2STTA

Solution nmr structure of the human ets1/dna complex, 25 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*CP*GP*AP*GP*CP*CP*GP*GP*AP*AP*GP*TP*TP*CP*GP*A
publication title Correction of the NMR structure of the ETS1/DNA complex.
pubmed doi rcsb
molecule tags Dna binding protein/dna
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1996-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2sttA00
4OIQF 1HW2A 2COMA 5K5RA 1MJAA 1J2XA 2YU3A 4BNCA 4G6DA 2QQ9A 4ENJA 2EA2A 1RUOA 3WTSC 1UHWA 4IRGA 2O8XA 2ZFWA 3GFIA 1HKTA 3KP3A 2RGVA 1XSXA 4GGGA 1R5HA 2FRHA 2Z5UA 3QP6A 1LEAA 1R7JA 4HBLA 4Q4ZF 5D6FA 1T38A 3R4KA 5CVVA 2XV4S 1YW8A 1YIOA 1R00A 1Z6RA 2JPBA 2RC4A 3KE2A 3CUQB 4RB3C 4RGXA 1F9NA 3CO6C 4OIPF 4HV6A 4ASNA 4K2EA 2PN6A 3E5UA 3H3ZA 4L5JA 3GX4X 1I1SA 1IN8A 1XB4A 5DCMA 4LJZF 5FB2A 2WWYA 3G3ZA 1SFXA 1NHAA 4P9UA 3TGNA 3GO5A 1R1UA 2P7VB 2M5WA 2RN7A 2LF8A 4DNCA 3JAMZ 2DQLA 3JW4A 1QBJA 3LSTA 4WCGA 5CLSA 3GUDA 3PFIA 2OQRA 1W7PA 1LB2A 1QZYA 3JSPA 3MZHA 5E1ZB 3HOSA 4G7OF 2HTSA 1QQIA 1FP1D 3I53A 4HDVA 3BPXA 3MWMA 3SHFA 3ZPLA 5KVRA 2IA0A 1FBQA 3FF5A 1KYWA 1CGPA 4UVCA 1HXDA 1O57A 3LA3A 1O3RA 1K6OA 4R79A 2M45A 4XSZF 2A69F 4GO1A 4HQMA 3SZPA 4JK1X 1FOKA 4MEYF 4MGRA 4G94A 4KNYA 2BBYA 3GEZA 3ECHA 1BIBA 3KP2A 1UFMA 2NS0A 3DKWA 5D8KB 3WE2A 2WV0A 3FXRA 1PUEE 3OOPA 4A6DA 2NAZA 3I59B 3IC7A 3V4GA 4HA8A 1ZGJA 4JQFA 3CO7C 1XGOA 5TJJA 1D8KA 1ZRFA 1MDMA 1A04A 2RDPA 3RDIA 3R6SA 5LHGA 4WWCA 1WRJA 4UNOA 4I2OA 4M6YA 1LNWA 2QVOA 1HKSA 1RI7A 2L4AA 3K9TA 1IUYA 1WSUA 1YS6A 1WI9A 2AXLA 3QU6A 3V8LA 1IW7F 4MQVA 4RS8A 1R5GA 4H0EA 3HUGA 2VT2A 1FBSA 3DPLC 3F23A 3MZYA 2LSOA 2V1XA 3SZTA 4LG0A 1TQMA 2C6YA 5L3FA 2PFBA 1MJBA 5HVQC 1AOYA 1EV7A 2KJBA 4KFCA 4BHPA 1FC3A 3HRSA 4MNUA 1KU3A 2DFIA 2L4MA 5BPDA 2ZO4A 2OQGA 1ONVA 4B09A 4I01A 5L3GA 4L5IA 2HZTA 2F5FA 3GW2A 1QPMA 3GXOA 1KQ9A 1H9GA 5DD8A 1J0RA 3FXUA 4ETSA 3IWFA 4MTDA 4N9IA 5ICEA 3GFMA 3P9IA 3GVAA 4CXFA 5DUIA 2ETHA 4YFXF 3Q9SA 2V6CA 2E1NA 2FOKA 3KZYA 5TRDA 4OOIA 1IF1A 1O3TA 1U78A 4HX7A 4S04A 3HTUA 4GCVA 5ILUA 1W5TA 3R0AA 1WQ2A 4LD5A 2EFOA 2HOEA 3FHZA 2L01A 3TO9A 1IN6A 2EK5A 2VE8A 1U6GA 3GFJA 4OMZA 1BI2A 2EWNA 4YIFA 2KIFA 1GXPA 1OKRA 1P92A 5LGNA 5DCMB 2W25A 2QBYB 1Y0UA 1YW9A 3ZMTA 3I64A 1TBXA 2Z33A 4NHJA 2DK8A 5D8LB 1ZHFA 4YFNF 2ADUA 1FPQA 2Y48A 2CWEA 3CUQC 5ED4A 5ERIA 1HBXG 1KYZA 2FBIA 1JHHA 1W7PB 1K78A 4EJTA 4KUMA 2IW5A 4LLGF 2STTA 2HGCA 2QLZA 3TO7A 3QOPA 3N4MA 3QRFF 4KDPA 1UB9A 2JZYA 5LGUA 3ZMVA 4P55A 1ZG5A 1W7PD 4FT8A 3BJAA 2FF4A 3I71A 3VEPA 2VBZA 3ZMSA 1H9TA 3HOTA 3KP7A 2ZBKA 3ROUA 2HDCA 2PJPA 4CO8A 3BOQA 2W57A 4OMYA 5LHIA 5BQTA 2ESNA 4XBFA 2DTRA 2O3FA 2VOPA 3H92A 1T0FA 5K5OA 2EFNA 5AIQA 3V7RA 2M1BA 3DP7A 2A61A 4O6JA 3HSFA 2XROA 3BWGA 4Q5SF 2Z99A 1FT9A 4E70A 2XKOA 3K0LA 1W4MA 2M87A 4UHTA 4ZZDA 3VB2A 3DQVC 3T0YA 2A5YB 4LMYA 2YX4A 1S3JA 3MEXA 1TQPA 2G7UA 1MDMB 2V9VA 1O7LA 2JPCA 3WTZA 2ZCWA 4I0AA 4HLYA 4EJUA 3PQJA 3ULQB 3RKWA 2CFXA 4LB5A 4L9JA 3DXJF 2FMLA 2V1DA 1IXCA 1TLHB 2EV6A 2GA1A 5LHHA 5HDNA 1YYVA 3HRUA 4XLPF 2WTEA 2B0LA 4U0VA 1R58A 4HW0A 2OAZA 4Y17A 2XGXA 3REOA 3TKYA 2KRFA 2XAGA 1IRGA 1ZG3A 4ZYGA 3WODF 2R3SA 1BC7C 4LG0B 2G7HA 4PZJA 2OZUA 5CJ9A 3CDHA 2MC3A 2UXNA 3NQOA 4RB2C 2X0LA 4M9XA 3LQQA 3D5LA 5FFZA 2FNPA 4HV5A 3GZ6A 2QUFA 1MZBA 4RGRA 4EV0A 2A3SA 2ISYA 5E17F 3I58A 2XAJA 2FQ3A 1ZRDA 3LAJA 1IAWA 3L09A 2A6EF 3F21A 2UWMA 2J5PA 5K1YA 3T5XA 2V1UA 4KMUX 4KIGA 4QWQA 4XRFA 1I6XA 1HW1A 1FNNA 2ZMEA 1E2XA 4A2UA 4KIBA 2GAUA 2CW0F 2IP2A 5JFRA 1DDNA 2MD5A 3MAJA 2HKOA 4PGHA 2ELHA 3GF2A 4U88A 3E6MA 1GVJA 3MCZA 4ON0A 5JI6A 4EQQA 1P2FA 3G73A 1Z1DA 1DUXC 1IZ1A 4MQ9F 2O6GE 2FEZA 3JAMK 3QAHA 5JR3A 3M8EA 5HDGA 2UZKA 2O03A 3KEQA 4WXDA 1ZREA 4A6EA 4TV7A 1Q1HA 3L7WA 4M73A 1HSJA 5J8CA 4IRHA 2EFQA 2H6BA 4O3MA 3RI4A 1G3WA 5CYVA 1I5ZA 1HQCA 2QWWA 3F72A 5EEGA 1L3LA 4A0ZA 4KA4A 1XGSA 2LF7A 2Y75A 2PMHA 1SFUA 1P4WA 1ON2A 1LJ9A 3LFKA 2VE9A 3E5QA 3WTVC 1ZG1A 1R1TA 2NNNA 4M72A 3P7NA 1JHFA 1V4RA 1P4XA 3C18A 5A2QZ 1ZGAA 4WF2A 1K79A 5D6EA 4WX9A 4MEXF 2MLKA 1S6LA 3WTTC 4EM2A 2FA5A 1LVAA 1Z05A 3SXYA 2PI0A 2LDUA 4G8XA 1U5TC 2GXGA 2RKHA 3FXQA 3C1DA 1STZA 4KN4X 3ZMDA 1IN5A 3EETA 1OMIA 2ISZA 4OIOF 4ZH4F 1G3YA 4RGSA 4R8HA 4NB5A 3J80Z 5CVUA 2P5LC 2E1CA 2EB7A 2E7XA 3F8CA 2IT0A 4YG2F 5L3DA 4Z2YA 2G9WA 3TDUC 1FYKA 2AS5F 5IT9K 2ZJ2A 2OZ6A 3WGGA 1OYWA 4HX4A 2ACJA 2M30A 2DU9A 5DV5A 5FD6A 5D5WB 1QGPA 1IN4A 1R1VA 2P5VA 5BPIA 4P96A 2XVCA 2RVCA 3DV8A 4RGUA 1QZZA 4AWXB 1PP7U 4EJWA 4CHUA 4LLLA 1S29A 3I4PA 1G3SA 2IVMA 1BC8C 1FSHA 4UXNA 2W24A 2L3DA 2DAOA 4HOBA 2MH9A 3TQNA 2H6CA 3HSRA 4ZYEA 2L54A 1T98A 5FGMA 1PP8F 5ILVA 4YFKF 2VBWA 1EH7A 4HDUA 1KU2A 3L9FA 1B59A 3IKVA 5IT9Z 4ENNA 2CQKA 1HSTA 2XAQA 3IWZA 2GXBA 1EH8A 4CZZA 2LKPA 2HS5A 5FD5A 1J9IA 4LFUA 1CF7B 1I27A 3L2CA 1B9MA 2M8EA 2IPQX 3O2PE 5DEQA 3RKXA 3H3UA 1SAXA 5CVRA 2Q0OA 2Z3YA 1IXRC 1XCVA 1FWZA 2JRTA 2UXXA 5H20A 1XDSA 2XRNA 1SMYF 5L3EA 5HOOA 3WU1B 5D4SA 1XSDA 4CYDA 4HF0A 4N0BA 5E1WA 2YSRA 2DO7A 5J8FA 4OINF 1WWXA 1G3TA 3SFZA 1U3EM 1XDUA 1ZYRF 3BZ6A 3RYPA 4BAYA 4IF4A 2ZMEB 4U0YA 4LK1F 3DEUA 5FO5A 1SMTA 2QENA 3NEUA 3JSOA 1B1BA 1G6NA 4L0ZB 4GYGA 3KLNA 2K4JA 1LQ1A 1H0MA 1BIAA 3RIRA 2J5OA 2YPRA 1XMKA 2FSWA 1ZH5A 4IHSA 3OV8A 4LGWA 1F1ZA 2CSOA 2HYGD 2KKOA 3VOEA 1K7AA 3W6JB 2QQBA 3CJNA 4LK0F 2NYXA 2JSCA 2HWVA 2H27A 4G9YA 1I1GA 5LEJA 1B4AA 1YS7A 1W5SA 1R22A 2PBIA 3U2RA 4A5MA 2OA4A 1G4DA 3IRRA 2BEOA 2V79A 1LDKB 3MQ0A 3K1MA 3VODA 4ENMA 3VFZA 2OBPA 3HHGA 3IRQA 4I98B 1V3FA 3T8RA 1C0WA 3CUQA 1J7KA 2CG4A 4P5OA 1USSA 4PGGA 4F7ZA 3ZMZA 2DI3A 3M8FA 2GIVA 4S05A 4EVIA 3WG9A 3TOBA 1JXSA 4G7HF 1RIOH 4U7BA 2VC1A 4B8XA 1BM9A 3WU0A 3WTWC 1XN7A 5H6QA 3WGIA 4KICA 1Z7UA 4EM0B 4R1HA 1ODDA 4CGZA 3CTAA 4XSXF 1XMAA 1FSEA 5D5UB 1YW7A 3KP6A 2H09A 3K1PA 4Q48A 2EA4A 3F8BA 5FLXK 3FMRA 4XLNF 3EQLF 1KU9A 3LA7A 2CYYA 3ABTA 1ZARA 1SD5A 2P7CB 3E3VA 2GZWA 2DPUA 3HYIA 4OU0A 3WTXC 1OR7A 5IT3A 3KZZA 2EFWA 2JTVA 4Y13A 3TDZC 3BJOA 1O3SA 4ENKA 3F8FA 4BYYA 2Q2EA 3K69A 3R0JA 3M9AA 4L9NA 1UCRA 3HRTA 3F8NA 3BPVA 5HS7A 4I7HA 4KYWA 3T1BA 4ESFA 5FLXZ 5JHUA 4OIRF 1PDNC 1BOAA 2F2EA 5F6FA 2EJRA 1FZPB 2NNYA 3KP5A 3I54A 6PAXA 3V8KA 4EGZA 3K2ZA 1KGSA 2GQQA 3J81Z 5CVJA 4MTEA 3RYRA 3I59A 3QPHA 1HKQA 4FX0A 5D4RA 2STWA 3BROA 4AIHA 5J6XA 2OD5A 3GZ5A 1FX7A 3C3WA 1ULYA 2FNAA 5BMZA 2PEXA 4IVNA 1LEBA 1Z91A 4QLCU 1LDJA 2ESHA 3QPTA 1TNTA 1FBUA 2L02A 1L0OC 3FM3A 2RV8A 2DLLA 2K86A 3F8MA 5E20A 3U1DA 3WTYC 3GLXA 3WGHA 5HS9A 2GA2A 4HLXA 3F22A 3FM5A 1Z6TA 3HIFA 2Z9OA 2DK5A 3FZVA 3K1NA 3DFGA 4L9TA 2BGCA 4HF2A 3BP8A 2D45A 1BI0A 3SQNA 1SFEA 3ISPA 3LWFA 3ZQ7A 2MBFA 3DPTA 3O6BB 3LAPA 4N9HA 2PLYA 2F5EA 1YFHA 1FLIA 3RPUA 3RJPA 4ZZLA 3P9KA 5A2QK 4AVPA 4RB0A 4M9ZA 1DPRA 3ECOA 3FWEA 5ICGA 1U8RA 1GXQA 4I0BA 5ICFA 1TNSA 2F5DA 2XAHA 1IN7A 3E6CC 3Q5FA 3EYYA 4Y15A 2QZ8A 1O7FA 5K5QA 3J80K 2O0YA 1D5VA 1XCBA 5ILSA 1K78B 1TQIA 4BQAA 3DF8A 2PMUA 1D8JA 3M1EA 2DW4A 1REPC 4NQWA 2XHKA 2PG4A 2QBYA 1R36A 1O3QA 4ZYDA 2VBYA 3EYIA 2HQRA 3LA2A 2W85A 1KU7A 2VXZA 3ML6A 1XSVA 4LLNA 4KN7X 1U5TA 2PQ8A 1D3YA 2YR2A 3B02A 5LRRA 3F3XA 4AIKA 2ZNZA 5CVIA 3F6OA 3BJ6A 2A6HF 4EJVA 1B9NA 1YO5C 4KMFA 2QYOA 4UUVA 5DDGA 3AAFA 2XUBA 4G6QA 5L3BA 2A07F 4G7ZF 3F6VA 1X3UA 1RZ4A 1TW2A 4HYEA 1FYMA 5D5XB 1ZLJA 4A0YA 3JTGA 5BOXA 3HTSB 1TTYA 3E6BA 5LLQA 3ZN0A 1FY7A 2BV6A 1T2KA 5JVTA 3KP4A 3QU3A 4MHGA 2RNJA 2QM3A 3IKTA 2CGPA 3E97A 2WC2A 4ESJA 2VT3A 5HLGA 1P4AA 2P8TA 1SD6A 3KLOA 3IL2A 3KEOA 1F5TA 5DUKA 2XASA 3Q9VA 1KA8A 3ABUA 1UHMA 3V7CA 3ERED 3HHHA 4CICA 2R7DA 3FMSA 1R23A 2VC0A 1YLFA 2TDXA 1QNTA 3BDDA 5LEKA 1B6AA 2GWRA 1ZAOA 2K27A 1ZLKA 3EDPA 5FFXA 5D5VB 4M71A 1XGNA 4L0YB 3E5XA 3GYHX 1TW3A 2BE5F 5F1RA 4A0XA 2IA2A 2HEOA 3LQRA 4IHTA 1HW5A 2FBKA 3CLOA 3PQKA 3EUHA 3I0TA 3R60A 2IRFG 4M74A 4GXOA 1YG2A 4EMSA 1BI1A 1USTA 3CUOA 3WE3A 2P4WA 5LGTA 1EH6A 1Z9CA 1KQ0A 4O5VA 4L9VA 2H94A 3ELKA 1KQ8A 4IXAA 2KJCA 4UV8A 1IRFA 2MA3A 1BI3A 3M7GA 3WTUC 5HS8A 1J5YA 2Y0MA 4UV9A 2HTJA 2MLGA 4BH9A 3BY6A 5E8IA 1QO0D 2DPDA 1MKMA 1BJAA 4PCQA 4GYIA 2K02A 3RTRA 3T8TA 1YQAA 2D1HA 3ZP5A 3JTHA 3J7AO 1DPUA 3D0SA 2VODA 4EM1A 2FBHA 5HDKA 2P5KA 2NRAC 2XIGA 4HX8A 4EGYA 2HFHA 5E1XA 3MFKA 1AWCA 4M6XA 2VOOA 4BXUA 1U2WA 4WXCA 4IRIA 4Q47A 5HLHA 5EEHA 2IJLA 1RUNA 1MGTA 5E8GA 5H6RA 5L3CA 3GWZA 4UVAA 1YTYA 2ZNYA 3FMQA 3QP5A 1MD0A 4M9SA 4KIFA 1IXSB 4ZYHA 4ESBA 1U5TB 1ON1A 2BYVE 1ZN2A 2JT1A 1J59A 3ZMUA 3KFWX 2FE3A 4I02A 1E17A 3I5UA 5DD4A 4WXHA 4WK8F 3L00A 3O3KA 5DYMA 1FYLA 3HSEA 2HYFA 2D2WA 1RNLA 2IA1A 1P6RA 2ZKZA 5AIPA 2QQAA 2VN2A 3E6DA 4FX4A 1T39A 3TO6A 2EV0A 2K7LA 1FP2A 2KIMA 2LNBA 1GHCA 2MH2A 5BS6A 2FXAA 3V8JA 4I09A 1XGMA 2DT5A 3P9CA 4D0PA 4FHTA 4UVBA 1MJ9A 1WKMA 1F4KA 2A68F 1JE8A 3C7JA 2FU4A 3B73A 2D1VA 1ZRCA 4CDGA 3J81K 2DQRA 4U7DA 4BHBA 4LB6B 4L18B 3W6KB 4IJAA 4YIIA 1DP7P 4RAZA 1VTNC 2HKXA 4JBAA 1J75A 1LDDA 2OU2A 4A5NA 5E18F 1S7OA 4PDKA 4RAYA 2ZXJA 5AONA 3RPQA 2HR3A 2K4BA 5F64A 5KK1A 4KT5C 2E7WA 4AIJA 2XAFA 1S8NA 2XKPA 1OYIA 4RB1A 3R61A 2CO5A 2F5CA 3NRVA 2EV5A 3IHUA 3RKYA 4BHCA 2YX7A 1T6SA 3V7SA 2EFPA 1XD7A 5LRSA 4HZFA 2DBBA 3FX3A 4A12A 1OPCA 1SD7A 5DCFA 3N97A 2O61A 4HQEA 2P6TA 3COAC 3HRMA 2HQNA 4AD9A 3U9GA 2KIUA 2VBXA 1BN5A 4EJOA 1OYYA 3TOAA 2R7FA 5ICCA 5LBQA 3KETA 1S7AA 3ZN1A 1JGSA 4HF1A 2W84A 4DQ2A 4IPAA 1CF7A 2RQPA 3KCCA 4P9FA 4U0WA 2VONA 1BBYA 2P6SA 4HAMA 5HLIA 2FMYA 3GFLA 3S2WA 1SD4A 2X4HA 2Q8KA
chains in the Genus database with same CATH superfamily
3JRFA 4OIQF 1FTZA 1HW2A 2COMA 5M5YJ 5K5RA 1MJAA 1J2XA 2YU3A 4XLCA 4BNCA 4G6DA 2QQ9A 3OS0A 1VQPI 4ITVA 4PJLA 4ENJA 2EA2A 2KDZA 2JA7J 5C4JJ 4BY1J 3ZCOA 1RUOA 1VF9A 3KYCB 1UHWA 2EILH 3FIWA 4XRSG 3WTSC 4IRGA 1IGNA 2O8XA 2ZMEC 1I3QJ 1QZEA 3OOUA 2LG4A 3BG5A 1HLVA 2ZFWA 1AKHA 3GFIA 2R5YA 2EINH 3OR1C 1HKTA 3DU5A 1A6QA 3KP3A 2RGVA 1XSXA 4GGGA 1R5HA 2EH3A 2UV1A 3AL0B 2DFFA 1O4XA 2FRHA 2Z5UA 3KZIC 3QP6A 2R92J 2LY9A 1LEAA 1MNDA 1R7JA 2CW7A 2K9LA 3QQAA 4HBLA 4Q4ZF 5D6FA 1RETA 1T38A 3R4KA 5CVVA 2HVSA 1UHSA 4E7IA 2XV4S 4F93B 1YW8A 4W97A 1YIOA 4HPQA 1R00A 1NG6A 1Z6RA 2I8DA 4C2TA 2JPBA 5C44J 1GT0C 2X1DA 2RC4A 3KE2A 4B4CA 2WAQA 4U87A 3CUQB 4RB3C 4RGXA 2Y2ZA 2B63J 1F9NA 3BLYA 3CO6C 4OIPF 4HV6A 4ASNA 2CUFA 4K2EA 5F1JA 2DMQA 3A1YA 2PN6A 4I99C 3E5UA 3AG4H 1Y1WJ 3H3ZA 3DEEA 3I4NJ 4L5JA 2VJ5A 4XOTA 2NS7A 3GX4X 4YIRX 1I1SA 1TWCJ 1YI2I 1IN8A 1XB4A 5DCMA 1MW7A 2R7OA 1G8XA 1LE8B 4XOPA 2CQNA 4XM3A 2M3AA 4LJZF 4BQNA 1JKQC 5FRMA 5FB2A 2M7AA 1MNMC 2WWYA 3G3ZA 1SFXA 1LFPA 1NHAA 3CESA 5FRNA 4P9UA 3SEQA 3H3VK 3TGNA 5GTIC 2X51A 1R1UA 2P7VB 2ZSIB 3GO5A 3MKWB 2M5WA 2RN7A 2LF8A 4DNCA 5FLMJ 3L2QA 3JAMZ 2DQLA 3JW4A 4CH7A 1QBJA 3LSTA 5M5WJ 3ASNH 4WCGA 2JA2A 2Z1DA 3CC2I 3K4LA 3PSIA 4F3QA 5CLSA 3GUDA 2LVSA 3PFIA 5HDNA 2OQRA 5E79C 1W7PA 3BG9A 1LB2A 1QZYA 2F48A 2GIZA 3JSPA 3HOXJ 2O8KA 1DP3A 2X6OA 3MZHA 5E1ZB 4D7MA 2VB6A 1T08B 3HOSA 4Y3OA 3L1PA 4G7OF 2ZXWH 2HPIA 2HTSA 1QQIA 1FP1D 3I53A 3BZCA 4HDVA 2CQ7A 1P7JA 2OCCH 2KLOA 2XDVA 3BPXA 4E7SA 3MWMA 3BG6A 3SHFA 5GADJ 5KVRA 2LOOA 3ZPLA 2IA0A 2LYCA 2OPTA 3OYCA 2O9LA 2ME0A 1FBQA 3FF5A 4ZTJA 1KYWA 2ZC2A 3ERMA 5K7HA 3MD2A 1CGPA 1BA5A 3LL7A 4UVCA 2Q2EB 2ZSHB 1HXDA 2BXZA 1O57A 2JWTA 3DCFA 2LD5A 4RBOA 4DYQA 3LA3A 1O3RA 1K6OA 4IHVA 2NVUB 4R79A 2DA1A 1BW5A 2M45A 4XSZF 2A69F 4GO1A 3D5RC 4HQMA 4UUTA 4ZDOA 2H8RA 4NDLA 1Y56A 3SZPA 4JK1X 2DOEA 1MBFA 1FOKA 2HVRA 4MEYF 2PMZA 2VKEA 3ZOBA 1SVLA 3H5RA 5IYBJ 1GDTA 3HC7A 4MGRA 2VPLA 2Z2SB 4G94A 4ZC3A 4KNYA 4HEA2 3DKXA 2BBYA 3GEZA 3ECHA 2KIQA 1BIBA 3BQYA 4B44A 3LSHA 3KP2A 1UFMA 4NNJA 4V19K 4FASD 2NS0A 3DKWA 1MMSA 5D8KB 4XL9A 3WE2A 2WV0A 3FXRA 1PUEE 1OCPA 3OOPA 2HDWA 4A6DA 2NAZA 3I59B 3WHBA 2WA0A 3IC7A 5EYRA 1UELB 5IYCJ 1YHQI 1P7IA 4HA8A 3V4GA 1ZGJA 4JQFA 