2STBE

Anionic salmon trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor ii)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRYPSIN)
publication title High-resolution structures of three new trypsin-squash-inhibitor complexes: a detailed comparison with other trypsins and their complexes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2stbE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2stbE02
1IQEA 2ZQ2A 1FXYA 1BJUA 5T6FA 1BIOA 1AD8H 1UO6A 4QT8C 4A1VA 1EZXC 2GP9B 5GWZA 4FU8A 1KY9A 2FP7B 4AB8A 3SUFA 3H7TA 3Q3KA 1MKWH 1O3JA 5F03A 1EOLA 5GPIB 1C2GA 1UVSH 4K1SA 1EZQA 6GCHG 1GMHG 3U8OH 3FP6E 3AAVA 1O2LA 1CA8B 1GBKA 1O3AA 2BD4A 5A09A 4CBNA 3RM2H 1F0UA 1ANDA 1DANH 4J2YB 1AMHA 1KXEA 3RXDA 1LKAA 1GI3A 5FPYA 1QTFA 1G37A 2UWLA 3MWIU 1ZRBA 1L1GA 4NFFA 2HPQH 1G32B 1QGFA 3K65B 2OC7A 1JIMA 1IQGA 2EC9H 5EQQA 1THSH 4ISLA 4ZUHA 3T5FH 1E35B 5LGOA 2A45B 2F9NA 2XC4A 1C1RA 1O37A 1CT2E 3A7VA 4Y0ZE 1NM6A 2BVRH 1GJCB 1TFXA 4FVDA 5DP9A 1GJ6A 1TPSA 3EA8A 1QCPA 3MU0A 1RGQA 3HK6B 2GV7A 1EB1H 1Z6EA 4RKOB 2BHGA 1H1BA 4VGCC 1C5QA 1W7XH 3M7TA 5EXMA 1B0EA 2OD3B 1Y3VA 2G4UA 5A0BA 1GHBG 1GWAA 1O2QA 3RXUA 7GCHG 1J17T 2FZZA 3SW2B 5K0HA 4YO9A 1LHFH 3BTTE 1MTWA 4I33A 2BLVA 1AU8A 2W7SA 1O35A 1HAOH 1DXWA 4Z6AH 1FY3A 1THRH 3CS0A 3RXPA 1QBNA 2UUKB 5EXNA 1ZSLA 1PPGE 1C2EA 2GVFA 1BRBE 1NFWA 2GCTB 2BM2A 1SG8B 4CRFA 1BHXF 1C1TA 1KLJH 1NESE 1V2JT 4Y8YA 5I46H 1J14A 3EA7A 2Y7ZA 2ZU5A 2FXRA 1P2NA 3KF2A 3UQOA 3RU4T 1SGCA 1F5KU 5SGAE 1ZHRA 2J34A 1K1JA 3MO3A 1P10A 1O34A 2BD2A 5C5OA 4KKDA 3RUOA 4BOHA 4K5ZA 1MCVA 1CGIE 8KME2 2IOTA 1VCQA 1D4PB 2NU0E 2QA9E 1CHGA 2CF9H 2B0FA 3M3TA 1GI0A 1MU8B 1Y5AT 1DXPA 1UCYE 2XTTB 2Q6GA 1OOKB 2BDAA 1BZXE 2BYAX 4CRDA 1WSSH 2THFB 4X2VA 1ELAA 1QB9A 1N8OC 4DIHH 1XXDA 3GCOA 2WPHS 2ANWA 3D65E 2IPHA 2AIPA 3UNSA 1MQ6A 2PGQB 3CENA 1C4Y2 1DDJA 4CRAA 1DICA 1QR3E 1MQ5A 5H4IB 4Y79A 2G52A 2XRCA 2SNVA 2AH4X 1W13U 1GBTA 1QBOA 1G3BA 1HAVB 1WU1A 3PMJA 4K1EA 2A4QA 4PROA 4GCHF 1AB9C 5EW1H 2OTVA 1FI8A 2Z94A 1HJAB 2FLBH 1GL0E 5EW2H 4MNWA 2R9PA 2GT7A 2GGVB 1A0HB 1HJAC 3ATLA 3NPSA 5G4BA 4F4OC 1T8NA 2DE9A 3RXSA 2AGEX 2FO9A 1AI8H 3BEFB 4U30A 1Z6JH 3S9CA 4DCDA 1TIOA 1PPHE 4JYUH 2VWMA 1TBRH 1UTLM 1P2OA 1C1PA 1TA2A 1CGJE 1EZSC 3MH4A 2D8WA 4A6LA 1LHGH 1P3CA 3A8AA 3A7XA 2IN2A 2WYGA 2HALA 1AFQB 2GDEH 1GDQA 1GBMA 2FOCA 1K1OA 4MQAA 3MU4A 3SV9A 2A4OA 3E8LA 1HPGA 1GDUA 5F8XA 1C2JA 1NC6A 3SHAH 4AX9H 2CHAB 1C2LA 2QY0B 1WTGH 1VJAU 2B8OH 2ZDNA 1IQFA 1EAIA 3GY4A 5GCHG 2UWPA 1C5LH 1FONA 3A7YA 3P8FA 1BMNH 1MTNB 1LDTT 1GG6B 3RXFA 1MTUA 5TCAA 1C4V2 1L4ZA 2GZ7A 1GG6C 4K8BA 1BRAA 2GV6A 5C1YA 4MNXA 3FZDA 1T8MA 1S84A 5DP5A 1SB1H 2BY7X 1L1NA 2ZF0H 4MLFB 1Z8GA 3HATH 1TPAE 1Z8JB 2BX3A 1TALA 2FMJA 3A86A 5JBCS 2SGPE 4OS2A 1UCYH 1G3CA 1TMUH 3F9HA 1YPGH 5CHAB 2Z6BD 1GBBA 1TB6H 5LPRA 1GMDG 4E7NA 2ZPQA 2ZCKP 1TMTH 2QAAA 2FOEA 1FUJA 3OSYA 4CRCA 2BOHB 1UTKA 1QL7A 1VGCC 4U2WA 1BBRE 1AGJA 1HYLA 1PQ8A 1C1WH 1C2DA 1HJ9A 2NU1E 1SFQB 2BDGA 3NZIA 3E3TA 1P2JA 3UNQA 4X8UH 1MBQA 1ZMLA 1OP8A 3E91A 1O0DH 2F3CE 3E0NB 5FXLA 3BTWE 2VWLA 1O3CA 3UTUH 3VGCC 1LCYA 2FX6A 4FXGH 1ETRH 1CT4E 3IG6B 2CMYA 9ESTA 2G81E 5JB8S 1VR1H 3ATWA 3VFEA 2A7HA 1GBLA 1P9UA 1SLWB 3MFJA 1C1NA 1N6XA 1TABE 2G5VA 3SGQE 1ELTA 3QWCH 4UONA 4JZEH 1FQ3A 3EGKH 3AVZA 3BG8A 1A4WH 1KSNA 3ZZ7A 4BAHB 8GCHG 1EASA 3MH5A 3PO1B 3RXEA 1TNHA 1G36A 3W94A 4B74A 1GJ5H 2A5AA 1TWXB 2C8XB 2VH0A 2SNWA 3KQDA 5AFYH 3SJ9A 4D9RA 1BDAA 4THNH 2VINA 1BQYA 5DP6A 4NZQA 2A1DB 3QLPH 1E38B 3I78A 1P11E 1LVOA 5C5NA 1FZZA 1E36B 4ISIH 4YOJA 2I6QA 4K69A 4ABGA 1D6WA 4BTUB 2VGCB 2VIWA 4R0IA 2OC1A 1KIGH 2OBQA 3DHKH 2VGCC 2ZU2A 3SU0A 1UHBA 1QFKH 1L2EA 4JZFH 1TBZH 2CGAA 3PTBA 1M9UA 2OQUA 2FOMB 3GICB 2NU4E 1S0RA 1O30A 5EODA 3PYHA 1AZZA 1P2MA 1TRMA 4DY7B 1DUAA 4X1PU 1ELEE 1FNIA 3T28A 4IN1A 1U6QA 4X6OA 1GJ8B 1DM4B 1W12U 3SI3H 2JH6D 1TQ7B 1BTUA 1ZPBA 3UR6A 3KL6A 3VB4A 1E0FD 2Y5GA 1N6YA 2JETB 1GBAA 1LVBA 3TH3H 1NU7B 2ZFSA 2JETC 1TPPA 1ANEA 3V12A 2B7DH 3V0XA 2ZU3A 3PB1E 4O3TA 2VH6A 1Y3YA 4X8VH 2BLOA 2ZGBH 3B23B 4MNVA 1OWKA 1YPJH 4Q7YA 3FP8E 2ZGXH 4AG2A 1S81A 4HI3A 5JDUB 5AFZH 1UTOA 3K2UA 1LQDB 3B9FH 1E34B 1LTOA 4RKJB 1P0SH 1NRPH 2AGIX 3MYWA 5IYTA 1Q3XA 1ANBA 3SQEE 4IC6A 3ZVGA 5BRRE 4X6NA 1C5MD 2CV3A 3FAOA 1EQ9A 1OKXA 1ZR0A 5E2OA 1JXPA 2FODA 1AKSB 2A31A 2R0KA 3ZZDA 3SJIA 1K1MA 3ZZ3A 3I29A 2Y81A 4NZLA 1AE8H 1FDPA 1EPTA 1CHOG 1DS2E 2SGFE 3OY6U 1C5UA 2KAIA 4CHAB 2VIPA 4ISNA 1YLDA 2BQWB 4WXVA 3TLOA 2BD3A 1X7AC 2D2DA 1O36A 4YOIA 4CHAC 3BTEE 5TJXA 1XMNB 1O39A 1C4U2 2NU3E 4YESB 3SV2H 3GCTG 1YCPH 2P3FH 4MNYA 1O5AB 3EE0B 2ZNKH 4GLYA 1IHTH 1CBWC 2ZTYA 1KTTB 3NCLA 2BDIA 1LHEH 4ABEA 5DP3A 1BTYA 2GCHG 3PWBA 3ZVBA 1IOEA 3LU9B 3RLWH 1FAXA 4AYYB 1AWHB 1GI7B 5EG4A 1P2KA 1GJ9B 3VB3A 1L4DA 2VVCA 1NRSH 5T3HA 2VU8E 3M3SA 1HJ8A 1O2UA 2AGGX 5DO4H 2OCVB 3A88A 3A81A 1SGEE 3LGVA 4ZHMU 1SGYE 3SNEA 3GY2A 4JYTA 2ZECA 1OP2A 3EYDA 3RXBA 2Y82A 4JZIA 1GL1A 2PFEA 2A32A 3ZZBA 1ID5H 2Y5FA 3LC5A 1WBGB 1UJ1A 4TY7A 2PKAA 3DA9B 1DLEA 2ZU4A 1V2QT 4MPWA 2GT8A 1A0JA 1IQLA 5I25A 2VIOA 3BTQE 4B2CA 3LOXA 3BIUH 4TPIZ 1BMMH 