 4NFEA 1ESAA 5DP4A 2W26A 1O2KA 4TY7A 2BZ6H 3VB3A 2ZCHP 2I6QA 4MPVA 5F6MA 3RXIA 1MBMA 1J16A 1V3XA 3BEFB 1CBWB 1Y5AT 2C8YB 3GOVB 4MPUA 3EGKH 3LONA 3MH5A 3RXBA 4GLYA 2CJIA 2Z94A 1O36A 1E37B 2FX4A 5G4BA 1GL1A 2ZGHA 4ZKSU 1WBGB 3PB1E 2OUAA 4CRCA 2ZGJA 3MO9A 3MHWU 4UFGH 1V2WT 5DP3A 1V2QT 4HI3A 1Z1JA 3BTEE 1OWJA 4E05H 2BOKA 1DOJA 1BCUH 1Z8JB 3T25A 2Z3EA 4CH8B 1MU8B 2O9QA 4FUFA 4D8NA 1TNKA 2Y81A 1WTGH 2ZFSA 1GBBA 5A2MH 1OYQA 1BMAA 1KLJH 2FMJA 2XBWA 2Y6TA 3OU0A 2P8OC 1NRPH 1QBNA 1O2QA 1V2TT 2A7CA 4JMYA 3A7VA 1RGQA 1OWHA 2VWMA 1F0UA 1SGIB 2NU4E 1ZRKA 3RXDA 4NIYA 4YOGA 4AB8A 2PUQH 1C4Y2 3P92A 4MPWA 1AE8H 2B7DH 4AYYB 1C5TA 6CHAB 1GJ8B 3AASA 1AWHB 2BYAX 2GV6A 1OKXA 1BTHH 1DITH 1EJNA 5EQQA 1PPFE 4IC5A 1Z7KA 1SLXB 2BD2A 4KGAA 1QQ4A 1HAZB 2GCTB 1DDJA 1WQVH 4ABEA 1T31A 4FUJA 4OS4A 2W7SA 1D4PB 5DP6A 1GPZA 7KMEH 3MNCA 1ARBA 3K65B 1RRKA 3IWMA 3UWIA 3T26A 4ISOA 2UWLA 2ODYB 1TMBH 3Q3YA 1GI4A 1GG6C 1BTUA 3ESTA 1GBIA 2FI4E 5HMAA 3RXSA 1SVPA 3GY7A 5FX6A 2A45B 1ARCA 1JXPA 3VB6A 4X2WA 1LHCH 2FM2A 3ODDA 1C1QA 1Z8IB 5FPYA 7ESTE 1Y5UT 1W14U 2SGEE 3MU1A 1IQJA 5A09A 3LGVA 1O3AA 2Q6FA 4ABJA 5GDSH 2LNCA 3UFAA 1MZAA 1VCWA 1O5AB 3ZZCA 4NSVA 1ZR0A 4WH8A 3P8NA 1ZGIA 3EA7A 4WJG2 1FN8A 3OTJE 1UVPA 1TAWA 3F9HA 3BTHE 1QIXB 2PGBB 1SOTA 1GCTB 1QQUA 1BRCE 3O8RA 4OS2A 7LPRA 1GBMA 5EODA 3RXJA 1D3TB 4TY6A 1ANCA 4IW4E 2HVXA 4ZXXH 3SU1A 1UK2A 4I31A 4BXSA 1NROH 3UREA 3BTDE 5LPFA 1EKBB 1S5SA 1GMDG 4J1YA 4OGYA 2ODPA 2P95A 1TWXB 1P11E 3BG8A 1A3BH 1CBWC 1NU7B 2ZPQA 6GCHG 4OS5A 1FAXA 1O2UA 5C67A 1ELVA 1F2SE 8KME2 1FXYA 1RJXB 3MWIU 3SV2H 2OP9A 3P95A 5HM9A 1BBRK 1MKWK 5EW1H 1GI9B 1UVOA 2Y7XA 3A81A 4UFEH 5ESBA 1FLEE 3M5OA 2F91A 2BVSH 1MMJN 4YOIA 2QF3A 2JH6D 4AG1A 2H9EH 3KQDA 1GJCB 1LQDB 1WV7H 1XM1A 2QYIA 3Q00A 1HDTH 2B8OH 4KTSA 3A80A 5DP5A 1VR1H 3E16B 1XUFA 1CT4E 2QC2A 3KF2A 1HNEE 4FUBA 1A2CH 2O8LA 5A8YA 3M7TA 1ZJKA 2J2UA 2Y82A 3RU4D 1TIOA 3VPKA 1CHOF 5HXFA 2QV1A 2C8XB 1MBQA 1EP6A 1W3CA 3UIRA 1ETRH 1QA7A 2ZEBA 1ORFA 1P2KA 1NTPA 3L3TA 4Q7YA 5JBTA 1O3DA 1TGSZ 2CN0H 3V13A 1O2MA 1ELEE 2A32A 1QL7A 2FS8A 1O2SA 4Q7XA 1D3DB 1C5WB 3NUMA 2FTMA 1EZQA 1PFXC 3OX7U 2G00A 5T6DA 3M3SA 4CBNA 4X1RU 1VGCC 2RA0A 2ZFPH 1O5EH 3M36A 2G8TA 5LH8A 4Y71A 3A8AA 1GCTC 1XKAC 1E35B 4JYTA 4ASHA 1C5PA 3A87A 2Y7ZA 2BD7A 1V2RT 5C5NA 1TYNA 3F68H 4K1TA 2OC0A 4NG9H 1UVSH 1L4DA 1ELFA 2WV5A 4WMEA 1GBAA 4KTCA 2FO9A 3SJKA 5E0HA 3P8OA 1MCVA 3K6YA 4ABGA 1G3EA 1C5QA 2UUJB 2D26C 3QZRA 2ZPSA 3S69A 3QN7A 1FNIA 3TJUA 5CHAB 1PYTD 3TK6A 1IHTH 2PR3A 4B2CA 3TIUA 3ZZ3A 2ZDVH 1Z71A 2ZHDA 5EXNA 3MNXA 2H6MA 1RD3B 2VWOA 3SNEA 2RA3A 1DPOA 1OPHB 1T8MA 1K1PA 3E0NB 5SGAE 3MI4A 3TGKE 1TX7A 1YYY1 3ZVFA 4RKOB 1J15A 1AN1E 2ZU4A 3SUDA 2OD3B 3RXKA 1A3EH 1DFPA 1RTLA 3U8TH 3D49H 1B5GH 1L2EA 3DA9B 4YLUA 1TPPA 5FXLA 1GDQA 5H4IB 1UK4A 2M5TA 1E0FD 5AF9H 1AFEH 2ZDAH 1GI1A 3E6PH 4DG4A 2GT8A 1AQ7A 1T8NA 4IN2A 1XKBC 1NN6A 3UWJH 1GJAB 1ACBE 3SORA 1GBHA 2C90B 2CF8H 2A5IA 3PWBA 4XOJA 3RXVA 1YPLH 1FPCH 1K22H 2ZFQH 1NPMA 2BY8X 3GY2A 3P8FA 1TX8A 3RXHA 1W0YH 1O30A 1SC8U 1S84A 1TNGA 4DIIH 5DG6A 1THPB 2ZQ1A 3F9GA 3BV9B 3L33A 1XUKA 2TRMA 1HFDA 1G3BA 2ZU3A 5EPYA 1ZSJA 1KYNA 1L1GA 1S83A 1UTJA 3A82A 1N6YA 1C2IA 4GCHG 2Q6GA 1HV7A 1XX9A 4NA9H 4BXWA 5T3HA 1P8VC 5GIBA 1Y3WA 3CENA 2B0FA 3QK1A 1AMHA 1EZUC 4OS6A 2WINI 5EPNA 1TGBA 1ANBA 1F5RA 3SU3A 2ZGCA 1QL9A 2GD4B 2BY5X 2EC9H 4ISLA 2G52A 3NCLA 1EPTC 2CGAA 2ULLA 2TGAA 3UOUA 4ABFA 3PROA 1IQGA 4INLA 2P59A 3ATKA 1BMNH 1YP9A 2F9NA 2HOBA 4AFQA 1HJ8A 1PPHE 2BD5A 3A7ZA 1AWFH 1O35A 2J9NA 2AGIX 4I7YH 5DKMA 1O3KA 1EASA 1OP8A 3F6UH 1BB0B 1J9CH 2BLVA 2PKAA 1CGJE 4K1SA 2GZ7A 1O2XA 3MTYA 1QB1A 1O2RA 2ALPA 1TB6H 2CHAB 4MNWA 4A92A 1GGDC 4INKA 3H7OA 3TGJE 1P3EA 1F0TA 1N8OB 3EYDA 1GHAG 2JKHA 5C20A 1D3QB 2FLBH 1LVMA 4JYUH 2AGEX 2D8WA 4H42U 3CP7A 1GJ6A 1YLCA 1P9SA 3H5CB 1GDUA 1ZPCA 2F3CE 2J94A 2D1JA 2TGPZ 2CXVA 