4QSHA 4RAGA 3CO7C 2VQHA 2WY7Q 2W48A 1XGOA 5TJJA 3Q0WA 1D8KA 1WH7A 4FTHA 2EIMH 1ZRFA 1MDMA 1A04A 2RDPA 3RDIA 1SC7A 3OL3A 3R6SA 1ZELA 2ME6A 5LHGA 5F08A 1JGGA 4WWCA 1WRJA 4UNOA 4I2OA 4M6YA 1LNWA 2LBFB 3EUAA 2E5NA 2QVOA 1HKSA 3LSRA 5JLXA 1RI7A 2L4AA 3K9TA 2JRMA 1IUYA 2IS4A 1WSUA 1YS6A 1WI9A 2AXLA 2K3PA 1P9QC 4FISA 3TBIA 3CMEI 3QU6A 3S3MA 2E2IJ 3CZ6A 3V8LA 4FE7A 1IW7F 1BR2A 1QPIA 4MQVA 1VZ0A 1PUFA 4DZPA 1R5GA 4OAYA 4RS8A 2VT2A 3DPLC 1FBSA 3HUGA 4H0EA 3F23A 1BW6A 3MZYA 1BR4A 5TISC 3HB9A 1G2HA 2LSOA 2V1XA 4JP0A 3SZTA 4LG0A 1TQMA 2VQLA 4KITB 2C6YA 4J00A 5L3FA 2DDAA 2PFBA 1MJBA 5HVQC 1AOYA 1EV7A 2ID3A 2KJBA 4KFCA 4BHPA 1FC3A 3HRSA 2BY3A 3CMMA 4MNUA 4YEJA 1KU3A 2DFIA 2L4MA 2O7OA 5BPDA 3DPUA 1FOYA 2RAEA 2ZO4A 2OQGA 3OMYA 4CCLA 1ONVA 2TRTA 1APLC 3VDXA 4B09A 2V9KA 5H2FC 1NH3A 4Y7NJ 2M4GA 2V1NA 3OIQA 4I01A 5L3GA 4L5IA 2V7FA 1MH4A 2HZTA 2F5FA 3GW2A 1QPMA 3GXOA 3QYFA 1KQ9A 3BG3A 1VQLI 1H9GA 5DD8A 1AKHB 1J0RA 3FXUA 4ETSA 2R5YB 3IWFA 2B9SA 4MTDA 4N9IA 2XRLA 5ICEA 3GFMA 5EJCA 3P9IA 2V9PA 4E7JA 3GVAA 1QU3A 3PSFA 4CXFA 5DUIA 2ETHA 4YFXF 3Q9SA 4IKFA 2V6CA 2E1NA 3OYBA 3CJRB 3GTPJ 3JRAA 1FMWA 4C2MJ 1Y39A 2FOKA 3KZYA 1LFBA 2DMUA 2JA8J 5TRDA 3DTKA 4OOIA 3I55I 4IZZA 1UMQA 4CCMA 3K70C 2VKVA 2CUZA 1IF1A 1O3TA 3CF5F 2HOAA 5GPAA 1U78A 4HX7A 2A6TA 4S04A 3HTUA 2MC4A 4GCVA 2VI6A 5ILUA 2R7XA 4XONA 1FJLA 2XF7A 1S7EA 1BOBA 3RCOA 1W5TA 3BTCA 3R0AA 4BBSJ 1OCZH 1WQ2A 4LD5A 2EFOA 2QF7A 4P1WA 4IHWA 2HOEA 3PIOF 4BEHA 3FHZA 2MG4A 2L01A 5IP9J 1OCCH 1X19A 3OL4A 3TO9A 2K40A 1IN6A 2EK5A 1WI3A 4AYBN 2VE8A 2JUCA 1U6GA 3GFJA 4OMZA 2GOXB 1BI2A 1W1WE 4CCOA 5IP7J 2EWNA 2Z16A 4YIFA 3ZQLA 3BR2A 5GAEJ 2KIFA 4BBRJ 2KHMA 1Y8RB 2LK2A 1GXPA 1OKRA 1P92A 3K4JA 1AA7A 2BVLA 5LGNA 5DCMB 2W25A 2QBYB 1Y0UA 1YW9A 3ZMTA 3I64A 1TBXA 2M4KA 2Z33A 2F5VA 3FBIB 4NHJA 2BHZA 2EZKA 2DK8A 5D8LB 2CQXA 2KZGA 4JX4A 4I76A 1ZHFA 2M9HA 4YFNF 2ADUA 1MMDA 1YOVB 1FPQA 4MFEA 2R7WA 2Y48A 2CWEA 3CUQC 2CV1A 3OS2A 5ED4A 1XPXA 4D5CA 3BR6A 5ERIA 1HBXG 2QSFX 1KYZA 2WY8Q 4AIDA 2FBIA 3B6CA 4PUSA 3GTLJ 4C3HJ 2QSHX 1JHHA 2RREA 1W7PB 2VKDA 3D1NI 2BOLA 2R7RA 2HQ5A 2XAUA 2CFOA 2A5WA 1R6RA 2DJIA 1S72I 1OFCX 4KUMA 1K78A 4EJTA 2Q1ZB 2IW5A 3A4CA 3C2HA 4LLGF 2STTA 3S2DJ 2X48A 4ABZA 2HGCA 2VIXA 4PJ0C 2QLZA 3TO7A 1XTAA 3QOPA 1MBKA 3N4MA 4F92B 3QRFF 4KDPA 1UB9A 2JZYA 3ZMVA 5LGUA 1FIPA 2DCEA 1W7PD 4P55A 3BQZA 4FT8A 1ZG5A 3GLLA 2LC2A 1OLTA 1KONA 3VYSB 3BJAA 2FF4A 3I71A 3VEPA 1WJBA 2VBZA 2CRGA 4BY7J 1MSEC 3ZMSA 1H9TA 3BCBA 3HOTA 4HNTA 3KP7A 2ZBKA 3ROUA 3X2QH 2LR8A 3QYEA 1HA8A 1OISA 2HDCA 2PJPA 4CO8A 4IHXA 5CKTA 2DMPA 4BU2A 3BOQA 4D5FA 2W57A 4G6TB 4OMYA 5LHIA 5BQTA 2CU7A 1SEUA 2ESNA 1WJ5A 4XBFA 1T0FC 2DTRA 2P81A 4ZDPA 2O3FA 2QGUA 2W4SA 2CH0A 3JRCA 5BNGA 2VOPA 3H92A 3CCUI 1T0FA 5K5OA 3QOEA 2WADA 2EFNA 5AIQA 2L7FP 2X9DA 2MABA 3P5JA 2LY1A 3V7RA 2YS9A 1ITYA 1MNEA 4DGWB 1ZK8A 2M1BA 3DP7A 1J09A 2A61A 3CJQB 4O6JA 3HSFA 2DMTA 3BWGA 3LOCA 2Z99A 2XROA 4Q5SF 3U21A 1LUJB 1IDYA 4RAFA 1FT9A 4E70A 2L7ZA 1JT0A 1MBJA 4BGDA 2XKOA 3K0LA 3Q3SA 1W4MA 2M87A 2HNHA 3DBRB 4UHTA 4ZZDA 2PJRA 2IS1A 4NUBA 4BE1A 1SVMA 2K9NA 3DQVC 3VB2A 3ABMH 4J01A 3T0YA 4AM3A 2A5YB 4LMYA 1Z0XA 2YX4A 1TT5B 3OYHA 1S3JA 1DGRM 3MEXA 4LG3A 5B1BH 5B66C 5J1UA 1TQPA 3PM1A 3AFHA 4XICA 2G7UA 3SDGA 3GTOJ 5E3LA 1MDMB 2V9VA 3OYDA 1O7LA 2JPCA 3WTZA 2IEKA 1AHDP 2ZCWA 3M4OJ 4I0AA 4HLYA 4EJUA 3PQJA 4DOZA 5FLVA 2R7ZJ 1VQ5I 3ULQB 1ZQ3P 3GTQJ 3RKWA 2CFXA 3CCRI 4LB5A 1E3HA 4L9JA 3DXJF 2FMLA 2V1DA 2BHYA 1IXCA 1QHHD 1TLHB 2EV6A 1X3WB 2ELKA 2GA1A 5LHHA 1TWGJ 1MH3A 3CCVI 2E60A 4Y33A 1YYVA 2X6XA 3HRUA 4UUSA 3IUOA 4XLPF 2WTEA 2B0LA 4U0VA 4DJAA 1R58A 2M2EA 4M3GA 4HW0A 2OAZA 4Y17A 1EJ9A 1PUFB 2XGXA 3REOA 3TKYA 3A01A 2KRFA 2XAGA 1IRGA 5IP6A 3HUGB 1ZG3A 3DKYA 4ZYGA 4PFPA 3TW6A 1DU0A 3LSGA 3WODF 2R3SA 5EG0A 2OC6A 2HOTA 1BC7C 4LG0B 2LRDA 2G7HA 2E19A 4YELA 4PZJA 3HPGA 2OZUA 5CJ9A 4GDFA 2DOAA 1UG2A 3W3CA 3CDHA 2MC3A 3IP4B 4C30A 2HPMA 2UXNA 1OCOH 3NQOA 2X0LA 4RB2C 4C9YA 4M9XA 4CA0A 1D1BA 3LQQA 3D5LA 4EATA 1NK3P 5FFZA 3VSKA 3S32A 2FNPA 2DODA 4HV5A 2QUFA 3GZ6A 1WGXA 3CCQI 1TT0A 1MZBA 2K9SA 2Y69H 4RGRA 4EV0A 3TMOA 2A3SA 2ISYA 5FROA 1QVTA 3S93A 2E2HJ 2DA6A 3I58A 2XAJA 2FQ3A 1ZRDA 5E17F 2HZDA 3LAJA 1JUMA 1IAWA 2GOMA 1XS9A 3A02A 3L09A 2A6EF 1U8BA 3F21A 5JLWA 2E2JJ 2UWMA 2W7NA 2J5PA 3DLAA 3M3YJ 5K1YA 4Y4RA 1JT6A 3T5XA 3A03A 2O5RA 2F4IA 2E35A 2IGNA 2V1UA 4KMUX 3TP0A 4KIGA 4QWQA 2PX9A 3BC8A 2IGOA 4XRFA 3CP8A 4IQJA 3H9GA 2OUMA 1BR1A 2DDBA 1I6XA 3K4KA 1RPWA 2KL4A 1HW1A 4RLFA 3KX2A 1FNNA 2ZMEA 1R49A 2IXSA 1V5FA 1E2XA 4A2UA 4KIBA 2GAUA 2L9RA 3L2WA 2AHQA 2CW0F 5IPAA 2VJIA 2IP2A 5JFRA 1DDNA 4KISA 2MD5A 1S9HA 3MAJA 2HKOA 4RDUA 1TP4A 2FD5A 2ELHA 3GF2A 3IAM2 4PGHA 4U88A 3E6MA 4BEHB 4PSXA 4F91B 1GVJA 1VNDA 3MCZA 2NVQJ 2JA6J 2XF5A 4ON0A 5JI6A 3GZNB 4EQQA 1P2FA 3G73A 3ZR8X 5EDNA 4D7NA 1Z1DA 4HG2A 1IZ1A 1Z3YA 1QVUA 4MQ9F 1DUXC 3HOVJ 2I10A 1DU6A 1VQ4I 2FEZA 3JAMK 2O6GE 4B47A 3QAHA 2COBA 5JR3A 3QODA 1V54H 3M8EA 5HDGA 3RZDJ 2UZKA 3W6VA 1JUSA 2O03A 1X1BA 3KEQA 4WXDA 4F55A 1ZREA 1UJ8A 4A6EA 4TV7A 1FMVA 1Q1HA 3L7WA 3S2HJ 3O8HA 4M73A 3GCMA 1HSJA 5J8CA 4IRHA 1IDZA 4QPQA 2EFQA 2H6BA 4Z6YA 4O3MA 3RI4A 1G3WA 4BQQA 2GLOA 5CYVA 2NXNB 1I5ZA 1FIAA 3Q0UA 1HQCA 2QWWA 3F72A 5EEGA 1LFUP 1L3LA 4A0ZA 2IGMA 1LKXA 4AC0A 4M3BA 1YJ9I 3ZQFA 4KA4A 1TWFJ 3RSNA 1XGSA 2LF7A 5E3MA 2W00A 1JTXA 4B3AA 2WB1N 2YUSA 2Y75A 4XQFA 2PMHA 1SFUA 1P4WA 1ON2A 3GMEA 1LJ9A 3LFKA 5JHFA 4IHYA 2VE9A 3E5QA 3WTVC 1ZG1A 1R1TA 2NNNA 2VJ4A 4M72A 3P7NA 1JHFA 1V4RA 1P4XA 3C18A 4WF2A 1ZGAA 1LVKA 5A2QZ 1K4TA 1K79A 5D6EA 1DGWY 4WX9A 4MEXF 2MLKA 3J7AY 1S6LA 3OYJA 3WTTC 2QSGX 4AYBA 2FA5A 4EM2A 1LVAA 1Z05A 3SXYA 2QA4I 2PI0A 2LDUA 4G8XA 1U5TC 2ZXIA 3G1MA 5B3SH 3PNVA 2GXGA 2RKHA 3FXQA 3C1DA 3S1MJ 2R0QC 2ZJRF 1STZA 4CUGA 3GTMJ 2Y0SA 4KN4X 1ZR4A 2ELJA 3ZMDA 1IN5A 3EETA 5HNHA 1OMIA 5EF6A 4FQGA 3G6EI 2ISZA 5HNFA 5F0CA 4OIOF 4XLFA 1G3YA 4ZH4F 4RGSA 5KHDA 4R8HA 4NB5A 1MIJA 1Y6IA 3J80Z 4S0HB 5CVUA 3OYFA 1IV6A 2VQGA 3PO2J 1N78A 3OSGA 2P5LC 2DT6A 2E1CA 2EB7A 2E7XA 2P0WA 3F8CA 4XLEA 2VKHA 3FKJA 2XPWA 1X2NA 2JVGA 1ORKA 2W82A 1UAAA 2IT0A 2F4OB 5GTHC 4YG2F 5IY5H 5L3DA 4BXXJ 4H4KC 1ETYA 2G9WA 4Z2YA 3TDUC 1FYKA 1IRXA 2AS5F 1U0JA 4BACA 2ZXHA 3WU2C 5IT9K 2ZJ2A 2CMPA 2OZ6A 2JUGA 1TZLA 3WGGA 1OYWA 4HX4A 2ACJA 2M30A 2DU9A 5DV5A 2DTZA 5FD6A 2HQAA 2E1OA 2EZHA 2HXOA 2DA5A 5D5WB 4B1RA 1WVRA 3OYIA 1QGPA 1IN4A 1R1VA 2P5VA 4HSTA 2E1MC 4P96A 5BPIA 1Z67A 2B7EA 2XVCA 3FXOA 3ABLH 2RVCA 3DV8A 4RGUA 1QZZA 4AWXB 1PP7U 4EJWA 4CHUA 4LLLA 1S29A 3I4PA 1G3SA 2IVMA 1BC8C 2L9SA 1D0XA 2XGCA 2VLAA 3OYEA 2CJJA 4UXNA 1FSHA 2W24A 2L3DA 2DAOA 3PL8A 3H9JA 4HOBA 2MH9A 3TQNA 2H6CA 3HSRA 3IAS2 4ZYEA 5KCMA 3ASOH 2L54A 3BTIA 1VQOI 1T98A 5FGMA 4KT6A 3GTJJ 3SFIA 1PP8F 4ZJZA 5ILVA 4UUSB 4YFKF 2VBWA 4DW6A 5C3EJ 1EH7A 3OWTA 1BJZA 3G2BA 2R5ZA 2KISA 4LOCA 3BCAA 4HDUA 4BE0A 1RR8C 1KU2A 3L9FA 3A01B 2MD0A 1B59A 1X2MA 3IKVA 5IT9Z 2RQQA 2X6YA 4ENNA 2CQKA 1B8IB 2ICWG 3BR0A 1HSTA 2XAQA 3IWZA 3HKZN 3G4SI 5EG0B 3OYLA 2QQ8A 2GXBA 4E4HA 1EH8A 4CZZA 2LKPA 5GAHJ 4B43A 2HS5A 5FD5A 1J9IA 4LFUA 1CF7B 1I27A 3CMAI 3QWLA 3L2CA 4XLHA 1B9MA 2M8EA 3TW7A 2YU9J 2X1EA 2IPQX 1FEXA 3O2PE 5DEQA 3RKXA 3H3UA 1SAXA 3FK6A 4QPOA 2DMNA 5M3FJ 1ZTRA 3BR5A 5CVRA 2Q0OA 2Z3YA 3S1RJ 1IXRC 1XCVA 3LSJA 1FWZA 2JRTA 2UXXA 5H20A 1XDSA 2XRNA 1SMYF 5L3EA 5HOOA 3WU1B 2Y9ZA 5D4SA 1XSDA 1R4MB 4CYDA 4IL6C 4HF0A 1ETWA 3OIPA 2K9MA 4N0BA 5E1WA 2H1KA 5DTDA 2YSRA 4PSWA 2DO7A 4CYCA 5J8FA 4X0GA 4OINF 2QEXI 5M5XJ 1WWXA 5B1AH 1N77A 2EIJH 1G3TA 4FETA 3SFZA 1YE9A 3ZQQA 1EA3A 4DZJA 5DM7F 1U3EM 1K4SA 4N4OB 1XDUA 1ZYRF 2M7BA 3BZ6A 3RYPA 1G59A 4BAYA 2JA5J 4IF4A 3PJRA 2ZMEB 3JRHA 1X4OA 3GBGA 4NC7A 4U0YA 1CQTA 4L5EA 3I4MJ 2E36A 4LK1F 3I56I 3DEUA 5FO5A 1SMTA 2BW3A 2QENA 3NEUA 3WHCA 3FK7A 3JSOA 1B1BA 4E7KA 3GTGJ 1G6NA 3S3NA 3A0BC 2K9QA 2Y9YA 5IYDJ 5DM6F 4L0ZB 4GYGA 3KLNA 2K4JA 3FXMA 1LQ1A 1H0MA 2AQFA 3CC7I 1TL8A 1BIAA 4PK4A 3RIRA 1JJ6C 1F43A 1GV2A 2J5OA 2YPRA 2BY2A 1XMKA 2FSWA 4D9JA 4IOAF 1ZH5A 3JREA 4IHSA 3OV8A 2R7TA 1H88C 3AG2H 3IH4A 4LGWA 2E71A 5J4YA 2FQ4A 5EZHA 1F1ZA 2W1OA 2E5ZA 1IV8A 2CSOA 2HYGD 2KKOA 4XN0A 3VOEA 1K7AA 4FE4A 3W6JB 2QQBA 3CJNA 1YJNI 3CLQA 2NYXA 3DU6A 4LK0F 2JSCA 2HWVA 3FBNB 2H27A 5FKNA 3RKQA 4G9YA 3ABKH 3AL0C 3CQZJ 2QKMB 1I1GA 5LEJA 1B4AA 1WJCA 3QYBA 5J1RA 3F9KA 3PUFA 1YS7A 4IQ4A 1W5SA 1R22A 2PBIA 3VYUB 3U2RA 4A5MA 1GUUA 3ZQHA 2OA4A 3BTLA 3QPSA 2R7UA 1IC8A 1FOXA 1G4DA 3IRRA 4XR6A 5M3MJ 2MYSA 1Z7LA 2ZB9A 2BEOA 2V79A 1LDKB 3MQ0A 3K1MA 4W1UA 4NC6A 3ZQGA 3VODA 3MKYB 4ENMA 3VFZA 2OBPA 2EZLA 3HHGA 1D1AA 4XKBA 2LP0A 3IRQA 4I98B 2NVTJ 2WAFA 1V3FA 3T8RA 1C0WA 3UR3C 4BL0B 3CUQA 1J7KA 2CG4A 4P5OA 4M6VA 3LSPA 4A3IJ 1USSA 4PGGA 4F7ZA 3TEDA 4MIMA 1Z3XA 1VQ8I 3ZMZA 3LSIA 1U9OA 2DI3A 3M8FA 2GIVA 4UB6C 4S05A 4EVIA 3WG9A 3TOBA 4A3GJ 2OF7A 1JXSA 1K6YA 3PO3J 4G7HF 1RIOH 4U7BA 2VC1A 4B8XA 3DLLF 1BM9A 5KNLA 4JYKA 2NVXJ 4PJJA 1NTCA 3NAUA 3WU0A 3WTWC 1XN7A 5H6QA 3WGIA 4J19A 4KICA 5J40A 3HL2A 4IO9F 1Z7UA 4EM0B 1ZR2A 4R1HA 1ODDA 2JQ7A 3CTAA 4CGZA 3S17J 4XSXF 3E7LA 1XMAA 1FSEA 4A3EJ 3OR2C 3TL4X 3VYTB 5D5UB 3KEYA 4BJ6C 3G71I 3G1OA 1YW7A 3FKIJ 1HF0A 3KP6A 2H09A 3K1PA 4Q48A 2EA4A 3F8BA 4LIVA 5GAGJ 3S16J 3K4NA 3CCSI 3JR9A 5FLXK 5KAFC 1I39A 2WB1A 2R93J 3FMRA 4XLNF 3LMMA 3EQLF 3ESWB 3RQIA 2HDDA 1PYVA 1KU9A 3LA7A 2CYYA 2DYSH 2OV7A 3ABTA 4UB8C 4XIDA 1ZARA 1OR7C 1SD5A 3E3VA 5FKOA 2P7CB 4DYCA 3HDDA 2VL8A 2Y30A 2GZWA 3S14J 1JTYA 5GPCA 2M0CA 3L2VA 1ETQA 2DPUA 3HYIA 4OU0A 3WTXC 1OR7A 5IT3A 3KZZA 2EFWA 2JTVA 4Y13A 3TDZC 1XC5A 3BJOA 1O3SA 4ENKA 4E6KG 4XLAA 3CDIA 3F8FA 2DFEA 4BYYA 2Q2EA 3J7ZI 3K69A 1JKPC 3HXLA 3R0JA 1RRJA 2V6EA 3M9AA 4L9NA 3IH2A 1UCRA 3HRTA 3V42A 3F8NA 3BPVA 2OJED 2WBMA 5HS7A 4I7HA 4XRSA 4A3JJ 2R5ZB 4JX6A 3K2AA 4KYWA 1MBHA 3PFYA 3T1BA 4BKXA 4CCKA 2KRHA 3HZJA 3PNTA 4ESFA 4XN3A 5FLXZ 2DOFA 5JHUA 4OIRF 1PDNC 1TWAJ 1FTTA 1BOAA 4JX5A 2F2EA 3HPHA 4MO7A 4C2UA 5F6FA 2ZFUA 2EJRA 1FZPB 1SANA 3F0CA 2NNYA 2K5CA 3KP5A 3I54A 1F36A 6PAXA 4ZTFA 3V8KA 3H5NA 3CCMI 4EGZA 2LKXA 3K2ZA 1KGSA 2GQQA 3J81Z 2X6WA 5CVJA 3SDBA 4MTEA 3RYRA 3I59A 3QPHA 3CCLI 1HKQA 3NARA 4FX0A 5J47A 5D4RA 2STWA 3BROA 4AIHA 5J6XA 2OD5A 2BXYA 3HBLA 3GZ5A 1FX7A 3C3WA 1ULYA 2FNAA 5BMZA 2PEXA 2XF6A 4IVNA 1OCTC 1LEBA 2K3FA 5IOYA 1Z91A 3QPLA 4QLCU 4DIQA 1E3OC 1LDJA 1V55H 2ESHA 1X1PA 2LBFA 3QPTA 1TNTA 4CYCB 1XX5A 1ZKGA 1FBUA 4HRIA 3HOYJ 2IBDA 2L02A 3H5AA 5F27A 2E34A 1L0OC 3FM3A 1HCRA 2RV8A 2DLLA 2K86A 2RNGA 3F8MA 5E20A 2WAEA 3U1DA 3WTYC 9ANTA 3GLXA 3WGHA 5HS9A 1EF4A 2ZJPF 2DFHA 2GA2A 4HLXA 3F22A 1NG7A 3JRGA 4C3IJ 3FM5A 4IEJA 1Z6TA 3HIFA 2Z9OA 2BW3B 2DK5A 2FUG2 1H89C 1D5YA 3ZQIA 3FZVA 5F04A 3K1NA 4IX7A 3DFGA 2BZTA 4L9TA 4A69C 2BGCA 4HF2A 1QHGA 2LKSA 3EPZA 2DA4A 4RM3A 3BP8A 3NWSA 3IH3A 2D45A 1OJLA 1HC8A 4I6ZA 1GLNA 3HJEA 3HOZJ 1BI0A 5CQGA 3SQNA 1SFEA 3K4MA 3VSLA 2HYJA 3ISPA 4BDYA 1Z77A 3LWFA 3ZQ7A 2MBFA 3K70D 3SYTA 4E7HA 1KZHA 5JVGF 3DPTA 3O6BB 2L9VA 3LAPA 1UG0A 4N9HA 2PLYA 2F5EA 1A31A 4XKVA 1YFHA 3VYRB 1IUFA 1FLIA 2KQRA 1HOMA 1RKWA 3RPUA 3RJPA 4ZZLA 2HXIA 3P9KA 4FCYA 2CS3A 5A2QK 1YX5A 2XSDC 4AVPA 4RB0A 4M9ZA 1DPRA 1V5GA 2FOWA 3OS1A 3ECOA 3FWEA 5ICGA 1N25A 2MGQA 3H0GJ 1GXQA 2JMWA 4I0BA 1U8RA 2XGDA 5ICFA 1TNSA 2F5DA 4XRMA 2XAHA 3JRBA 1SFKA 3CCEI 2DT7B 1IN7A 2DA7A 2MFZA 4B3XA 3E6CC 3DWLE 2TCTA 2X85A 1POGA 3Q5FA 2KMUA 3EYYA 4Y15A 3K7AJ 4CCNA 3CMYA 3LSKA 1Y8QB 2QZ8A 1MSFC 1O7FA 5K5QA 3J80K 4QIWN 1MBGA 3BR1A 2O0YA 5E3NA 3OYAA 1D5VA 1YIJI 1ETKA 2OTJI 1VQ6I 1XCBA 5ILSA 1ACIA 1K78B 1TQIA 2KP6A 4OWRB 4BQAA 4PJMA 3DF8A 1VQ7I 4A3BJ 3JRDA 4ANJA 2PMUA 5E3OA 3M1EA 1D8JA 2DN0A 3KIOA 2DW4A 2Y31A 1REPC 2OTLI 4NQWA 2XHKA 4II3A 2PG4A 3S8PA 2QBYA 2FX0A 