3RLYH 1VITH 3RP2A 3NUMA 3S0NA 2ODQA 2ZP0H 1H8IH 5E0HA 2P8OB 2PW8H 4WXIA 3ESTA 3ZYDA 2P8OC 1HLTH 3QGNB 5A0CA 2Q1JA 4CH8B 1KYNA 1YPLH 2BD9A 3OY5U 1INCA 1SLUB 1FN8A 4ZROA 4YOGA 1EATA 2QIQA 4BANB 1L1JA 4ZMAH 1C1QA 1PPFE 1XX9A 4ABFA 2G51A 3TK6A 1AQ7A 1O2IA 1RXPA 1G30B 1VITF 4TWWA 3U8RH 3A84A 1WQVH 1YF4A 3ZVCA 2F9UA 1O3DA 1NROH 2VIDA 4D76A 4NA7A 5HMAA 1YGCH 5HM9A 1GJBB 2EEKA 4O03A 1TA6A 4XE4A 4INKA 1O2WA 3RMMH 3ZZ5A 3E0PB 4BTTB 2GKVE 1GI1A 1TNJA 3CS7A 1ZLRA 4BXWA 3M35A 1CQQA 2XBVA 1C5VA 3LH1A 5L30H 3IWMA 1GPZA 3RU4D 4D7GA 2H5CA 1O2OA 3S69A 1ZJKA 1FPHH 4LZ4B 4NSYA 2CJIA 4CREA 4INHA 1QL8A 2ZGCA 3BV9B 2PUQH 5A0AE 4FUIA 2V0BA 1V2UT 1SGNE 1CA0B 3T27A 3MH6A 2XYAA 3E6PH 2ZQ1A 2FLRH 1F2SE 1JBUH 5J4QA 2H9EH 3A7TA 1GCTB 1DOJA 1GCTC 3U9AH 2OC8A 2HRVA 3SGAE 1SR5C 3UWJH 2ESTE 4WMEA 1BHXB 3HKJB 1PQAA 4H6TA 1FIWA 3GY8A 2R3YA 4IW4E 4TYDA 3V3MA 3RXJA 4WY3A 1HFDA 1CSOE 2Z9GA 2XWAA 1CGHA 1PFXC 1O31A 1Y59T 5T6GA 1XM1A 3RXMA 2ANYA 3EA9A 6CHAB 1KXFA 5EOKA 4X6PA 6CHAC 3LGUA 3KQBA 6LPRA 1XUGA 3VB5A 4NWKA 2ZO3H 1A5HA 3LIWA 2C4FH 2W26A 1V2WT 4OS5A 2ZTXA 1P12E 4MVNA 4O97A 1G3EA 1FAKH 1GI4A 3GCHB 1O3NA 1Y8TA 2BDBA 2K1QA 2ZHEH 3GCHC 2HOBA 2A5KA 4GHTA 2PTCE 1P2QA 3SV8A 1FPCH 2ZGJA 1GGDB 2PR3A 3C1KA 2P93A 3G01A 3ZVEA 1GGDC 3TNSA 2ZDLA 1XUFA 1THPB 4GCHG 1V2MT 2V3OH 4TPYA 1S0QA 1T4VH 1AN1E 4H4FA 2TBSA 3TJVA 2GCTC 4FU9A 2AMPA 3P95A 2PSXA 1P04A 3CP7A 3DFLA 4WMFA 3L3TA 1DT2A 2FOFA 4ISHH 2RDLA 3UQVA 2UWOA 1YM0A 1SFIA 4H6SB 5E2PA 1K1IA 2GZ9A 3HGPA 3GISB 4CR9A 5FBEA 3SBKA 6GCHF 1G9IE 1GMHF 1GVZA 2OLGA 3KEEA 2SGDE 2BQ6B 3BEIB 4OS6A 3SU2A 3TPIZ 1P01A 2VWNA 1IQHA 1QQ4A 2FI4E 1A2CH 3FZZA 3RXHA 3SU5A 1NPMA 1C2MA 5FPTA 1YPEH 1GVKB 2PWXA 2BX4A 5FBIA 2XNIA 5HYOA 4BAQB 3MMGA 3ZV9A 1A7SA 1EAUA 2ZEBA 2BDCA 1ZGVA 1SQTA 1AY6H 1Y3UA 4E06H 3A7ZA 1H8DH 1KDQA 1F0RA 1HAGE 1ANCA 1OPHB 3E90B 4FUCA 3TK5A 1SLVB 1Z71A 2H9TH 2ZDMA 1JOUB 1ELBA 3NKKA 3QK1A 4D7FA 2ZU1A 1GHBF 5FAHA 4Q80A 2QF3A 1ZOMA 1S6HA 1EP6A 3K6YA 1XUIA 1C1MA 1ABIH 1VZQH 4AGJA 4XFQA 3KNXA 3LONA 2BXTH 2ZPRA 1IQJA 4SGAE 2BY8X 4YLUA 1T32A 1GHXH 1H9IE 5JPMH 1Y3WA 2Q6DA 4B73A 1O2MA 2FDAA 4GPGA 4O9VA 1C2IA 2BDYA 1GBEA 3UR9A 1F0TA 1C5YB 1BUIA 3GY6A 3A80A 3QUMP 1PQ5A 1AFQC 3BTKE 3MNSA 6ESTA 3GY5A 5EGMA 1O2NA 2FX4A 5LH8A 4YTAA 1QB1A 3PM3A 3STIA 3S9BA 1BA8B 3U8TH 2CHAC 2ALVA 3R3GB 5ABWA 2J9NA 2ZFFH 4WMDA 1DPOA 2G5NA 3V13A 4YLQH 3EQ0H 3SU1A 1GDNA 2FI3E 1T31A 1DLKB 2BDHA 1AHTH 1EXFA 4KTSA 1Y3XA 1MTNC 3TK9A 3SGBE 4D8NA 4IMQA 1LO6A 2A4GA 1GHAG 3ZZ6A 2H5DA 3MNBA 2F9OA 4ZH8A 3KHVA 3K6ZA 2FPZA 3ATMA 2HNTF 3GY3A 1YPMH 1TRYA 4KTUA 2GMTB 1P9SA 1O2XA 4B71A 1IQMA 1BRUP 3UWIA 5F8TA 4IC5A 1K1NA 2GMTC 2J4IA 5AVDA 3T26A 1L0ZA 2BLQA 1V2LT 3BTDE 5HM2A 3QX5H 5CHAC 2R0LA 1WV7H 1C5RA 1SQOA 3ELAH 4WJG2 1IQIA 3K9XB 1J8AA 4DW2U 5C67A 2GD4B 2VWOA 1H4WA 1C2KA 3SU3A 1ZJDA 3QO6A 4K1TA 2AERH 4AFSA 1V2TT 2BY5X 3WY8A 1HAZB 4CRGA 2VJ1A 1KLTA 2VIQA 1XUHA 1DY8A 1HGTH 2H9HA 3ATIA 4NA9H 1F7ZA 3Q76A 3QN7A 1GHWH 2AFQB 2SGQE 2GDDA 2BB4A 3TH4H 1ESAA 1GBIA 1W7GH 5GDSH 4ZXYH 3VB6A 1SBWA 1SSXA 4NIVA 2P16A 3R0FA 2ZGHA 1RIWB 4LOYH 1NRNH 3MU8A 2NWNA 1V2OT 1O3KA 1K1LA 3LDXH 3UOUA 1K2I1 1OP0A 3PLKA 2Z7FE 2HPPH 4F49A 4I8HA 1JWTA 1HCGA 3M5NA 3UNRA 3OU0A 1GVLA 1W0ZU 1BTHH 3PO1C 2HLCA 1S5SA 5LPEA 1HIAA 1G2MA 1MZAA 5DP7A 4NFEA 1TGSZ 5GCHF 1QJ6B 1EAXA 5FX5A 1K9OE 1SGTA 2PGBB 4AGKA 1O3MA 2BMGB 1ZYOA 2DE8A 1O32A 1BT7A 4NCYA 3LKWA 1O2GH 1W3CA 1NU9A 2F83A 4UFEH 1JRTA 3RXLA 3UFAA 2ZA5A 4IBLH 1C1SA 4X1NU 4ABAA 1QURH 2ZFTA 2QXIA 2ZWLH 1KXCA 1MBMA 1QNJA 5FX6A 1O2VA 1UHBB 3P6ZB 3VEQB 1ELGA 1ARCA 1LHDH 1GMDF 1P03A 4ZXXH 1AFEH 1LMWB 4MG3A 5C1UA 4NA8A 3EAJA 2C8WB 1PPCE 1V2KT 2FS9A 3Q3XA 1Z1JA 1GBDA 1GBFA 2GX4A 4MPUA 2FOHA 2TIOA 4INLA 1HNEE 4NGAH 4NIYA 1YC0A 4UE7H 3U98H 1IAUA 2F91A 1C2HA 1QIXB 2BQ7B 3LJJA 1QHRB 2JH5D 1NS3A 2C90B 3OX7U 3S7KB 4MTBA 1W10U 2FTMA 2QXHA 3MO9A 1UTPA 1EOJA 3F68H 1NTPA 3TIUA 2UUFB 2A4RA 3DT0H 5A8ZA 3D49H 4XBDA 3F9GA 3F6UH 3A7WA 4FUHA 1HDTH 3GYMA 2AS9A 8GCHF 1BITA 1SGIB 3PMHB 1SVPA 1A61H 3P92A 1JIRA 3SOSA 4Q7ZA 7KMEH 2ZFQH 4DGJA 3KCGH 4Y11E 2ZDKA 1ABJH 2ZDAH 2SFAA 1AUJA 1SOTA 3LGIA 2W7UA 2Y7XA 1YPHC 1GJDB 3M61U 1WTHD 3M5OA 1QA7A 5DKMA 2A0QB 1EPTB 1MAYA 1Z7KA 1OWIA 1ESBA 2J38A 1EPTC 4ZKRU 4H42U 1O5FH 2KAIB 1ELFA 1SGQE 3STJA 3VXFH 1SL3A 3SO3A 1QRWA 3TJNA 5FCKA 5T6DA 1AKSA 4FUGA 2FS8A 4HTCH 1ZMJA 3PMBB 1SGRE 1HAIH 1DWDH 2YOLA 5FHTA 1QB6A 2A7JA 1S82A 1NY22 1ETTH 2QXJA 4IN2A 3A85A 1GBHA 1P8VC 4OGXA 1LHCH 1FV9A 2OXSA 1ACBE 1A5IA 1ARBA 1D3QB 2OINA 1MAXA 1O3IA 1YBWA 1C5SA 4NG9H 4YZUA 3M7QA 3SU6A 2R2MB 3SV7A 8ESTE 4MPVA 4ESTE 1BB0B 1TMBH 3OYPA 3O8DA 2PUXB 1FY1A 3FP7E 2O8TA 2IJOB 3SZNA 5C1XA 2Z3EA 2XCNA 1TX8A 3O8CA 1YCPM 4AFUA 4DOQA 2Z9KA 1PPBH 2PKAB 4KELA 1Z1IA 1MZDA 2F9BH 5FCRA 3KQEA 2XC5A 1AVGH 1FY4A 1A3EH 2WPIS 4K8YA 1BBRK 2AYWA 3A87A 1O2YA 2BTCE 1G2LA 4X2XA 1WAYB 1UTMA 1UVPA 3SNAA 3KIDU 3SJOA 2EI7A 3PMAB 2FIRH 5IDKA 3M3VA 1O3GA 3QZRA 5A2MH 4BTIB 4ABHA 2Z9IA 1O3HA 1TQ0B 1UVUH 3GDUA 3LJOA 4Y6DA 2PSYA 4OS1A 1C5WB 2D1JA 5EPYA 1HV7A 1B0FA 2G55A 1RS0A 1EP5A 1OWDA 1C1UH 1TGCA 2J95A 