4MG3A 4IMQA 3ZZAA 1V2MT 4D7FA 2QGRA 1MD7A 2THFB 1CT0E 1UHBB 1TBQH 3LIWA 1UMAH 4O9VA 1G2MA 5FCRA 2Y80A 1DLEA 1W0ZU 4X2YA 4ZAEA 2AGGX 1PQAA 4DCDA 2O8MA 4YO9A 1C4U2 1XVMA 2CMYA 4K2YA 4OS7A 2FS9A 1DXWA 3RUOA 1C5SA 1A0JA 4K8YA 5A8ZA 1SGRE 1C1MA 1GBDA 2UUFB 3KEEA 3RM2H 1OP2A 2BLWA 2AS9A 4UE7H 1FJSA 1ZPZA 2A2XH 3SGQE 1NFXA 3AVZA 1XUIA 2GDEH 1EATA 3LGIA 1EX3A 4FU8A 4DY7B 2FXRA 7GCHF 1VITG 4ZKOU 4E7NA 3S0NA 5HYOA 2G55A 5F03A 2R0LA 1PQ7A 5T6FA 2STBE 3SV8A 4D9QA 2IPHA 1KXBA 1UTNA 4ZKNU 3Q3XA 1TBRH 1HAXB 2AMQA 1P12E 5AHGH 4LZ1H 4Q2KA 1UTOA 3SU0A 3TK5A 3TJVA 2BXTH 2VGCB 1HXFH 2FODA 1EXFA 1IHSH 2HGTH 3LC5A 1HBTH 4RKJB 2BVXH 1DSUA 4A1VA 4B1TA 1H9LB 3FP7E 3EAJA 3HK3B 3FP6E 3JZ1B 2QY0B 4NIWA 1ID5H 1BRBE 4X8VH 2B5TB 5EXMA 1QRXA 2UUYA 1JIRA 3GCTG 1OX1A 5PTPA 1QBOA 2FOHA 3UNRA 1A61H 3NXPA 1HAVB 2ZTYA 1Z6JH 3GDVA 2OINA 4GAWA 1SR5C 1V2OT 2H1UA 3UOPA 2ZCKP 3A7XA 4NA7A 2ZC9H 1DLKB 3E3TA 3BG4C 5EXLA 1JRTA 1OSSA 1FV9A 2VVUA 4H4FA 3GY5A 1CU1A 1BTWA 1O3GA 4FUEA 2CF9H 5DJ7A 3BTGE 3BTWE 4CRGA 1O31A 4X8SH 1BRUP 3RXRA 1EPTA 1C5NH 4R0IA 4Y8XA 3T28A 1HIAA 1EAUA 4B76A 1TQ7B 2ZGXH 1TNJA 3E1XB 1C1UH 1G30B 3RXTA 4QT8C 2A0QB 4BANB 1IQLA 2ZFTA 3QGJA 1AU8A 1MQ6A 1W12U 4NZLA 3A88A 1LPZB 4YM9A 3RXMA 3S9BA 1V2NT 5JDUB 4U2WA 8LPRA 2EI8A 1TRMA 3EQ0H 1ZTKA 3URDA 1SGQE 2W3IA 3QTVH 4MPXA 3B8JA 4CR5A 2GDDA 2FOCA 3VB7A 4CRBA 2PV9B 4TPIZ 4DVAU 2P3FH 3RXGA 1NY22 3A8CA 3HATH 2FOEA 1FY3A 1SQAA 2VNTA 1NRNH 5FAHA 2ZI2H 3FVFB 5B6OA 1GBEA 1EB2A 1PJPA 4FUGA 1GDNA 1V2KT 3UQVA 2F9OA 3BIVH 1SLVB 3KQBA 2VH0A 4ABAA 1BT7A 1LVOA 4ABHA 2Y5FA 4NSYA 3BEUA 4YT6H 4TPYA 2HWLB 1EAXA 3PTNA 2VGCC 2FEQH 4ISNA 1ZMJA 2LPRA 2GCHG 2R2MB 3BSQA 2XBYA 2FI3E 2HNTF 2OXSA 4B73A 3VXFH 4X2VA 1SFIA 1LKAA 1L1JA 5EQRA 2H5DA 2VWLA 2HNTE 1H9HE 3URCA 4HGCA 1K1MA 3W94A 4AX9H 1A0LA 3HKJB 3TH2H 1W2KH 3GCOA 3TH4H 3SJ9A 1O5FH 3SJ8A 3VEQB 1GI7B 2KAIB 1BJVA 4MQAA 4CREA 1THSH 1NFWA 7GCHG 2V3HH 5FBIA 1ESBA 5TJXA 3GICB 2OC8A 1SFQB 1MTWA 5JBBS 2ZTZA 1O2JA 3PMHB 3NZIA 3LC3A 4BTIB 2ALVA 1UO6A 3PLPA 1E38B 2Z3CA 4GPGA 1C2LA 1MAXA 1MUEB 4MVNA 2XC4A 1GBKA 1RTKA 1V2JT 2O8UA 5F8ZA 1QHRB 4B75A 3LGYA 4AFZA 1F5KU 1ZMNA 1AUTC 2OQ5A 1O3FA 2Z9LA 3QWCH 4K69A 2ANMH 5I46H 1BTXA 1DE7H 1GI5A 1T8LA 2R3YA 3SJIA 1LTOA 1ETTH 1W8BH 1C2GA 3AAUA 1O3MA 5DP9A 1IOEA 1GHYH 1GHVH 1P01A 1SGTA 2EI6A 2V35A
chains in the Genus database with same CATH superfamily
1YPKH 4Y10E 1L0ZA 4BTUB 3VGCC 2JH0D 2PTCE 4DGJA 1HJAC 3M35A 1KLTA 1GI8B 1SSXA 1C2FA 2BLOA 1PQ8A 3D65E 3WY8A 4FUIA 1T4UH 3RXQA 1S81A 3G01A 3SGAE 1ELAA 3AAVA 2V3OH 2WPIS 4M9FA 2H9HA 4OS1A 4UEHH 5C2ZA 1O2OA 1TABE 1O2ZA 1VJAU 3DUXH 2ZP0H 4BOHA 1O2WA 1EOLA 1QRZA 2GT7A 1G32B 1O2VA 1KY9A 1PYTC 3TJNA 1O5DH 3BN9A 4IN1A 3SV9A 3P70B 4MLFB 2KAIA 3A83A 4AG2A 5GCHG 2HPPH 2BB4A 5ETXA 2KCAA 1N8OC 1SI5H 2WZQA 1P2IA 2GTBA 3L6PA 1GJ7B 1RIWC 4NCYA 2FOBA 2C8ZB 1C2EA 1KDQB 1DWCH 1BHXF 1O2LA 1NU9A 2FX6A 4JCNA 1MU6B 3OY5U 2F83A 1UCYK 5LPRA 1H9IE 1LCYA 3TNTA 3QUMP 3SNCA 2P3UB 3BF6H 1WUNH 2JJ2D 1O5GH 2W3KA 1KXEA 4YXWD 3KQ5A 3KHVA 1K1NA 2AEIH 2G4UA 1S6LA 2SGDE 1GG6B 1SGFG 3PM3A 1DANH 2V7QD 2GX4A 2CV3A 1TGNA 1EAWA 1GMCF 3V3MA 3U1JB 2JDID 4E06H 1GHXH 4ZMAH 1MKXK 4YESB 3ODFA 1K1JA 3MYWA 1IQFA 1FX0B 1TA2A 3W95A 3A8DA 1YPHC 3UR6A 1CA0C 1Z6EA 2F9VA 1K9OE 1LVYA 3SNAA 4IMZA 3RDZA 3LGUA 2F9UA 2WUCA 1VKYA 3WWFA 1GMDF 2R0KA 1GMCG 4NWLA 2ESTE 4K60A 3UTUH 5LGOA 1OOKB 3SW2B 4JZEH 2ZGBH 2OBOA 1V6DA 3RC5A 2Z6BD 3IITA 2Z9JA 1EAIA 2PLXA 2FOFA 2XCFA 2OQUA 1RIWB 3SZEA 1ZHMA 2SGPE 4FU9A 1QJ6B 3I77A 1XXDA 3AW0A 2ZCLP 1BQYA 2IJOB 1YY3A 4ASUD 1O37A 4ISIH 3ZZ9A 1O3OA 1VCQA 3RXAA 1Z8RA 2V0BA 3NK8A 4THNH 4K3JA 4NIVA 3CS0A 3SOSA 1O0DH 1SQOA 2WUBA 3ZYDA 1TRYA 3PMJA 2GGVB 2OCVB 1TPSA 1UTMA 4KELA 1O3BA 3KQCA 1EOJA 4IBLH 4TWWA 4VGCB 3ZZ6A 8GCHG 2TIOA 1VITF 3DT0H 4F55A 3EA8A 1B0EA 4KTUA 1O3CA 1O2IA 3GYLB 3MH4A 1GJ4H 4I8KA 1Y59T 