1ETOA 2UUZA 1R36A 1O3QA 4ZYDA 2BY1A 2VBYA 3ONQA 2M0MA 1FOWA 2ECCA 3PUBA 5EEAA 3EYIA 2HQRA 3M8JA 2IS6A 4A3DJ 2AO9A 3LA2A 4YRVA 1A35A 1A36A 3OYNA 1WH5A 3CCJI 2W85A 3CD6I 1KU7A 2V26A 3KPHA 2VXZA 3ML6A 1XSVA 4E7LA 2CV2A 4LLNA 4KN7X 4AVZA 1U5TA 2PQ8A 1D3YA 2YR2A 3B02A 3E0JB 2JN6A 4XORA 5LRRA 3F3XA 5KAIC 4AIKA 2HVQA 3N05A 3CF2A 2FJ1A 1HDPA 2ZNZA 5CVIA 3F6OA 3W2AA 3BJ6A 2A6HF 4LITA 4EJVA 1B9NA 1YO5C 3ZRGA 2GM4A 4KMFA 3S3OA 1V5EA 2BY0A 1JKRC 2QYOA 4UUVA 5DDGA 3NWTA 3AAFA 3A2KA 1U9NA 2XUBA 4G6QA 3UKGA 4F52A 4MLOA 1Z21A 5L3BA 2A07F 4G7ZF 3F6VA 1X3UA 4XK4A 3G1LA 4BQOA 1D1CA 1RZ4A 1W36C 1TW2A 1MMAA 4HYEA 1FYMA 5D5XB 2CV0A 5B5EC 2PJRB 1ZLJA 2K85A 4A0YA 2DXIA 4M3FA 3JTGA 1SVOA 1XG1A 5BOXA 3HTSB 1TTYA 3E6BA 5LLQA 3ZN0A 4X1EA 1FY7A 2BV6A 4N4NB 1T2KA 2VUMJ 3OIOA 5JVTA 3KP4A 2L5QA 1OQYA 2L0KA 3QU3A 3LFUA 2KPMA 2VXDA 4MHGA 5EGOA 2RNJA 4GFBA 2QM3A 3IKTA 2CGPA 3E97A 2WC2A 5GP9A 3HGGA 4ESJA 1YRNA 4A3FJ 4NBQA 2VT3A 5HLGA 1P4AA 3OY9A 3ZXSA 1WJAA 2P8TA 3LSMA 3M07A 1EKEA 1SD6A 3KLOA 3IL2A 4ZDLA 5CQEA 1IO2A 2L9NA 3KEOA 1JKOC 1F5TA 5DUKA 2I5UA 2XASA 2NS8A 2NVYJ 5FKLA 3Q9VA 5CPRB 5LFAA 1KA8A 3ABUA 4BXFA 1UHMA 2F4MB 3C2GA 3HOUJ 4V2FA 3H1CA 2L2OA 4DBRA 2DYRH 1MBEA 4QTRA 3CJTB 3V7CA 1E3PA 3A0HC 4XMYA 3I9V2 3ERED 1S5LC 3MN2A 2KT0A 4DBQA 2LMDA 3GTKJ 3HHHA 4CICA 2R7DA 3FMSA 5K7FA 1T8IA 1ERDA 2KRCA 3JCUC 1R23A 3Q0VA 2VC0A 1I6HJ 1A6IA 1YLFA 1MMNA 4JOMA 1DQUA 2TDXA 1QNTA 3BDDA 4CZCA 1YJWI 2VQCA 5LEKA 4IOCF 1B6AA 2GWRA 1ZAOA 2K27A 1ZLKA 3DEWA 2VPRA 1PVEA 3EDPA 3O8GA 5FFXA 4XKCA 3CP2A 4B48A 5D5VB 4M71A 5FJ8J 3VWBA 1GV5A 1D0YA 4Y52J 3TP3A 1XGNA 3WG7H 2R4GA 4L0YB 3E5XA 2H8WA 2LFBA 5J3LA 1IRZA 1K61A 3GYHX 1TW3A 4X6AJ 2L7KA 2BE5F 3H36A 2EBIA 3K4CA 2JVHA 5F1RA 4A0XA 2IA2A 3BT9A 2HEOA 3B6AA 2BVMA 1WHUA 1M1EB 2XGEA 2L7MP 3LQRA 3EUHC 4CCJA 2XC7A 4IHTA 2IAIA 1D0ZA 1HW5A 2FBKA 3CLOA 1VI0A 3PQKA 3EUHA 3I0TA 3J7YJ 3FXKA 4BS9A 3ZQCA 3R60A 4E7ZA 1B72A 2LREA 4BDZA 1X1CA 1JJ8C 4BJ5C 1ENHA 2IRFG 2R7SA 3C2BA 1BL0A 4M74A 4GXOA 1YG2A 4EMSA 2DA2A 2LTPA 1BI1A 2ZJQF 5DS9A 1USTA 3CUOA 3WE3A 2P4WA 4PJNA 1GVDA 5LGTA 1T33A 4MFDA 3EUKL 1EH6A 1Z9CA 2WAQN 3D5SC 2A05A 3K4BA 1KQ0A 4O5VA 4L9VA 3BZKA 2H94A 1X4PA 3ELKA 1KQ8A 4IXAA 2KJCA 4UV8A 2R7VA 2EPFA 4A3KJ 2QKLB 2CQQA 1IRFA 2MA3A 3BTJA 4M3DA 4RA2A 1BI3A 3M7GA 5TGTA 1WCMJ 2CW8A 5F0FA 1A5JA 3WTUC 1RC9A 1W0TA 3FDYA 1K83J 5HS8A 3OSFA 1JI8A 1J5YA 2Y0MA 2ID6A 4UV9A 2HTJA 2N8GA 2MLGA 4BH9A 3RZOJ 3BY6A 5LD2C 5E8IA 1QO0D 3AG3H 2DPDA 2DJNA 4HNVA 4AU7A 3CCYA 1MKMA 1BJAA 4PCQA 2GXAA 4RLQA 4GYIA 2K02A 3RPUD 1TWHJ 3OYKA 4ZYAA 3MMYB 3RTRA 1SAUA 3T8TA 1VQ9I 3PNYA 1YQAA 2WV1A 2D1HA 4A3CJ 1VQNI 3ZP5A 3JTHA 3J7AO 2JSPA 1DPUA 3FXJA 1IJWC 1VFCA 3D0SA 2VODA 2NOJB 4EM1A 2FBHA 3CDLA 1T56A 5HDKA 1R9TJ 2P5KA 2VASA 1X1AA 4M3EA 2NRAC 2EQRA 2XIGA 3K10A 5HODA 1VQMI 2OCEA 4HX8A 4EGYA 1YITI 2HFHA 1QRYA 2H1LA 5E1XA 3MFKA 4NQWB 2Y0SN 1WJEA 4BUPA 3W2VA 1AWCA 4M6XA 2VOOA 2EIKH 4BXUA 1U2WA 3AG1H 4WXCA 4CSWA 4IRIA 4Q47A 5HLHA 5EEHA 2IJLA 1Y1VJ 1RUNA 2XPVA 4BE2A 3SZGA 1MGTA 1I3AA 5E8GA 5H6RA 5L3CA 5F0HA 3FHNA 3GWZA 4UVAA 1YTYA 2ZNYA 2KZVA 3FMQA 3QP5A 2HU9A 4G12A 3MKZA 1MD0A 2V4JC 4M9SA 1RR7A 4PFOA 4HNUA 4KIFA 1LPQA 1IXSB 4ZYHA 4ESBA 1NK2P 1WFXA 1MMGA 3U1KA 1U5TB 1ON1A 2BYVE 1ZN2A 4AUXA 2JT1A 5J4VA 5HLTA 2VJJA 1J59A 1T95A 3JRIA 5J1YA 3ZMUA 1LE8A 3KFWX 2FE3A 4I02A 1E17A 2HOSA 4RMNA 3I5UA 2MSYA 5DD4A 4WXHA 4WK8F 3PIPF 2JJ7A 3L00A 3O3KA 5DYMA 1H8AC 3HG9A 3DTEA 3HSEA 2PMZN 1FYLA 2HYFA 1WJDA 2F6CA 1RNLA 2D2WA 2IA1A 1P6RA 3S1NJ 2ZKZA 5AIPA 2QQAA 1WPKA 2VN2A 3E6DA 4FX4A 1T39A 2XB5A 3TO6A 2EV0A 4UY8I 2K7LA 1FP2A 2KIMA 2LNBA 1GHCA 2MH2A 3IV5A 5BS6A 3OYGA 2FXAA 1E0EA 1QA6A 3L2RA 3V8JA 1Q1VA 4GRIA 2AQEA 1XGMA 2DT5A 2LLKA 4I09A 3P9CA 1ETXA 1R71A 4D0PA 3DBHB 4FHTA 4HSRA 4UVBA 1MJ9A 1OCRH 2IGKA 3HGYA 1WKMA 2HI3A 3FISA 4OAZA 1F4KA 3SEZA 2A68F 1JE8A 2X1CA 4EEFG 3C7JA 3ZGKA 2FU4A 2E1MB 5EGOB 4D1QA 1W36D 3B73A 2D1VA 3K6GA 3DTIA 4XNFA 4A93J 1TC3C 2EZIA 3BG7A 1ZRCA 4CDGA 2DA3A 3J81K 1YRNB 3KYLA 2DQRA 3CC4I 3RQ4A 4U7DA 4BHBA 3E1SA 4DYRA 4LB6B 4L18B 3W6KB 4IJAA 4YIIA 1DP7P 3M1CA 4RAZA 2M8GX 4KJZA 4II2A 1X58A 3SJMA 1VTNC 2CUJA 1ZGWA 2HKXA 3HEFA 4JBAA 1J75A 1LDDA 2OU2A 5C4XJ 1WZ2A 1YX3A 4A5NA 1X1DA 1WJFA 3MVPA 5E18F 1S7OA 1Y0NA 4PDKA 3UNGC 4RAYA 2ZXJA 4A3LJ 5AONA 3RPQA 3KYDB 1X3ZB 2CUEA 1W5CC 2HR3A 2K4BA 5F64A 5KK1A 1PJRA 1UZCA 3OYMA 4KT5C 2E7WA 4AIJA 3I3LA 4LIUA 2LY2A 3FXLA 2XAFA 4V2GA 1XMXA 1S8NA 2XKPA 2XPUA 1IG7A 1OYIA 4RB1A 3R61A 1AU7A 2CO5A 3H0DA 2AXTC 2F5CA 3NRVA 2EV5A 2XB0X 3IHUA 4BJTA 1W0UA 3S1QJ 2GBYA 2R7QA 3RKYA 4BHCA 2YX7A 1T6SA 3V7SA 3W2WA 1R4NB 2EFPA 4A3MJ 1XD7A 5LRSA 2G0EA 4HZFA 2DBBA 3FX3A 3BR3A 5IOZA 2KFDA 4A12A 2ECBA 1OPCA 1SD7A 1HDDC 3S15J 5DCFA 3N97A 2O61A 2IS2A 1R5ID 3VPRA 1SFOJ 2D5VA 4HQEA 2P6TA 3COAC 3HRMA 2HQNA 4AD9A 3U9GA 4RM2A 2KIUA 5FKKA 3HOWJ 1ETVA 2VBXA 1BN5A 2QCOA 4EJOA 1B8IA 1OYYA 3TOAA 1VQKI 3LNQA 2R7FA 2XSJC 5ICCA 1B72B 5LBQA 3KETA 1S7AA 2NOGA 3AKZA 1I50J 3ZN1A 4C3JJ 1JGSA 2KDOA 3H35A 4HF1A 1RESA 2W84A 4DQ2A 5FKMA 4IPAA 1CF7A 3MKLA 2RQPA 5K7ZA 2JK3A 3KCCA 5EZGA 1JUPA 2M34A 3H9QA 3L2UA 4P9FA 4U0WA 2MW8A 3HM5A 2VONA 1BBYA 2P6SA 3HKZA 1RKTA 2LH9A 3MZ8A 4HAMA 5HLIA 2FMYA 4XKWA 3GFLA 4NC8A 1N75A 3S2WA 3DBLB 1SD4A 2X4HA 2Q8KA
chains in the Genus database with same CATH topology
4OIQF 1HW2A 2COMA 5K5RA 1MJAA 1J2XA 2YU3A 4BNCA 4G6DA 2QQ9A 4ENJA 2EA2A 1RUOA 3WTSC 1UHWA 4IRGA 2O8XA 2ZFWA 3GFIA 1HKTA 3KP3A 2RGVA 1XSXA 4GGGA 1R5HA 2FRHA 2Z5UA 3QP6A 1LEAA 1R7JA 4HBLA 4Q4ZF 5D6FA 1T38A 3R4KA 5CVVA 2XV4S 1YW8A 1YIOA 1R00A 1Z6RA 2JPBA 2RC4A 3KE2A 3CUQB 4RB3C 4RGXA 1F9NA 3CO6C 4OIPF 4HV6A 4ASNA 4K2EA 2PN6A 3E5UA 3H3ZA 4L5JA 3GX4X 1I1SA 1IN8A 1XB4A 5DCMA 4LJZF 5FB2A 2WWYA 3G3ZA 1SFXA 1NHAA 4P9UA 3TGNA 3GO5A 1R1UA 2P7VB 2M5WA 2RN7A 2LF8A 4DNCA 3JAMZ 2DQLA 3JW4A 1QBJA 3LSTA 4WCGA 5CLSA 3GUDA 3PFIA 2OQRA 1W7PA 1LB2A 1QZYA 3JSPA 3MZHA 5E1ZB 3HOSA 4G7OF 2HTSA 1QQIA 1FP1D 3I53A 4HDVA 3BPXA 3MWMA 3SHFA 3ZPLA 5KVRA 2IA0A 1FBQA 3FF5A 1KYWA 1CGPA 4UVCA 1HXDA 1O57A 3LA3A 1O3RA 1K6OA 4R79A 2M45A 4XSZF 2A69F 4GO1A 4HQMA 3SZPA 4JK1X 1FOKA 4MEYF 4MGRA 4G94A 4KNYA 2BBYA 3GEZA 3ECHA 1BIBA 3KP2A 1UFMA 2NS0A 3DKWA 5D8KB 3WE2A 2WV0A 3FXRA 1PUEE 3OOPA 4A6DA 2NAZA 3I59B 3IC7A 3V4GA 4HA8A 1ZGJA 4JQFA 3CO7C 1XGOA 5TJJA 1D8KA 1ZRFA 1MDMA 1A04A 2RDPA 3RDIA 3R6SA 5LHGA 4WWCA 1WRJA 4UNOA 4I2OA 4M6YA 1LNWA 2QVOA 1HKSA 1RI7A 2L4AA 3K9TA 1IUYA 1WSUA 1YS6A 1WI9A 2AXLA 3QU6A 3V8LA 1IW7F 4MQVA 4RS8A 1R5GA 4H0EA 3HUGA 2VT2A 1FBSA 3DPLC 3F23A 3MZYA 2LSOA 2V1XA 3SZTA 4LG0A 1TQMA 2C6YA 5L3FA 2PFBA 1MJBA 5HVQC 1AOYA 1EV7A 2KJBA 4KFCA 4BHPA 1FC3A 3HRSA 4MNUA 1KU3A 2DFIA 2L4MA 5BPDA 2ZO4A 2OQGA 1ONVA 4B09A 4I01A 5L3GA 4L5IA 2HZTA 2F5FA 3GW2A 1QPMA 3GXOA 1KQ9A 1H9GA 5DD8A 1J0RA 3FXUA 4ETSA 3IWFA 4MTDA 4N9IA 5ICEA 3GFMA 3P9IA 3GVAA 4CXFA 5DUIA 2ETHA 4YFXF 3Q9SA 2V6CA 2E1NA 2FOKA 3KZYA 5TRDA 4OOIA 1IF1A 1O3TA 1U78A 4HX7A 4S04A 3HTUA 4GCVA 5ILUA 1W5TA 3R0AA 1WQ2A 4LD5A 2EFOA 2HOEA 3FHZA 2L01A 3TO9A 1IN6A 2EK5A 2VE8A 1U6GA 3GFJA 4OMZA 1BI2A 2EWNA 4YIFA 2KIFA 1GXPA 1OKRA 1P92A 5LGNA 5DCMB 2W25A 2QBYB 1Y0UA 1YW9A 3ZMTA 3I64A 1TBXA 2Z33A 4NHJA 2DK8A 5D8LB 1ZHFA 4YFNF 2ADUA 1FPQA 2Y48A 2CWEA 3CUQC 5ED4A 5ERIA 1HBXG 1KYZA 2FBIA 1JHHA 1W7PB 1K78A 4EJTA 4KUMA 2IW5A 4LLGF 2STTA 2HGCA 2QLZA 3TO7A 3QOPA 3N4MA 3QRFF 4KDPA 1UB9A 2JZYA 5LGUA 3ZMVA 4P55A 1ZG5A 1W7PD 4FT8A 3BJAA 2FF4A 3I71A 3VEPA 2VBZA 3ZMSA 1H9TA 3HOTA 3KP7A 2ZBKA 3ROUA 2HDCA 2PJPA 4CO8A 3BOQA 2W57A 4OMYA 5LHIA 5BQTA 2ESNA 4XBFA 2DTRA 2O3FA 2VOPA 3H92A 1T0FA 5K5OA 2EFNA 5AIQA 3V7RA 2M1BA 3DP7A 2A61A 4O6JA 3HSFA 2XROA 3BWGA 4Q5SF 2Z99A 1FT9A 4E70A 2XKOA 3K0LA 1W4MA 2M87A 4UHTA 4ZZDA 3VB2A 3DQVC 3T0YA 2A5YB 4LMYA 2YX4A 1S3JA 3MEXA 1TQPA 2G7UA 1MDMB 2V9VA 1O7LA 2JPCA 3WTZA 2ZCWA 4I0AA 4HLYA 4EJUA 3PQJA 3ULQB 3RKWA 2CFXA 4LB5A 4L9JA 3DXJF 2FMLA 2V1DA 1IXCA 1TLHB 2EV6A 2GA1A 5LHHA 5HDNA 1YYVA 3HRUA 4XLPF 2WTEA 2B0LA 4U0VA 1R58A 4HW0A 2OAZA 4Y17A 2XGXA 3REOA 3TKYA 2KRFA 2XAGA 1IRGA 1ZG3A 4ZYGA 3WODF 2R3SA 1BC7C 4LG0B 2G7HA 4PZJA 2OZUA 5CJ9A 3CDHA 2MC3A 2UXNA 3NQOA 4RB2C 2X0LA 4M9XA 3LQQA 3D5LA 5FFZA 2FNPA 4HV5A 3GZ6A 2QUFA 1MZBA 4RGRA 4EV0A 2A3SA 2ISYA 5E17F 3I58A 2XAJA 2FQ3A 1ZRDA 3LAJA 1IAWA 3L09A 2A6EF 3F21A 2UWMA 2J5PA 5K1YA 3T5XA 2V1UA 4KMUX 4KIGA 4QWQA 4XRFA 1I6XA 1HW1A 1FNNA 2ZMEA 1E2XA 4A2UA 4KIBA 2GAUA 2CW0F 2IP2A 5JFRA 1DDNA 2MD5A 3MAJA 2HKOA 4PGHA 2ELHA 3GF2A 4U88A 3E6MA 1GVJA 3MCZA 4ON0A 5JI6A 4EQQA 1P2FA 3G73A 1Z1DA 1DUXC 1IZ1A 4MQ9F 2O6GE 2FEZA 3JAMK 3QAHA 5JR3A 3M8EA 5HDGA 2UZKA 2O03A 3KEQA 4WXDA 1ZREA 4A6EA 4TV7A 1Q1HA 3L7WA 4M73A 1HSJA 5J8CA 4IRHA 2EFQA 2H6BA 4O3MA 3RI4A 1G3WA 5CYVA 1I5ZA 1HQCA 2QWWA 3F72A 5EEGA 1L3LA 4A0ZA 4KA4A 1XGSA 2LF7A 2Y75A 2PMHA 1SFUA 1P4WA 1ON2A 1LJ9A 3LFKA 2VE9A 3E5QA 3WTVC 1ZG1A 1R1TA 2NNNA 4M72A 3P7NA 1JHFA 1V4RA 1P4XA 3C18A 5A2QZ 1ZGAA 4WF2A 1K79A 5D6EA 4WX9A 4MEXF 2MLKA 1S6LA 3WTTC 4EM2A 2FA5A 1LVAA 1Z05A 3SXYA 2PI0A 2LDUA 4G8XA 1U5TC 2GXGA 2RKHA 3FXQA 3C1DA 1STZA 4KN4X 3ZMDA 1IN5A 3EETA 1OMIA 2ISZA 4OIOF 4ZH4F 1G3YA 4RGSA 4R8HA 4NB5A 3J80Z 5CVUA 2P5LC 2E1CA 2EB7A 2E7XA 3F8CA 2IT0A 4YG2F 5L3DA 4Z2YA 2G9WA 3TDUC 1FYKA 2AS5F 5IT9K 2ZJ2A 2OZ6A 3WGGA 1OYWA 4HX4A 2ACJA 2M30A 2DU9A 5DV5A 5FD6A 5D5WB 1QGPA 1IN4A 1R1VA 2P5VA 5BPIA 4P96A 2XVCA 2RVCA 3DV8A 4RGUA 1QZZA 4AWXB 1PP7U 4EJWA 4CHUA 4LLLA 1S29A 3I4PA 1G3SA 2IVMA 1BC8C 1FSHA 4UXNA 2W24A 2L3DA 2DAOA 4HOBA 2MH9A 3TQNA 2H6CA 3HSRA 4ZYEA 2L54A 1T98A 5FGMA 1PP8F 5ILVA 4YFKF 2VBWA 1EH7A 4HDUA 1KU2A 3L9FA 1B59A 3IKVA 5IT9Z 4ENNA 2CQKA 1HSTA 2XAQA 3IWZA 2GXBA 1EH8A 4CZZA 2LKPA 2HS5A 5FD5A 1J9IA 4LFUA 1CF7B 1I27A 3L2CA 1B9MA 2M8EA 2IPQX 3O2PE 5DEQA 3RKXA 3H3UA 1SAXA 5CVRA 2Q0OA 2Z3YA 1IXRC 1XCVA 1FWZA 2JRTA 2UXXA 5H20A 1XDSA 2XRNA 1SMYF 5L3EA 5HOOA 3WU1B 5D4SA 1XSDA 4CYDA 4HF0A 4N0BA 5E1WA 2YSRA 2DO7A 5J8FA 4OINF 1WWXA 1G3TA 3SFZA 1U3EM 1XDUA 1ZYRF 3BZ6A 3RYPA 4BAYA 4IF4A 2ZMEB 4U0YA 4LK1F 3DEUA 5FO5A 1SMTA 2QENA 3NEUA 3JSOA 1B1BA 1G6NA 4L0ZB 4GYGA 3KLNA 2K4JA 1LQ1A 1H0MA 1BIAA 3RIRA 2J5OA 2YPRA 1XMKA 2FSWA 1ZH5A 4IHSA 3OV8A 4LGWA 1F1ZA 2CSOA 2HYGD 2KKOA 3VOEA 1K7AA 3W6JB 2QQBA 3CJNA 4LK0F 2NYXA 2JSCA 2HWVA 2H27A 4G9YA 1I1GA 5LEJA 1B4AA 1YS7A 1W5SA 1R22A 2PBIA 3U2RA 4A5MA 2OA4A 1G4DA 3IRRA 2BEOA 2V79A 1LDKB 3MQ0A 3K1MA 3VODA 4ENMA 3VFZA 2OBPA 3HHGA 3IRQA 4I98B 1V3FA 3T8RA 1C0WA 3CUQA 1J7KA 2CG4A 4P5OA 1USSA 4PGGA 4F7ZA 3ZMZA 2DI3A 3M8FA 2GIVA 4S05A 4EVIA 3WG9A 3TOBA 1JXSA 4G7HF 1RIOH 4U7BA 2VC1A 4B8XA 1BM9A 3WU0A 3WTWC 1XN7A 5H6QA 3WGIA 4KICA 1Z7UA 4EM0B 4R1HA 1ODDA 4CGZA 3CTAA 4XSXF 1XMAA 1FSEA 5D5UB 1YW7A 3KP6A 2H09A 3K1PA 4Q48A 2EA4A 3F8BA 5FLXK 3FMRA 4XLNF 3EQLF 1KU9A 3LA7A 2CYYA 3ABTA 1ZARA 1SD5A 2P7CB 3E3VA 2GZWA 2DPUA 3HYIA 4OU0A 3WTXC 1OR7A 5IT3A 3KZZA 2EFWA 2JTVA 4Y13A 3TDZC 3BJOA 1O3SA 4ENKA 3F8FA 4BYYA 2Q2EA 3K69A 3R0JA 3M9AA 4L9NA 1UCRA 3HRTA 3F8NA 3BPVA 5HS7A 4I7HA 4KYWA 3T1BA 4ESFA 5FLXZ 5JHUA 4OIRF 1PDNC 1BOAA 2F2EA 5F6FA 2EJRA 1FZPB 2NNYA 3KP5A 3I54A 6PAXA 3V8KA 4EGZA 3K2ZA 1KGSA 2GQQA 3J81Z 5CVJA 4MTEA 3RYRA 3I59A 3QPHA 1HKQA 4FX0A 5D4RA 2STWA 3BROA 4AIHA 5J6XA 2OD5A 3GZ5A 1FX7A 3C3WA 1ULYA 2FNAA 5BMZA 2PEXA 4IVNA 1LEBA 1Z91A 4QLCU 1LDJA 2ESHA 3QPTA 1TNTA 1FBUA 2L02A 1L0OC 3FM3A 2RV8A 2DLLA 2K86A 3F8MA 5E20A 3U1DA 3WTYC 3GLXA 3WGHA 5HS9A 2GA2A 4HLXA 3F22A 3FM5A 1Z6TA 3HIFA 2Z9OA 2DK5A 3FZVA 3K1NA 3DFGA 4L9TA 2BGCA 4HF2A 3BP8A 2D45A 1BI0A 3SQNA 1SFEA 3ISPA 3LWFA 3ZQ7A 2MBFA 3DPTA 3O6BB 3LAPA 4N9HA 2PLYA 2F5EA 1YFHA 1FLIA 3RPUA 3RJPA 4ZZLA 3P9KA 5A2QK 4AVPA 4RB0A 4M9ZA 1DPRA 3ECOA 3FWEA 5ICGA 1U8RA 1GXQA 4I0BA 5ICFA 1TNSA 2F5DA 2XAHA 