1GI9B 1ZTKA 3MHWU 1XUKA 1VCPA 2YNBA 2O8UA 4O3UA 4WVPE 3GCTF 5L2YH 1C9PA 2SGAA 2TPIZ 4R8TB 4BAMB 1SHHB 5CMXH 1WOFA 1D9IA 2GZ8A 1B7XB 1P3EA 2BLWA 2W5EA 3LPRA 1HXFH 4GVUA 1D3DB 1O3LA 2YNAA 1C5XB 1AZ8A 3RDZA 2GCHF 4AZ2B 3FFGA 2I6SA 4GHQA 2F9PA 1EB2A 1JMOH 1Y5BT 1RTKA 3AAUA 3MU5A 1DX5M 1Q2WA 3URCA 2BD7A 4Y7AA 3SHCH 2Z3DA 1ZMNA 2WINI 2QN5T 1ZTJA 3QGJA 3MNXA 4JK6A 4ABDA 1BTWA 1QY6A 1OSSA 1FJSA 2EA3A 1AVWA 2B9LA 1KXDA 1BTPA 1S83A 4FU7A 3ZVDA 1BTXA 1GBJA 2Z9JA 4BAKB 1RRKA 1MH0A 3A8BA 1F5RA 3P70B 4KGAA 1O3EA 2FI5E 1CA0C 1PQ7A 1GI8B 2ZI2H 1KXBA 1RTLA 3SUGA 1TAWA 4B1TA 4HZHA 2JKHA 3ITIA 1O2TA 2VB0A 4WF8A 5JB9S 3T62A 2HGTH 5EU8A 2C93B 3TGKE 1DY9A 2O8MA 3HKIB 3MOCA 2A2XH 1EZUC 1ESTA 2CN0H 1OWHA 4K60A 3AW0A 5E0JA 1A46H 1HBTH 2OBOA 2W3IA 1Q31A 2R2WU 1FLEE 1ZSKA 4X1SU 1V2ST 2ZZUH 3RXTA 1LPGB 1SGDE 2QCYA 5A8XA 1DUEA 3Q77A 3ZZ9A 2TGDA 1RJXB 5TCCA 1V3XA 4A7IB 1ZHPA 1ZZZA 1PPZA 4ISOA 3Q3YA 1BRCE 1FY8E 1AE5A 2P95A 3MTYA 2Z9LA 1AO5A 1MKXK 4Y8ZA 4ZAEA 3D62A 2Z3CA 1UMAH 1LPKB 4X6MA 4FVBA 4I8LA 3DUXH 5K7RA 2ALPA 4UDWH 1GMCF 4XBBA 2P59A 1KXAA 2H6MA 3BSQA 2ZC9H 4VGCB 4B75A 1BTZA 1CO7E 1ZSJA 2OC0A 2HWLB 2Y6TA 3BG4B 2TRMA 3LGTA 2XWBI 1MUEB 2FTLE 1UK2A 3BG4C 4I32A 1DFPA 1QA0A 1TGBA 2G00A 4NWLA 2HNTE 3RXVA 3F1SB 2LNCA 1AWFH 2WPKS 1XVOA 1C5ZB 2VIVA 1AIXH 1YLCA 3ZZ4A 2ZCLP 1SOZA 1D3TB 3U1JB 4HFPB 2WUCA 1TNLA 4TY6A 1GI6A 1LPZB 4YM9A 4MDSA 4JMYA 3F9FA 1K28D 2XXLA 1O2PA 4JZDH 4X0WU 2ODPA 3T25A 1E37B 2RA3A 4ASHA 4E05H 1HRTH 1RD3B 2JH0D 1W2KH 3URDA 1DITH 1OWEA 1WQSA 2F9VA 4DVAU 3ZYEA 2ZFRH 1T7CA 2C8YB 4AB9A 4E7RG 4ZHAA 1Z8RA 2V3HH 3MNCA 3RM0H 1W8BH 2R3UA 3NK8A 1P06A 4GUXA 3ZVAA 4DT7B 1DWBH 2Y5HA 1QJ1B 1MKWK 3GYLB 4UEHH 2P3TB 1TRNA 4X8SH 3RXOA 3P17H 2A7CA 5JBAS 4D9QA 4U32A 3BTHE 4ABIA 1A5GH 3ODDA 2PLXA 3HGNA 1O3BA 1PPEE 1KDQB 1SPJA 1N8OB 4CH2B 1FY5A 1GI5A 5PTPA 4A5TS 5F8ZA 2BXUH 1EJAA 5ESTE 2G4TA 1ZRKA 4X1RU 3F9EA 2ZTZA 4XOJA 7GCHF 5DPAA 4GSOA 2J92A 1UK4A 7LPRA 3LH3A 2ZFPH 4X2WA 2XBYA 1P02A 1ZPCA 2RCEA 4FUBA 1ZGIA 1WUNH 1XXFA 2QF0A 1ETSH 2ZHWH 5DK1A 3TNTA 1ELDE 1HAVA 4XDEA 4B2BA 2SGEE 4BAOB 1AB9B 1UK3A 1NT1A 2HNTC 4ZHLU 3PLPA 1C1VH 1K22H 4I31A 4OS4A 2BY9X 5LPFA 2LPRA 2ZCHP 3MH7A 3A83A 2STAE 1MTSA 4JZ1A 5EXLA 2PKSB 5HXFA 3PV4A 1TGNA 2PKSC 4AFQA 1A3BH 3PTNA 4JK5A 1EX3A 2G8TA 1C5TA 1XVMA 2A2QH 2ZPSA 1O5DH 3UIRA 1NZQH 5ESBA 1BJVA 3AW1A 1V2NT 4ZKOU 2QV1A 4UD9H 2XW9A 3RU4E 3M37A 4GAWA 5DGJA 3O8BA 2Y80A 3H5CB 3TJOA 2Q6FA 3ZZCA 4CR5A 1MTVA 3V7TA 4FUFA 4NSVA 1GCDA 1GJAB 3M5LA 3A82A 1O2ZA 2OQ5A 3RMLH 1DSTA 1O2RA 3NXPA 2VNTA 1VCWA 1A1RA 1NFXA 1HAHH 1H9HE 1PJPA 1YYY1 4FUEA 4YT6H 5JBTA 1NO9H 3PROA 2J94A 4ZKNU 4X1QU 4A92A 5FPSA 2QGRA 2TGAA 4J1YA 1RTFB 1UTQA 2O8WA 1O2HA 1Z8IB 4NIWA 5HGGA 4OGYA 1NRRH 3SUEA 1PYTD 1CVWH 2UUJB 3T2NA 1GBCA 3P8OA 2OUAA 2NU2E 3SJKA 4LZ1H 1LVYA 3TJUA 1O2KA 2XBWA 3N7OA 4NIXA 3S9AA 4XSKU 2FOAA 3DD2H 3PWCA 1D3PB 1WYKA 4AYVB 3KGPA 3RC6A 1MCTA 5JYIA 1DSUA 2BVSH 5AF9H 1QL9A 2V6NA 4I7YH 1O38A 1BMLA 3DFJA 3SUDA 1NFYA 3HK3B 1P57B 1VGCB 3GDVA 1WCZA 1EJMA 2FESH 1HAYB 2FEQH 4Q2KA 3TH2H 4DIIH 3KN2A 3RXIA 3JZ1B 2VVUA 1T8LA 3M7UA 1V6DA 1TLDA 2WYJA 3RMNH 1GHVH 1TBQH 4UFFH 3ZZAA 1QJ7B 3SNDA 3VGCB 3LGYA 1S6FA 2GTBA 3QTVH 1G3DA 1RIWC 4FUJA 4WWYA 3C27B 4AN7A 1F92A 3JZ2B 1OX1A 1SC8U 4A1TA 1MD7A 1KTSB 2PTNA 4AOQA 1MMJN 4KTCA 2HVXA 2UUYA 2RA0A 1TPOA 1O5CB 3GOVB 1HIAB 1MD8A 4KP0A 3H7OA 2ZDVH 1O2JA 1YPHE 1TONA 4Y10E 4Y76A 1FIZA 1EKBB 2ZHFH 2P3UB 4K3JA 3FANA 1ZTLA 3VB7A 1GHAF 3SI4H 1ZPZA 1BMAA 1O3OA 1O3FA 1AVXA 1BOQA 2ODYB 4UFDH 4DJZB 1LVMA 1O33A 1P2IA 1QRXA 4DG4A 7ESTE 4RSPA 1ORFA 2OP9A 2WPMS 3ENSB 1LQEA 1XUJA 8LPRA 3TGIE 2D26C 1O3PB 3SN8A 2V35A 1NN6A 3UY9A 5EQRA 5JBBS 1C5PA 3P8NA 3U1IB 2EI8A 3GY7A 1TNIA 5ETXA 2STBE 3A8DA 1P09A 1CU1A 4B2AA 1TE0A 3L6PA 1V2PT 3ATKA 1UCYK 5E8EH 4ABBA 1XKBC 3MO6A 1UVTH 4I8JA 2ILNA 5C20A 1EUFA 4DURA 2ASUB 1TNGA 2VVVA 1UTNA 1CT0E 1J15A 4IGDA 3QDZB 3BIVH 1OWJA 3BTFE 3ZZ8A 2TGTA 1GI2A 3OTJE 2FOGA 1A0LA 3RXRA 2BZAA 1GHZA 3RXQA 4U01A 1ELCA 3O8RA 3QTOH 2ANMH 3A8CA 4X8TH 1IHSH 2BOKA 4Y0YE 1TOMH 1BBRH 2QYIA 2H2ZA 5EQSA 2C8ZB 3EDXB 3BTGE 2B5TB 4SGBE 5J4SA 1C9TA 1YKTA 4MPXA 5C2ZA 1TX7A 2WPLS 4UFGH 1TYNA 1C1OA 1OXGA 1SI5H 1EJNA 4LK4A 4RN6A 2XC0A 5DG6A 1K21H 3L33A 5BPEA 5L6NH 3RMOH 1QBVH 1HAXB 1C5NH 3SNCA 4HGCA 2WV5A 2RG3A 2O9QA 4FUDA 4AORA 1GHYH 1SGFG 3SU4A 3RXCA 5CE1A 1DE7H 3BEUA 1XKAC 4BNRA 9LPRA 5EPNA 3RC4A 4AFZA 1Y5UT 1B5GH 4YT7H 1ELVA 3NWUA 2PV9B 1QRZA 2BD8A 3BF6H 1V2RT 1O5BB 2AEIH 1YPKH 3UUZA 1DWEH 2DUCA 1RFNA 1NRQH 3A89A 1S85A 2C3SA 2CXVA 1W14U 4K2YA 3ZVFA 4Q7XA 3BTME 1N1LA 1FMGA 1SHYA 5DJ7A 3RC5A 3AASA 1GJ7B 2CF8H 3BN9A 1QQUA 1J16A 1HUTH 1VITG 1JRSA 1SGFA 4IMZA 3UREA 3GCNA 3TGJE 1CBWB 1F5LA 1OYQA 3LC3A 3HPTB 2PHBA 2XBXA 1UVOA 3QZQA 1W0YH 1T4UH 2WUBA 1ZHMA 3LT3A 1LKBA 2BY6X 2ZG0H 2QXGA 2WV4A 5DP8A 3TVJB 1DVAH 2AMDA 4CBOA 3SV6A 1BCUH 1H9LB 2W3KA 1OS8A 4WH8A 3ODFA 5DP4A 1J9CH 3M5MA 5F6MA 2FOBA 3ZV8A 5L2ZH 3PLBA 4M7GA 1VJ9U 1SLXB 3UOPA 5GJ4B 3MI4A 4Y7BA 4JYVH 3RXKA 3SQHE 1P05A 3IITA 4Y71A 1YP9A 4ZKSU 4I8KA 4XBCA 2AMQA 1O2SA 1AUTC 2FWWA 3E1XB 4OS7A 1V2VT 2A5IA 2WPJS 1C5OH 3SJ8A 4ABJA 4AG1A 1CHOF 1TGTA 3RXGA 3RXAA 2TGPZ 3S7HB 3SORA 1K1PA 2BD5A 2ZHQH 3KQCA 2ZHDA 1HXEH 2ANKH 2ZIQH 1IQKA 2FM2A 4BXSA 2FYQA 1MKXH 3VXEH 4IS5A 5GXPA 2BZ6H 4JCNA 1NFUA 2P94A 1SGPE 1TNKA 3I77A 1HAPH 3TITA 2H1UA 3E16B 3T29A 5GIBA 4B76A 3M36A 1GJ4H 3U69H 4LXBH 1FN6A 3VPKA 3SNBA 3LGWA 1UTJA 1OYTH 1D6RA 1EAWA 4CRBA 4WH6A 3P8GA 3Q00A 4X2YA 3TU7H 5AHGH 1KLIH 1PYTC 3UPEA 4Y8XA 2BVXH 2XCFA 1W11U 1T8OA 1C2FA 2FYRA 1CE5A 3D23A 1MU6B 4Z0KA 1IQNA 1YCPK 1DWCH 2ULLA 3W95A 1TX6A 1HB0B 1GMCG 1O5GH 1SQAA 4TWYA 3GDSA 1SMFE 2AIQA 2QC2A 3FVFB 5B6OA 1TOCB 2O8LA 3B8JA 4A1XA 5E0GA 5C3NA 2EI6A 2J2UA 1O5EH 5A8YA 2M5TA 1F0SA 2ZKSA 4I8GA 3MU1A