1KTSB 2BM2A 2JH5D 2XC5A 3F0OA 2R3UA 1DY9A 1IQNA 1UVTH 1SGEE 3KQEA 1D9IA 1QB6A 1CA0B 3K9XB 1T8OA 3Q3KA 3ZVEA 2VU8E 4CHAC 5FHTA 1C4V2 1D6RA 1NM6A 4Y79A 2AH4X 3ZIAD 1P09A 5C17A 3GDSA 4WMDA 2Q6DA 2OC1A 1INCA 1MZDA 2G5NA 1KMHB 4B6FA 1RXPA 5IK2D 2ZPRA 1Q3XA 1YPGH 2VJ1A 5JYIA 1AI8H 2ZIQH 1P57B 1YCPH 3MH7A 2GZ9A 3ZV9A 1MTNB 3KCGH 3AK5A 2HVYB 3M7UA 4O03A 4P00A 3S7HB 3NWUA 3S7KB 1TX6A 1K28D 2WYJA 5C0TA 4U01A 1GBFA 1AB9B 1QFKH 2A4QA 4NA8A 1CT2E 4DW2U 1NESE 1X7AC 3PV4A 3SJOA 1KIGH 4FUDA 2ANKH 2TGTA 3B23B 3DFLA 1NRRH 5FBEA 2R2WU 1F5LA 3RXFA 2UWPA 1WU1A 2ZFFH 5E2OA 1K2I1 1GVZA 4JK5A 3RXOA 1H1BA 1S0QA 3N7OA 5BPEA 4GHTA 3STIA 3BTFE 5CDFE 2Z9GA 3UPEA 1C5LH 4UD9H 1GMHF 1HAPH 1B7XB 2AYWA 3C1KA 4GUXA 4FVDA 4J2YB 1QA0A 3UQOA 3ATIA 5J4SA 2L74A 1NZQH 5EJ1A 1G2LA 5EGMA 2O8TA 4HFPB 2YMSB 3F9FA 1SLWB 1GVLA 1BBRH 2HLCA 3LH3A 4ZCNA 1G9IE 1GL0E 4FXGH 1LPGB 2YNAA 1NRSH 1AD8H 1A5HA 1HAYB 5DGJA 1TGTA 2F4LA 1Z8GA 5HGGA 5C0UA 2ZDLA 4JZDH 4I8JA 2BD9A 4Q4LA 3TPIZ 3JZ2B 1O34A 3TJOA 3GCHB 1AKSA 2AMDA 2HNTC 1EFRD 2QXGA 4I33A 4ABDA 1OWIA 1ZZZA 2QA9E 1TPAE 1O5BB 4H6TA 3FP8E 5TCAA 1COWD 1O2HA 2BD8A 3RXLA 1S6HA 1Y5BT 3R0FA 3E8LA 3M61U 1BJUA 3FN8A 2TPIZ 2P8OB 4ZKRU 3GY6A 3E90B 1UVUH 1KXDA 4DURA 4UONA 1C1NA 5DP7A 2VVVA 1J17T 3M5MA 4XSKU 2XXLA 4A1TA 1W7XH 2G51A 4XDEA 2ZQ2A 1AVXA 2P94A 4HTCH 4Y0ZE 2BY7X 2KFWA 3TITA 1UTKA 1WSSH 4BAQB 1P05A 3U28C 1YPJH 2BX4A 2ZDKA 1UHBA 4AC9A 1QB9A 4DT4A 1EJMA 2BDBA 2PWXA 3SV7A 5JPMH 3TNSA 1VCPA 3PMAB 2EA3A 2GVFA 1HRTH 3KNXA 1EJAA 3STJA 1GHAF 1O38A 2GKVE 2RG3A 2FP7B 1P2JA 2AIPA 1D6WA 1O3IA 4AORA 1W11U 2SGFE 3SUGA 3F2GA 1ELTA 2FZZA 2BDIA 5F8TA 4CH2B 1SQTA 1TOCB 5GNDA 1GI6A 1IAUA 2BQ6B 1YPHE 1HYLA 1P02A 2Q1JA 1HCGA 1A5IA 3KN2A 3PMBB 3TU7H 1YPEH 1O2YA 5HIZA 3TLOA 4WMFA 1HAOH 1UCYE 1WDIA 3QX5H 1D3PB 5F8XA 3RLYH 3MO3A 4I8GA 4AFUA 1CGIE 4AYVB 3FZDA 2QF0A 1WQSA 2Z9KA 4GHQA 1P3CA 4FVBA 1F92A 2ZHQH 1BUIA 1DVAH 4CRAA 2ZF0H 1C1TA 2P3TB 5HM2A 4WF8A 1HAVA 3SNBA 3SUFA 2KCYA 4DOQA 2HLDD 4CRDA 2BVRH 2J98A 2M2AA 4ZROA 3Q77A 2DUCA 3OAAD 4ZHMU 3A8BA 3VXEH 2XC0A 1OP0A 4Y0YE 1V2PT 1G3CA 1XUJA 2GCHF 3SZNA 2J4IA 3UUZA 2BQWB 3N7EA 2A1DB 1PPGE 2SGAA 3FOAA 3T2NA 3ZZ8A 3FZZA 1V2ST 1FONA 2ZDMA 2PKSB 1GJ9B 1P9UA 1AY6H 1W7GH 4ZHLU 1HPGA 1BZXE 5JBCS 1C2JA 1PPEE 5ABWA 4JK6A 3SO3A 4JZ1A 1O2TA 1ELDE 2A5AA 5C1XA 2FTLE 1FDPA 1DWDH 2ZNKH 2FOAA 5DSFA 4Y8ZA 1P0SH 2OK5A 3MOCA 1MKXH 2QIQA 3E91A 4I32A 4B74A 5A0AE 5DO4H 3ZV8A 3SV6A 5L30H 1Q31A 1W0KD 3RP2A 2GV7A 1ZLRA 1GVKB 3KIDU 4DT7B 3M3VA 2SGQE 4GSOA 1VGCB 1TBZH 2A2QH 3UNSA 4LK4A 5EG4A 2BQ7B 3ZVBA 1B0FA 4X1SU 4ESTE 1QTFA 1S85A 4A6LA 1C1VH 1DWEH 1F0SA 4HZHA 1KSNA 1IQKA 3GISB 2P93A 1EB1H 1K0HA 2ZG0H 2STAE 1LPKB 1TALA 3SUEA 1KTTB 1C5VA 2Z7FE 4AGJA 1LO6A 3I29A 2HALA 4TYDA 1OYTH 3ZVDA 1N6XA 2EQNA 1VITH 9LPRA 3EE7A 4INHA 2VVCA 2R9PA 4UFDH 1FY5A 2J92A 2G81E 1T7CA 2LP6A 5C1UA 2RDEA 4XBDA 4RSPA 5FCKA 4Y7AA 1SL3A 1RS0A 3BIUH 4KKDA 2OTVA 3RMOH 2FWWA 2PHBA 1FUJA 4X1PU 1ZPBA 1ABIH 5EQSA 1Y3YA 1MKWH 3K6ZA 3BTQE 2BDCA 1H8HD 1GI0A 2A31A 3PTBA 1WYKA 1XXFA 3D62A 3GDUA 4XE4A 1C1PA 4GCHF 1YCPK 3NRLA 3SYJA 1NC6A 2FYRA 2J95A 3FFGA 2FPZA 1P2QA 2ZHWH 1FIZA 3RMMH 1WOFA 4BAKB 1K21H 3RXUA 1O3NA 4X2XA 1CE5A 4B71A 2EEKA 3F1SB 1TE0A 1IQEA 1SKYE 5GXPA 3ZZ4A 1IQMA 2GMTC 3GCNA 1FZZA 1A5GH 1GWAA 1SB1H 3U9AH 5A0BA 1DXPA 3GY8A 1GBJA 1DS2E 5GCHF 4Z1MD 1KXAA 3FANA 2B9LA 5K0HA 1AE5A 1DWBH 1C5MD 8GCHF 1MAYA 1TOMH 3A89A 1HUTH 2ZWLH 1BITA 1JRSA 1AUJA 1SGCA 2UWOA 2AHME 3PO1B 5EJZA 1SBWA 3O8BA 1E36B 2SFAA 2KZ4A 4Z0KA 2FI5E 2HRVA 1HJ9A 1LDTT 5DK1A 3SGBE 3T5FH 1NS3A 1RTFB 1Y3XA 3GY4A 1AZ8A 1GJBB 2V6NA 3ATWA 2PGQB 1TFXA 1P2NA 1YLNA 4BAHB 2FESH 2GP9B 1ETSH 3LGWA 1V2VT 1KDQA 2FOGA 5A0CA 4ABIA 2BDHA 1F7ZA 2W7UA 4X1NU 5T6GA 3PLBA 3ZZ7A 1H8IH 4ZUHA 1BA8B 3QTOH 1W13U 2NU2E 2ZU5A 1BMLA 1YBWA 2WV9A 4AB9A 4D76A 1J14A 2DE9A 1AGJA 1ESTA 5IDKA 1EP5A 2OBQA 