1IN7A 3E6CC 3Q5FA 3EYYA 4Y15A 2QZ8A 1O7FA 5K5QA 3J80K 2O0YA 1D5VA 1XCBA 5ILSA 1K78B 1TQIA 4BQAA 3DF8A 2PMUA 1D8JA 3M1EA 2DW4A 1REPC 4NQWA 2XHKA 2PG4A 2QBYA 1R36A 1O3QA 4ZYDA 2VBYA 3EYIA 2HQRA 3LA2A 2W85A 1KU7A 2VXZA 3ML6A 1XSVA 4LLNA 4KN7X 1U5TA 2PQ8A 1D3YA 2YR2A 3B02A 5LRRA 3F3XA 4AIKA 2ZNZA 5CVIA 3F6OA 3BJ6A 2A6HF 4EJVA 1B9NA 1YO5C 4KMFA 2QYOA 4UUVA 5DDGA 3AAFA 2XUBA 4G6QA 5L3BA 2A07F 4G7ZF 3F6VA 1X3UA 1RZ4A 1TW2A 4HYEA 1FYMA 5D5XB 1ZLJA 4A0YA 3JTGA 5BOXA 3HTSB 1TTYA 3E6BA 5LLQA 3ZN0A 1FY7A 2BV6A 1T2KA 5JVTA 3KP4A 3QU3A 4MHGA 2RNJA 2QM3A 3IKTA 2CGPA 3E97A 2WC2A 4ESJA 2VT3A 5HLGA 1P4AA 2P8TA 1SD6A 3KLOA 3IL2A 3KEOA 1F5TA 5DUKA 2XASA 3Q9VA 1KA8A 3ABUA 1UHMA 3V7CA 3ERED 3HHHA 4CICA 2R7DA 3FMSA 1R23A 2VC0A 1YLFA 2TDXA 1QNTA 3BDDA 5LEKA 1B6AA 2GWRA 1ZAOA 2K27A 1ZLKA 3EDPA 5FFXA 5D5VB 4M71A 1XGNA 4L0YB 3E5XA 3GYHX 1TW3A 2BE5F 5F1RA 4A0XA 2IA2A 2HEOA 3LQRA 4IHTA 1HW5A 2FBKA 3CLOA 3PQKA 3EUHA 3I0TA 3R60A 2IRFG 4M74A 4GXOA 1YG2A 4EMSA 1BI1A 1USTA 3CUOA 3WE3A 2P4WA 5LGTA 1EH6A 1Z9CA 1KQ0A 4O5VA 4L9VA 2H94A 3ELKA 1KQ8A 4IXAA 2KJCA 4UV8A 1IRFA 2MA3A 1BI3A 3M7GA 3WTUC 5HS8A 1J5YA 2Y0MA 4UV9A 2HTJA 2MLGA 4BH9A 3BY6A 5E8IA 1QO0D 2DPDA 1MKMA 1BJAA 4PCQA 4GYIA 2K02A 3RTRA 3T8TA 1YQAA 2D1HA 3ZP5A 3JTHA 3J7AO 1DPUA 3D0SA 2VODA 4EM1A 2FBHA 5HDKA 2P5KA 2NRAC 2XIGA 4HX8A 4EGYA 2HFHA 5E1XA 3MFKA 1AWCA 4M6XA 2VOOA 4BXUA 1U2WA 4WXCA 4IRIA 4Q47A 5HLHA 5EEHA 2IJLA 1RUNA 1MGTA 5E8GA 5H6RA 5L3CA 3GWZA 4UVAA 1YTYA 2ZNYA 3FMQA 3QP5A 1MD0A 4M9SA 4KIFA 1IXSB 4ZYHA 4ESBA 1U5TB 1ON1A 2BYVE 1ZN2A 2JT1A 1J59A 3ZMUA 3KFWX 2FE3A 4I02A 1E17A 3I5UA 5DD4A 4WXHA 4WK8F 3L00A 3O3KA 5DYMA 1FYLA 3HSEA 2HYFA 2D2WA 1RNLA 2IA1A 1P6RA 2ZKZA 5AIPA 2QQAA 2VN2A 3E6DA 4FX4A 1T39A 3TO6A 2EV0A 2K7LA 1FP2A 2KIMA 2LNBA 1GHCA 2MH2A 5BS6A 2FXAA 3V8JA 4I09A 1XGMA 2DT5A 3P9CA 4D0PA 4FHTA 4UVBA 1MJ9A 1WKMA 1F4KA 2A68F 1JE8A 3C7JA 2FU4A 3B73A 2D1VA 1ZRCA 4CDGA 3J81K 2DQRA 4U7DA 4BHBA 4LB6B 4L18B 3W6KB 4IJAA 4YIIA 1DP7P 4RAZA 1VTNC 2HKXA 4JBAA 1J75A 1LDDA 2OU2A 4A5NA 5E18F 1S7OA 4PDKA 4RAYA 2ZXJA 5AONA 3RPQA 2HR3A 2K4BA 5F64A 5KK1A 4KT5C 2E7WA 4AIJA 2XAFA 1S8NA 2XKPA 1OYIA 4RB1A 3R61A 2CO5A 2F5CA 3NRVA 2EV5A 3IHUA 3RKYA 4BHCA 2YX7A 1T6SA 3V7SA 2EFPA 1XD7A 5LRSA 4HZFA 2DBBA 3FX3A 4A12A 1OPCA 1SD7A 5DCFA 3N97A 2O61A 4HQEA 2P6TA 3COAC 3HRMA 2HQNA 4AD9A 3U9GA 2KIUA 2VBXA 1BN5A 4EJOA 1OYYA 3TOAA 2R7FA 5ICCA 5LBQA 3KETA 1S7AA 3ZN1A 1JGSA 4HF1A 2W84A 4DQ2A 4IPAA 1CF7A 2RQPA 3KCCA 4P9FA 4U0WA 2VONA 1BBYA 2P6SA 4HAMA 5HLIA 2FMYA 3GFLA 3S2WA 1SD4A 2X4HA 2Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIQ F;  1HW2 A;  2COM A;  5K5R A;  1MJA A;  1J2X A;  2YU3 A;  4BNC A;  4G6D A;  2QQ9 A;  4ENJ A;  2EA2 A;  1RUO A;  3WTS C;  1UHW A;  4IRG A;  2O8X A;  2ZFW A;  3GFI A;  1HKT A;  3KP3 A;  2RGV A;  1XSX A;  4GGG A;  1R5H A;  2FRH A;  2Z5U A;  3QP6 A;  1LEA A;  1R7J A;  4HBL A;  4Q4Z F;  5D6F A;  1T38 A;  3R4K A;  5CVV A;  2XV4 S;  1YW8 A;  1YIO A;  1R00 A;  1Z6R A;  2JPB A;  2RC4 A;  3KE2 A;  3CUQ B;  4RB3 C;  4RGX A;  1F9N A;  3CO6 C;  4OIP F;  4HV6 A;  4ASN A;  4K2E A;  2PN6 A;  3E5U A;  3H3Z A;  4L5J A;  3GX4 X;  1I1S A;  1IN8 A;  1XB4 A;  5DCM A;  4LJZ F;  5FB2 A;  2WWY A;  3G3Z A;  1SFX A;  1NHA A;  4P9U A;  3TGN A;  3GO5 A;  1R1U A;  2P7V B;  2M5W A;  2RN7 A;  2LF8 A;  4DNC A;  3JAM Z;  2DQL A;  3JW4 A;  1QBJ A;  3LST A;  4WCG A;  5CLS A;  3GUD A;  3PFI A;  2OQR A;  1W7P A;  1LB2 A;  1QZY A;  3JSP A;  3MZH A;  5E1Z B;  3HOS A;  4G7O F;  2HTS A;  1QQI A;  1FP1 D;  3I53 A;  4HDV A;  3BPX A;  3MWM A;  3SHF A;  3ZPL A;  5KVR A;  2IA0 A;  1FBQ A;  3FF5 A;  1KYW A;  1CGP A;  4UVC A;  1HXD A;  1O57 A;  3LA3 A;  1O3R A;  1K6O A;  4R79 A;  2M45 A;  4XSZ F;  2A69 F;  4GO1 A;  4HQM A;  3SZP A;  4JK1 X;  1FOK A;  4MEY F;  4MGR A;  4G94 A;  4KNY A;  2BBY A;  3GEZ A;  3ECH A;  1BIB A;  3KP2 A;  1UFM A;  2NS0 A;  3DKW A;  5D8K B;  3WE2 A;  2WV0 A;  3FXR A;  1PUE E;  3OOP A;  4A6D A;  2NAZ A;  3I59 B;  3IC7 A;  3V4G A;  4HA8 A;  1ZGJ A;  4JQF A;  3CO7 C;  1XGO A;  5TJJ A;  1D8K A;  1ZRF A;  1MDM A;  1A04 A;  2RDP A;  3RDI A;  3R6S A;  5LHG A;  4WWC A;  1WRJ A;  4UNO A;  4I2O A;  4M6Y A;  1LNW A;  2QVO A;  1HKS A;  1RI7 A;  2L4A A;  3K9T A;  1IUY A;  1WSU A;  1YS6 A;  1WI9 A;  2AXL A;  3QU6 A;  3V8L A;  1IW7 F;  4MQV A;  4RS8 A;  1R5G A;  4H0E A;  3HUG A;  2VT2 A;  1FBS A;  3DPL C;  3F23 A;  3MZY A;  2LSO A;  2V1X A;  3SZT A;  4LG0 A;  1TQM A;  2C6Y A;  5L3F A;  2PFB A;  1MJB A;  5HVQ C;  1AOY A;  1EV7 A;  2KJB A;  4KFC A;  4BHP A;  1FC3 A;  3HRS A;  4MNU A;  1KU3 A;  2DFI A;  2L4M A;  5BPD A;  2ZO4 A;  2OQG A;  1ONV A;  4B09 A;  4I01 A;  5L3G A;  4L5I A;  2HZT A;  2F5F A;  3GW2 A;  1QPM A;  3GXO A;  1KQ9 A;  1H9G A;  5DD8 A;  1J0R A;  3FXU A;  4ETS A;  3IWF A;  4MTD A;  4N9I A;  5ICE A;  3GFM A;  3P9I A;  3GVA A;  4CXF A;  5DUI A;  2ETH A;  4YFX F;  3Q9S A;  2V6C A;  2E1N A;  2FOK A;  3KZY A;  5TRD A;  4OOI A;  1IF1 A;  1O3T A;  1U78 A;  4HX7 A;  4S04 A;  3HTU A;  4GCV A;  5ILU A;  1W5T A;  3R0A A;  1WQ2 A;  4LD5 A;  2EFO A;  2HOE A;  3FHZ A;  2L01 A;  3TO9 A;  1IN6 A;  2EK5 A;  2VE8 A;  1U6G A;  3GFJ A;  4OMZ A;  1BI2 A;  2EWN A;  4YIF A;  2KIF A;  1GXP A;  1OKR A;  1P92 A;  5LGN A;  5DCM B;  2W25 A;  2QBY B;  1Y0U A;  1YW9 A;  3ZMT A;  3I64 A;  1TBX A;  2Z33 A;  4NHJ A;  2DK8 A;  5D8L B;  1ZHF A;  4YFN F;  2ADU A;  1FPQ A;  2Y48 A;  2CWE A;  3CUQ C;  5ED4 A;  5ERI A;  1HBX G;  1KYZ A;  2FBI A;  1JHH A;  1W7P B;  1K78 A;  4EJT A;  4KUM A;  2IW5 A;  4LLG F;  2STT A;  2HGC A;  2QLZ A;  3TO7 A;  3QOP A;  3N4M A;  3QRF F;  4KDP A;  1UB9 A;  2JZY A;  5LGU A;  3ZMV A;  4P55 A;  1ZG5 A;  1W7P D;  4FT8 A;  3BJA A;  2FF4 A;  3I71 A;  3VEP A;  2VBZ A;  3ZMS A;  1H9T A;  3HOT A;  3KP7 A;  2ZBK A;  3ROU A;  2HDC A;  2PJP A;  4CO8 A;  3BOQ A;  2W57 A;  4OMY A;  5LHI A;  5BQT A;  2ESN A;  4XBF A;  2DTR A;  2O3F A;  2VOP A;  3H92 A;  1T0F A;  5K5O A;  2EFN A;  5AIQ A;  3V7R A;  2M1B A;  3DP7 A;  2A61 A;  4O6J A;  3HSF A;  2XRO A;  3BWG A;  4Q5S F;  2Z99 A;  1FT9 A;  4E70 A;  2XKO A;  3K0L A;  1W4M A;  2M87 A;  4UHT A;  4ZZD A;  3VB2 A;  3DQV C;  3T0Y A;  2A5Y B;  4LMY A;  2YX4 A;  1S3J A;  3MEX A;  1TQP A;  2G7U A;  1MDM B;  2V9V A;  1O7L A;  2JPC A;  3WTZ A;  2ZCW A;  4I0A A;  4HLY A;  4EJU A;  3PQJ A;  3ULQ B;  3RKW A;  2CFX A;  4LB5 A;  4L9J A;  3DXJ F;  2FML A;  2V1D A;  1IXC A;  1TLH B;  2EV6 A;  2GA1 A;  5LHH A;  5HDN A;  1YYV A;  3HRU A;  4XLP F;  2WTE A;  2B0L A;  4U0V A;  1R58 A;  4HW0 A;  2OAZ A;  4Y17 A;  2XGX A;  3REO A;  3TKY A;  2KRF A;  2XAG A;  1IRG A;  1ZG3 A;  4ZYG A;  3WOD F;  2R3S A;  1BC7 C;  4LG0 B;  2G7H A;  4PZJ A;  2OZU A;  5CJ9 A;  3CDH A;  2MC3 A;  2UXN A;  3NQO A;  4RB2 C;  2X0L A;  4M9X A;  3LQQ A;  3D5L A;  5FFZ A;  2FNP A;  4HV5 A;  3GZ6 A;  2QUF A;  1MZB A;  4RGR A;  4EV0 A;  2A3S A;  2ISY A;  5E17 F;  3I58 A;  2XAJ A;  2FQ3 A;  1ZRD A;  3LAJ A;  1IAW A;  3L09 A;  2A6E F;  3F21 A;  2UWM A;  2J5P A;  5K1Y A;  3T5X A;  2V1U A;  4KMU X;  4KIG A;  4QWQ A;  4XRF A;  1I6X A;  1HW1 A;  1FNN A;  2ZME A;  1E2X A;  4A2U A;  4KIB A;  2GAU A;  2CW0 F;  2IP2 A;  5JFR A;  1DDN A;  2MD5 A;  3MAJ A;  2HKO A;  4PGH A;  2ELH A;  3GF2 A;  4U88 A;  3E6M A;  1GVJ A;  3MCZ A;  4ON0 A;  5JI6 A;  4EQQ A;  1P2F A;  3G73 A;  1Z1D A;  1DUX C;  1IZ1 A;  4MQ9 F;  2O6G E;  2FEZ A;  3JAM K;  3QAH A;  5JR3 A;  3M8E A;  5HDG A;  2UZK A;  2O03 A;  3KEQ A;  4WXD A;  1ZRE A;  4A6E A;  4TV7 A;  1Q1H A;  3L7W A;  4M73 A;  1HSJ A;  5J8C A;  4IRH A;  2EFQ A;  2H6B A;  4O3M A;  3RI4 A;  1G3W A;  5CYV A;  1I5Z A;  1HQC A;  2QWW A;  3F72 A;  5EEG A;  1L3L A;  4A0Z A;  4KA4 A;  1XGS A;  2LF7 A;  2Y75 A;  2PMH A;  1SFU A;  1P4W A;  1ON2 A;  1LJ9 A;  3LFK A;  2VE9 A;  3E5Q A;  3WTV C;  1ZG1 A;  1R1T A;  2NNN A;  4M72 A;  3P7N A;  1JHF A;  1V4R A;  1P4X A;  3C18 A;  5A2Q Z;  1ZGA A;  4WF2 A;  1K79 A;  5D6E A;  4WX9 A;  4MEX F;  2MLK A;  1S6L A;  3WTT C;  4EM2 A;  2FA5 A;  1LVA A;  1Z05 A;  3SXY A;  2PI0 A;  2LDU A;  4G8X A;  1U5T C;  2GXG A;  2RKH A;  3FXQ A;  3C1D A;  1STZ A;  4KN4 X;  3ZMD A;  1IN5 A;  3EET A;  1OMI A;  2ISZ A;  4OIO F;  4ZH4 F;  1G3Y A;  4RGS A;  4R8H A;  4NB5 A;  3J80 Z;  5CVU A;  2P5L C;  2E1C A;  2EB7 A;  2E7X A;  3F8C A;  2IT0 A;  4YG2 F;  5L3D A;  4Z2Y A;  2G9W A;  3TDU C;  1FYK A;  2AS5 F;  5IT9 K;  2ZJ2 A;  2OZ6 A;  3WGG A;  1OYW A;  4HX4 A;  2ACJ A;  2M30 A;  2DU9 A;  5DV5 A;  5FD6 A;  5D5W B;  1QGP A;  1IN4 A;  1R1V A;  2P5V A;  5BPI A;  4P96 A;  2XVC A;  2RVC A;  3DV8 A;  4RGU A;  1QZZ A;  4AWX B;  1PP7 U;  4EJW A;  4CHU A;  4LLL A;  1S29 A;  3I4P A;  1G3S A;  2IVM A;  1BC8 C;  1FSH A;  4UXN A;  2W24 A;  2L3D A;  2DAO A;  4HOB A;  2MH9 A;  3TQN A;  2H6C A;  3HSR A;  4ZYE A;  2L54 A;  1T98 A;  5FGM A;  1PP8 F;  5ILV A;  4YFK F;  2VBW A;  1EH7 A;  4HDU A;  1KU2 A;  3L9F A;  1B59 A;  3IKV A;  5IT9 Z;  4ENN A;  2CQK A;  1HST A;  2XAQ A;  3IWZ A;  2GXB A;  1EH8 A;  4CZZ A;  2LKP A;  2HS5 A;  5FD5 A;  1J9I A;  4LFU A;  1CF7 B;  1I27 A;  3L2C A;  1B9M A;  2M8E A;  2IPQ X;  3O2P E;  5DEQ A;  3RKX A;  3H3U A;  1SAX A;  5CVR A;  2Q0O A;  2Z3Y A;  1IXR C;  1XCV A;  1FWZ A;  2JRT A;  2UXX A;  5H20 A;  1XDS A;  2XRN A;  1SMY F;  5L3E A;  5HOO A;  3WU1 B;  5D4S A;  1XSD A;  4CYD A;  4HF0 A;  4N0B A;  5E1W A;  2YSR A;  2DO7 A;  5J8F A;  4OIN F;  1WWX A;  1G3T A;  3SFZ A;  1U3E M;  1XDU A;  1ZYR F;  3BZ6 A;  3RYP A;  4BAY A;  4IF4 A;  2ZME B;  4U0Y A;  4LK1 F;  3DEU A;  5FO5 A;  1SMT A;  2QEN A;  3NEU A;  3JSO A;  1B1B A;  1G6N A;  4L0Z B;  4GYG A;  3KLN A;  2K4J A;  1LQ1 A;  1H0M A;  1BIA A;  3RIR A;  2J5O A;  2YPR A;  1XMK A;  2FSW A;  1ZH5 A;  4IHS A;  3OV8 A;  4LGW A;  1F1Z A;  2CSO A;  2HYG D;  2KKO A;  3VOE A;  1K7A A;  3W6J B;  2QQB A;  3CJN A;  4LK0 F;  2NYX A;  2JSC A;  2HWV A;  2H27 A;  4G9Y A;  1I1G A;  5LEJ A;  1B4A A;  1YS7 A;  1W5S A;  1R22 A;  2PBI A;  3U2R A;  4A5M A;  2OA4 A;  1G4D A;  3IRR A;  2BEO A;  2V79 A;  1LDK B;  3MQ0 A;  3K1M A;  3VOD A;  4ENM A;  3VFZ A;  2OBP A;  3HHG A;  3IRQ A;  4I98 B;  1V3F A;  3T8R A;  1C0W A;  3CUQ A;  1J7K A;  2CG4 A;  4P5O A;  1USS A;  4PGG A;  4F7Z A;  3ZMZ A;  2DI3 A;  3M8F A;  2GIV A;  4S05 A;  4EVI A;  3WG9 A;  3TOB A;  1JXS A;  4G7H F;  1RIO H;  4U7B A;  2VC1 A;  4B8X A;  1BM9 A;  3WU0 A;  3WTW C;  1XN7 A;  5H6Q A;  3WGI A;  4KIC A;  1Z7U A;  4EM0 B;  4R1H A;  1ODD A;  4CGZ A;  3CTA A;  4XSX F;  1XMA A;  1FSE A;  5D5U B;  1YW7 A;  3KP6 A;  2H09 A;  3K1P A;  4Q48 A;  2EA4 A;  3F8B A;  5FLX K;  3FMR A;  4XLN F;  3EQL F;  1KU9 A;  3LA7 A;  2CYY A;  3ABT A;  1ZAR A;  1SD5 A;  2P7C B;  3E3V A;  2GZW A;  2DPU A;  3HYI A;  4OU0 A;  3WTX C;  1OR7 A;  5IT3 A;  3KZZ A;  2EFW A;  2JTV A;  4Y13 A;  3TDZ C;  3BJO A;  1O3S A;  4ENK A;  3F8F A;  4BYY A;  2Q2E A;  3K69 A;  3R0J A;  3M9A A;  4L9N A;  1UCR A;  3HRT A;  3F8N A;  3BPV A;  5HS7 A;  4I7H A;  4KYW A;  3T1B A;  4ESF A;  5FLX Z;  5JHU A;  4OIR F;  1PDN C;  1BOA A;  2F2E A;  5F6F A;  2EJR A;  1FZP B;  2NNY A;  3KP5 A;  3I54 A;  6PAX A;  3V8K A;  4EGZ A;  3K2Z A;  1KGS A;  2GQQ A;  3J81 Z;  5CVJ A;  4MTE A;  3RYR A;  3I59 A;  3QPH A;  1HKQ A;  4FX0 A;  5D4R A;  2STW A;  3BRO A;  4AIH A;  5J6X A;  2OD5 A;  3GZ5 A;  1FX7 A;  3C3W A;  1ULY A;  2FNA A;  5BMZ A;  2PEX A;  4IVN A;  1LEB A;  1Z91 A;  4QLC U;  1LDJ A;  2ESH A;  3QPT A;  1TNT A;  1FBU A;  2L02 A;  1L0O C;  3FM3 A;  2RV8 A;  2DLL A;  2K86 A;  3F8M A;  5E20 A;  3U1D A;  3WTY C;  3GLX A;  3WGH A;  5HS9 A;  2GA2 A;  