chains in the Genus database with same CATH superfamily
1IQEA 2ZQ2A 1FXYA 1BJUA 5T6FA 1E1RD 5CHBA 1BIOA 1AD8H 1UO6A 4QT8C 4M9FA 4A1VA 1EZXC 2GP9B 5GWZA 4FU8A 1KY9A 2FP7B 4AB8A 3SUFA 3H7TA 3Q3KA 1MKWH 1O3JA 5F03A 1EOLA 5GPIB 1C2GA 1UVSH 4K1SA 1EZQA 6GCHG 1GMHG 3U8OH 3FP6E 3AAVA 1O2LA 1CA8B 1GBKA 1O3AA 2BD4A 5A09A 4CBNA 3RM2H 2JDID 1F0UA 1ANDA 1DANH 4J2YB 1AMHA 1KXEA 3RXDA 1LKAA 1GI3A 5FPYA 1QTFA 1G37A 2UWLA 3MWIU 1ZRBA 1L1GA 4NFFA 2HPQH 1G32B 1QGFA 3K65B 2OC7A 1JIMA 1IQGA 2EC9H 5EQQA 1THSH 3N7EA 4ISLA 4ZUHA 3T5FH 1E35B 5LGOA 2A45B 2F9NA 2XC4A 1C1RA 1O37A 1CT2E 3A7VA 4Y0ZE 1NM6A 2BVRH 1GJCB 1TFXA 4FVDA 5DP9A 1GJ6A 1TPSA 3EA8A 1QCPA 3MU0A 1RGQA 3HK6B 2GV7A 1EB1H 1Z6EA 4RKOB 2BHGA 2YMSB 1H1BA 4VGCC 1C5QA 1W7XH 3M7TA 5EXMA 1B0EA 2OD3B 1Y3VA 2G4UA 5A0BA 1GHBG 1GWAA 1O2QA 3RXUA 7GCHG 4P00A 1J17T 1YY3A 2FZZA 3SW2B 5K0HA 4YO9A 1LHFH 3BTTE 1MTWA 4I33A 2BLVA 1AU8A 2W7SA 4B6EA 1O35A 1HAOH 1DXWA 4Z6AH 1FY3A 1THRH 3CS0A 3RXPA 1QBNA 2UUKB 4RT0A 3CNRA 5EXNA 1ZSLA 1PPGE 1C2EA 2GVFA 2IPQX 1BRBE 1NFWA 2GCTB 2BM2A 1SG8B 4CRFA 1BHXF 1C1TA 1KLJH 1NESE 1V2JT 4Y8YA 5I46H 1J14A 3EA7A 2Y7ZA 2ZU5A 2FXRA 1P2NA 3KF2A 3UQOA 3RU4T 1SGCA 1F5KU 5SGAE 1ZHRA 2J34A 1K1JA 3MO3A 1P10A 1O34A 2BD2A 5C5OA 4KKDA 3RUOA 4BOHA 4K5ZA 5EJZA 1MCVA 1CGIE 8KME2 2IOTA 1VCQA 2V7QD 1D4PB 2NU0E 2QA9E 1CHGA 2CF9H 2B0FA 3M3TA 1GI0A 1MU8B 1Y5AT 1DXPA 1UCYE 2XTTB 2Q6GA 1OOKB 2BDAA 1BZXE 2BYAX 4CRDA 1WSSH 2THFB 4X2VA 1ELAA 1QB9A 1N8OC 4DIHH 1XXDA 3N7DA 3OEED 3GCOA 2WPHS 2ANWA 3D65E 3WWFA 2IPHA 2AIPA 3UNSA 1MQ6A 2PGQB 3CENA 1C4Y2 3PV2A 1DDJA 4CRAA 1DICA 1QR3E 4XD7D 1MQ5A 2QE7D 5H4IB 4Y79A 2G52A 2XRCA 2SNVA 2AH4X 1W13U 1GBTA 1QBOA 1G3BA 1HAVB 1WU1A 3PMJA 4K1EA 2A4QA 4PROA 4GCHF 1AB9C 5EW1H 2OTVA 1FI8A 2Z94A 1HJAB 2FLBH 1GL0E 5EW2H 4MNWA 2R9PA 2GT7A 2GGVB 1A0HB 1HJAC 3ATLA 3NPSA 5G4BA 4F4OC 1T8NA 2DE9A 3RXSA 2AGEX 2FO9A 1AI8H 1WDIA 3BEFB 4U30A 1Z6JH 3S9CA 4DCDA 1TIOA 1PPHE 2J98A 2VWMA 1TBRH 4JYUH 1UTLM 2JJ1D 1P2OA 1C1PA 1TA2A 1CGJE 1EZSC 3MH4A 2D8WA 4A6LA 1LHGH 1P3CA 3A8AA 3A7XA 2IN2A 2WYGA 5IK2D 2HALA 1AFQB 2GDEH 1GDQA 1GBMA 2FOCA 4FETA 1K1OA 4MQAA 3MU4A 3DSGA 3SV9A 2A4OA 3E8LA 1HPGA 1GDUA 5F8XA 1C2JA 1NC6A 3SHAH 4AX9H 2CHAB 1C2LA 2QY0B 1WTGH 1VJAU 2B8OH 2KCYA 2ZDNA 1IQFA 1EAIA 3GY4A 5GCHG 2UWPA 1C5LH 1FONA 3A7YA 3P8FA 1BMNH 1MTNB 1LDTT 1GG6B 3RXFA 1MTUA 5TCAA 1C4V2 1L4ZA 2GZ7A 1GG6C 4K8BA 1NBME 1BRAA 2GV6A 2KX4A 5C1YA 4MNXA 3FZDA 1T8MA 1S84A 5DP5A 1SB1H 2BY7X 1L1NA 2ZF0H 4MLFB 1Z8GA 3HATH 1TPAE 1Z8JB 2BX3A 1TALA 2FMJA 3A86A 5JBCS 1S6LA 2SGPE 4OS2A 2KZ4A 1UCYH 1G3CA 1TMUH 3F9HA 1YPGH 5CHAB 2Z6BD 1GBBA 1TB6H 5LPRA 1GMDG 4E7NA 2ZPQA 2ZCKP 4ASUD 1TMTH 2QAAA 2FOEA 1FUJA 3OSYA 4CRCA 2BOHB 1UTKA 1QL7A 1VGCC 4U2WA 1BBRE 1AGJA 1HYLA 1PQ8A 1C1WH 1C2DA 1HJ9A 2NU1E 2WHXA 1SFQB 2BDGA 3NZIA 3E3TA 1P2JA 3UNQA 4X8UH 1MBQA 1ZMLA 1OP8A 3E91A 1O0DH 2F3CE 3E0NB 5FXLA 4YXWD 3BTWE 2VWLA 1O3CA 2W6ID 3UTUH 3VGCC 1LCYA 2FX6A 1H8ED 1ETRH 4FXGH 1CT4E 3IG6B 2CMYA 9ESTA 2G81E 5JB8S 1VR1H 3ATWA 3VFEA 2A7HA 1GBLA 1P9UA 1SLWB 2KCOA 2EQNA 3MFJA 1C1NA 1N6XA 1TABE 2G5VA 3SGQE 1ELTA 3QWCH 4UONA 4JZEH 1FQ3A 3EGKH 3AVZA 3BG8A 1A4WH 1KSNA 3ZZ7A 4BAHB 8GCHG 1EASA 3MH5A 2WV9A 3FN8A 3PO1B 3RXEA 1TNHA 1G36A 3W94A 4B74A 4ZCNA 1GJ5H 2A5AA 1TWXB 2C8XB 2VH0A 2SNWA 3KQDA 5AFYH 3SJ9A 4D9RA 1BDAA 4THNH 2VINA 1BQYA 5DP6A 4NZQA 2A1DB 3QLPH 1E38B 3I78A 1P11E 1LVOA 5C5NA 1FZZA 1E36B 4ISIH 2IJD1 2I6QA 4K69A 4ABGA 4YOJA 1D6WA 4BTUB 2VGCB 2VIWA 4R0IA 2OC1A 1KIGH 2OBQA 3DHKH 2VGCC 2ZU2A 3SU0A 1UHBA 1QFKH 1L2EA 4JZFH 1TBZH 2CGAA 3PTBA 1M9UA 2OQUA 2FOMB 3GICB 2NU4E 1S0RA 1O30A 5EODA 3PYHA 1AZZA 2RFKC 2XNDD 1P2MA 1TRMA 4DY7B 4AC9A 5HKKD 1DUAA 4X1PU 1ELEE 1FNIA 3T28A 4IN1A 1U6QA 4X6OA 1GJ8B 1DM4B 1W12U 3SI3H 2JH6D 1TQ7B 1BTUA 1ZPBA 3UR6A 3KL6A 3VB4A 1E0FD 2Y5GA 1N6YA 2JETB 1GBAA 1LVBA 3TH3H 1NU7B 2ZFSA 2JETC 1TPPA 1ANEA 3V12A 2B7DH 3V0XA 2ZU3A 3PB1E 4O3TA 2WZQA 2VH6A 1EFRD 1Y3YA 4X8VH 2BLOA 2ZGBH 3B23B 4MNVA 1OWKA 1YPJH 4Q7YA 3FP8E 2ZGXH 4AG2A 1S81A 4HI3A 1BMFD 5JDUB 5AFZH 1UTOA 3K2UA 1LQDB 3B9FH 5CDFE 1E34B 2CK3D 1LTOA 4RKJB 1P0SH 1NRPH 2AGIX 3MYWA 5IYTA 1Q3XA 1ANBA 3SQEE 4IC6A 3ZVGA 5BRRE 4X6NA 1C5MD 2CV3A 3FAOA 1EQ9A 1OKXA 1ZR0A 5E2OA 1JXPA 2FODA 1AKSB 4F55A 2A31A 2R0KA 3ZZDA 3SJIA 5DN6D 1K1MA 3ZZ3A 3I29A 2Y81A 4NZLA 1AE8H 1FDPA 1EPTA 1CHOG 1DS2E 2SGFE 3OY6U 1C5UA 2KAIA 4CHAB 2VIPA 4ISNA 4B6FA 