1FY4A 1ZSKA 1TGCA 3GYMA 1FAKH 2D2DA 3A7TA 3S9AA 4BTTB 3PWCA 3LPRA 3ZYEA 3ZZBA 1NO9H 1JBUH 3RMLH 1A0HB 3SQEE 4A7IB 2BLQA 3SHCH 1FIWA 1HXEH 2PFEA 4YZUA 1TONA 5FX5A 5ESTE 2ZTXA 2WPJS 1O2PA 2VINA 2WPKS 3QGNB 4R8TB 1AKSB 4ZHAA 1TMTH 2IPQX 4JYVH 1Y3VA 4CRFA 3PV5A 4BAMB 1O3JA 2XWAA 1AIXH 1P03A 4JZFH 2WPMS 4O3TA 2ILNA 1OS8A 1PPBH 3RU4E 5C94A 1CO7E 1EPTB 1LHEH 5C1YA 1JOUB 2ODQA 2BXUH 1BTPA 2VIDA 3KGPA 2XRCA 2VIVA 3U69H 1QRWA 2C3SA 2ANWA 3Q76A 1C5RA 2PSYA 1TNIA 2W5EA 3EDXB 4YTAA 5GJ4B 1BIOA 3MU4A 3QLPH 2GJGA 3H7TA 3SU4A 3KL6A 4F4OC 2Z3DA 4A5TS 1TNLA 1E79D 2NU1E 3ATMA 4D9RA 1ZMLA 2K1QA 1XUHA 1CQQA 3PO1C 3DD2H 2A4RA 4XD7D 1GHZA 3CS7A 4Y8YA 1AVGH 3SHAH 1UTPA 3MNSA 2XYAA 4RT0A 4NIXA 3SQHE 2EI7A 4Q7ZA 2PW8H 4B2BA 4U30A 1DUAA 1C2MA 1FY1A 1XMNB 3MU8A 3D23A 4U32A 4F49A 2G4TA 3ZVCA 1MD8A 5EW2H 3ITIA 3NPSA 2BY9X 1RFNA 4MNYA 3LH1A 2QE7D 5CE1A 3MFJA 1PPZA 3OEED 1PPCE 1XUGA 1E34B 1OWEA 1WCZA 2C93B 2F9BH 4IC6A 3T29A 2V3MA 1JIMA 5E0GA 1GBTA 3S9CA 2GCTC 2YNBA 1DX5M 5E0JA 3VB5A 1W0JD 2BD4A 1ZHRA 4UDWH 1G36A 2PUXB 4BNRA 2GMTB 1MQ5A 4FU7A 5GPIB 1K1LA 4CHAB 1GHBF 1O5CB 2RCEA 3U8RH 4GVUA 3BEIB 3LU9B 1SLUB 1GHBG 1AFQC 1OWKA 4DIHH 1O39A 5L6NH 4TT3D 4TWYA 1C2DA 1ELCA 2VWNA 1SHYA 2OC7A 4AOQA 1MTSA 1C1OA 4X8UH 3V12A 1S82A 1YKTA 5EIYA 5J4QA 2QAAA 1EQ9A 3HK6B 3A85A 2VB0A 3EE0B 1GI2A 1A7SA 1SMFE 2QF5A 3IG6B 4X6MA 1G37A 3BG4B 3MMGA 2WV4A 3UNQA 2TGDA 2QXHA 4MTBA 1GHWH 1ZTJA 5JB8S 1ABJH 5L2ZH 1NFYA 2XBVA 1HJAB 3DHKH 2BDAA 4AGKA 1EUFA 1A1RA 2RDLA 2ZU1A 3RLWH 1C2HA 4WH6A 1Z1IA 2PKAB 5K7RA 1UTLM 1KLIH 2IOTA 2BX3A 1QL8A 1SPJA 5AFYH 2KR7A 3GCTF 2NWNA 4Q80A 1TPOA 1FI8A 4X0WU 1AVWA 2PSXA 2VIWA 1HAHH 2BZAA 2WYGA 3RM0H 1U6QA 3ZZ5A 3SI4H 2BDYA 3E0PB 1ANEA 1GGDB 1LQEA 2YOLA 1H4WA 1UJ1A 4XFQA 4WY3A 5CMXH 3M37A 1GJ5H 3U1IB 2ZECA 2XNIA 5KGOA 1O2GH 5FPSA 3UR9A 2QN5T 2JETB 2XBXA 1S6FA 5C3NA 1AZZA 2KCOA 4AFSA 5FL7D 2ANYA 4FUHA 4XBCA 1EZSC 1VZQH 9ESTA 4ISHH 1ANDA 2H5CA 3TGIE 1GCDA 6ESTA 3U98H 3RMNH 5KECA 1TA6A 1ZSLA 2QXIA 1ELGA 3GY3A 1MTNC 1EZXC 3RXPA 2QCYA 4OGXA 2BDGA 1BTYA 1YCPM 2AIQA 3OYPA 1K1IA 2LELA 2ZU2A 1BMFD 2O8WA 1SHHB 5TCCA 3OEHD 2QXJA 1CA8B 3ENSB 1QBVH 2XW9A 1UTQA 1J8AA 1YC0A 4WWYA 1N1LA 1TLDA 1BBRE 1QJ7B 1BDAA 5KEDA 1P2OA 3QDZB 1O3LA 2VH6A 1O33A 1M9UA 4Z6AH 1W10U 2DE8A 2XTTB 3MU0A 2H2ZA 3P6ZB 4K8BA 4ZXYH 1BMMH 1TNHA 2J38A 3QZQA 1Y8TA 1GI3A 1LHFH 4AZ2B 6GCHF 1AHTH 1C9TA 1IQHA 3ZVAA 2NU0E 3AW1A 1VJ9U 4CR9A 3RXCA 2ZFRH 3H09A 1A4WH 4PROA 2YMSD 1LMWB 3ELAH 3RC4A 1YGCH 3MNBA 5C5OA 1NRQH 1MTVA 1SGYE 1ZOMA 1GJDB 1ZHPA 1KXCA 3GCHC 2K8IA 3SN8A 1AO5A 4AN7A 5T1VA 1MH0A 1YM0A 4Y6DA 4X1QU 1NFUA 3SU5A 3EA9A 3LJOA 4Y7BA 4VGCC 4NGAH 4B6EA 1C5YB 1DUEA 4YLQH 3KYGA 3SU6A 1P04A 2F9PA 3LT3A 4WVPE 4CBOA 1C2KA 1DICA 4Y11E 1LHGH 3ZZDA 3UAIC 1JMOH 1KXFA 2A7JA 1HB0B 2EY4C 2XCNA 2ZHFH 4MNXA 3N99A 2BD3A 4SGBE 4IGDA 4UFFH 3TVJB 4P02A 3W1EA 1MTUA 5JBAS 4FOUC 3RXEA 1QGFA 1THRH 4MDSA 1UCYH 3VGCB 1QURH 2SNWA 3FAOA 1JWTA 4RN6A 1BOQA 2IN2A 1V2UT 2ZHEH 1FY8E 1PQ5A 3F9EA 1ELBA 4XBBA 4K5ZA 1LVBA 4E7RG 5JB9S 2XWBI 2BHGA 3BTTE 4NWKA 4BAOB 3F2HA 1YLDA 4X6NA 1C5XB 2FLRH 1Y3UA 8ESTE 2ZA5A 3T27A 1F0RA 2A7HA 2G5VA 4Y76A 3QO6A 3M3TA 1CHGA 1SG8B 3HGNA 4M7GA 3DFJA 2VIOA 1XVOA 3V0XA 2C8WB 4NZQA 3VB4A 1FPHH 5I25A 4SGAE 5DPAA 3I78A 1OXGA 2Z9IA 3SBKA 1FN6A 3MO6A 1HLTH 2XNDD 1C5ZB 5E8EH 1BRAA 2FDAA 2UUKB 1WTHD 4A1XA 3PLKA 1DSTA 1LKBA 1T4VH 2WSSD 5L2YH 1O3PB 3O8CA 1C5UA 3ZVGA 2YMSC 4H6SB 2Y5GA 3ATLA 3N7DA 1CGHA 3P8GA 2FOMB 2A4OA 1S0RA 3RU4T 1O3EA 2AMPA 1QJ1B 1SGFA 3BTKE 3UY9A 1YF4A 2A4GA 1OWDA 2H9TH 4ABBA 1TMUH 3TK9A 1AFQB 1QY6A 1G3DA 1V2LT 1HAGE 3A7WA 3SNDA 4I8LA 1BHXB 1GMHG 4YOJA 3A86A 3HKIB 4LOYH 1MCTA 2BOHB 3MU5A 4ACAA 4I8HA 4KP0A 5DP8A 2AFQB 3M5LA 4D7GA 1FMGA 1CHOG 4WXVA 1CSOE 1C1WH 2ZZUH 1SGPE 3LJJA 3R3GB 1O3HA 3A84A 3PYHA 1K1OA 1P2MA 1WAYB 3B9FH 1O32A 1TQ0B 4IS5A 1LHDH 1Q2WA 4NFFA 