4HLX A;  3F22 A;  3FM5 A;  1Z6T A;  3HIF A;  2Z9O A;  2DK5 A;  3FZV A;  3K1N A;  3DFG A;  4L9T A;  2BGC A;  4HF2 A;  3BP8 A;  2D45 A;  1BI0 A;  3SQN A;  1SFE A;  3ISP A;  3LWF A;  3ZQ7 A;  2MBF A;  3DPT A;  3O6B B;  3LAP A;  4N9H A;  2PLY A;  2F5E A;  1YFH A;  1FLI A;  3RPU A;  3RJP A;  4ZZL A;  3P9K A;  5A2Q K;  4AVP A;  4RB0 A;  4M9Z A;  1DPR A;  3ECO A;  3FWE A;  5ICG A;  1U8R A;  1GXQ A;  4I0B A;  5ICF A;  1TNS A;  2F5D A;  2XAH A;  1IN7 A;  3E6C C;  3Q5F A;  3EYY A;  4Y15 A;  2QZ8 A;  1O7F A;  5K5Q A;  3J80 K;  2O0Y A;  1D5V A;  1XCB A;  5ILS A;  1K78 B;  1TQI A;  4BQA A;  3DF8 A;  2PMU A;  1D8J A;  3M1E A;  2DW4 A;  1REP C;  4NQW A;  2XHK A;  2PG4 A;  2QBY A;  1R36 A;  1O3Q A;  4ZYD A;  2VBY A;  3EYI A;  2HQR A;  3LA2 A;  2W85 A;  1KU7 A;  2VXZ A;  3ML6 A;  1XSV A;  4LLN A;  4KN7 X;  1U5T A;  2PQ8 A;  1D3Y A;  2YR2 A;  3B02 A;  5LRR A;  3F3X A;  4AIK A;  2ZNZ A;  5CVI A;  3F6O A;  3BJ6 A;  2A6H F;  4EJV A;  1B9N A;  1YO5 C;  4KMF A;  2QYO A;  4UUV A;  5DDG A;  3AAF A;  2XUB A;  4G6Q A;  5L3B A;  2A07 F;  4G7Z F;  3F6V A;  1X3U A;  1RZ4 A;  1TW2 A;  4HYE A;  1FYM A;  5D5X B;  1ZLJ A;  4A0Y A;  3JTG A;  5BOX A;  3HTS B;  1TTY A;  3E6B A;  5LLQ A;  3ZN0 A;  1FY7 A;  2BV6 A;  1T2K A;  5JVT A;  3KP4 A;  3QU3 A;  4MHG A;  2RNJ A;  2QM3 A;  3IKT A;  2CGP A;  3E97 A;  2WC2 A;  4ESJ A;  2VT3 A;  5HLG A;  1P4A A;  2P8T A;  1SD6 A;  3KLO A;  3IL2 A;  3KEO A;  1F5T A;  5DUK A;  2XAS A;  3Q9V A;  1KA8 A;  3ABU A;  1UHM A;  3V7C A;  3ERE D;  3HHH A;  4CIC A;  2R7D A;  3FMS A;  1R23 A;  2VC0 A;  1YLF A;  2TDX A;  1QNT A;  3BDD A;  5LEK A;  1B6A A;  2GWR A;  1ZAO A;  2K27 A;  1ZLK A;  3EDP A;  5FFX A;  5D5V B;  4M71 A;  1XGN A;  4L0Y B;  3E5X A;  3GYH X;  1TW3 A;  2BE5 F;  5F1R A;  4A0X A;  2IA2 A;  2HEO A;  3LQR A;  4IHT A;  1HW5 A;  2FBK A;  3CLO A;  3PQK A;  3EUH A;  3I0T A;  3R60 A;  2IRF G;  4M74 A;  4GXO A;  1YG2 A;  4EMS A;  1BI1 A;  1UST A;  3CUO A;  3WE3 A;  2P4W A;  5LGT A;  1EH6 A;  1Z9C A;  1KQ0 A;  4O5V A;  4L9V A;  2H94 A;  3ELK A;  1KQ8 A;  4IXA A;  2KJC A;  4UV8 A;  1IRF A;  2MA3 A;  1BI3 A;  3M7G A;  3WTU C;  5HS8 A;  1J5Y A;  2Y0M A;  4UV9 A;  2HTJ A;  2MLG A;  4BH9 A;  3BY6 A;  5E8I A;  1QO0 D;  2DPD A;  1MKM A;  1BJA A;  4PCQ A;  4GYI A;  2K02 A;  3RTR A;  3T8T A;  1YQA A;  2D1H A;  3ZP5 A;  3JTH A;  3J7A O;  1DPU A;  3D0S A;  2VOD A;  4EM1 A;  2FBH A;  5HDK A;  2P5K A;  2NRA C;  2XIG A;  4HX8 A;  4EGY A;  2HFH A;  5E1X A;  3MFK A;  1AWC A;  4M6X A;  2VOO A;  4BXU A;  1U2W A;  4WXC A;  4IRI A;  4Q47 A;  5HLH A;  5EEH A;  2IJL A;  1RUN A;  1MGT A;  5E8G A;  5H6R A;  5L3C A;  3GWZ A;  4UVA A;  1YTY A;  2ZNY A;  3FMQ A;  3QP5 A;  1MD0 A;  4M9S A;  4KIF A;  1IXS B;  4ZYH A;  4ESB A;  1U5T B;  1ON1 A;  2BYV E;  1ZN2 A;  2JT1 A;  1J59 A;  3ZMU A;  3KFW X;  2FE3 A;  4I02 A;  1E17 A;  3I5U A;  5DD4 A;  4WXH A;  4WK8 F;  3L00 A;  3O3K A;  5DYM A;  1FYL A;  3HSE A;  2HYF A;  2D2W A;  1RNL A;  2IA1 A;  1P6R A;  2ZKZ A;  5AIP A;  2QQA A;  2VN2 A;  3E6D A;  4FX4 A;  1T39 A;  3TO6 A;  2EV0 A;  2K7L A;  1FP2 A;  2KIM A;  2LNB A;  1GHC A;  2MH2 A;  5BS6 A;  2FXA A;  3V8J A;  4I09 A;  1XGM A;  2DT5 A;  3P9C A;  4D0P A;  4FHT A;  4UVB A;  1MJ9 A;  1WKM A;  1F4K A;  2A68 F;  1JE8 A;  3C7J A;  2FU4 A;  3B73 A;  2D1V A;  1ZRC A;  4CDG A;  3J81 K;  2DQR A;  4U7D A;  4BHB A;  4LB6 B;  4L18 B;  3W6K B;  4IJA A;  4YII A;  1DP7 P;  4RAZ A;  1VTN C;  2HKX A;  4JBA A;  1J75 A;  1LDD A;  2OU2 A;  4A5N A;  5E18 F;  1S7O A;  4PDK A;  4RAY A;  2ZXJ A;  5AON A;  3RPQ A;  2HR3 A;  2K4B A;  5F64 A;  5KK1 A;  4KT5 C;  2E7W A;  4AIJ A;  2XAF A;  1S8N A;  2XKP A;  1OYI A;  4RB1 A;  3R61 A;  2CO5 A;  2F5C A;  3NRV A;  2EV5 A;  3IHU A;  3RKY A;  4BHC A;  2YX7 A;  1T6S A;  3V7S A;  2EFP A;  1XD7 A;  5LRS A;  4HZF A;  2DBB A;  3FX3 A;  4A12 A;  1OPC A;  1SD7 A;  5DCF A;  3N97 A;  2O61 A;  4HQE A;  2P6T A;  3COA C;  3HRM A;  2HQN A;  4AD9 A;  3U9G A;  2KIU A;  2VBX A;  1BN5 A;  4EJO A;  1OYY A;  3TOA A;  2R7F A;  5ICC A;  5LBQ A;  3KET A;  1S7A A;  3ZN1 A;  1JGS A;  4HF1 A;  2W84 A;  4DQ2 A;  4IPA A;  1CF7 A;  2RQP A;  3KCC A;  4P9F A;  4U0W A;  2VON A;  1BBY A;  2P6S A;  4HAM A;  5HLI A;  2FMY A;  3GFL A;  3S2W A;  1SD4 A;  2X4H A;  2Q8K A; 
#chains in the Genus database with same CATH topology
 3JRF A;  4OIQ F;  1FTZ A;  1HW2 A;  2COM A;  5M5Y J;  5K5R A;  1MJA A;  1J2X A;  2YU3 A;  4XLC A;  4BNC A;  4G6D A;  2QQ9 A;  3OS0 A;  1VQP I;  4ITV A;  4PJL A;  4ENJ A;  2EA2 A;  2KDZ A;  2JA7 J;  5C4J J;  4BY1 J;  3ZCO A;  1RUO A;  1VF9 A;  3KYC B;  1UHW A;  2EIL H;  3FIW A;  4XRS G;  3WTS C;  4IRG A;  1IGN A;  2O8X A;  2ZME C;  1I3Q J;  1QZE A;  3OOU A;  2LG4 A;  3BG5 A;  1HLV A;  2ZFW A;  1AKH A;  3GFI A;  2R5Y A;  2EIN H;  3OR1 C;  1HKT A;  3DU5 A;  1A6Q A;  3KP3 A;  2RGV A;  1XSX A;  4GGG A;  1R5H A;  2EH3 A;  2UV1 A;  3AL0 B;  2DFF A;  1O4X A;  2FRH A;  2Z5U A;  3KZI C;  3QP6 A;  2R92 J;  2LY9 A;  1LEA A;  1MND A;  1R7J A;  2CW7 A;  2K9L A;  3QQA A;  4HBL A;  4Q4Z F;  5D6F A;  1RET A;  1T38 A;  3R4K A;  5CVV A;  2HVS A;  1UHS A;  4E7I A;  2XV4 S;  4F93 B;  1YW8 A;  4W97 A;  1YIO A;  4HPQ A;  1R00 A;  1NG6 A;  1Z6R A;  2I8D A;  4C2T A;  2JPB A;  5C44 J;  1GT0 C;  2X1D A;  2RC4 A;  3KE2 A;  4B4C A;  2WAQ A;  4U87 A;  3CUQ B;  4RB3 C;  4RGX A;  2Y2Z A;  2B63 J;  1F9N A;  3BLY A;  3CO6 C;  4OIP F;  4HV6 A;  4ASN A;  2CUF A;  4K2E A;  5F1J A;  2DMQ A;  3A1Y A;  2PN6 A;  4I99 C;  3E5U A;  3AG4 H;  1Y1W J;  3H3Z A;  3DEE A;  3I4N J;  4L5J A;  2VJ5 A;  4XOT A;  2NS7 A;  3GX4 X;  4YIR X;  1I1S A;  1TWC J;  1YI2 I;  1IN8 A;  1XB4 A;  5DCM A;  1MW7 A;  2R7O A;  1G8X A;  1LE8 B;  4XOP A;  2CQN A;  4XM3 A;  2M3A A;  4LJZ F;  4BQN A;  1JKQ C;  5FRM A;  5FB2 A;  2M7A A;  1MNM C;  2WWY A;  3G3Z A;  1SFX A;  1LFP A;  1NHA A;  3CES A;  5FRN A;  4P9U A;  3SEQ A;  3H3V K;  3TGN A;  5GTI C;  2X51 A;  1R1U A;  2P7V B;  2ZSI B;  3GO5 A;  3MKW B;  2M5W A;  2RN7 A;  2LF8 A;  4DNC A;  5FLM J;  3L2Q A;  3JAM Z;  2DQL A;  3JW4 A;  4CH7 A;  1QBJ A;  3LST A;  5M5W J;  3ASN H;  4WCG A;  2JA2 A;  2Z1D A;  3CC2 I;  3K4L A;  3PSI A;  4F3Q A;  5CLS A;  3GUD A;  2LVS A;  3PFI A;  5HDN A;  2OQR A;  5E79 C;  1W7P A;  3BG9 A;  1LB2 A;  1QZY A;  2F48 A;  2GIZ A;  3JSP A;  3HOX J;  2O8K A;  1DP3 A;  2X6O A;  3MZH A;  5E1Z B;  4D7M A;  2VB6 A;  1T08 B;  3HOS A;  4Y3O A;  3L1P A;  4G7O F;  2ZXW H;  2HPI A;  2HTS A;  1QQI A;  1FP1 D;  3I53 A;  3BZC A;  4HDV A;  2CQ7 A;  1P7J A;  2OCC H;  2KLO A;  2XDV A;  3BPX A;  4E7S A;  3MWM A;  3BG6 A;  3SHF A;  5GAD J;  5KVR A;  2LOO A;  3ZPL A;  2IA0 A;  2LYC A;  2OPT A;  3OYC A;  2O9L A;  2ME0 A;  1FBQ A;  3FF5 A;  4ZTJ A;  1KYW A;  2ZC2 A;  3ERM A;  5K7H A;  3MD2 A;  1CGP A;  1BA5 A;  3LL7 A;  4UVC A;  2Q2E B;  2ZSH B;  1HXD A;  2BXZ A;  1O57 A;  2JWT A;  3DCF A;  2LD5 A;  4RBO A;  4DYQ A;  3LA3 A;  1O3R A;  1K6O A;  4IHV A;  2NVU B;  4R79 A;  2DA1 A;  1BW5 A;  2M45 A;  4XSZ F;  2A69 F;  4GO1 A;  3D5R C;  4HQM A;  4UUT A;  4ZDO A;  2H8R A;  4NDL A;  1Y56 A;  3SZP A;  4JK1 X;  2DOE A;  1MBF A;  1FOK A;  2HVR A;  4MEY F;  2PMZ A;  2VKE A;  3ZOB A;  1SVL A;  3H5R A;  5IYB J;  1GDT A;  3HC7 A;  4MGR A;  2VPL A;  2Z2S B;  4G94 A;  4ZC3 A;  4KNY A;  4HEA 2;  3DKX A;  2BBY A;  3GEZ A;  3ECH A;  2KIQ A;  1BIB A;  3BQY A;  4B44 A;  3LSH A;  3KP2 A;  1UFM A;  4NNJ A;  4V19 K;  4FAS D;  2NS0 A;  3DKW A;  1MMS A;  5D8K B;  4XL9 A;  3WE2 A;  2WV0 A;  3FXR A;  1PUE E;  1OCP A;  3OOP A;  2HDW A;  4A6D A;  2NAZ A;  3I59 B;  3WHB A;  2WA0 A;  3IC7 A;  5EYR A;  1UEL B;  5IYC J;  1YHQ I;  1P7I A;  4HA8 A;  3V4G A;  1ZGJ A;  4JQF A;  4QSH A;  4RAG A;  3CO7 C;  2VQH A;  2WY7 Q;  2W48 A;  1XGO A;  5TJJ A;  3Q0W A;  1D8K A;  1WH7 A;  4FTH A;  2EIM H;  1ZRF A;  1MDM A;  1A04 A;  2RDP A;  3RDI A;  1SC7 A;  3OL3 A;  3R6S A;  1ZEL A;  2ME6 A;  5LHG A;  5F08 A;  1JGG A;  4WWC A;  1WRJ A;  4UNO A;  4I2O A;  4M6Y A;  1LNW A;  2LBF B;  3EUA A;  2E5N A;  2QVO A;  1HKS A;  3LSR A;  5JLX A;  1RI7 A;  2L4A A;  3K9T A;  2JRM A;  1IUY A;  2IS4 A;  1WSU A;  1YS6 A;  1WI9 A;  2AXL A;  2K3P A;  1P9Q C;  4FIS A;  3TBI A;  3CME I;  3QU6 A;  3S3M A;  2E2I J;  3CZ6 A;  3V8L A;  4FE7 A;  1IW7 F;  1BR2 A;  1QPI A;  4MQV A;  1VZ0 A;  1PUF A;  4DZP A;  1R5G A;  4OAY A;  4RS8 A;  2VT2 A;  3DPL C;  1FBS A;  3HUG A;  4H0E A;  3F23 A;  1BW6 A;  3MZY A;  1BR4 A;  5TIS C;  3HB9 A;  1G2H A;  2LSO A;  2V1X A;  4JP0 A;  3SZT A;  4LG0 A;  1TQM A;  2VQL A;  4KIT B;  2C6Y A;  4J00 A;  5L3F A;  2DDA A;  2PFB A;  1MJB A;  5HVQ C;  1AOY A;  1EV7 A;  2ID3 A;  2KJB A;  4KFC A;  4BHP A;  1FC3 A;  3HRS A;  2BY3 A;  3CMM A;  4MNU A;  4YEJ A;  1KU3 A;  2DFI A;  2L4M A;  2O7O A;  5BPD A;  3DPU A;  1FOY A;  2RAE A;  2ZO4 A;  2OQG A;  3OMY A;  4CCL A;  1ONV A;  2TRT A;  1APL C;  3VDX A;  4B09 A;  2V9K A;  5H2F C;  1NH3 A;  4Y7N J;  2M4G A;  2V1N A;  3OIQ A;  4I01 A;  5L3G A;  4L5I A;  2V7F A;  1MH4 A;  2HZT A;  2F5F A;  3GW2 A;  1QPM A;  3GXO A;  3QYF A;  1KQ9 A;  3BG3 A;  1VQL I;  1H9G A;  5DD8 A;  1AKH B;  1J0R A;  3FXU A;  4ETS A;  2R5Y B;  3IWF A;  2B9S A;  4MTD A;  4N9I A;  2XRL A;  5ICE A;  3GFM A;  5EJC A;  3P9I A;  2V9P A;  4E7J A;  3GVA A;  1QU3 A;  3PSF A;  4CXF A;  5DUI A;  2ETH A;  4YFX F;  3Q9S A;  4IKF A;  2V6C A;  2E1N A;  3OYB A;  3CJR B;  3GTP J;  3JRA A;  1FMW A;  4C2M J;  1Y39 A;  2FOK A;  3KZY A;  1LFB A;  2DMU A;  2JA8 J;  5TRD A;  3DTK A;  4OOI A;  3I55 I;  4IZZ A;  1UMQ A;  4CCM A;  3K70 C;  2VKV A;  2CUZ A;  1IF1 A;  1O3T A;  3CF5 F;  2HOA A;  5GPA A;  1U78 A;  4HX7 A;  2A6T A;  4S04 A;  3HTU A;  2MC4 A;  4GCV A;  2VI6 A;  5ILU A;  2R7X A;  4XON A;  1FJL A;  2XF7 A;  1S7E A;  1BOB A;  3RCO A;  1W5T A;  3BTC A;  3R0A A;  4BBS J;  1OCZ H;  1WQ2 A;  4LD5 A;  2EFO A;  2QF7 A;  4P1W A;  4IHW A;  2HOE A;  3PIO F;  4BEH A;  3FHZ A;  2MG4 A;  2L01 A;  5IP9 J;  1OCC H;  1X19 A;  3OL4 A;  3TO9 A;  2K40 A;  1IN6 A;  2EK5 A;  1WI3 A;  4AYB N;  2VE8 A;  2JUC A;  1U6G A;  3GFJ A;  4OMZ A;  2GOX B;  1BI2 A;  1W1W E;  4CCO A;  5IP7 J;  2EWN A;  2Z16 A;  4YIF A;  3ZQL A;  3BR2 A;  5GAE J;  2KIF A;  4BBR J;  2KHM A;  1Y8R B;  2LK2 A;  1GXP A;  1OKR A;  1P92 A;  3K4J A;  1AA7 A;  2BVL A;  5LGN A;  5DCM B;  2W25 A;  2QBY B;  1Y0U A;  1YW9 A;  3ZMT A;  3I64 A;  1TBX A;  2M4K A;  2Z33 A;  2F5V A;  3FBI B;  4NHJ A;  2BHZ A;  2EZK A;  2DK8 A;  5D8L B;  2CQX A;  2KZG A;  4JX4 A;  4I76 A;  1ZHF A;  2M9H A;  4YFN F;  2ADU A;  1MMD A;  1YOV B;  1FPQ A;  4MFE A;  2R7W A;  2Y48 A;  2CWE A;  3CUQ C;  2CV1 A;  3OS2 A;  5ED4 A;  1XPX A;  4D5C A;  3BR6 A;  5ERI A;  1HBX G;  2QSF X;  1KYZ A;  2WY8 Q;  4AID A;  2FBI A;  3B6C A;  4PUS A;  3GTL J;  4C3H J;  2QSH X;  1JHH A;  2RRE A;  1W7P B;  2VKD A;  3D1N I;  2BOL A;  2R7R A;  2HQ5 A;  2XAU A;  2CFO A;  2A5W A;  1R6R A;  2DJI A;  1S72 I;  1OFC X;  4KUM A;  1K78 A;  4EJT A;  2Q1Z B;  2IW5 A;  3A4C A;  3C2H A;  4LLG F;  2STT A;  3S2D J;  2X48 A;  4ABZ A;  2HGC A;  2VIX A;  4PJ0 C;  2QLZ A;  3TO7 A;  1XTA A;  3QOP A;  1MBK A;  3N4M A;  4F92 B;  3QRF F;  4KDP A;  1UB9 A;  2JZY A;  3ZMV A;  5LGU A;  1FIP A;  2DCE A;  1W7P D;  4P55 A;  3BQZ A;  4FT8 A;  1ZG5 A;  3GLL A;  2LC2 A;  1OLT A;  1KON A;  3VYS B;  3BJA A;  2FF4 A;  3I71 A;  3VEP A;  1WJB A;  2VBZ A;  2CRG A;  4BY7 J;  1MSE C;  3ZMS A;  1H9T A;  3BCB A;  3HOT A;  4HNT A;  3KP7 A;  2ZBK A;  3ROU A;  3X2Q H;  2LR8 A;  3QYE A;  1HA8 A;  1OIS A;  2HDC A;  2PJP A;  4CO8 A;  4IHX A;  5CKT A;  