1YLDA 2BQWB 4WXVA 3TLOA 2BD3A 1X7AC 2D2DA 1O36A 4YOIA 4CHAC 3BTEE 5TJXA 1XMNB 1O39A 1C4U2 2NU3E 4YESB 3SV2H 3GCTG 1YCPH 2P3FH 4MNYA 1O5AB 5FL7D 5EIYA 3EE0B 2ZNKH 4GLYA 1IHTH 1CBWC 2ZTYA 1KTTB 3NCLA 2BDIA 1LHEH 1E79D 4ABEA 5DP3A 1BTYA 2GCHG 3PWBA 3ZVBA 1IOEA 3LU9B 3RLWH 1FAXA 4AYYB 1AWHB 1GI7B 5EG4A 1P2KA 1GJ9B 3VB3A 2JIZD 1L4DA 2VVCA 1NRSH 5T3HA 2VU8E 3M3SA 1HJ8A 1O2UA 2AGGX 5DO4H 2OCVB 3A88A 3A81A 1SGEE 3LGVA 4ZHMU 1SGYE 4P02A 3SNEA 4XRNA 3GY2A 4JYTA 2ZECA 1OP2A 3EYDA 1W0JD 3RXBA 2Y82A 4JZIA 1GL1A 2PFEA 2A32A 3ZZBA 1ID5H 2Y5FA 3LC5A 5C17A 1WBGB 1UJ1A 4TY7A 2PKAA 3DA9B 1DLEA 2ZU4A 1V2QT 4MPWA 2GT8A 1A0JA 1IQLA 5I25A 2VIOA 3WWBA 3BTQE 4B2CA 3LOXA 3BIUH 4TPIZ 1BMMH 3RLYH 1VITH 3RP2A 3NUMA 3S0NA 2ODQA 2ZP0H 1H8IH 5E0HA 2P8OB 2PW8H 4WXIA 3ESTA 3ZYDA 3SYJA 5C0UA 2P8OC 1HLTH 3QGNB 5A0CA 2Q1JA 4CH8B 1KYNA 1YPLH 2BD9A 3OY5U 1INCA 1SLUB 1FN8A 4ZROA 4YOGA 1EATA 2QIQA 4BANB 1L1JA 4ZMAH 1C1QA 1PPFE 1XX9A 4ABFA 2G51A 3TK6A 1AQ7A 1O2IA 1RXPA 1G30B 1VITF 3DSPA 4TWWA 3U8RH 3A84A 1WQVH 1YF4A 3ZVCA 2F9UA 1O3DA 1NROH 2VIDA 4D76A 4NA7A 5HMAA 1YGCH 5EJ1A 5HM9A 1GJBB 2EEKA 3FO8D 4O03A 1TA6A 4XE4A 4INKA 1O2WA 3RMMH 3ZZ5A 3E0PB 4BTTB 2GKVE 1GI1A 1TNJA 3CS7A 5GNDA 1ZLRA 3F0OA 3DCLA 4BXWA 3M35A 1CQQA 2XBVA 1C5VA 3LH1A 5L30H 3IWMA 1GPZA 3RU4D 4D7GA 2H5CA 1O2OA 3S69A 1ZJKA 1FPHH 4DT4A 4LZ4B 4NSYA 2CJIA 4CREA 2GJGA 4INHA 1QL8A 2ZGCA 3BV9B 1FX0B 2PUQH 5A0AE 4FUIA 2V0BA 1V2UT 1SGNE 1CA0B 3T27A 3MH6A 2XYAA 3E6PH 2ZQ1A 2FLRH 1F2SE 1JBUH 5J4QA 2H9EH 3A7TA 1GCTB 1DOJA 1GCTC 3U9AH 2K8IA 2OC8A 2HRVA 3SGAE 1SR5C 2WPDD 3UWJH 2ESTE 4WMEA 1BHXB 3HKJB 1PQAA 4H6TA 1FIWA 3GY8A 2R3YA 4IW4E 4TYDA 3V3MA 3RXJA 4WY3A 1HFDA 3OAAD 1CSOE 2V3MA 2Z9GA 2XWAA 1CGHA 1PFXC 1O31A 1Y59T 5T6GA 1XM1A 3RXMA 2ANYA 3EA9A 6CHAB 1KXFA 5EOKA 4X6PA 6CHAC 3LGUA 1QZ8A 3KQBA 2HLDD 6LPRA 1XUGA 3VB5A 5T1VA 4NWKA 2ZO3H 2YMSC 1A5HA 3LIWA 2C4FH 2W26A 1V2WT 4OS5A 2ZTXA 1P12E 4MVNA 4O97A 1G3EA 1FAKH 1GI4A 3GCHB 1O3NA 1Y8TA 2BDBA 2K1QA 2ZHEH 4Q63A 3GCHC 2HOBA 2A5KA 4GHTA 2PTCE 1P2QA 3SV8A 1FPCH 2ZGJA 3H09A 1GGDB 2PR3A 3C1KA 2P93A 3G01A 3ZVEA 1GGDC 3TNSA 2ZDLA 1XUFA 1THPB 4GCHG 1V2MT 2V3OH 4TPYA 1S0QA 1T4VH 5EJLA 1AN1E 4H4FA 2F4LA 2TBSA 3TJVA 2GCTC 4FU9A 2AMPA 3P95A 2PSXA 1P04A 3CP7A 3DFLA 4WMFA 3L3TA 1DT2A 2FOFA 4ISHH 2RDLA 3UQVA 2UWOA 1YM0A 1SFIA 4H6SB 2VBCA 5E2PA 1K1IA 2GZ9A 3HGPA 3GISB 4CR9A 5FBEA 3SBKA 3UAIC 6GCHF 1G9IE 1GMHF 1GVZA 2OLGA 3KEEA 2SGDE 2BQ6B 3BEIB 4OS6A 3SU2A 3TPIZ 1P01A 2VWNA 1IQHA 1QQ4A 2FI4E 1A2CH 3FZZA 3RXHA 3SU5A 1NPMA 1C2MA 5FPTA 1YPEH 1GVKB 2PWXA 2BX4A 5FBIA 2XNIA 5HYOA 4BAQB 3MMGA 3ZV9A 1A7SA 1EAUA 2ZEBA 2BDCA 1ZGVA 1SQTA 1AY6H 1Y3UA 4E06H 3A7ZA 1H8DH 1KDQA 1F0RA 1HAGE 1ANCA 1OPHB 3E90B 4FUCA 3TK5A 1SLVB 1Z71A 2H9TH 2ZDMA 1JOUB 1ELBA 3NKKA 2OK5A 3QK1A 4D7FA 2ZU1A 1GHBF 5FAHA 4Q80A 2QF3A 1ZOMA 1S6HA 1EP6A 3K6YA 1XUIA 1C1MA 1ABIH 1VZQH 4AGJA 4XFQA 3KNXA 3LONA 2BXTH 2ZPRA 2K0QA 1IQJA 4SGAE 2BY8X 2J98B 4YLUA 1T32A 1GHXH 1H9IE 5JPMH 1Y3WA 2Q6DA 4B73A 1O2MA 2FDAA 4GPGA 4O9VA 1C2IA 5KEDA 2BDYA 1GBEA 3UR9A 1F0TA 1C5YB 1BUIA 3GY6A 3A80A 3QUMP 1PQ5A 1AFQC 3BTKE 3MNSA 6ESTA 3GY5A 5EGMA 4RI0A 1O2NA 2FX4A 5LH8A 4YTAA 1QB1A 3PM3A 3STIA 3S9BA 1BA8B 3U8TH 4TSFD 2CHAC 2ALVA 3R3GB 5ABWA 2J9NA 2ZFFH 2LELA 4WMDA 1DPOA 2G5NA 3V13A 4YLQH 3EQ0H 3SU1A 1GDNA 2FI3E 1T31A 1DLKB 2BDHA 1AHTH 1EXFA 4KTSA 1Y3XA 1MTNC 3TK9A 2AHME 3SGBE 4D8NA 4IMQA 1LO6A 2A4GA 4HG6A 1GHAG 3ZZ6A 2H5DA 3MNBA 2F9OA 4ZH8A 3KHVA 3K6ZA 2FPZA 3ATMA 2HNTF 3GY3A 1YPMH 1TRYA 4KTUA 2GMTB 1P9SA 1O2XA 3SZEA 4B71A 1IQMA 1BRUP 3UWIA 5F8TA 4IC5A 1K1NA 2GMTC 2J4IA 5AVDA 3T26A 1L0ZA 2BLQA 1V2LT 3BTDE 5HM2A 3QX5H 5CHAC 2R0LA 1WV7H 1C5RA 1SQOA 3ELAH 4OM9A 4WJG2 1IQIA 3K9XB 1J8AA 4DW2U 5C67A 2GD4B 2VWOA 1H4WA 1C2KA 3SU3A 1ZJDA 3QO6A 4K1TA 2AERH 4AFSA 3PV5A 1V2TT 2BY5X 3WY8A 1HAZB 4CRGA 2VJ1A 1KLTA 2VIQA 1XUHA 1DY8A 1HGTH 2H9HA 3ATIA 4NA9H 1F7ZA 3Q76A 3QN7A 1GHWH 2AFQB 2SGQE 2GDDA 2BB4A 3TH4H 1ESAA 1GBIA 1W7GH 5GDSH 4ZXYH 3VB6A 1SBWA 2QF4A 1SSXA 4NIVA 2P16A 3R0FA 2ZGHA 2F43B 1RIWB 4LOYH 1NRNH 3MU8A 2NWNA 1V2OT 1O3KA 5F53A 1K1LA 3LDXH 3UOUA 1K2I1 1OP0A 3PLKA 2Z7FE 2HPPH 4F49A 4I8HA 1JWTA 1HCGA 3M5NA 3UNRA 3OU0A 1GVLA 1W0ZU 1BTHH 3PO1C 2HLCA 1S5SA 2PP6A 5LPEA 2KM0A 1HIAA 1G2MA 1MZAA 5DP7A 4NFEA 1TGSZ 5GCHF 1QJ6B 1EAXA 5FX5A 1K9OE 1SGTA 1E1QD 2PGBB 4AGKA 1O3MA 2BMGB 5DSFA 1ZYOA 2DE8A 1O32A 1BT7A 4NCYA 3LKWA 1O2GH 1W3CA 1NU9A 2F83A 4UFEH 1JRTA 3RXLA 2KCAA 3UFAA 2ZA5A 4IBLH 1C1SA 4X1NU 4ABAA 1QURH 2ZFTA 2QXIA 2ZWLH 1KXCA 1MBMA 1QNJA 1OHHD 2WSSD 5FX6A 1O2VA 1UHBB 3P6ZB 3VEQB 1ELGA 1ARCA 1LHDH 1GMDF 1P03A 4ZXXH 1AFEH 1LMWB 4MG3A 5C1UA 4NA8A 3U28C 3F2HA 3EAJA 2C8WB 1PPCE 1V2KT 2FS9A 3Q3XA 1Z1JA 1GBDA 1GBFA 2GX4A 4MPUA 2FOHA 2TIOA 3PRDA 4INLA 1HNEE 4NGAH 5C0TA 4NIYA 1YC0A 4UE7H 3U98H 1IAUA 2F91A 1C2HA 1QIXB 2BQ7B 3LJJA 1QHRB 2JH5D 1NS3A 2C90B 3OX7U 3S7KB 3NRLA 4MTBA 1W10U 2FTMA 2QXHA 3MO9A 1UTPA 1EOJA 3F68H 1NTPA 3TIUA 2UUFB 2A4RA 3DT0H 5A8ZA 3D49H 4XBDA 3F9GA 3F6UH 3A7WA 4FUHA 1HDTH 5B6LA 3GYMA 2AS9A 8GCHF 3F2FA 1BITA 1SGIB 3PMHB 1SVPA 1A61H 3P92A 1JIRA 