2J34A 4K1EA 2I6SA 2VIQA 3VFEA 1H8DH 2WPHS 2JIZD 4LZ4B 1NT1A 5E2PA 2FYQA 5FPTA 4ZH8A 2NU3E 1UK3A 3SI3H 4B2AA 3LDXH 1O2NA 2ZDNA 3C27B 3MH6A 2PKSC 1DY8A 3SU2A 5AFZH 3TH3H 5BRRE 5A8XA 3V7TA 1ZGVA 2HPQH 2CHAC 3OSYA 1SGDE 4O3UA 3P17H 5AVDA 3BTME 1C1SA 1P10A 1QCPA 2XOKD 4DJZB 4JZIA 1C9PA 1QNJA 5GWZA 4LXBH 1C5OH 1YPMH 1HGTH 4WXIA 4X6OA 4YT7H 1P06A 5EOKA 5EU8A 1ZTLA 1ZYOA 1SOZA 2C4FH 2TBSA 2Y5HA 2A5KA 2VIPA 4X6PA 4FUCA 3RC6A 1ZRBA 5IYTA 1HIAB 2FIRH 1DM4B 1GBCA 3LGTA 1T32A 3U8OH 2AERH 4MNVA 1A46H 1ZJDA 3O8DA 2K0QA 1IQIA 1TRNA 1HAIH 3K2UA 1FQ3A 2JETC 2ASUB 1OHHD 4O97A 2ZKSA 3NKKA 2SNVA 5F53A 2GZ8A 2P16A 2ZO3H 1E1RD 6CHAC 1C1RA 1QR3E 1DT2A 5LPEA 4X8TH 2BTCE 2OLGA 1SGNE 2PTNA 3LKWA 3M7QA 1L1NA 1L4ZA 6LPRA 1CVWH 2BY6X 3A7YA 3M5NA 4RI0A 5CHAC 1WXRA 3HGPA 2WPLS 3T62A 3HPTB 1BTZA 2BMGB 1AB9C 3OY6U 1GBLA 3LOXA 4NFEA 1ESAA 5DP4A 2W26A 1O2KA 4TY7A 2BZ6H 3VB3A 2ZCHP 2I6QA 4MPVA 5F6MA 3RXIA 1MBMA 1J16A 1V3XA 3BEFB 1CBWB 1Y5AT 2C8YB 3GOVB 3OFND 4MPUA 3EGKH 3LONA 3MH5A 3RXBA 4GLYA 2CJIA 2Z94A 1O36A 1E37B 2FX4A 5G4BA 1GL1A 2ZGHA 4ZKSU 1WBGB 3PB1E 2OUAA 4CRCA 2ZGJA 3MO9A 3MHWU 4UFGH 2J98B 1V2WT 5DP3A 2QF4A 1V2QT 4HI3A 1Z1JA 3BTEE 1OWJA 4E05H 2BOKA 1DOJA 1BCUH 1Z8JB 3T25A 2Z3EA 4CH8B 1MU8B 2O9QA 4FUFA 4D8NA 1TNKA 2Y81A 1WTGH 2ZFSA 1GBBA 5A2MH 1OYQA 1BMAA 1QZ8A 1KLJH 2FMJA 2XBWA 2Y6TA 3OU0A 3WW7A 2P8OC 1NRPH 1QBNA 1O2QA 1V2TT 2A7CA 4JMYA 3A7VA 1RGQA 1OWHA 2VWMA 1F0UA 1SGIB 2NU4E 1ZRKA 3RXDA 4NIYA 4YOGA 4AB8A 2PUQH 2J97A 1C4Y2 3P92A 4MPWA 1AE8H 2B7DH 4AYYB 1C5TA 6CHAB 1GJ8B 3AASA 1AWHB 2BYAX 2GV6A 1OKXA 1BTHH 1DITH 1EJNA 5CHBA 3F0PA 5EQQA 1PPFE 4IC5A 1Z7KA 1SLXB 2BD2A 4KGAA 1QQ4A 1HAZB 2GCTB 1DDJA 1WQVH 4ABEA 1T31A 4FUJA 4OS4A 2W7SA 1D4PB 5DP6A 1GPZA 7KMEH 3MNCA 1ARBA 3K65B 1RRKA 3IWMA 3UWIA 3T26A 4ISOA 2UWLA 2ODYB 1TMBH 3Q3YA 1GI4A 1GG6C 1BTUA 3ESTA 1GBIA 2FI4E 5HMAA 3RXSA 1SVPA 3GY7A 5FX6A 2A45B 1ARCA 1JXPA 3VB6A 4X2WA 1LHCH 2FM2A 3ODDA 1C1QA 2KCPA 1Z8IB 5FPYA 7ESTE 1Y5UT 1W14U 5B6LA 2SGEE 3MU1A 1IQJA 5A09A 3LGVA 1O3AA 2Q6FA 4ABJA 5GDSH 2LNCA 3UFAA 1MZAA 1VCWA 1O5AB 3ZZCA 4NSVA 1ZR0A 4WH8A 3P8NA 1ZGIA 3F2FA 3EA7A 4WJG2 1FN8A 3OTJE 1UVPA 1TAWA 3F9HA 3BTHE 1QIXB 2PGBB 1SOTA 1GCTB 4OM9A 1QQUA 1BRCE 3O8RA 4OS2A 7LPRA 1GBMA 5EODA 3RXJA 1D3TB 3VG8A 4TY6A 1ANCA 4IW4E 2HVXA 4ZXXH 3SU1A 1UK2A 4I31A 4BXSA 1NROH 3UREA 3BTDE 5LPFA 3KYFA 1EKBB 1S5SA 1GMDG 4J1YA 4OGYA 2ODPA 2P95A 1TWXB 1P11E 3BG8A 1A3BH 1CBWC 1NU7B 2ZPQA 6GCHG 4OS5A 1FAXA 2VBCA 1O2UA 5C67A 1ELVA 1F2SE 8KME2 1FXYA 1RJXB 3MWIU 3SV2H 2OP9A 3P95A 5HM9A 1BBRK 1MKWK 2CK3D 1GI9B 5EW1H 1UVOA 2Y7XA 3A81A 4UFEH 5ESBA 1FLEE 3M5OA 2F91A 2BVSH 1MMJN 4YOIA 2QF3A 2JH6D 4AG1A 2H9EH 3KQDA 1GJCB 1LQDB 1WV7H 1XM1A 2QYIA 3Q00A 1HDTH 2B8OH 4KTSA 3A80A 5DP5A 1VR1H 3E16B 1XUFA 1CT4E 2QC2A 3KF2A 1HNEE 4FUBA 5DN6D 1A2CH 2O8LA 5A8YA 3M7TA 1ZJKA 2J2UA 2Y82A 3RU4D 1TIOA 3VPKA 1CHOF 5HXFA 1YWUA 2QV1A 2C8XB 1MBQA 1EP6A 1W3CA 3UIRA 1ETRH 1QA7A 2ZEBA 1ORFA 1P2KA 1NTPA 3L3TA 4Q7YA 1H8ED 5JBTA 4F48B 1O3DA 1TGSZ 2CN0H 3V13A 1O2MA 1ELEE 2A32A 1QL7A 2FS8A 1O2SA 4Q7XA 1D3DB 1C5WB 3NUMA 2FTMA 1EZQA 1PFXC 3OX7U 2G00A 5T6DA 3M3SA 4CBNA 4X1RU 1VGCC 2RA0A 2ZFPH 1O5EH 3M36A 2G8TA 5LH8A 4Y71A 3A8AA 1GCTC 1XKAC 1E35B 4JYTA 4ASHA 1C5PA 1SQRA 3A87A 2Y7ZA 2BD7A 1V2RT 5C5NA 1TYNA 3F68H 4I86A 4K1TA 2OC0A 4NG9H 1UVSH 1L4DA 1ELFA 2WV5A 4WMEA 1MABB 1GBAA 4KTCA 2FO9A 3SJKA 5E0HA 3P8OA 1MCVA 3K6YA 4ABGA 1G3EA 1C5QA 2UUJB 2D26C 3QZRA 2ZPSA 3S69A 3QN7A 1FNIA 3TJUA 5CHAB 1PYTD 3TK6A 1IHTH 2PR3A 4B2CA 3TIUA 3ZZ3A 2ZDVH 1Z71A 2ZHDA 5EXNA 3MNXA 2H6MA 1RD3B 2VWOA 3SNEA 2RA3A 1DPOA 1OPHB 1T8MA 1K1PA 3E0NB 5SGAE 3MI4A 4FETA 1TX7A 1YYY1 3ZVFA 3TGKE 4RKOB 3WWBA 1J15A 1AN1E 2KX4A 2ZU4A 3SUDA 2OD3B 3RXKA 1A3EH 5HKKD 1DFPA 1RTLA 3U8TH 3D49H 1B5GH 1L2EA 3DA9B 4YLUA 1TPPA 5FXLA 1GDQA 5H4IB 1UK4A 2M5TA 1E0FD 5AF9H 1AFEH 2ZDAH 1GI1A 