2DMP A;  4BU2 A;  3BOQ A;  4D5F A;  2W57 A;  4G6T B;  4OMY A;  5LHI A;  5BQT A;  2CU7 A;  1SEU A;  2ESN A;  1WJ5 A;  4XBF A;  1T0F C;  2DTR A;  2P81 A;  4ZDP A;  2O3F A;  2QGU A;  2W4S A;  2CH0 A;  3JRC A;  5BNG A;  2VOP A;  3H92 A;  3CCU I;  1T0F A;  5K5O A;  3QOE A;  2WAD A;  2EFN A;  5AIQ A;  2L7F P;  2X9D A;  2MAB A;  3P5J A;  2LY1 A;  3V7R A;  2YS9 A;  1ITY A;  1MNE A;  4DGW B;  1ZK8 A;  2M1B A;  3DP7 A;  1J09 A;  2A61 A;  3CJQ B;  4O6J A;  3HSF A;  2DMT A;  3BWG A;  3LOC A;  2Z99 A;  2XRO A;  4Q5S F;  3U21 A;  1LUJ B;  1IDY A;  4RAF A;  1FT9 A;  4E70 A;  2L7Z A;  1JT0 A;  1MBJ A;  4BGD A;  2XKO A;  3K0L A;  3Q3S A;  1W4M A;  2M87 A;  2HNH A;  3DBR B;  4UHT A;  4ZZD A;  2PJR A;  2IS1 A;  4NUB A;  4BE1 A;  1SVM A;  2K9N A;  3DQV C;  3VB2 A;  3ABM H;  4J01 A;  3T0Y A;  4AM3 A;  2A5Y B;  4LMY A;  1Z0X A;  2YX4 A;  1TT5 B;  3OYH A;  1S3J A;  1DGR M;  3MEX A;  4LG3 A;  5B1B H;  5B66 C;  5J1U A;  1TQP A;  3PM1 A;  3AFH A;  4XIC A;  2G7U A;  3SDG A;  3GTO J;  5E3L A;  1MDM B;  2V9V A;  3OYD A;  1O7L A;  2JPC A;  3WTZ A;  2IEK A;  1AHD P;  2ZCW A;  3M4O J;  4I0A A;  4HLY A;  4EJU A;  3PQJ A;  4DOZ A;  5FLV A;  2R7Z J;  1VQ5 I;  3ULQ B;  1ZQ3 P;  3GTQ J;  3RKW A;  2CFX A;  3CCR I;  4LB5 A;  1E3H A;  4L9J A;  3DXJ F;  2FML A;  2V1D A;  2BHY A;  1IXC A;  1QHH D;  1TLH B;  2EV6 A;  1X3W B;  2ELK A;  2GA1 A;  5LHH A;  1TWG J;  1MH3 A;  3CCV I;  2E60 A;  4Y33 A;  1YYV A;  2X6X A;  3HRU A;  4UUS A;  3IUO A;  4XLP F;  2WTE A;  2B0L A;  4U0V A;  4DJA A;  1R58 A;  2M2E A;  4M3G A;  4HW0 A;  2OAZ A;  4Y17 A;  1EJ9 A;  1PUF B;  2XGX A;  3REO A;  3TKY A;  3A01 A;  2KRF A;  2XAG A;  1IRG A;  5IP6 A;  3HUG B;  1ZG3 A;  3DKY A;  4ZYG A;  4PFP A;  3TW6 A;  1DU0 A;  3LSG A;  3WOD F;  2R3S A;  5EG0 A;  2OC6 A;  2HOT A;  1BC7 C;  4LG0 B;  2LRD A;  2G7H A;  2E19 A;  4YEL A;  4PZJ A;  3HPG A;  2OZU A;  5CJ9 A;  4GDF A;  2DOA A;  1UG2 A;  3W3C A;  3CDH A;  2MC3 A;  3IP4 B;  4C30 A;  2HPM A;  2UXN A;  1OCO H;  3NQO A;  2X0L A;  4RB2 C;  4C9Y A;  4M9X A;  4CA0 A;  1D1B A;  3LQQ A;  3D5L A;  4EAT A;  1NK3 P;  5FFZ A;  3VSK A;  3S32 A;  2FNP A;  2DOD A;  4HV5 A;  2QUF A;  3GZ6 A;  1WGX A;  3CCQ I;  1TT0 A;  1MZB A;  2K9S A;  2Y69 H;  4RGR A;  4EV0 A;  3TMO A;  2A3S A;  2ISY A;  5FRO A;  1QVT A;  3S93 A;  2E2H J;  2DA6 A;  3I58 A;  2XAJ A;  2FQ3 A;  1ZRD A;  5E17 F;  2HZD A;  3LAJ A;  1JUM A;  1IAW A;  2GOM A;  1XS9 A;  3A02 A;  3L09 A;  2A6E F;  1U8B A;  3F21 A;  5JLW A;  2E2J J;  2UWM A;  2W7N A;  2J5P A;  3DLA A;  3M3Y J;  5K1Y A;  4Y4R A;  1JT6 A;  3T5X A;  3A03 A;  2O5R A;  2F4I A;  2E35 A;  2IGN A;  2V1U A;  4KMU X;  3TP0 A;  4KIG A;  4QWQ A;  2PX9 A;  3BC8 A;  2IGO A;  4XRF A;  3CP8 A;  4IQJ A;  3H9G A;  2OUM A;  1BR1 A;  2DDB A;  1I6X A;  3K4K A;  1RPW A;  2KL4 A;  1HW1 A;  4RLF A;  3KX2 A;  1FNN A;  2ZME A;  1R49 A;  2IXS A;  1V5F A;  1E2X A;  4A2U A;  4KIB A;  2GAU A;  2L9R A;  3L2W A;  2AHQ A;  2CW0 F;  5IPA A;  2VJI A;  2IP2 A;  5JFR A;  1DDN A;  4KIS A;  2MD5 A;  1S9H A;  3MAJ A;  2HKO A;  4RDU A;  1TP4 A;  2FD5 A;  2ELH A;  3GF2 A;  3IAM 2;  4PGH A;  4U88 A;  3E6M A;  4BEH B;  4PSX A;  4F91 B;  1GVJ A;  1VND A;  3MCZ A;  2NVQ J;  2JA6 J;  2XF5 A;  4ON0 A;  5JI6 A;  3GZN B;  4EQQ A;  1P2F A;  3G73 A;  3ZR8 X;  5EDN A;  4D7N A;  1Z1D A;  4HG2 A;  1IZ1 A;  1Z3Y A;  1QVU A;  4MQ9 F;  1DUX C;  3HOV J;  2I10 A;  1DU6 A;  1VQ4 I;  2FEZ A;  3JAM K;  2O6G E;  4B47 A;  3QAH A;  2COB A;  5JR3 A;  3QOD A;  1V54 H;  3M8E A;  5HDG A;  3RZD J;  2UZK A;  3W6V A;  1JUS A;  2O03 A;  1X1B A;  3KEQ A;  4WXD A;  4F55 A;  1ZRE A;  1UJ8 A;  4A6E A;  4TV7 A;  1FMV A;  1Q1H A;  3L7W A;  3S2H J;  3O8H A;  4M73 A;  3GCM A;  1HSJ A;  5J8C A;  4IRH A;  1IDZ A;  4QPQ A;  2EFQ A;  2H6B A;  4Z6Y A;  4O3M A;  3RI4 A;  1G3W A;  4BQQ A;  2GLO A;  5CYV A;  2NXN B;  1I5Z A;  1FIA A;  3Q0U A;  1HQC A;  2QWW A;  3F72 A;  5EEG A;  1LFU P;  1L3L A;  4A0Z A;  2IGM A;  1LKX A;  4AC0 A;  4M3B A;  1YJ9 I;  3ZQF A;  4KA4 A;  1TWF J;  3RSN A;  1XGS A;  2LF7 A;  5E3M A;  2W00 A;  1JTX A;  4B3A A;  2WB1 N;  2YUS A;  2Y75 A;  4XQF A;  2PMH A;  1SFU A;  1P4W A;  1ON2 A;  3GME A;  1LJ9 A;  3LFK A;  5JHF A;  4IHY A;  2VE9 A;  3E5Q A;  3WTV C;  1ZG1 A;  1R1T A;  2NNN A;  2VJ4 A;  4M72 A;  3P7N A;  1JHF A;  1V4R A;  1P4X A;  3C18 A;  4WF2 A;  1ZGA A;  1LVK A;  5A2Q Z;  1K4T A;  1K79 A;  5D6E A;  1DGW Y;  4WX9 A;  4MEX F;  2MLK A;  3J7A Y;  1S6L A;  3OYJ A;  3WTT C;  2QSG X;  4AYB A;  2FA5 A;  4EM2 A;  1LVA A;  1Z05 A;  3SXY A;  2QA4 I;  2PI0 A;  2LDU A;  4G8X A;  1U5T C;  2ZXI A;  3G1M A;  5B3S H;  3PNV A;  2GXG A;  2RKH A;  3FXQ A;  3C1D A;  3S1M J;  2R0Q C;  2ZJR F;  1STZ A;  4CUG A;  3GTM J;  2Y0S A;  4KN4 X;  1ZR4 A;  2ELJ A;  3ZMD A;  1IN5 A;  3EET A;  5HNH A;  1OMI A;  5EF6 A;  4FQG A;  3G6E I;  2ISZ A;  5HNF A;  5F0C A;  4OIO F;  4XLF A;  1G3Y A;  4ZH4 F;  4RGS A;  5KHD A;  4R8H A;  4NB5 A;  1MIJ A;  1Y6I A;  3J80 Z;  4S0H B;  5CVU A;  3OYF A;  1IV6 A;  2VQG A;  3PO2 J;  1N78 A;  3OSG A;  2P5L C;  2DT6 A;  2E1C A;  2EB7 A;  2E7X A;  2P0W A;  3F8C A;  4XLE A;  2VKH A;  3FKJ A;  2XPW A;  1X2N A;  2JVG A;  1ORK A;  2W82 A;  1UAA A;  2IT0 A;  2F4O B;  5GTH C;  4YG2 F;  5IY5 H;  5L3D A;  4BXX J;  4H4K C;  1ETY A;  2G9W A;  4Z2Y A;  3TDU C;  1FYK A;  1IRX A;  2AS5 F;  1U0J A;  4BAC A;  2ZXH A;  3WU2 C;  5IT9 K;  2ZJ2 A;  2CMP A;  2OZ6 A;  2JUG A;  1TZL A;  3WGG A;  1OYW A;  4HX4 A;  2ACJ A;  2M30 A;  2DU9 A;  5DV5 A;  2DTZ A;  5FD6 A;  2HQA A;  2E1O A;  2EZH A;  2HXO A;  2DA5 A;  5D5W B;  4B1R A;  1WVR A;  3OYI A;  1QGP A;  1IN4 A;  1R1V A;  2P5V A;  4HST A;  2E1M C;  4P96 A;  5BPI A;  1Z67 A;  2B7E A;  2XVC A;  3FXO A;  3ABL H;  2RVC A;  3DV8 A;  4RGU A;  1QZZ A;  4AWX B;  1PP7 U;  4EJW A;  4CHU A;  4LLL A;  1S29 A;  3I4P A;  1G3S A;  2IVM A;  1BC8 C;  2L9S A;  1D0X A;  2XGC A;  2VLA A;  3OYE A;  2CJJ A;  4UXN A;  1FSH A;  2W24 A;  2L3D A;  2DAO A;  3PL8 A;  3H9J A;  4HOB A;  2MH9 A;  3TQN A;  2H6C A;  3HSR A;  3IAS 2;  4ZYE A;  5KCM A;  3ASO H;  2L54 A;  3BTI A;  1VQO I;  1T98 A;  5FGM A;  4KT6 A;  3GTJ J;  3SFI A;  1PP8 F;  4ZJZ A;  5ILV A;  4UUS B;  4YFK F;  2VBW A;  4DW6 A;  5C3E J;  1EH7 A;  3OWT A;  1BJZ A;  3G2B A;  2R5Z A;  2KIS A;  4LOC A;  3BCA A;  4HDU A;  4BE0 A;  1RR8 C;  1KU2 A;  3L9F A;  3A01 B;  2MD0 A;  1B59 A;  1X2M A;  3IKV A;  5IT9 Z;  2RQQ A;  2X6Y A;  4ENN A;  2CQK A;  1B8I B;  2ICW G;  3BR0 A;  1HST A;  2XAQ A;  3IWZ A;  3HKZ N;  3G4S I;  5EG0 B;  3OYL A;  2QQ8 A;  2GXB A;  4E4H A;  1EH8 A;  4CZZ A;  2LKP A;  5GAH J;  4B43 A;  2HS5 A;  5FD5 A;  1J9I A;  4LFU A;  1CF7 B;  1I27 A;  3CMA I;  3QWL A;  3L2C A;  4XLH A;  1B9M A;  2M8E A;  3TW7 A;  2YU9 J;  2X1E A;  2IPQ X;  1FEX A;  3O2P E;  5DEQ A;  3RKX A;  3H3U A;  1SAX A;  3FK6 A;  4QPO A;  2DMN A;  5M3F J;  1ZTR A;  3BR5 A;  5CVR A;  2Q0O A;  2Z3Y A;  3S1R J;  1IXR C;  1XCV A;  3LSJ A;  1FWZ A;  2JRT A;  2UXX A;  5H20 A;  1XDS A;  2XRN A;  1SMY F;  5L3E A;  5HOO A;  3WU1 B;  2Y9Z A;  5D4S A;  1XSD A;  1R4M B;  4CYD A;  4IL6 C;  4HF0 A;  1ETW A;  3OIP A;  2K9M A;  4N0B A;  5E1W A;  2H1K A;  5DTD A;  2YSR A;  4PSW A;  2DO7 A;  4CYC A;  5J8F A;  4X0G A;  4OIN F;  2QEX I;  5M5X J;  1WWX A;  5B1A H;  1N77 A;  2EIJ H;  1G3T A;  4FET A;  3SFZ A;  1YE9 A;  3ZQQ A;  1EA3 A;  4DZJ A;  5DM7 F;  1U3E M;  1K4S A;  4N4O B;  1XDU A;  1ZYR F;  2M7B A;  3BZ6 A;  3RYP A;  1G59 A;  4BAY A;  2JA5 J;  4IF4 A;  3PJR A;  2ZME B;  3JRH A;  1X4O A;  3GBG A;  4NC7 A;  4U0Y A;  1CQT A;  4L5E A;  3I4M J;  2E36 A;  4LK1 F;  3I56 I;  3DEU A;  5FO5 A;  1SMT A;  2BW3 A;  2QEN A;  3NEU A;  3WHC A;  3FK7 A;  3JSO A;  1B1B A;  4E7K A;  3GTG J;  1G6N A;  3S3N A;  3A0B C;  2K9Q A;  2Y9Y A;  5IYD J;  5DM6 F;  4L0Z B;  4GYG A;  3KLN A;  2K4J A;  3FXM A;  1LQ1 A;  1H0M A;  2AQF A;  3CC7 I;  1TL8 A;  1BIA A;  4PK4 A;  3RIR A;  1JJ6 C;  1F43 A;  1GV2 A;  2J5O A;  2YPR A;  2BY2 A;  1XMK A;  2FSW A;  4D9J A;  4IOA F;  1ZH5 A;  3JRE A;  4IHS A;  3OV8 A;  2R7T A;  1H88 C;  3AG2 H;  3IH4 A;  4LGW A;  2E71 A;  5J4Y A;  2FQ4 A;  5EZH A;  1F1Z A;  2W1O A;  2E5Z A;  1IV8 A;  2CSO A;  2HYG D;  2KKO A;  4XN0 A;  3VOE A;  1K7A A;  4FE4 A;  3W6J B;  2QQB A;  3CJN A;  1YJN I;  3CLQ A;  2NYX A;  3DU6 A;  4LK0 F;  2JSC A;  2HWV A;  3FBN B;  2H27 A;  5FKN A;  3RKQ A;  4G9Y A;  3ABK H;  3AL0 C;  3CQZ J;  2QKM B;  1I1G A;  5LEJ A;  1B4A A;  1WJC A;  3QYB A;  5J1R A;  3F9K A;  3PUF A;  1YS7 A;  4IQ4 A;  1W5S A;  1R22 A;  2PBI A;  3VYU B;  3U2R A;  4A5M A;  1GUU A;  3ZQH A;  2OA4 A;  3BTL A;  3QPS A;  2R7U A;  1IC8 A;  1FOX A;  1G4D A;  3IRR A;  4XR6 A;  5M3M J;  2MYS A;  1Z7L A;  2ZB9 A;  2BEO A;  2V79 A;  1LDK B;  3MQ0 A;  3K1M A;  4W1U A;  4NC6 A;  3ZQG A;  3VOD A;  3MKY B;  4ENM A;  3VFZ A;  2OBP A;  2EZL A;  3HHG A;  1D1A A;  4XKB A;  2LP0 A;  3IRQ A;  4I98 B;  2NVT J;  2WAF A;  1V3F A;  3T8R A;  1C0W A;  3UR3 C;  4BL0 B;  3CUQ A;  1J7K A;  2CG4 A;  4P5O A;  4M6V A;  3LSP A;  4A3I J;  1USS A;  4PGG A;  4F7Z A;  3TED A;  4MIM A;  1Z3X A;  1VQ8 I;  3ZMZ A;  3LSI A;  1U9O A;  2DI3 A;  3M8F A;  2GIV A;  4UB6 C;  4S05 A;  4EVI A;  3WG9 A;  3TOB A;  4A3G J;  2OF7 A;  1JXS A;  1K6Y A;  3PO3 J;  4G7H F;  1RIO H;  4U7B A;  2VC1 A;  4B8X A;  3DLL F;  1BM9 A;  5KNL A;  4JYK A;  2NVX J;  4PJJ A;  1NTC A;  3NAU A;  3WU0 A;  3WTW C;  1XN7 A;  5H6Q A;  3WGI A;  4J19 A;  4KIC A;  5J40 A;  3HL2 A;  4IO9 F;  1Z7U A;  4EM0 B;  1ZR2 A;  4R1H A;  1ODD A;  2JQ7 A;  3CTA A;  4CGZ A;  3S17 J;  4XSX F;  3E7L A;  1XMA A;  1FSE A;  4A3E J;  3OR2 C;  3TL4 X;  3VYT B;  5D5U B;  3KEY A;  4BJ6 C;  3G71 I;  3G1O A;  1YW7 A;  3FKI J;  1HF0 A;  3KP6 A;  2H09 A;  3K1P A;  4Q48 A;  2EA4 A;  3F8B A;  4LIV A;  5GAG J;  3S16 J;  3K4N A;  3CCS I;  3JR9 A;  5FLX K;  5KAF C;  1I39 A;  2WB1 A;  2R93 J;  3FMR A;  4XLN F;  3LMM A;  3EQL F;  3ESW B;  3RQI A;  2HDD A;  1PYV A;  1KU9 A;  3LA7 A;  2CYY A;  2DYS H;  2OV7 A;  3ABT A;  4UB8 C;  4XID A;  1ZAR A;  1OR7 C;  1SD5 A;  3E3V A;  5FKO A;  2P7C B;  4DYC A;  3HDD A;  2VL8 A;  2Y30 A;  2GZW A;  3S14 J;  1JTY A;  5GPC A;  2M0C A;  3L2V A;  1ETQ A;  2DPU A;  3HYI A;  4OU0 A;  3WTX C;  1OR7 A;  5IT3 A;  3KZZ A;  2EFW A;  2JTV A;  4Y13 A;  3TDZ C;  1XC5 A;  3BJO A;  1O3S A;  4ENK A;  4E6K G;  4XLA A;  3CDI A;  3F8F A;  2DFE A;  4BYY A;  2Q2E A;  3J7Z I;  3K69 A;  1JKP C;  3HXL A;  3R0J A;  1RRJ A;  2V6E A;  3M9A A;  4L9N A;  3IH2 A;  1UCR A;  3HRT A;  3V42 A;  3F8N A;  3BPV A;  2OJE D;  2WBM A;  5HS7 A;  4I7H A;  4XRS A;  4A3J J;  2R5Z B;  4JX6 A;  3K2A A;  4KYW A;  1MBH A;  3PFY A;  3T1B A;  4BKX A;  4CCK A;  2KRH A;  3HZJ A;  3PNT A;  4ESF A;  4XN3 A;  5FLX Z;  2DOF A;  5JHU A;  4OIR F;  1PDN C;  1TWA J;  1FTT A;  1BOA A;  4JX5 A;  2F2E A;  3HPH A;  4MO7 A;  4C2U A;  5F6F A;  2ZFU A;  2EJR A;  1FZP B;  1SAN A;  3F0C A;  2NNY A;  2K5C A;  3KP5 A;  3I54 A;  1F36 A;  6PAX A;  4ZTF A;  3V8K A;  3H5N A;  3CCM I;  4EGZ A;  2LKX A;  3K2Z A;  1KGS A;  2GQQ A;  3J81 Z;  2X6W A;  5CVJ A;  3SDB A;  4MTE A;  3RYR A;  3I59 A;  3QPH A;  3CCL I;  1HKQ A;  3NAR A;  4FX0 A;  5J47 A;  5D4R A;  2STW A;  3BRO A;  4AIH A;  5J6X A;  2OD5 A;  2BXY A;  3HBL A;  3GZ5 A;  1FX7 A;  3C3W A;  1ULY A;  2FNA A;  5BMZ A;  2PEX A;  2XF6 A;  4IVN A;  1OCT C;  1LEB A;  2K3F A;  5IOY A;  1Z91 A;  3QPL A;  4QLC U;  4DIQ A;  1E3O C;  1LDJ A;  1V55 H;  2ESH A;  1X1P A;  2LBF A;  3QPT A;  1TNT A;  4CYC B;  1XX5 A;  1ZKG A;  1FBU A;  4HRI A;  3HOY J;  2IBD