3SOSA 4Q7ZA 7KMEH 2ZFQH 4DGJA 3KCGH 4Y11E 2ZDKA 1ABJH 2ZDAH 2SFAA 1AUJA 1SOTA 3LGIA 2W7UA 2Y7XA 1YPHC 1GJDB 1SQRA 3F3BA 3M61U 1WTHD 3M5OA 1QA7A 5DKMA 2A0QB 1EPTB 1MAYA 1Z7KA 1OWIA 1ESBA 2J38A 1EPTC 4ZKRU 4H42U 1O5FH 2KAIB 1ELFA 1SGQE 3STJA 3VXFH 1SL3A 3SO3A 1QRWA 3TJNA 5FCKA 3VG8A 5T6DA 1AKSA 3F0PA 4FUGA 2FS8A 4HTCH 1ZMJA 3PMBB 1SGRE 1HAIH 1DWDH 2YOLA 5FHTA 4F48B 1QB6A 2A7JA 1S82A 1NY22 1ETTH 3MQKC 2QXJA 4IN2A 3A85A 1GBHA 1P8VC 1K0HA 4OGXA 4RT1A 1LHCH 1FV9A 2OXSA 1ACBE 1A5IA 1ARBA 1D3QB 2OINA 1MAXA 1O3IA 1YBWA 1C5SA 4NG9H 4YZUA 3M7QA 3SU6A 2R2MB 3SV7A 8ESTE 4MPVA 4ESTE 1BB0B 1TMBH 3OYPA 3O8DA 2PUXB 1FY1A 3FP7E 2O8TA 2IJOB 3SZNA 5C1XA 2Z3EA 2XCNA 1TX8A 3O8CA 1YCPM 4AFUA 4DOQA 2Z9KA 1SKYE 1PPBH 2PKAB 4KELA 1Z1IA 1MZDA 2F9BH 5FCRA 3KQEA 2XC5A 1AVGH 1FY4A 1A3EH 2WPIS 4K8YA 1BBRK 5C94A 2AYWA 3A87A 1O2YA 2BTCE 1G2LA 4X2XA 1WAYB 1UTMA 3EE7A 1UVPA 1COWD 4Q4LA 3SNAA 3KIDU 3SJOA 2EI7A 3PMAB 2FIRH 5IDKA 3M3VA 1O3GA 3QZRA 5A2MH 4BTIB 4ABHA 2Z9IA 1O3HA 1TQ0B 1UVUH 3GDUA 3LJOA 4Y6DA 2PSYA 4OS1A 1C5WB 2D1JA 5EPYA 1HV7A 1B0FA 2G55A 1RS0A 1EP5A 1OWDA 1C1UH 1TGCA 2J95A 1GI9B 1ZTKA 3MHWU 1XUKA 1VCPA 2YNBA 2O8UA 4O3UA 4WVPE 3GCTF 5L2YH 1C9PA 2SGAA 2TPIZ 4R8TB 4BAMB 1SHHB 5CMXH 1WOFA 1D9IA 2GZ8A 1B7XB 1P3EA 2BLWA 2W5EA 3LPRA 1HXFH 4GVUA 1D3DB 1O3LA 2YNAA 1C5XB 1AZ8A 3RDZA 2GCHF 4AZ2B 3FFGA 2I6SA 4GHQA 2F9PA 1EB2A 1JMOH 1Y5BT 1RTKA 3AAUA 3MU5A 1DX5M 1Q2WA 3URCA 2QF5A 2BD7A 4Y7AA 3SHCH 2Z3DA 1ZMNA 2WINI 2QN5T 1ZTJA 3QGJA 3MNXA 4JK6A 4ABDA 1BTWA 1QY6A 1OSSA 1FJSA 3W1EA 2EA3A 1AVWA 2B9LA 1KXDA 1BTPA 1S83A 4FU7A 3ZVDA 1BTXA 1GBJA 2Z9JA 4BAKB 1RRKA 1MH0A 3A8BA 1F5RA 3P70B 4KGAA 1O3EA 2FI5E 1CA0C 1PQ7A 1GI8B 2ZI2H 1KXBA 1RTLA 3SUGA 4ACAA 1TAWA 4B1TA 4HZHA 2JKHA 3ITIA 1O2TA 2VB0A 4FOUC 1NBMD 4WF8A 2J97A 3T62A 5JB9S 2HGTH 5EU8A 2C93B 5KECA 3TGKE 1DY9A 2O8MA 3HKIB 3MOCA 2A2XH 1EZUC 1ESTA 2CN0H 1OWHA 4K60A 3AW0A 5E0JA 1A46H 1HBTH 2OBOA 2W3IA 1Q31A 2R2WU 1FLEE 1ZSKA 4X1SU 1V2ST 2ZZUH 3RXTA 1LPGB 1SGDE 2QCYA 5A8XA 1DUEA 3Q77A 3ZZ9A 2TGDA 1RJXB 5TCCA 1V3XA 4A7IB 1ZHPA 1ZZZA 1PPZA 4ISOA 3Q3YA 1BRCE 1FY8E 1AE5A 2P95A 3MTYA 2Z9LA 1AO5A 1MKXK 3KQ5A 4Y8ZA 3OE7D 4ZAEA 3D62A 2Z3CA 1UMAH 1LPKB 4X6MA 4FVBA 4I8LA 3DUXH 5K7RA 2ALPA 4UDWH 1GMCF 4XBBA 2P59A 1KXAA 2H6MA 3BSQA 2ZC9H 4VGCB 4B75A 1BTZA 1CO7E 1ZSJA 2OC0A 2HWLB 2Y6TA 3BG4B 1MABB 2TRMA 3LGTA 2XWBI 1MUEB 2FTLE 1UK2A 3BG4C 4I32A 1DFPA 1QA0A 1TGBA 2G00A 4NWLA 2HNTE 3RXVA 3F1SB 2LNCA 1AWFH 2WPKS 1XVOA 1C5ZB 2VIVA 1AIXH 1YLCA 3ZZ4A 2ZCLP 1SOZA 1D3TB 4TT3D 3U1JB 4HFPB 3FKSD 2WUCA 1TNLA 4TY6A 1GI6A 1LPZB 4YM9A 4MDSA 4JMYA 3F9FA 1K28D 2XXLA 1O2PA 4JZDH 4X0WU 2ODPA 3T25A 1E37B 2RA3A 4ASHA 4E05H 1HRTH 1RD3B 2JH0D 1W2KH 3URDA 1DITH 1OWEA 2KCPA 1WQSA 2F9VA 4DVAU 3ZYEA 2ZFRH 1T7CA 2C8YB 4AB9A 4E7RG 4ZHAA 1Z8RA 2V3HH 3MNCA 2W6JD 3RM0H 1W8BH 2R3UA 3NK8A 1P06A 4GUXA 3ZVAA 4DT7B 1DWBH 2Y5HA 1QJ1B 1MKWK 3GYLB 4UEHH 1TRNA 2P3TB 4X8SH 3RXOA 3P17H 2A7CA 5JBAS 4D9QA 4U32A 3BTHE 4ABIA 1A5GH 3ODDA 2PLXA 3HGNA 1O3BA 1PPEE 1KDQB 1SPJA 1N8OB 4CH2B 1FY5A 1GI5A 5PTPA 4A5TS 5F8ZA 2BXUH 1EJAA 3FOAA 5ESTE 2G4TA 1ZRKA 4X1RU 3F9EA 2ZTZA 4XOJA 7GCHF 5DPAA 4GSOA 2J92A 4ACBA 1UK4A 7LPRA 3LH3A 2ZFPH 4X2WA 2XBYA 1P02A 1ZPCA 2RCEA 4FUBA 1ZGIA 1WUNH 1XXFA 2QF0A 1ETSH 2ZHWH 5DK1A 3TNTA 1ELDE 1HAVA 4XDEA 4B2BA 2SGEE 4BAOB 1AB9B 1UK3A 1NT1A 3OFND 3KYGA 1UW7A 2HNTC 4ZHLU 3PLPA 1C1VH 1K22H 4I31A 4OS4A 2BY9X 5LPFA 2LPRA 2ZCHP 3MH7A 3A83A 2STAE 1MTSA 4JZ1A 5EXLA 2PKSB 1VKYA 5HXFA 3PV4A 1TGNA 2PKSC 4AFQA 2XOKD 1A3BH 3PTNA 4JK5A 1EX3A 2G8TA 1C5TA 1XVMA 2A2QH 2ZPSA 1O5DH 3OEHD 3UIRA 1NZQH 5ESBA 1BJVA 1YWUA 3AW1A 1V2NT 4ZKOU 2QV1A 4UD9H 2XW9A 3RU4E 3M37A 4GAWA 5DGJA 3O8BA 2Y80A 3H5CB 3TJOA 2Q6FA 3ZZCA 4CR5A 1MTVA 3V7TA 4FUFA 3OTPA 4NSVA 1GCDA 1GJAB 3M5LA 3A82A 1O2ZA 2OQ5A 3RMLH 1DSTA 1O2RA 3NXPA 2VNTA 1VCWA 1A1RA 1NFXA 4Z1MD 1HAHH 1H9HE 1PJPA 2J5UA 1YYY1 2EY4C 4FUEA 4YT6H 5JBTA 1NO9H 3PROA 2J94A 4ZKNU 4X1QU 4A92A 5FPSA 2QGRA 2TGAA 4J1YA 1RTFB 1UTQA 2O8WA 1O2HA 1Z8IB 4NIWA 5HGGA 4OGYA 1NRRH 3SUEA 1PYTD 1CVWH 2UUJB 3T2NA 1GBCA 3P8OA 2OUAA 2NU2E 3SJKA 4LZ1H 1LVYA 3TJUA 1O2KA 2XBWA 3N7OA 4NIXA 3S9AA 5HIZA 4XSKU 2FOAA 3DD2H 3PWCA 1D3PB 1WYKA 4AYVB 3KGPA 3RC6A 1MCTA 5JYIA 1DSUA 2BVSH 5AF9H 1QL9A 2V6NA 4I7YH 1O38A 1BMLA 3DFJA 3SUDA 1NFYA 3HK3B 1P57B 1VGCB 3GDVA 1WCZA 1EJMA 2FESH 1HAYB 2FEQH 4Q2KA 3TH2H 4DIIH 3KN2A 3RXIA 3JZ1B 2VVUA 1T8LA 3M7UA 3UB0A 1V6DA 1TLDA 2WYJA 3RMNH 1GHVH 1TBQH 4UFFH 3ZZAA 1QJ7B 3SNDA 3VGCB 3WW7A 3LGYA 1S6FA 2GTBA 3QTVH 1G3DA 1RIWC 4FUJA 4WWYA 3C27B 4AN7A 1F92A 3JZ2B 1OX1A 1SC8U 4A1TA 1MD7A 1KTSB 2PTNA 4AOQA 1MMJN 4KTCA 2HVXA 2UUYA 2RA0A 1TPOA 1O5CB 3GOVB 1HIAB 1W0KD 1KMHB 1MD8A 4KP0A 3H7OA 2ZDVH 1O2JA 1YPHE 1TONA 4Y10E 4Y76A 1FIZA 1EKBB 2ZHFH 2P3UB 4K3JA 3FANA 1ZTLA 3VB7A 1GHAF 3SI4H 1ZPZA 1BMAA 1O3OA 1O3FA 1AVXA 1BOQA 2ODYB 4UFDH 1H8HD 4DJZB 1LVMA 1O33A 2M2AA 1P2IA 1QRXA 4DG4A 7ESTE 4RSPA 1ORFA 2YMSD 2OP9A 2WPMS 3ENSB 1LQEA 1XUJA 8LPRA 3TGIE 2D26C 1O3PB 3SN8A 2V35A 1NN6A 3UY9A 5EQRA 5JBBS 1C5PA 3P8NA 2L74A 3U1IB 2EI8A 3GY7A 1TNIA 5ETXA 