3E6PH 4DG4A 2GT8A 1AQ7A 1T8NA 4IN2A 1XKBC 1NN6A 3UWJH 1GJAB 1ACBE 3SORA 1GBHA 2C90B 2CF8H 2A5IA 3PWBA 4XOJA 3RXVA 1YPLH 1FPCH 1K22H 2ZFQH 3CNRA 1NPMA 2BY8X 3GY2A 3P8FA 1TX8A 3RXHA 1W0YH 1O30A 1SC8U 2J5UA 1S84A 1TNGA 3DCLA 4DIIH 5DG6A 1THPB 2ZQ1A 3F9GA 3BV9B 3L33A 1XUKA 2TRMA 1HFDA 1G3BA 2W6JD 2ZU3A 1ZSJA 5EPYA 1KYNA 2RFKC 1L1GA 1S83A 1UTJA 3A82A 1N6YA 1C2IA 4GCHG 2Q6GA 1HV7A 1XX9A 4NA9H 4BXWA 5T3HA 1P8VC 5GIBA 1Y3WA 3CENA 2B0FA 3QK1A 1AMHA 1EZUC 4OS6A 2WINI 5EPNA 4TSFD 1TGBA 1ANBA 1F5RA 3SU3A 2ZGCA 1QL9A 2GD4B 2BY5X 2EC9H 4ISLA 2G52A 3NCLA 1EPTC 2CGAA 2ULLA 2TGAA 3UOUA 4ABFA 3PROA 1IQGA 4INLA 2P59A 3ATKA 1BMNH 1YP9A 2F9NA 2HOBA 4AFQA 1HJ8A 1PPHE 2BD5A 3A7ZA 1AWFH 1O35A 2J9NA 2AGIX 4I7YH 5DKMA 1O3KA 3PRDA 1EASA 1OP8A 3F6UH 1BB0B 1J9CH 2BLVA 2PKAA 1CGJE 4K1SA 2GZ7A 1O2XA 2JJ1D 3MTYA 1QB1A 1O2RA 2ALPA 1TB6H 2CHAB 3PV2A 4MNWA 4A92A 1GGDC 4INKA 3H7OA 3TGJE 1P3EA 4RT1A 1F0TA 1N8OB 3EYDA 1GHAG 2JKHA 5C20A 1D3QB 2FLBH 3DSOA 1LVMA 4JYUH 2AGEX 2D8WA 4H42U 3CP7A 1GJ6A 1YLCA 1P9SA 3H5CB 1GDUA 1ZPCA 2F3CE 2J94A 2D1JA 2TGPZ 2CXVA 4MG3A 4IMQA 3ZZAA 1V2MT 4D7FA 2QGRA 3PRBA 1E1QD 1MD7A 2THFB 1CT0E 3OTPA 1UHBB 1TBQH 3LIWA 1UMAH 4O9VA 1G2MA 5FCRA 2Y80A 1DLEA 1W0ZU 4X2YA 5EJLA 4ZAEA 2AGGX 1PQAA 4DCDA 2O8MA 4YO9A 1C4U2 1XVMA 2CMYA 4K2YA 4OS7A 2FS9A 1DXWA 3RUOA 1C5SA 1A0JA 4K8YA 5A8ZA 1SGRE 1C1MA 1GBDA 2UUFB 3KEEA 3RM2H 1OP2A 2BLWA 2AS9A 4UE7H 1FJSA 1ZPZA 2A2XH 3SGQE 1NFXA 3AVZA 1XUIA 2GDEH 1EATA 3F3BA 3LGIA 1EX3A 2IJD1 4FU8A 4DY7B 2FXRA 7GCHF 1VITG 4ZKOU 4E7NA 3S0NA 5HYOA 2G55A 5F03A 2R0LA 1PQ7A 5T6FA 2STBE 3SV8A 4D9QA 2IPHA 1KXBA 1UTNA 4ZKNU 3Q3XA 1TBRH 2L6OA 1HAXB 2AMQA 1P12E 5AHGH 4LZ1H 4Q2KA 1UTOA 3SU0A 3TK5A 3TJVA 2BXTH 2VGCB 1HXFH 2FODA 1EXFA 1IHSH 2HGTH 3LC5A 1HBTH 4RKJB 2BVXH 1DSUA 4A1VA 4B1TA 1H9LB 3FP7E 3EAJA 3HK3B 3FP6E 3JZ1B 2QY0B 4NIWA 1ID5H 1BRBE 4X8VH 2B5TB 5EXMA 4ACBA 1QRXA 2UUYA 1JIRA 3GCTG 1OX1A 5PTPA 1QBOA 2FOHA 2KM0A 3UNRA 1A61H 3NXPA 1HAVB 2W6ID 1Z6JH 2ZTYA 3GDVA 2OINA 4GAWA 1SR5C 1V2OT 2H1UA 3FO8D 3UOPA 3FKSD 3OE7D 2ZCKP 3A7XA 3GS9A 4NA7A 2ZC9H 1DLKB 3E3TA 3BG4C 5EXLA 1JRTA 1OSSA 1NBMD 1FV9A 2VVUA 4H4FA 3GY5A 1CU1A 1BTWA 1O3GA 4FUEA 2CF9H 5DJ7A 3BTGE 3BTWE 4CRGA 1O31A 2F43B 4X8SH 1BRUP 3RXRA 1EPTA 1C5NH 4R0IA 4Y8XA 3T28A 1HIAA 1EAUA 4B76A 1TQ7B 2ZGXH 1TNJA 3E1XB 1C1UH 1G30B 2PP6A 3RXTA 4QT8C 2A0QB 4BANB 1IQLA 2ZFTA 3QGJA 1AU8A 1MQ6A 1W12U 2WPDD 4NZLA 3A88A 1LPZB 4YM9A 3RXMA 5HIYA 3S9BA 1V2NT 5JDUB 4U2WA 8LPRA 2EI8A 1TRMA 3EQ0H 1ZTKA 3URDA 1SGQE 2W3IA 3QTVH 4MPXA 3B8JA 4CR5A 2GDDA 2FOCA 3VB7A 4CRBA 2PV9B 1UW7A 4TPIZ 4DVAU 2P3FH 3RXGA 1NY22 3A8CA 3HATH 4HG6A 2FOEA 1FY3A 1SQAA 2VNTA 1NRNH 5FAHA 2ZI2H 3FVFB 5B6OA 1GBEA 1NBME 1EB2A 1PJPA 4FUGA 1GDNA 1V2KT 3UQVA 2F9OA 3BIVH 1SLVB 3KQBA 2VH0A 4ABAA 1BT7A 1LVOA 4ABHA 2Y5FA 4NSYA 3BEUA 4YT6H 4XRNA 4TPYA 2HWLB 1EAXA 3PTNA 2VGCC 3MQKC 2FEQH 4ISNA 1ZMJA 2LPRA 2WHXA 3DSPA 2GCHG 2R2MB 3BSQA 3DSGA 2XBYA 2FI3E 2HNTF 2OXSA 4B73A 3VXFH 4X2VA 1SFIA 1LKAA 1L1JA 5EQRA 2H5DA 2VWLA 2HNTE 1H9HE 3URCA 4HGCA 1K1MA 3W94A 4AX9H 1A0LA 3HKJB 3TH2H 1W2KH 3GCOA 3TH4H 3SJ9A 1O5FH 3SJ8A 3VEQB 1GI7B 2KAIB 1BJVA 4MQAA 4CREA 1THSH 1NFWA 7GCHG 2V3HH 5FBIA 1ESBA 5TJXA 3GICB 2OC8A 1SFQB 1MTWA 5JBBS 2ZTZA 1O2JA 3PMHB 3NZIA 3LC3A 4BTIB 2ALVA 1UO6A 3PLPA 1E38B 2Z3CA 4GPGA 1C2LA 4Q63A 1MAXA 1MUEB 4MVNA 2XC4A 1GBKA 1RTKA 1V2JT 2O8UA 5F8ZA 1QHRB 3UB0A 4B75A 3LGYA 4AFZA 1F5KU 1ZMNA 1AUTC 2OQ5A 1O3FA 2Z9LA 3QWCH 4K69A 2ANMH 5I46H 1BTXA 1DE7H 1GI5A 1T8LA 2R3YA 3SJIA 1LTOA 1ETTH 1W8BH 1C2GA 3AAUA 1O3MA 5DP9A 1IOEA 1GHYH 1GHVH 1P01A 1SGTA 2EI6A 2V35A
chains in the Genus database with same CATH topology