A;  2L02 A;  3H5A A;  5F27 A;  2E34 A;  1L0O C;  3FM3 A;  1HCR A;  2RV8 A;  2DLL A;  2K86 A;  2RNG A;  3F8M A;  5E20 A;  2WAE A;  3U1D A;  3WTY C;  9ANT A;  3GLX A;  3WGH A;  5HS9 A;  1EF4 A;  2ZJP F;  2DFH A;  2GA2 A;  4HLX A;  3F22 A;  1NG7 A;  3JRG A;  4C3I J;  3FM5 A;  4IEJ A;  1Z6T A;  3HIF A;  2Z9O A;  2BW3 B;  2DK5 A;  2FUG 2;  1H89 C;  1D5Y A;  3ZQI A;  3FZV A;  5F04 A;  3K1N A;  4IX7 A;  3DFG A;  2BZT A;  4L9T A;  4A69 C;  2BGC A;  4HF2 A;  1QHG A;  2LKS A;  3EPZ A;  2DA4 A;  4RM3 A;  3BP8 A;  3NWS A;  3IH3 A;  2D45 A;  1OJL A;  1HC8 A;  4I6Z A;  1GLN A;  3HJE A;  3HOZ J;  1BI0 A;  5CQG A;  3SQN A;  1SFE A;  3K4M A;  3VSL A;  2HYJ A;  3ISP A;  4BDY A;  1Z77 A;  3LWF A;  3ZQ7 A;  2MBF A;  3K70 D;  3SYT A;  4E7H A;  1KZH A;  5JVG F;  3DPT A;  3O6B B;  2L9V A;  3LAP A;  1UG0 A;  4N9H A;  2PLY A;  2F5E A;  1A31 A;  4XKV A;  1YFH A;  3VYR B;  1IUF A;  1FLI A;  2KQR A;  1HOM A;  1RKW A;  3RPU A;  3RJP A;  4ZZL A;  2HXI A;  3P9K A;  4FCY A;  2CS3 A;  5A2Q K;  1YX5 A;  2XSD C;  4AVP A;  4RB0 A;  4M9Z A;  1DPR A;  1V5G A;  2FOW A;  3OS1 A;  3ECO A;  3FWE A;  5ICG A;  1N25 A;  2MGQ A;  3H0G J;  1GXQ A;  2JMW A;  4I0B A;  1U8R A;  2XGD A;  5ICF A;  1TNS A;  2F5D A;  4XRM A;  2XAH A;  3JRB A;  1SFK A;  3CCE I;  2DT7 B;  1IN7 A;  2DA7 A;  2MFZ A;  4B3X A;  3E6C C;  3DWL E;  2TCT A;  2X85 A;  1POG A;  3Q5F A;  2KMU A;  3EYY A;  4Y15 A;  3K7A J;  4CCN A;  3CMY A;  3LSK A;  1Y8Q B;  2QZ8 A;  1MSF C;  1O7F A;  5K5Q A;  3J80 K;  4QIW N;  1MBG A;  3BR1 A;  2O0Y A;  5E3N A;  3OYA A;  1D5V A;  1YIJ I;  1ETK A;  2OTJ I;  1VQ6 I;  1XCB A;  5ILS A;  1ACI A;  1K78 B;  1TQI A;  2KP6 A;  4OWR B;  4BQA A;  4PJM A;  3DF8 A;  1VQ7 I;  4A3B J;  3JRD A;  4ANJ A;  2PMU A;  5E3O A;  3M1E A;  1D8J A;  2DN0 A;  3KIO A;  2DW4 A;  2Y31 A;  1REP C;  2OTL I;  4NQW A;  2XHK A;  4II3 A;  2PG4 A;  3S8P A;  2QBY A;  2FX0 A;  1ETO A;  2UUZ A;  1R36 A;  1O3Q A;  4ZYD A;  2BY1 A;  2VBY A;  3ONQ A;  2M0M A;  1FOW A;  2ECC A;  3PUB A;  5EEA A;  3EYI A;  2HQR A;  3M8J A;  2IS6 A;  4A3D J;  2AO9 A;  3LA2 A;  4YRV A;  1A35 A;  1A36 A;  3OYN A;  1WH5 A;  3CCJ I;  2W85 A;  3CD6 I;  1KU7 A;  2V26 A;  3KPH A;  2VXZ A;  3ML6 A;  1XSV A;  4E7L A;  2CV2 A;  4LLN A;  4KN7 X;  4AVZ A;  1U5T A;  2PQ8 A;  1D3Y A;  2YR2 A;  3B02 A;  3E0J B;  2JN6 A;  4XOR A;  5LRR A;  3F3X A;  5KAI C;  4AIK A;  2HVQ A;  3N05 A;  3CF2 A;  2FJ1 A;  1HDP A;  2ZNZ A;  5CVI A;  3F6O A;  3W2A A;  3BJ6 A;  2A6H F;  4LIT A;  4EJV A;  1B9N A;  1YO5 C;  3ZRG A;  2GM4 A;  4KMF A;  3S3O A;  1V5E A;  2BY0 A;  1JKR C;  2QYO A;  4UUV A;  5DDG A;  3NWT A;  3AAF A;  3A2K A;  1U9N A;  2XUB A;  4G6Q A;  3UKG A;  4F52 A;  4MLO A;  1Z21 A;  5L3B A;  2A07 F;  4G7Z F;  3F6V A;  1X3U A;  4XK4 A;  3G1L A;  4BQO A;  1D1C A;  1RZ4 A;  1W36 C;  1TW2 A;  1MMA A;  4HYE A;  1FYM A;  5D5X B;  2CV0 A;  5B5E C;  2PJR B;  1ZLJ A;  2K85 A;  4A0Y A;  2DXI A;  4M3F A;  3JTG A;  1SVO A;  1XG1 A;  5BOX A;  3HTS B;  1TTY A;  3E6B A;  5LLQ A;  3ZN0 A;  4X1E A;  1FY7 A;  2BV6 A;  4N4N B;  1T2K A;  2VUM J;  3OIO A;  5JVT A;  3KP4 A;  2L5Q A;  1OQY A;  2L0K A;  3QU3 A;  3LFU A;  2KPM A;  2VXD A;  4MHG A;  5EGO A;  2RNJ A;  4GFB A;  2QM3 A;  3IKT A;  2CGP A;  3E97 A;  2WC2 A;  5GP9 A;  3HGG A;  4ESJ A;  1YRN A;  4A3F J;  4NBQ A;  2VT3 A;  5HLG A;  1P4A A;  3OY9 A;  3ZXS A;  1WJA A;  2P8T A;  3LSM A;  3M07 A;  1EKE A;  1SD6 A;  3KLO A;  3IL2 A;  4ZDL A;  5CQE A;  1IO2 A;  2L9N A;  3KEO A;  1JKO C;  1F5T A;  5DUK A;  2I5U A;  2XAS A;  2NS8 A;  2NVY J;  5FKL A;  3Q9V A;  5CPR B;  5LFA A;  1KA8 A;  3ABU A;  4BXF A;  1UHM A;  2F4M B;  3C2G A;  3HOU J;  4V2F A;  3H1C A;  2L2O A;  4DBR A;  2DYR H;  1MBE A;  4QTR A;  3CJT B;  3V7C A;  1E3P A;  3A0H C;  4XMY A;  3I9V 2;  3ERE D;  1S5L C;  3MN2 A;  2KT0 A;  4DBQ A;  2LMD A;  3GTK J;  3HHH A;  4CIC A;  2R7D A;  3FMS A;  5K7F A;  1T8I A;  1ERD A;  2KRC A;  3JCU C;  1R23 A;  3Q0V A;  2VC0 A;  1I6H J;  1A6I A;  1YLF A;  1MMN A;  4JOM A;  1DQU A;  2TDX A;  1QNT A;  3BDD A;  4CZC A;  1YJW I;  2VQC A;  5LEK A;  4IOC F;  1B6A A;  2GWR A;  1ZAO A;  2K27 A;  1ZLK A;  3DEW A;  2VPR A;  1PVE A;  3EDP A;  3O8G A;  5FFX A;  4XKC A;  3CP2 A;  4B48 A;  5D5V B;  4M71 A;  5FJ8 J;  3VWB A;  1GV5 A;  1D0Y A;  4Y52 J;  3TP3 A;  1XGN A;  3WG7 H;  2R4G A;  4L0Y B;  3E5X A;  2H8W A;  2LFB A;  5J3L A;  1IRZ A;  1K61 A;  3GYH X;  1TW3 A;  4X6A J;  2L7K A;  2BE5 F;  3H36 A;  2EBI A;  3K4C A;  2JVH A;  5F1R A;  4A0X A;  2IA2 A;  3BT9 A;  2HEO A;  3B6A A;  2BVM A;  1WHU A;  1M1E B;  2XGE A;  2L7M P;  3LQR A;  3EUH C;  4CCJ A;  2XC7 A;  4IHT A;  2IAI A;  1D0Z A;  1HW5 A;  2FBK A;  3CLO A;  1VI0 A;  3PQK A;  3EUH A;  3I0T A;  3J7Y J;  3FXK A;  4BS9 A;  3ZQC A;  3R60 A;  4E7Z A;  1B72 A;  2LRE A;  4BDZ A;  1X1C A;  1JJ8 C;  4BJ5 C;  1ENH A;  2IRF G;  2R7S A;  3C2B A;  1BL0 A;  4M74 A;  4GXO A;  1YG2 A;  4EMS A;  2DA2 A;  2LTP A;  1BI1 A;  2ZJQ F;  5DS9 A;  1UST A;  3CUO A;  3WE3 A;  2P4W A;  4PJN A;  1GVD A;  5LGT A;  1T33 A;  4MFD A;  3EUK L;  1EH6 A;  1Z9C A;  2WAQ N;  3D5S C;  2A05 A;  3K4B A;  1KQ0 A;  4O5V A;  4L9V A;  3BZK A;  2H94 A;  1X4P A;  3ELK A;  1KQ8 A;  4IXA A;  2KJC A;  4UV8 A;  2R7V A;  2EPF A;  4A3K J;  2QKL B;  2CQQ A;  1IRF A;  2MA3 A;  3BTJ A;  4M3D A;  4RA2 A;  1BI3 A;  3M7G A;  5TGT A;  1WCM J;  2CW8 A;  5F0F A;  1A5J A;  3WTU C;  1RC9 A;  1W0T A;  3FDY A;  1K83 J;  5HS8 A;  3OSF A;  1JI8 A;  1J5Y A;  2Y0M A;  2ID6 A;  4UV9 A;  2HTJ A;  2N8G A;  2MLG A;  4BH9 A;  3RZO J;  3BY6 A;  5LD2 C;  5E8I A;  1QO0 D;  3AG3 H;  2DPD A;  2DJN A;  4HNV A;  4AU7 A;  3CCY A;  1MKM A;  1BJA A;  4PCQ A;  2GXA A;  4RLQ A;  4GYI A;  2K02 A;  3RPU D;  1TWH J;  3OYK A;  4ZYA A;  3MMY B;  3RTR A;  1SAU A;  3T8T A;  1VQ9 I;  3PNY A;  1YQA A;  2WV1 A;  2D1H A;  4A3C J;  1VQN I;  3ZP5 A;  3JTH A;  3J7A O;  2JSP A;  1DPU A;  3FXJ A;  1IJW C;  1VFC A;  3D0S A;  2VOD A;  2NOJ B;  4EM1 A;  2FBH A;  3CDL A;  1T56 A;  5HDK A;  1R9T J;  2P5K A;  2VAS A;  1X1A A;  4M3E A;  2NRA C;  2EQR A;  2XIG A;  3K10 A;  5HOD A;  1VQM I;  2OCE A;  4HX8 A;  4EGY A;  1YIT I;  2HFH A;  1QRY A;  2H1L A;  5E1X A;  3MFK A;  4NQW B;  2Y0S N;  1WJE A;  4BUP A;  3W2V A;  1AWC A;  4M6X A;  2VOO A;  2EIK H;  4BXU A;  1U2W A;  3AG1 H;  4WXC A;  4CSW A;  4IRI A;  4Q47 A;  5HLH A;  5EEH A;  2IJL A;  1Y1V J;  1RUN A;  2XPV A;  4BE2 A;  3SZG A;  1MGT A;  1I3A A;  5E8G A;  5H6R A;  5L3C A;  5F0H A;  3FHN A;  3GWZ A;  4UVA A;  1YTY A;  2ZNY A;  2KZV A;  3FMQ A;  3QP5 A;  2HU9 A;  4G12 A;  3MKZ A;  1MD0 A;  2V4J C;  4M9S A;  1RR7 A;  4PFO A;  4HNU A;  4KIF A;  1LPQ A;  1IXS B;  4ZYH A;  4ESB A;  1NK2 P;  1WFX A;  1MMG A;  3U1K A;  1U5T B;  1ON1 A;  2BYV E;  1ZN2 A;  4AUX A;  2JT1 A;  5J4V A;  5HLT A;  2VJJ A;  1J59 A;  1T95 A;  3JRI A;  5J1Y A;  3ZMU A;  1LE8 A;  3KFW X;  2FE3 A;  4I02 A;  1E17 A;  2HOS A;  4RMN A;  3I5U A;  2MSY A;  5DD4 A;  4WXH A;  4WK8 F;  3PIP F;  2JJ7 A;  3L00 A;  3O3K A;  5DYM A;  1H8A C;  3HG9 A;  3DTE A;  3HSE A;  2PMZ N;  1FYL A;  2HYF A;  1WJD A;  2F6C A;  1RNL A;  2D2W A;  2IA1 A;  1P6R A;  3S1N J;  2ZKZ A;  5AIP A;  2QQA A;  1WPK A;  2VN2 A;  3E6D A;  4FX4 A;  1T39 A;  2XB5 A;  3TO6 A;  2EV0 A;  4UY8 I;  2K7L A;  1FP2 A;  2KIM A;  2LNB A;  1GHC A;  2MH2 A;  3IV5 A;  5BS6 A;  3OYG A;  2FXA A;  1E0E A;  1QA6 A;  3L2R A;  3V8J A;  1Q1V A;  4GRI A;  2AQE A;  1XGM A;  2DT5 A;  2LLK A;  4I09 A;  3P9C A;  1ETX A;  1R71 A;  4D0P A;  3DBH B;  4FHT A;  4HSR A;  4UVB A;  1MJ9 A;  1OCR H;  2IGK A;  3HGY A;  1WKM A;  2HI3 A;  3FIS A;  4OAZ A;  1F4K A;  3SEZ A;  2A68 F;  1JE8 A;  2X1C A;  4EEF G;  3C7J A;  3ZGK A;  2FU4 A;  2E1M B;  5EGO B;  4D1Q A;  1W36 D;  3B73 A;  2D1V A;  3K6G A;  3DTI A;  4XNF A;  4A93 J;  1TC3 C;  2EZI A;  3BG7 A;  1ZRC A;  4CDG A;  2DA3 A;  3J81 K;  1YRN B;  3KYL A;  2DQR A;  3CC4 I;  3RQ4 A;  4U7D A;  4BHB A;  3E1S A;  4DYR A;  4LB6 B;  4L18 B;  3W6K B;  4IJA A;  4YII A;  1DP7 P;  3M1C A;  4RAZ A;  2M8G X;  4KJZ A;  4II2 A;  1X58 A;  3SJM A;  1VTN C;  2CUJ A;  1ZGW A;  2HKX A;  3HEF A;  4JBA A;  1J75 A;  1LDD A;  2OU2 A;  5C4X J;  1WZ2 A;  1YX3 A;  4A5N A;  1X1D A;  1WJF A;  3MVP A;  5E18 F;  1S7O A;  1Y0N A;  4PDK A;  3UNG C;  4RAY A;  2ZXJ A;  4A3L J;  5AON A;  3RPQ A;  3KYD B;  1X3Z B;  2CUE A;  1W5C C;  2HR3 A;  2K4B A;  5F64 A;  5KK1 A;  1PJR A;  1UZC A;  3OYM A;  4KT5 C;  2E7W A;  4AIJ A;  3I3L A;  4LIU A;  2LY2 A;  3FXL A;  2XAF A;  4V2G A;  1XMX A;  1S8N A;  2XKP A;  2XPU A;  1IG7 A;  1OYI A;  4RB1 A;  3R61 A;  1AU7 A;  2CO5 A;  3H0D A;  2AXT C;  2F5C A;  3NRV A;  2EV5 A;  2XB0 X;  3IHU A;  4BJT A;  1W0U A;  3S1Q J;  2GBY A;  2R7Q A;  3RKY A;  4BHC A;  2YX7 A;  1T6S A;  3V7S A;  3W2W A;  1R4N B;  2EFP A;  4A3M J;  1XD7 A;  5LRS A;  2G0E A;  4HZF A;  2DBB A;  3FX3 A;  3BR3 A;  5IOZ A;  2KFD A;  4A12 A;  2ECB A;  1OPC A;  1SD7 A;  1HDD C;  3S15 J;  5DCF A;  3N97 A;  2O61 A;  2IS2 A;  1R5I D;  3VPR A;  1SFO J;  2D5V A;  4HQE A;  2P6T A;  3COA C;  3HRM A;  2HQN A;  4AD9 A;  3U9G A;  4RM2 A;  2KIU A;  5FKK A;  3HOW J;  1ETV A;  2VBX A;  1BN5 A;  2QCO A;  4EJO A;  1B8I A;  1OYY A;  3TOA A;  1VQK I;  3LNQ A;  2R7F A;  2XSJ C;  5ICC A;  1B72 B;  5LBQ A;  3KET A;  1S7A A;  2NOG A;  3AKZ A;  1I50 J;  3ZN1 A;  4C3J J;  1JGS A;  2KDO A;  3H35 A;  4HF1 A;  1RES A;  2W84 A;  4DQ2 A;  5FKM A;  4IPA A;  1CF7 A;  3MKL A;  2RQP A;  5K7Z A;  2JK3 A;  3KCC A;  5EZG A;  1JUP A;  2M34 A;  3H9Q A;  3L2U A;  4P9F A;  4U0W A;  2MW8 A;  3HM5 A;  2VON A;  1BBY A;  2P6S A;  3HKZ A;  1RKT A;  2LH9 A;  3MZ8 A;  4HAM A;  5HLI A;  2FMY A;  4XKW A;  3GFL A;  4NC8 A;  1N75 A;  3S2W A;  3DBL B;  1SD4 A;  2X4H A;  2Q8K A; 
#chains in the Genus database with same CATH homology
 4OIQ F;  1HW2 A;  2COM A;  5K5R A;  1MJA A;  1J2X A;  2YU3 A;  4BNC A;  4G6D A;  2QQ9 A;  4ENJ A;  2EA2 A;  1RUO A;  3WTS C;  1UHW A;  4IRG A;  2O8X A;  2ZFW A;  3GFI A;  1HKT A;  3KP3 A;  2RGV A;  1XSX A;  4GGG A;  1R5H A;  2FRH A;  2Z5U A;  3QP6 A;  1LEA A;  1R7J A;  4HBL A;  4Q4Z F;  5D6F A;  1T38 A;  3R4K A;  5CVV A;  2XV4 S;  1YW8 A;  1YIO A;  1R00 A;  1Z6R A;  2JPB A;  2RC4 A;  3KE2 A;  3CUQ B;  4RB3 C;  4RGX A;  1F9N A;  3CO6 C;  4OIP F;  4HV6 A;  4ASN A;  4K2E A;  2PN6 A;  3E5U A;  3H3Z A;  4L5J A;  3GX4 X;  1I1S A;  1IN8 A;  1XB4 A;  5DCM A;  4LJZ F;  5FB2 A;  2WWY A;  3G3Z A;  1SFX A;  1NHA A;  4P9U A;  3TGN A;  3GO5 A;  1R1U A;  2P7V B;  2M5W A;  2RN7 A;  2LF8 A;  4DNC A;  3JAM Z;  2DQL A;  3JW4 A;  1QBJ A;  3LST A;  4WCG A;  5CLS A;  3GUD A;  3PFI A;  2OQR A;  1W7P A;  1LB2 A;  1QZY A;  3JSP A;  3MZH A;  5E1Z B;  3HOS A;  4G7O F;  2HTS A;  1QQI A;  1FP1 D;  3I53 A;  4HDV A;  3BPX A;  3MWM A;  3SHF A;  3ZPL A;  5KVR A;  2IA0 A;  1FBQ A;  3FF5 A;  1KYW A;  1CGP A;  4UVC A;  1HXD A;  1O57 A;  3LA3 A;  1O3R A;  1K6O A;  4R79 A;  2M45 A;  4XSZ F;  2A69 F;  4GO1 A;  4HQM A;  3SZP A;  4JK1 X;  1FOK A;  4MEY F;  4MGR A;  4G94 A;  4KNY A;  2BBY A;  3GEZ A;  3ECH A;  1BIB A;  3KP2 A;  1UFM A;  2NS0 A;  3DKW A;  5D8K B;  3WE2 A;  2WV0 A;  3FXR A;  1PUE E;  3OOP A;  4A6D A;  2NAZ A;  3I59 B;  3IC7 A;  3V4G A;  4HA8 A;  1ZGJ A;  4JQF A;  3CO7 C;  1XGO A;  5TJJ A;  1D8K A;  1ZRF A;  1MDM A;  1A04 A;  2RDP A;  3RDI A;  3R6S A;  5LHG A;  4WWC A;  1WRJ A;  4UNO A;  4I2O A;  4M6Y A;  1LNW A;  2QVO A;  1HKS A;  1RI7 A;  2L4A A;  3K9T A;  1IUY A;  1WSU A;  1YS6 A;  1WI9 A;  2AXL A;  3QU6 A;  3V8L A;  1IW7 F;  4MQV A;  4RS8 A;  1R5G A;  4H0E