2STBE 3A8DA 1P09A 1CU1A 4B2AA 1TE0A 3L6PA 1V2PT 3ATKA 1UCYK 5E8EH 4ABBA 1XKBC 3MO6A 1UVTH 4I8JA 2ILNA 5C20A 1EUFA 4DURA 2ASUB 1TNGA 2VVVA 1UTNA 5KGOA 1CT0E 1J15A 4IGDA 3QDZB 3BIVH 1OWJA 3BTFE 3ZZ8A 2TGTA 1GI2A 3OTJE 2FOGA 1A0LA 3RXRA 2BZAA 1GHZA 3RXQA 4U01A 1ELCA 3O8RA 3QTOH 2ANMH 3A8CA 4X8TH 1IHSH 2BOKA 4Y0YE 1TOMH 1BBRH 2QYIA 2H2ZA 5EQSA 2C8ZB 3EDXB 3BTGE 2B5TB 4SGBE 5J4SA 1C9TA 1YKTA 4MPXA 5C2ZA 1TX7A 2WPLS 4UFGH 1TYNA 1C1OA 1OXGA 1SI5H 1EJNA 4LK4A 4RN6A 2XC0A 5DG6A 1K21H 3L33A 5BPEA 5L6NH 3RMOH 1QBVH 1HAXB 1C5NH 3SNCA 3F2GA 4HGCA 2WV5A 2RG3A 2O9QA 4FUDA 4AORA 1GHYH 1SGFG 3SU4A 3RXCA 5CE1A 1DE7H 3BEUA 3ZIAD 1XKAC 4BNRA 9LPRA 5EPNA 3RC4A 1YLNA 1Y5UT 4AFZA 1B5GH 3GS9A 4YT7H 3N99A 1ELVA 3NWUA 2PV9B 1QRZA 2BD8A 3BF6H 1V2RT 1O5BB 2AEIH 1YPKH 3UUZA 1DWEH 2DUCA 2L6OA 1RFNA 1NRQH 3A89A 1S85A 2C3SA 2CXVA 1W14U 4K2YA 3ZVFA 4Q7XA 3BTME 1N1LA 1FMGA 1SHYA 5DJ7A 3RC5A 3AASA 1GJ7B 2CF8H 3BN9A 1QQUA 1J16A 1HUTH 1VITG 1JRSA 1SGFA 4IMZA 3UREA 3GCNA 3TGJE 1CBWB 1F5LA 1OYQA 3LC3A 3HPTB 2PHBA 2XBXA 1UVOA 2LP6A 3QZQA 1W0YH 1T4UH 2WUBA 1ZHMA 3LT3A 1LKBA 2BY6X 2ZG0H 2QXGA 2WV4A 5DP8A 3TVJB 1DVAH 2AMDA 4CBOA 3SV6A 1BCUH 1H9LB 2W3KA 1OS8A 4WH8A 3ODFA 5DP4A 1J9CH 3M5MA 5F6MA 2FOBA 3ZV8A 5L2ZH 3PLBA 3AK5A 4M7GA 1VJ9U 1SLXB 3UOPA 5GJ4B 3MI4A 4Y7BA 4JYVH 3RXKA 3SQHE 1P05A 3IITA 4Y71A 1YP9A 4ZKSU 4I8KA 4XBCA 2AMQA 1O2SA 1AUTC 2FWWA 2KFWA 3E1XB 4OS7A 4I86A 1V2VT 2A5IA 2WPJS 1C5OH 3SJ8A 4ABJA 4AG1A 1CHOF 1TGTA 3RXGA 3RXAA 2TGPZ 3S7HB 3SORA 1K1PA 2BD5A 2ZHQH 3KQCA 2KR7A 2ZHDA 1HXEH 2ANKH 2ZIQH 5HIYA 1IQKA 2RDEA 2FM2A 4BXSA 2FYQA 1MKXH 3VXEH 4IS5A 5GXPA 2BZ6H 4JCNA 1NFUA 2P94A 1SGPE 1TNKA 3I77A 1HAPH 3TITA 2H1UA 3E16B 3KYFA 3T29A 5GIBA 4B76A 3M36A 1WXRA 1GJ4H 3U69H 4LXBH 1FN6A 3VPKA 3SNBA 3LGWA 1UTJA 1OYTH 1D6RA 1EAWA 4CRBA 4WH6A 3P8GA 3Q00A 4X2YA 3TU7H 5AHGH 1KLIH 1PYTC 3UPEA 2JJ2D 2BVXH 4Y8XA 2XCFA 1W11U 1T8OA 1C2FA 2FYRA 1CE5A 3D23A 2HVYB 1MU6B 4Z0KA 1IQNA 1YCPK 1DWCH 2ULLA 3W95A 1TX6A 1HB0B 1GMCG 1O5GH 1SQAA 4TWYA 3GDSA 1SMFE 2AIQA 2QC2A 3FVFB 5B6OA 1TOCB 2O8LA 3B8JA 4A1XA 5E0GA 5C3NA 2EI6A 3PRBA 2J2UA 1O5EH 5A8YA 2M5TA 1F0SA 3DSOA 2ZKSA 4I8GA 3MU1A
chains in the Genus database with same CATH topology
1IQEA 2ZQ2A 1FXYA 1BJUA 5T6FA 1BIOA 1AD8H 1UO6A 4QT8C 4A1VA 1EZXC 2GP9B 5GWZA 4FU8A 1KY9A 2FP7B 4AB8A 3SUFA 3H7TA 3Q3KA 1MKWH 1O3JA 5F03A 1EOLA 5GPIB 1C2GA 1UVSH 4K1SA 1EZQA 6GCHG 1GMHG 3U8OH 3FP6E 3AAVA 1O2LA 1CA8B 1GBKA 1O3AA 2BD4A 5A09A 4CBNA 3RM2H 1F0UA 1ANDA 1DANH 4J2YB 1AMHA 1KXEA 3RXDA 1LKAA 1GI3A 5FPYA 1QTFA 1G37A 2UWLA 3MWIU 1ZRBA 1L1GA 4NFFA 2HPQH 1G32B 1QGFA 3K65B 2OC7A 1JIMA 1IQGA 2EC9H 5EQQA 1THSH 4ISLA 4ZUHA 3T5FH 1E35B 5LGOA 2A45B 2F9NA 2XC4A 1C1RA 1O37A 1CT2E 3A7VA 4Y0ZE 1NM6A 2BVRH 1GJCB 1TFXA 4FVDA 5DP9A 1GJ6A 1TPSA 3EA8A 1QCPA 3MU0A 1RGQA 3HK6B 2GV7A 1EB1H 1Z6EA 4RKOB 2BHGA 1H1BA 4VGCC 1C5QA 1W7XH 3M7TA 5EXMA 1B0EA 2OD3B 1Y3VA 2G4UA 5A0BA 1GHBG 1GWAA 1O2QA 3RXUA 7GCHG 1J17T 2FZZA 3SW2B 5K0HA 4YO9A 1LHFH 3BTTE 1MTWA 4I33A 2BLVA 1AU8A 2W7SA 1O35A 1HAOH 1DXWA 4Z6AH 1FY3A 1THRH 3CS0A 3RXPA 1QBNA 2UUKB 5EXNA 1ZSLA 1PPGE 1C2EA 2GVFA 1BRBE 1NFWA 2GCTB 2BM2A 1SG8B 4CRFA 1BHXF 1C1TA 1KLJH 1NESE 1V2JT 4Y8YA 5I46H 1J14A 3EA7A 2Y7ZA 2ZU5A 2FXRA 1P2NA 3KF2A 3UQOA 3RU4T 1SGCA 1F5KU 5SGAE 1ZHRA 2J34A 1K1JA 3MO3A 1P10A 1O34A 2BD2A 5C5OA 4KKDA 3RUOA 4BOHA 4K5ZA 1MCVA 1CGIE 8KME2 2IOTA 1VCQA 1D4PB 2NU0E 2QA9E 1CHGA 2CF9H 2B0FA 3M3TA 1GI0A 1MU8B 1Y5AT 1DXPA 1UCYE 2XTTB 2Q6GA 1OOKB 2BDAA 1BZXE 2BYAX 4CRDA 1WSSH 2THFB 4X2VA 1ELAA 1QB9A 1N8OC 4DIHH 1XXDA 3GCOA 2WPHS 2ANWA 3D65E 2IPHA 2AIPA 3UNSA 1MQ6A 2PGQB 3CENA 1C4Y2 1DDJA 4CRAA 1DICA 1QR3E 1MQ5A 5H4IB 4Y79A 2G52A 2XRCA 2SNVA 2AH4X 1W13U 1GBTA 1QBOA 1G3BA 1HAVB 1WU1A 3PMJA 4K1EA 2A4QA 4PROA 4GCHF 1AB9C 5EW1H 2OTVA 1FI8A 2Z94A 1HJAB 2FLBH 1GL0E 5EW2H 4MNWA 2R9PA 2GT7A 2GGVB 1A0HB 1HJAC 3ATLA 3NPSA 5G4BA 4F4OC 1T8NA 2DE9A 3RXSA 2AGEX 2FO9A 1AI8H 3BEFB 4U30A 1Z6JH 3S9CA 4DCDA 1TIOA 1PPHE 4JYUH 2VWMA 1TBRH 1UTLM 1P2OA 1C1PA 1TA2A 1CGJE 1EZSC 3MH4A 2D8WA 4A6LA 1LHGH 1P3CA 3A8AA 3A7XA 2IN2A 2WYGA 2HALA 1AFQB 2GDEH 1GDQA 1GBMA 2FOCA 1K1OA 4MQAA 3MU4A 3SV9A 2A4OA 3E8LA 1HPGA 1GDUA 5F8XA 1C2JA 1NC6A 3SHAH 4AX9H 2CHAB 1C2LA 2QY0B 1WTGH 1VJAU 2B8OH 2ZDNA 1IQFA 1EAIA 3GY4A 5GCHG 2UWPA 1C5LH 1FONA 3A7YA 3P8FA 1BMNH 1MTNB 1LDTT 1GG6B 3RXFA 1MTUA 5TCAA 1C4V2 1L4ZA 2GZ7A 1GG6C 4K8BA 1BRAA 2GV6A 5C1YA 4MNXA 3FZDA 1T8MA 1S84A 5DP5A 1SB1H 2BY7X 1L1NA 2ZF0H 4MLFB 1Z8GA 3HATH 1TPAE 1Z8JB 2BX3A 1TALA 2FMJA 3A86A 5JBCS 2SGPE 4OS2A 1UCYH 1G3CA 1TMUH 3F9HA 1YPGH 5CHAB 2Z6BD 1GBBA 1TB6H 5LPRA 1GMDG 4E7NA 2ZPQA 2ZCKP 1TMTH 2QAAA 2FOEA 1FUJA 3OSYA 4CRCA 2BOHB 1UTKA 1QL7A 1VGCC 4U2WA 1BBRE 1AGJA 1HYLA 1PQ8A 1C1WH 1C2DA 1HJ9A 2NU1E 1SFQB 2BDGA 3NZIA 3E3TA 1P2JA 3UNQA 4X8UH 1MBQA 1ZMLA 1OP8A 3E91A 1O0DH 2F3CE 3E0NB 5FXLA 3BTWE 2VWLA 1O3CA 3UTUH 3VGCC 1LCYA 2FX6A 4FXGH 1ETRH 1CT4E 3IG6B 2CMYA 9ESTA 2G81E 5JB8S 1VR1H 3ATWA 3VFEA 2A7HA 1GBLA 1P9UA 1SLWB 3MFJA 1C1NA 1N6XA 1TABE 2G5VA 3SGQE 1ELTA 3QWCH 4UONA 4JZEH 1FQ3A 3EGKH 3AVZA 