1YPKH 4Y10E 1L0ZA 4BTUB 3VGCC 2JH0D 2PTCE 4DGJA 1HJAC 3M35A 1KLTA 1GI8B 1SSXA 1C2FA 2BLOA 1PQ8A 3D65E 3WY8A 4FUIA 1T4UH 3RXQA 1S81A 3G01A 3SGAE 1ELAA 3AAVA 2V3OH 2WPIS 2H9HA 4OS1A 4UEHH 5C2ZA 1O2OA 1TABE 1O2ZA 1VJAU 3DUXH 2ZP0H 4BOHA 1O2WA 1EOLA 1QRZA 2GT7A 1G32B 1O2VA 1KY9A 1PYTC 3TJNA 1O5DH 3BN9A 4IN1A 3SV9A 3P70B 4MLFB 2KAIA 3A83A 4AG2A 5GCHG 2HPPH 2BB4A 5ETXA 1N8OC 1SI5H 1P2IA 2GTBA 3L6PA 1GJ7B 1RIWC 4NCYA 2FOBA 2C8ZB 1C2EA 1KDQB 1DWCH 1BHXF 1O2LA 1NU9A 2FX6A 4JCNA 1MU6B 3OY5U 2F83A 1UCYK 5LPRA 1H9IE 1LCYA 3TNTA 3QUMP 3SNCA 2P3UB 3BF6H 1WUNH 1O5GH 2W3KA 1KXEA 3KHVA 1K1NA 2AEIH 2G4UA 2SGDE 1GG6B 1SGFG 3PM3A 1DANH 2GX4A 2CV3A 1TGNA 1EAWA 1GMCF 3V3MA 3U1JB 4E06H 1GHXH 4ZMAH 1MKXK 4YESB 3ODFA 1K1JA 3MYWA 1IQFA 1TA2A 3W95A 3A8DA 1YPHC 3UR6A 1CA0C 1Z6EA 2F9VA 1K9OE 1LVYA 3SNAA 4IMZA 3RDZA 3LGUA 2F9UA 2WUCA 1GMDF 2R0KA 1GMCG 4NWLA 2ESTE 4K60A 3UTUH 5LGOA 1OOKB 3SW2B 4JZEH 2ZGBH 2OBOA 1V6DA 3RC5A 2Z6BD 3IITA 2Z9JA 1EAIA 2PLXA 2FOFA 2XCFA 2OQUA 1RIWB 1ZHMA 2SGPE 4FU9A 1QJ6B 3I77A 1XXDA 3AW0A 2ZCLP 1BQYA 2IJOB 1O37A 4ISIH 3ZZ9A 1O3OA 1VCQA 3RXAA 1Z8RA 2V0BA 3NK8A 4THNH 4K3JA 4NIVA 3CS0A 3SOSA 1O0DH 1SQOA 2WUBA 3ZYDA 1TRYA 3PMJA 2GGVB 2OCVB 1TPSA 1UTMA 4KELA 1O3BA 3KQCA 1EOJA 4IBLH 4TWWA 4VGCB 3ZZ6A 8GCHG 2TIOA 1VITF 3DT0H 3EA8A 1B0EA 4KTUA 1O3CA 1O2IA 3GYLB 3MH4A 1GJ4H 4I8KA 1Y59T 1KTSB 2BM2A 2JH5D 2XC5A 1DY9A 2R3UA 1IQNA 1UVTH 1SGEE 3KQEA 1D9IA 1QB6A 1CA0B 3K9XB 1T8OA 3Q3KA 3ZVEA 2VU8E 4CHAC 5FHTA 1C4V2 1D6RA 1NM6A 4Y79A 2AH4X 1P09A 3GDSA 4WMDA 2Q6DA 2OC1A 1INCA 1MZDA 2G5NA 1RXPA 2ZPRA 1Q3XA 1YPGH 2VJ1A 5JYIA 1AI8H 2ZIQH 1P57B 1YCPH 3MH7A 2GZ9A 3ZV9A 1MTNB 3KCGH 3M7UA 4O03A 3S7HB 3NWUA 3S7KB 1TX6A 1K28D 2WYJA 4U01A 1GBFA 1AB9B 1QFKH 2A4QA 4NA8A 1CT2E 4DW2U 1NESE 1X7AC 3PV4A 3SJOA 1KIGH 4FUDA 2ANKH 2TGTA 3B23B 3DFLA 1NRRH 5FBEA 2R2WU 1F5LA 3RXFA 2UWPA 1WU1A 2ZFFH 5E2OA 1K2I1 1GVZA 4JK5A 3RXOA 1H1BA 1S0QA 3N7OA 5BPEA 4GHTA 3STIA 3BTFE 2Z9GA 3UPEA 1C5LH 4UD9H 1GMHF 1HAPH 1B7XB 2AYWA 3C1KA 4GUXA 4FVDA 4J2YB 1QA0A 3UQOA 3ATIA 5J4SA 1NZQH 1G2LA 5EGMA 2O8TA 4HFPB 3F9FA 1SLWB 1GVLA 1BBRH 2HLCA 3LH3A 1G9IE 1GL0E 4FXGH 1LPGB 2YNAA 1NRSH 1AD8H 1A5HA 1HAYB 5DGJA 1TGTA 1Z8GA 5HGGA 2ZDLA 4JZDH 4I8JA 2BD9A 3TPIZ 3JZ2B 1O34A 3TJOA 3GCHB 1AKSA 2AMDA 2HNTC 2QXGA 4I33A 4ABDA 1OWIA 1ZZZA 2QA9E 1TPAE 1O5BB 4H6TA 3FP8E 5TCAA 1O2HA 2BD8A 3RXLA 1S6HA 1Y5BT 3R0FA 3E8LA 3M61U 1BJUA 2TPIZ 2P8OB 4ZKRU 3GY6A 3E90B 1UVUH 1KXDA 4DURA 4UONA 1C1NA 5DP7A 2VVVA 1J17T 3M5MA 4XSKU 2XXLA 4A1TA 1W7XH 2G51A 4XDEA 2ZQ2A 1AVXA 2P94A 4HTCH 4Y0ZE 2BY7X 3TITA 1UTKA 1WSSH 4BAQB 1P05A 1YPJH 2BX4A 2ZDKA 1UHBA 1QB9A 1EJMA 2BDBA 2PWXA 3SV7A 5JPMH 3TNSA 1VCPA 3PMAB 2EA3A 2GVFA 1HRTH 3KNXA 1EJAA 3STJA 1GHAF 1O38A 2GKVE 2RG3A 2FP7B 1P2JA 2AIPA 1D6WA 1O3IA 4AORA 1W11U 2SGFE 3SUGA 1ELTA 2FZZA 2BDIA 5F8TA 4CH2B 1SQTA 1TOCB 1GI6A 1IAUA 2BQ6B 1YPHE 1HYLA 1P02A 2Q1JA 1HCGA 1A5IA 3KN2A 3PMBB 3TU7H 1YPEH 1O2YA 3TLOA 4WMFA 1HAOH 1UCYE 3QX5H 1D3PB 5F8XA 3RLYH 3MO3A 4I8GA 4AFUA 1CGIE 4AYVB 3FZDA 2QF0A 1WQSA 2Z9KA 4GHQA 1P3CA 4FVBA 1F92A 2ZHQH 1BUIA 1DVAH 4CRAA 2ZF0H 1C1TA 2P3TB 5HM2A 4WF8A 1HAVA 3SNBA 3SUFA 4DOQA 4CRDA 2BVRH 4ZROA 3Q77A 2DUCA 4ZHMU 3A8BA 3VXEH 2XC0A 1OP0A 4Y0YE 1V2PT 1G3CA 1XUJA 2GCHF 3SZNA 2J4IA 3UUZA 2BQWB 2A1DB 1PPGE 2SGAA 3T2NA 3ZZ8A 3FZZA 1V2ST 1FONA 2ZDMA 2PKSB 1GJ9B 1P9UA 1AY6H 1W7GH 4ZHLU 1HPGA 1BZXE 5JBCS 1C2JA 1PPEE 5ABWA 4JK6A 3SO3A 4JZ1A 1O2TA 1ELDE 2A5AA 5C1XA 2FTLE 1FDPA 1DWDH 2ZNKH 2FOAA 4Y8ZA 1P0SH 3MOCA 1MKXH 2QIQA 3E91A 4I32A 4B74A 5A0AE 5DO4H 3ZV8A 3SV6A 5L30H 1Q31A 3RP2A 2GV7A 1ZLRA 1GVKB 3KIDU 4DT7B 3M3VA 2SGQE 4GSOA 1VGCB 1TBZH 2A2QH 3UNSA 4LK4A 5EG4A 2BQ7B 3ZVBA 1B0FA 4X1SU 4ESTE 1QTFA 1S85A 4A6LA 1C1VH 1DWEH 1F0SA 4HZHA 1KSNA 1IQKA 3GISB 2P93A 1EB1H 2ZG0H 2STAE 1LPKB 1TALA 3SUEA 1KTTB 1C5VA 2Z7FE 4AGJA 1LO6A 3I29A 2HALA 4TYDA 1OYTH 3ZVDA 1N6XA 1VITH 9LPRA 4INHA 2VVCA 2R9PA 4UFDH 1FY5A 2J92A 2G81E 1T7CA 5C1UA 4XBDA 4RSPA 5FCKA 4Y7AA 1SL3A 1RS0A 3BIUH 4KKDA 2OTVA 3RMOH 2FWWA 2PHBA 1FUJA 4X1PU 1ZPBA 1ABIH 