A;  3HUG A;  2VT2 A;  1FBS A;  3DPL C;  3F23 A;  3MZY A;  2LSO A;  2V1X A;  3SZT A;  4LG0 A;  1TQM A;  2C6Y A;  5L3F A;  2PFB A;  1MJB A;  5HVQ C;  1AOY A;  1EV7 A;  2KJB A;  4KFC A;  4BHP A;  1FC3 A;  3HRS A;  4MNU A;  1KU3 A;  2DFI A;  2L4M A;  5BPD A;  2ZO4 A;  2OQG A;  1ONV A;  4B09 A;  4I01 A;  5L3G A;  4L5I A;  2HZT A;  2F5F A;  3GW2 A;  1QPM A;  3GXO A;  1KQ9 A;  1H9G A;  5DD8 A;  1J0R A;  3FXU A;  4ETS A;  3IWF A;  4MTD A;  4N9I A;  5ICE A;  3GFM A;  3P9I A;  3GVA A;  4CXF A;  5DUI A;  2ETH A;  4YFX F;  3Q9S A;  2V6C A;  2E1N A;  2FOK A;  3KZY A;  5TRD A;  4OOI A;  1IF1 A;  1O3T A;  1U78 A;  4HX7 A;  4S04 A;  3HTU A;  4GCV A;  5ILU A;  1W5T A;  3R0A A;  1WQ2 A;  4LD5 A;  2EFO A;  2HOE A;  3FHZ A;  2L01 A;  3TO9 A;  1IN6 A;  2EK5 A;  2VE8 A;  1U6G A;  3GFJ A;  4OMZ A;  1BI2 A;  2EWN A;  4YIF A;  2KIF A;  1GXP A;  1OKR A;  1P92 A;  5LGN A;  5DCM B;  2W25 A;  2QBY B;  1Y0U A;  1YW9 A;  3ZMT A;  3I64 A;  1TBX A;  2Z33 A;  4NHJ A;  2DK8 A;  5D8L B;  1ZHF A;  4YFN F;  2ADU A;  1FPQ A;  2Y48 A;  2CWE A;  3CUQ C;  5ED4 A;  5ERI A;  1HBX G;  1KYZ A;  2FBI A;  1JHH A;  1W7P B;  1K78 A;  4EJT A;  4KUM A;  2IW5 A;  4LLG F;  2STT A;  2HGC A;  2QLZ A;  3TO7 A;  3QOP A;  3N4M A;  3QRF F;  4KDP A;  1UB9 A;  2JZY A;  5LGU A;  3ZMV A;  4P55 A;  1ZG5 A;  1W7P D;  4FT8 A;  3BJA A;  2FF4 A;  3I71 A;  3VEP A;  2VBZ A;  3ZMS A;  1H9T A;  3HOT A;  3KP7 A;  2ZBK A;  3ROU A;  2HDC A;  2PJP A;  4CO8 A;  3BOQ A;  2W57 A;  4OMY A;  5LHI A;  5BQT A;  2ESN A;  4XBF A;  2DTR A;  2O3F A;  2VOP A;  3H92 A;  1T0F A;  5K5O A;  2EFN A;  5AIQ A;  3V7R A;  2M1B A;  3DP7 A;  2A61 A;  4O6J A;  3HSF A;  2XRO A;  3BWG A;  4Q5S F;  2Z99 A;  1FT9 A;  4E70 A;  2XKO A;  3K0L A;  1W4M A;  2M87 A;  4UHT A;  4ZZD A;  3VB2 A;  3DQV C;  3T0Y A;  2A5Y B;  4LMY A;  2YX4 A;  1S3J A;  3MEX A;  1TQP A;  2G7U A;  1MDM B;  2V9V A;  1O7L A;  2JPC A;  3WTZ A;  2ZCW A;  4I0A A;  4HLY A;  4EJU A;  3PQJ A;  3ULQ B;  3RKW A;  2CFX A;  4LB5 A;  4L9J A;  3DXJ F;  2FML A;  2V1D A;  1IXC A;  1TLH B;  2EV6 A;  2GA1 A;  5LHH A;  5HDN A;  1YYV A;  3HRU A;  4XLP F;  2WTE A;  2B0L A;  4U0V A;  1R58 A;  4HW0 A;  2OAZ A;  4Y17 A;  2XGX A;  3REO A;  3TKY A;  2KRF A;  2XAG A;  1IRG A;  1ZG3 A;  4ZYG A;  3WOD F;  2R3S A;  1BC7 C;  4LG0 B;  2G7H A;  4PZJ A;  2OZU A;  5CJ9 A;  3CDH A;  2MC3 A;  2UXN A;  3NQO A;  4RB2 C;  2X0L A;  4M9X A;  3LQQ A;  3D5L A;  5FFZ A;  2FNP A;  4HV5 A;  3GZ6 A;  2QUF A;  1MZB A;  4RGR A;  4EV0 A;  2A3S A;  2ISY A;  5E17 F;  3I58 A;  2XAJ A;  2FQ3 A;  1ZRD A;  3LAJ A;  1IAW A;  3L09 A;  2A6E F;  3F21 A;  2UWM A;  2J5P A;  5K1Y A;  3T5X A;  2V1U A;  4KMU X;  4KIG A;  4QWQ A;  4XRF A;  1I6X A;  1HW1 A;  1FNN A;  2ZME A;  1E2X A;  4A2U A;  4KIB A;  2GAU A;  2CW0 F;  2IP2 A;  5JFR A;  1DDN A;  2MD5 A;  3MAJ A;  2HKO A;  4PGH A;  2ELH A;  3GF2 A;  4U88 A;  3E6M A;  1GVJ A;  3MCZ A;  4ON0 A;  5JI6 A;  4EQQ A;  1P2F A;  3G73 A;  1Z1D A;  1DUX C;  1IZ1 A;  4MQ9 F;  2O6G E;  2FEZ A;  3JAM K;  3QAH A;  5JR3 A;  3M8E A;  5HDG A;  2UZK A;  2O03 A;  3KEQ A;  4WXD A;  1ZRE A;  4A6E A;  4TV7 A;  1Q1H A;  3L7W A;  4M73 A;  1HSJ A;  5J8C A;  4IRH A;  2EFQ A;  2H6B A;  4O3M A;  3RI4 A;  1G3W A;  5CYV A;  1I5Z A;  1HQC A;  2QWW A;  3F72 A;  5EEG A;  1L3L A;  4A0Z A;  4KA4 A;  1XGS A;  2LF7 A;  2Y75 A;  2PMH A;  1SFU A;  1P4W A;  1ON2 A;  1LJ9 A;  3LFK A;  2VE9 A;  3E5Q A;  3WTV C;  1ZG1 A;  1R1T A;  2NNN A;  4M72 A;  3P7N A;  1JHF A;  1V4R A;  1P4X A;  3C18 A;  5A2Q Z;  1ZGA A;  4WF2 A;  1K79 A;  5D6E A;  4WX9 A;  4MEX F;  2MLK A;  1S6L A;  3WTT C;  4EM2 A;  2FA5 A;  1LVA A;  1Z05 A;  3SXY A;  2PI0 A;  2LDU A;  4G8X A;  1U5T C;  2GXG A;  2RKH A;  3FXQ A;  3C1D A;  1STZ A;  4KN4 X;  3ZMD A;  1IN5 A;  3EET A;  1OMI A;  2ISZ A;  4OIO F;  4ZH4 F;  1G3Y A;  4RGS A;  4R8H A;  4NB5 A;  3J80 Z;  5CVU A;  2P5L C;  2E1C A;  2EB7 A;  2E7X A;  3F8C A;  2IT0 A;  4YG2 F;  5L3D A;  4Z2Y A;  2G9W A;  3TDU C;  1FYK A;  2AS5 F;  5IT9 K;  2ZJ2 A;  2OZ6 A;  3WGG A;  1OYW A;  4HX4 A;  2ACJ A;  2M30 A;  2DU9 A;  5DV5 A;  5FD6 A;  5D5W B;  1QGP A;  1IN4 A;  1R1V A;  2P5V A;  5BPI A;  4P96 A;  2XVC A;  2RVC A;  3DV8 A;  4RGU A;  1QZZ A;  4AWX B;  1PP7 U;  4EJW A;  4CHU A;  4LLL A;  1S29 A;  3I4P A;  1G3S A;  2IVM A;  1BC8 C;  1FSH A;  4UXN A;  2W24 A;  2L3D A;  2DAO A;  4HOB A;  2MH9 A;  3TQN A;  2H6C A;  3HSR A;  4ZYE A;  2L54 A;  1T98 A;  5FGM A;  1PP8 F;  5ILV A;  4YFK F;  2VBW A;  1EH7 A;  4HDU A;  1KU2 A;  3L9F A;  1B59 A;  3IKV A;  5IT9 Z;  4ENN A;  2CQK A;  1HST A;  2XAQ A;  3IWZ A;  2GXB A;  1EH8 A;  4CZZ A;  2LKP A;  2HS5 A;  5FD5 A;  1J9I A;  4LFU A;  1CF7 B;  1I27 A;  3L2C A;  1B9M A;  2M8E A;  2IPQ X;  3O2P E;  5DEQ A;  3RKX A;  3H3U A;  1SAX A;  5CVR A;  2Q0O A;  2Z3Y A;  1IXR C;  1XCV A;  1FWZ A;  2JRT A;  2UXX A;  5H20 A;  1XDS A;  2XRN A;  1SMY F;  5L3E A;  5HOO A;  3WU1 B;  5D4S A;  1XSD A;  4CYD A;  4HF0 A;  4N0B A;  5E1W A;  2YSR A;  2DO7 A;  5J8F A;  4OIN F;  1WWX A;  1G3T A;  3SFZ A;  1U3E M;  1XDU A;  1ZYR F;  3BZ6 A;  3RYP A;  4BAY A;  4IF4 A;  2ZME B;  4U0Y A;  4LK1 F;  3DEU A;  5FO5 A;  1SMT A;  2QEN A;  3NEU A;  3JSO A;  1B1B A;  1G6N A;  4L0Z B;  4GYG A;  3KLN A;  2K4J A;  1LQ1 A;  1H0M A;  1BIA A;  3RIR A;  2J5O A;  2YPR A;  1XMK A;  2FSW A;  1ZH5 A;  4IHS A;  3OV8 A;  4LGW A;  1F1Z A;  2CSO A;  2HYG D;  2KKO A;  3VOE A;  1K7A A;  3W6J B;  2QQB A;  3CJN A;  4LK0 F;  2NYX A;  2JSC A;  2HWV A;  2H27 A;  4G9Y A;  1I1G A;  5LEJ A;  1B4A A;  1YS7 A;  1W5S A;  1R22 A;  2PBI A;  3U2R A;  4A5M A;  2OA4 A;  1G4D A;  3IRR A;  2BEO A;  2V79 A;  1LDK B;  3MQ0 A;  3K1M A;  3VOD A;  4ENM A;  3VFZ A;  2OBP A;  3HHG A;  3IRQ A;  4I98 B;  1V3F A;  3T8R A;  1C0W A;  3CUQ A;  1J7K A;  2CG4 A;  4P5O A;  1USS A;  4PGG A;  4F7Z A;  3ZMZ A;  2DI3 A;  3M8F A;  2GIV A;  4S05 A;  4EVI A;  3WG9 A;  3TOB A;  1JXS A;  4G7H F;  1RIO H;  4U7B A;  2VC1 A;  4B8X A;  1BM9 A;  3WU0 A;  3WTW C;  1XN7 A;  5H6Q A;  3WGI A;  4KIC A;  1Z7U A;  4EM0 B;  4R1H A;  1ODD A;  4CGZ A;  3CTA A;  4XSX F;  1XMA A;  1FSE A;  5D5U B;  1YW7 A;  3KP6 A;  2H09 A;  3K1P A;  4Q48 A;  2EA4 A;  3F8B A;  5FLX K;  3FMR A;  4XLN F;  3EQL F;  1KU9 A;  3LA7 A;  2CYY A;  3ABT A;  1ZAR A;  1SD5 A;  2P7C B;  3E3V A;  2GZW A;  2DPU A;  3HYI A;  4OU0 A;  3WTX C;  1OR7 A;  5IT3 A;  3KZZ A;  2EFW A;  2JTV A;  4Y13 A;  3TDZ C;  3BJO A;  1O3S A;  4ENK A;  3F8F A;  4BYY A;  2Q2E A;  3K69 A;  3R0J A;  3M9A A;  4L9N A;  1UCR A;  3HRT A;  3F8N A;  3BPV A;  5HS7 A;  4I7H A;  4KYW A;  3T1B A;  4ESF A;  5FLX Z;  5JHU A;  4OIR F;  1PDN C;  1BOA A;  2F2E A;  5F6F A;  2EJR A;  1FZP B;  2NNY A;  3KP5 A;  3I54 A;  6PAX A;  3V8K A;  4EGZ A;  3K2Z A;  1KGS A;  2GQQ A;  3J81 Z;  5CVJ A;  4MTE A;  3RYR A;  3I59 A;  3QPH A;  1HKQ A;  4FX0 A;  5D4R A;  2STW A;  3BRO A;  4AIH A;  5J6X A;  2OD5 A;  3GZ5 A;  1FX7 A;  3C3W A;  1ULY A;  2FNA A;  5BMZ A;  2PEX A;  4IVN A;  1LEB A;  1Z91 A;  4QLC U;  1LDJ A;  2ESH A;  3QPT A;  1TNT A;  1FBU A;  2L02 A;  1L0O C;  3FM3 A;  2RV8 A;  2DLL A;  2K86 A;  3F8M A;  5E20 A;  3U1D A;  3WTY C;  3GLX A;  3WGH A;  5HS9 A;  2GA2 A;  4HLX A;  3F22 A;  3FM5 A;  1Z6T A;  3HIF A;  2Z9O A;  2DK5 A;  3FZV A;  3K1N A;  3DFG A;  4L9T A;  2BGC A;  4HF2 A;  3BP8 A;  2D45 A;  1BI0 A;  3SQN A;  1SFE A;  3ISP A;  3LWF A;  3ZQ7 A;  2MBF A;  3DPT A;  3O6B B;  3LAP A;  4N9H A;  2PLY A;  2F5E A;  1YFH A;  1FLI A;  3RPU A;  3RJP A;  4ZZL A;  3P9K A;  5A2Q K;  4AVP A;  4RB0 A;  4M9Z A;  1DPR A;  3ECO A;  3FWE A;  5ICG A;  1U8R A;  1GXQ A;  4I0B A;  5ICF A;  1TNS A;  2F5D A;  2XAH A;  1IN7 A;  3E6C C;  3Q5F A;  3EYY A;  4Y15 A;  2QZ8 A;  1O7F A;  5K5Q A;  3J80 K;  2O0Y A;  1D5V A;  1XCB A;  5ILS A;  1K78 B;  1TQI A;  4BQA A;  3DF8 A;  2PMU A;  1D8J A;  3M1E A;  2DW4 A;  1REP C;  4NQW A;  2XHK A;  2PG4 A;  2QBY A;  1R36 A;  1O3Q A;  4ZYD A;  2VBY A;  3EYI A;  2HQR A;  3LA2 A;  2W85 A;  1KU7 A;  2VXZ A;  3ML6 A;  1XSV A;  4LLN A;  4KN7 X;  1U5T A;  2PQ8 A;  1D3Y A;  2YR2 A;  3B02 A;  5LRR A;  3F3X A;  4AIK A;  2ZNZ A;  5CVI A;  3F6O A;  3BJ6 A;  2A6H F;  4EJV A;  1B9N A;  1YO5 C;  4KMF A;  2QYO A;  4UUV A;  5DDG A;  3AAF A;  2XUB A;  4G6Q A;  5L3B A;  2A07 F;  4G7Z F;  3F6V A;  1X3U A;  1RZ4 A;  1TW2 A;  4HYE A;  1FYM A;  5D5X B;  1ZLJ A;  4A0Y A;  3JTG A;  5BOX A;  3HTS B;  1TTY A;  3E6B A;  5LLQ A;  3ZN0 A;  1FY7 A;  2BV6 A;  1T2K A;  5JVT A;  3KP4 A;  3QU3 A;  4MHG A;  2RNJ A;  2QM3 A;  3IKT A;  2CGP A;  3E97 A;  2WC2 A;  4ESJ A;  2VT3 A;  5HLG A;  1P4A A;  2P8T A;  1SD6 A;  3KLO A;  3IL2 A;  3KEO A;  1F5T A;  5DUK A;  2XAS A;  3Q9V A;  1KA8 A;  3ABU A;  1UHM A;  3V7C A;  3ERE D;  3HHH A;  4CIC A;  2R7D A;  3FMS A;  1R23 A;  2VC0 A;  1YLF A;  2TDX A;  1QNT A;  3BDD A;  5LEK A;  1B6A A;  2GWR A;  1ZAO A;  2K27 A;  1ZLK A;  3EDP A;  5FFX A;  5D5V B;  4M71 A;  1XGN A;  4L0Y B;  3E5X A;  3GYH X;  1TW3 A;  2BE5 F;  5F1R A;  4A0X A;  2IA2 A;  2HEO A;  3LQR A;  4IHT A;  1HW5 A;  2FBK A;  3CLO A;  3PQK A;  3EUH A;  3I0T A;  3R60 A;  2IRF G;  4M74 A;  4GXO A;  1YG2 A;  4EMS A;  1BI1 A;  1UST A;  3CUO A;  3WE3 A;  2P4W A;  5LGT A;  1EH6 A;  1Z9C A;  1KQ0 A;  4O5V A;  4L9V A;  2H94 A;  3ELK A;  1KQ8 A;  4IXA A;  2KJC A;  4UV8 A;  1IRF A;  2MA3 A;  1BI3 A;  3M7G A;  3WTU C;  5HS8 A;  1J5Y A;  2Y0M A;  4UV9 A;  2HTJ A;  2MLG A;  4BH9 A;  3BY6 A;  5E8I A;  1QO0 D;  2DPD A;  1MKM A;  1BJA A;  4PCQ A;  4GYI A;  2K02 A;  3RTR A;  3T8T A;  1YQA A;  2D1H A;  3ZP5 A;  3JTH A;  3J7A O;  1DPU A;  3D0S A;  2VOD A;  4EM1 A;  2FBH A;  5HDK A;  2P5K A;  2NRA C;  2XIG A;  4HX8 A;  4EGY A;  2HFH A;  5E1X A;  3MFK A;  1AWC A;  4M6X A;  2VOO A;  4BXU A;  1U2W A;  4WXC A;  4IRI A;  4Q47 A;  5HLH A;  5EEH A;  2IJL A;  1RUN A;  1MGT A;  5E8G A;  5H6R A;  5L3C A;  3GWZ A;  4UVA A;  1YTY A;  2ZNY A;  3FMQ A;  3QP5 A;  1MD0 A;  4M9S A;  4KIF A;  1IXS B;  4ZYH A;  4ESB A;  1U5T B;  1ON1 A;  2BYV E;  1ZN2 A;  2JT1 A;  1J59 A;  3ZMU A;  3KFW X;  2FE3 A;  4I02 A;  1E17 A;  3I5U A;  5DD4 A;  4WXH A;  4WK8 F;  3L00 A;  3O3K A;  5DYM A;  1FYL A;  3HSE A;  2HYF A;  2D2W A;  1RNL A;  2IA1 A;  1P6R A;  2ZKZ A;  5AIP A;  2QQA A;  2VN2 A;  3E6D A;  4FX4 A;  1T39 A;  3TO6 A;  2EV0 A;  2K7L A;  1FP2 A;  2KIM A;  2LNB A;  1GHC A;  2MH2 A;  5BS6 A;  2FXA A;  3V8J A;  4I09 A;  1XGM A;  2DT5 A;  3P9C A;  4D0P A;  4FHT A;  4UVB A;  1MJ9 A;  1WKM A;  1F4K A;  2A68 F;  1JE8 A;  3C7J A;  2FU4 A;  3B73 A;  2D1V A;  1ZRC A;  4CDG A;  3J81 K;  2DQR A;  4U7D A;  4BHB A;  4LB6 B;  4L18 B;  3W6K B;  4IJA A;  4YII A;  1DP7 P;  4RAZ A;  1VTN C;  2HKX A;  4JBA A;  1J75 A;  1LDD A;  2OU2 A;  4A5N A;  5E18 F;  1S7O A;  4PDK A;  4RAY A;  2ZXJ A;  5AON A;  3RPQ A;  2HR3 A;  2K4B A;  5F64 A;  5KK1 A;  4KT5 C;  2E7W A;  4AIJ A;  2XAF A;  1S8N A;  2XKP A;  1OYI A;  4RB1 A;  3R61 A;  2CO5 A;  2F5C A;  3NRV A;  2EV5 A;  3IHU A;  3RKY A;  4BHC A;  2YX7 A;  1T6S A;  3V7S A;  2EFP A;  1XD7 A;  5LRS A;  4HZF A;  2DBB A;  3FX3 A;  4A12 A;  1OPC A;  1SD7 A;  5DCF A;  3N97 A;  2O61 A;  4HQE A;  2P6T A;  3COA C;  3HRM A;  2HQN A;  4AD9 A;  3U9G A;  2KIU A;  2VBX A;  1BN5 A;  4EJO A;  1OYY A;  3TOA A;  2R7F A;  5ICC A;  5LBQ A;  3KET A;  1S7A A;  3ZN1 A;  1JGS A;  4HF1 A;  2W84 A;  4DQ2 A;  4IPA A;  1CF7 A;  2RQP A;  3KCC A;  4P9F A;  4U0W A;  2VON A;  1BBY A;  2P6S A;  4HAM A;  5HLI A;  2FMY A;  3GFL A;  3S2W A;  1SD4 A;  2X4H A;  2Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...