3BG8A 1A4WH 1KSNA 3ZZ7A 4BAHB 8GCHG 1EASA 3MH5A 3PO1B 3RXEA 1TNHA 1G36A 3W94A 4B74A 1GJ5H 2A5AA 1TWXB 2C8XB 2VH0A 2SNWA 3KQDA 5AFYH 3SJ9A 4D9RA 1BDAA 4THNH 2VINA 1BQYA 5DP6A 4NZQA 2A1DB 3QLPH 1E38B 3I78A 1P11E 1LVOA 5C5NA 1FZZA 1E36B 4ISIH 4YOJA 2I6QA 4K69A 4ABGA 1D6WA 4BTUB 2VGCB 2VIWA 4R0IA 2OC1A 1KIGH 2OBQA 3DHKH 2VGCC 2ZU2A 3SU0A 1UHBA 1QFKH 1L2EA 4JZFH 1TBZH 2CGAA 3PTBA 1M9UA 2OQUA 2FOMB 3GICB 2NU4E 1S0RA 1O30A 5EODA 3PYHA 1AZZA 1P2MA 1TRMA 4DY7B 1DUAA 4X1PU 1ELEE 1FNIA 3T28A 4IN1A 1U6QA 4X6OA 1GJ8B 1DM4B 1W12U 3SI3H 2JH6D 1TQ7B 1BTUA 1ZPBA 3UR6A 3KL6A 3VB4A 1E0FD 2Y5GA 1N6YA 2JETB 1GBAA 1LVBA 3TH3H 1NU7B 2ZFSA 2JETC 1TPPA 1ANEA 3V12A 2B7DH 3V0XA 2ZU3A 3PB1E 4O3TA 2VH6A 1Y3YA 4X8VH 2BLOA 2ZGBH 3B23B 4MNVA 1OWKA 1YPJH 4Q7YA 3FP8E 2ZGXH 4AG2A 1S81A 4HI3A 5JDUB 5AFZH 1UTOA 3K2UA 1LQDB 3B9FH 1E34B 1LTOA 4RKJB 1P0SH 1NRPH 2AGIX 3MYWA 5IYTA 1Q3XA 1ANBA 3SQEE 4IC6A 3ZVGA 5BRRE 4X6NA 1C5MD 2CV3A 3FAOA 1EQ9A 1OKXA 1ZR0A 5E2OA 1JXPA 2FODA 1AKSB 2A31A 2R0KA 3ZZDA 3SJIA 1K1MA 3ZZ3A 3I29A 2Y81A 4NZLA 1AE8H 1FDPA 1EPTA 1CHOG 1DS2E 2SGFE 3OY6U 1C5UA 2KAIA 4CHAB 2VIPA 4ISNA 1YLDA 2BQWB 4WXVA 3TLOA 2BD3A 1X7AC 2D2DA 1O36A 4YOIA 4CHAC 3BTEE 5TJXA 1XMNB 1O39A 1C4U2 2NU3E 4YESB 3SV2H 3GCTG 1YCPH 2P3FH 4MNYA 1O5AB 3EE0B 2ZNKH 4GLYA 1IHTH 1CBWC 2ZTYA 1KTTB 3NCLA 2BDIA 1LHEH 4ABEA 5DP3A 1BTYA 2GCHG 3PWBA 3ZVBA 1IOEA 3LU9B 3RLWH 1FAXA 4AYYB 1AWHB 1GI7B 5EG4A 1P2KA 1GJ9B 3VB3A 1L4DA 2VVCA 1NRSH 5T3HA 2VU8E 3M3SA 1HJ8A 1O2UA 2AGGX 5DO4H 2OCVB 3A88A 3A81A 1SGEE 3LGVA 4ZHMU 1SGYE 3SNEA 3GY2A 4JYTA 2ZECA 1OP2A 3EYDA 3RXBA 2Y82A 4JZIA 1GL1A 2PFEA 2A32A 3ZZBA 1ID5H 2Y5FA 3LC5A 1WBGB 1UJ1A 4TY7A 2PKAA 3DA9B 1DLEA 2ZU4A 1V2QT 4MPWA 2GT8A 1A0JA 1IQLA 5I25A 2VIOA 3BTQE 4B2CA 3LOXA 3BIUH 4TPIZ 1BMMH 3RLYH 1VITH 3RP2A 3NUMA 3S0NA 2ODQA 2ZP0H 1H8IH 5E0HA 2P8OB 2PW8H 4WXIA 3ESTA 3ZYDA 2P8OC 1HLTH 3QGNB 5A0CA 2Q1JA 4CH8B 1KYNA 1YPLH 2BD9A 3OY5U 1INCA 1SLUB 1FN8A 4ZROA 4YOGA 1EATA 2QIQA 4BANB 1L1JA 4ZMAH 1C1QA 1PPFE 1XX9A 4ABFA 2G51A 3TK6A 1AQ7A 1O2IA 1RXPA 1G30B 1VITF 4TWWA 3U8RH 3A84A 1WQVH 1YF4A 3ZVCA 2F9UA 1O3DA 1NROH 2VIDA 4D76A 4NA7A 5HMAA 1YGCH 5HM9A 1GJBB 2EEKA 4O03A 1TA6A 4XE4A 4INKA 1O2WA 3RMMH 3ZZ5A 3E0PB 4BTTB 2GKVE 1GI1A 1TNJA 3CS7A 1ZLRA 4BXWA 3M35A 1CQQA 2XBVA 1C5VA 3LH1A 5L30H 3IWMA 1GPZA 3RU4D 4D7GA 2H5CA 1O2OA 3S69A 1ZJKA 1FPHH 4LZ4B 4NSYA 2CJIA 4CREA 4INHA 1QL8A 2ZGCA 3BV9B 2PUQH 5A0AE 4FUIA 2V0BA 1V2UT 1SGNE 1CA0B 3T27A 3MH6A 2XYAA 3E6PH 2ZQ1A 2FLRH 1F2SE 1JBUH 5J4QA 2H9EH 3A7TA 1GCTB 1DOJA 1GCTC 3U9AH 2OC8A 2HRVA 3SGAE 1SR5C 3UWJH 2ESTE 4WMEA 1BHXB 3HKJB 1PQAA 4H6TA 1FIWA 3GY8A 2R3YA 4IW4E 4TYDA 3V3MA 3RXJA 4WY3A 1HFDA 1CSOE 2Z9GA 2XWAA 1CGHA 1PFXC 1O31A 1Y59T 5T6GA 1XM1A 3RXMA 2ANYA 3EA9A 6CHAB 1KXFA 5EOKA 4X6PA 6CHAC 3LGUA 3KQBA 6LPRA 1XUGA 3VB5A 4NWKA 2ZO3H 1A5HA 3LIWA 2C4FH 2W26A 1V2WT 4OS5A 2ZTXA 1P12E 4MVNA 4O97A 1G3EA 1FAKH 1GI4A 3GCHB 1O3NA 1Y8TA 2BDBA 2K1QA 2ZHEH 3GCHC 2HOBA 2A5KA 4GHTA 2PTCE 1P2QA 3SV8A 1FPCH 2ZGJA 1GGDB 2PR3A 3C1KA 2P93A 3G01A 3ZVEA 1GGDC 3TNSA 2ZDLA 1XUFA 1THPB 4GCHG 1V2MT 2V3OH 4TPYA 1S0QA 1T4VH 1AN1E 4H4FA 2TBSA 3TJVA 2GCTC 4FU9A 2AMPA 3P95A 2PSXA 1P04A 3CP7A 3DFLA 4WMFA 3L3TA 1DT2A 2FOFA 4ISHH 2RDLA 3UQVA 2UWOA 1YM0A 1SFIA 4H6SB 5E2PA 1K1IA 2GZ9A 3HGPA 3GISB 4CR9A 5FBEA 3SBKA 6GCHF 1G9IE 1GMHF 1GVZA 2OLGA 3KEEA 2SGDE 2BQ6B 3BEIB 4OS6A 3SU2A 3TPIZ 1P01A 2VWNA 1IQHA 1QQ4A 2FI4E 1A2CH 3FZZA 3RXHA 3SU5A 1NPMA 1C2MA 5FPTA 1YPEH 1GVKB 2PWXA 2BX4A 5FBIA 2XNIA 5HYOA 4BAQB 3MMGA 3ZV9A 1A7SA 1EAUA 2ZEBA 2BDCA 1ZGVA 1SQTA 1AY6H 1Y3UA 4E06H 3A7ZA 1H8DH 1KDQA 1F0RA 1HAGE 1ANCA 1OPHB 3E90B 4FUCA 3TK5A 1SLVB 1Z71A 2H9TH 2ZDMA 1JOUB 1ELBA 3NKKA 3QK1A 4D7FA 2ZU1A 1GHBF 5FAHA 4Q80A 2QF3A 1ZOMA 1S6HA 1EP6A 3K6YA 1XUIA 1C1MA 1ABIH 1VZQH 4AGJA 4XFQA 3KNXA 3LONA 2BXTH 2ZPRA 1IQJA 4SGAE 2BY8X 4YLUA 1T32A 1GHXH 1H9IE 5JPMH 1Y3WA 2Q6DA 4B73A 1O2MA 2FDAA 4GPGA 4O9VA 1C2IA 2BDYA 1GBEA 3UR9A 1F0TA 1C5YB 1BUIA 3GY6A 3A80A 3QUMP 1PQ5A 1AFQC 3BTKE 3MNSA 6ESTA 3GY5A 5EGMA 1O2NA 2FX4A 5LH8A 4YTAA 1QB1A 3PM3A 3STIA 3S9BA 1BA8B 3U8TH 2CHAC 2ALVA 3R3GB 5ABWA 2J9NA 2ZFFH 4WMDA 1DPOA 2G5NA 3V13A 4YLQH 3EQ0H 3SU1A 1GDNA 2FI3E 1T31A 1DLKB 2BDHA 1AHTH 1EXFA 4KTSA 1Y3XA 1MTNC 3TK9A 3SGBE 4D8NA 4IMQA 1LO6A 2A4GA 1GHAG 3ZZ6A 2H5DA 3MNBA 2F9OA 4ZH8A 3KHVA 3K6ZA 2FPZA 3ATMA 2HNTF 3GY3A 1YPMH 1TRYA 4KTUA 2GMTB 1P9SA 1O2XA 4B71A 1IQMA 1BRUP 3UWIA 5F8TA 4IC5A 1K1NA 2GMTC 2J4IA 5AVDA 3T26A 1L0ZA 2BLQA 1V2LT 3BTDE 5HM2A 3QX5H 5CHAC 2R0LA 1WV7H 1C5RA 1SQOA 3ELAH 4WJG2 1IQIA 3K9XB 1J8AA 4DW2U 5C67A 2GD4B 2VWOA 1H4WA 1C2KA 3SU3A 1ZJDA 3QO6A 4K1TA 2AERH 4AFSA 1V2TT 2BY5X 3WY8A 1HAZB 4CRGA 2VJ1A 1KLTA 2VIQA 1XUHA 1DY8A 1HGTH 2H9HA 3ATIA 4NA9H 1F7ZA 3Q76A 3QN7A 1GHWH 2AFQB 2SGQE 2GDDA 2BB4A 3TH4H 1ESAA 1GBIA 1W7GH 5GDSH 4ZXYH 3VB6A 1SBWA 1SSXA 4NIVA 2P16A 3R0FA 2ZGHA 1RIWB 4LOYH 1NRNH 3MU8A 2NWNA 1V2OT 1O3KA 1K1LA 3LDXH 3UOUA 1K2I1 1OP0A 3PLKA 2Z7FE 2HPPH 4F49A 4I8HA 1JWTA 1HCGA 3M5NA 3UNRA 3OU0A 1GVLA 1W0ZU 1BTHH 3PO1C 2HLCA 1S5SA 5LPEA 1HIAA 1G2MA 1MZAA 5DP7A