5EQSA 1Y3YA 1MKWH 3K6ZA 3BTQE 2BDCA 1GI0A 2A31A 3PTBA 1WYKA 1XXFA 3D62A 3GDUA 4XE4A 1C1PA 4GCHF 1YCPK 1NC6A 2FYRA 2J95A 3FFGA 2FPZA 1P2QA 2ZHWH 1FIZA 3RMMH 1WOFA 4BAKB 1K21H 3RXUA 1O3NA 4X2XA 1CE5A 4B71A 2EEKA 3F1SB 1TE0A 1IQEA 5GXPA 3ZZ4A 1IQMA 2GMTC 3GCNA 1FZZA 1A5GH 1GWAA 1SB1H 3U9AH 5A0BA 1DXPA 3GY8A 1GBJA 1DS2E 5GCHF 1KXAA 3FANA 2B9LA 5K0HA 1AE5A 1DWBH 1C5MD 8GCHF 1MAYA 1TOMH 3A89A 1HUTH 2ZWLH 1BITA 1JRSA 1AUJA 1SGCA 2UWOA 3PO1B 1SBWA 3O8BA 1E36B 2SFAA 4Z0KA 2FI5E 2HRVA 1HJ9A 1LDTT 5DK1A 3SGBE 3T5FH 1NS3A 1RTFB 1Y3XA 3GY4A 1AZ8A 1GJBB 2V6NA 3ATWA 2PGQB 1TFXA 1P2NA 4BAHB 2FESH 2GP9B 1ETSH 3LGWA 1V2VT 1KDQA 2FOGA 5A0CA 4ABIA 2BDHA 1F7ZA 2W7UA 4X1NU 5T6GA 3PLBA 3ZZ7A 1H8IH 4ZUHA 1BA8B 3QTOH 1W13U 2NU2E 2ZU5A 1BMLA 1YBWA 4AB9A 4D76A 1J14A 2DE9A 1AGJA 1ESTA 5IDKA 1EP5A 2OBQA 1FY4A 1ZSKA 1TGCA 3GYMA 1FAKH 2D2DA 3A7TA 3S9AA 4BTTB 3PWCA 3LPRA 3ZYEA 3ZZBA 1NO9H 1JBUH 3RMLH 1A0HB 3SQEE 4A7IB 2BLQA 3SHCH 1FIWA 1HXEH 2PFEA 4YZUA 1TONA 5FX5A 5ESTE 2ZTXA 2WPJS 1O2PA 2VINA 2WPKS 3QGNB 4R8TB 1AKSB 4ZHAA 1TMTH 4JYVH 1Y3VA 4CRFA 4BAMB 1O3JA 2XWAA 1AIXH 1P03A 4JZFH 2WPMS 4O3TA 2ILNA 1OS8A 1PPBH 3RU4E 1CO7E 1EPTB 1LHEH 5C1YA 1JOUB 2ODQA 2BXUH 1BTPA 2VIDA 3KGPA 2XRCA 2VIVA 3U69H 1QRWA 2C3SA 2ANWA 3Q76A 1C5RA 2PSYA 1TNIA 2W5EA 3EDXB 4YTAA 5GJ4B 1BIOA 3MU4A 3QLPH 3H7TA 3SU4A 3KL6A 4F4OC 2Z3DA 4A5TS 1TNLA 2NU1E 3ATMA 4D9RA 1ZMLA 2K1QA 1XUHA 1CQQA 3PO1C 3DD2H 2A4RA 1GHZA 3CS7A 4Y8YA 1AVGH 3SHAH 1UTPA 3MNSA 2XYAA 4NIXA 3SQHE 2EI7A 4Q7ZA 2PW8H 4B2BA 4U30A 1DUAA 1C2MA 1FY1A 1XMNB 3MU8A 3D23A 4U32A 4F49A 2G4TA 3ZVCA 1MD8A 5EW2H 3ITIA 3NPSA 2BY9X 1RFNA 4MNYA 3LH1A 5CE1A 3MFJA 1PPZA 1PPCE 1XUGA 1E34B 1OWEA 1WCZA 2C93B 2F9BH 4IC6A 3T29A 1JIMA 5E0GA 1GBTA 3S9CA 2GCTC 2YNBA 1DX5M 5E0JA 3VB5A 2BD4A 1ZHRA 4UDWH 1G36A 2PUXB 4BNRA 2GMTB 1MQ5A 4FU7A 5GPIB 1K1LA 4CHAB 1GHBF 1O5CB 2RCEA 3U8RH 4GVUA 3BEIB 3LU9B 1SLUB 1GHBG 1AFQC 1OWKA 4DIHH 1O39A 5L6NH 4TWYA 1C2DA 1ELCA 2VWNA 1SHYA 2OC7A 4AOQA 1MTSA 1C1OA 4X8UH 3V12A 1S82A 1YKTA 5J4QA 2QAAA 1EQ9A 3HK6B 3A85A 2VB0A 3EE0B 1GI2A 1A7SA 1SMFE 3IG6B 4X6MA 1G37A 3BG4B 3MMGA 2WV4A 3UNQA 2TGDA 2QXHA 4MTBA 1GHWH 1ZTJA 5JB8S 1ABJH 5L2ZH 1NFYA 2XBVA 1HJAB 3DHKH 2BDAA 4AGKA 1EUFA 1A1RA 2RDLA 2ZU1A 3RLWH 1C2HA 4WH6A 1Z1IA 2PKAB 5K7RA 1UTLM 1KLIH 2IOTA 2BX3A 1QL8A 1SPJA 5AFYH 3GCTF 2NWNA 4Q80A 1TPOA 1FI8A 4X0WU 1AVWA 2PSXA 2VIWA 1HAHH 2BZAA 2WYGA 3RM0H 1U6QA 3ZZ5A 3SI4H 2BDYA 3E0PB 1ANEA 1GGDB 1LQEA 2YOLA 1H4WA 1UJ1A 4XFQA 4WY3A 5CMXH 3M37A 1GJ5H 3U1IB 2ZECA 2XNIA 3UR9A 1O2GH 5FPSA 2QN5T 2JETB 2XBXA 1S6FA 5C3NA 1AZZA 4AFSA 2ANYA 4FUHA 4XBCA 1EZSC 1VZQH 9ESTA 4ISHH 1ANDA 2H5CA 3TGIE 1GCDA 6ESTA 3U98H 3RMNH 1TA6A 1ZSLA 2QXIA 1ELGA 3GY3A 1MTNC 1EZXC 3RXPA 2QCYA 4OGXA 2BDGA 1BTYA 1YCPM 2AIQA 3OYPA 1K1IA 2ZU2A 2O8WA 1SHHB 5TCCA 2QXJA 1CA8B 3ENSB 1QBVH 2XW9A 1UTQA 1J8AA 1YC0A 4WWYA 1N1LA 1TLDA 1BBRE 1QJ7B 1BDAA 1P2OA 3QDZB 1O3LA 2VH6A 1O33A 1M9UA 4Z6AH 1W10U 2DE8A 2XTTB 3MU0A 2H2ZA 3P6ZB 4K8BA 4ZXYH 1BMMH 1TNHA 2J38A 3QZQA 1Y8TA 1GI3A 1LHFH 4AZ2B 6GCHF 1AHTH 1C9TA 1IQHA 3ZVAA 2NU0E 3AW1A 1VJ9U 4CR9A 3RXCA 2ZFRH 1A4WH 4PROA 1LMWB 3ELAH 3RC4A 1YGCH 3MNBA 5C5OA 1NRQH 1MTVA 1SGYE 1ZOMA 1GJDB 1ZHPA 1KXCA 3GCHC 3SN8A 1AO5A 4AN7A 1MH0A 1YM0A 4Y6DA 4X1QU 1NFUA 3SU5A 3EA9A 3LJOA 4Y7BA 4VGCC 4NGAH 1C5YB 1DUEA 4YLQH 3SU6A 1P04A 2F9PA 3LT3A 4WVPE 4CBOA 1C2KA 1DICA 4Y11E 1LHGH 3ZZDA 1JMOH 1KXFA 2A7JA 1HB0B 2XCNA 2ZHFH 4MNXA 2BD3A 4SGBE 4IGDA 4UFFH 3TVJB 1MTUA 5JBAS 3RXEA 1QGFA 1THRH 4MDSA 1UCYH 3VGCB 1QURH 2SNWA 3FAOA 1JWTA 4RN6A 1BOQA 2IN2A 1V2UT 2ZHEH 1FY8E 1PQ5A 3F9EA 1ELBA 4XBBA 4K5ZA 1LVBA 4E7RG 5JB9S 2XWBI 2BHGA 3BTTE 4NWKA 4BAOB 1YLDA 4X6NA 1C5XB 2FLRH 1Y3UA 8ESTE 2ZA5A 3T27A 1F0RA 2A7HA 2G5VA 4Y76A 3QO6A 3M3TA 1CHGA 1SG8B 3HGNA 4M7GA 3DFJA 2VIOA 1XVOA 3V0XA 2C8WB 4NZQA 3VB4A 1FPHH 5I25A 4SGAE 5DPAA 3I78A