2TGAA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgaA02
4Z6AH 1SGCA 5GJ4B 3T2NA 1NFUA 1AKSA 2Z3DA 2M5TA 2ANMH 1LVYA 3TJOA 1TGNA 4D7FA 3U1JB 1HAXB 3AVZA 1CGIE 1QB9A 1LPZB 4YOGA 5DJ7A 2OUAA 1ESAA 3VB3A 2LNCA 2H9HA 3T25A 1PQ7A 1E37B 4O9VA 4BAMB 1YLDA 3U98H 3F9GA 1ZHMA 5DP5A 1ZTLA 1LQEA 3QZQA 1A2CH 3P8OA 1UTJA 2ZTZA 4U01A 2VWNA 1C2IA 2XBVA 1BJUA 1UHBB 2ZPRA 5EXNA 3GDUA 4ABDA 3SJKA 1CHOF 1D6RA 1P2OA 1F0SA 2BY6X 3A82A 2D1JA 1QGFA 3BG4B 3UQVA 2ZU5A 1MQ5A 1QR3E 1TX7A 1IQFA 4KTUA 1RJXB 5C20A 2FOMB 5AFZH 1WOFA 1UVSH 1A5HA 3O8BA 2BLVA 2A7JA 3DT0H 1ESBA 3RC4A 2OC1A 2F3CE 3C1KA 4I33A 6LPRA 1B0EA 2GX4A 1P12E 3HGNA 1C5TA 3M37A 4ZHMU 1K1LA 3UNSA 3UOUA 4D76A 1KXEA 2XTTB 2QY0B 1GHBF 4MPXA 4B74A 3AAUA 3Q3YA 1MZAA 2XCNA 1TNHA 1FAKH 3LJJA 4FUCA 4HGCA 6CHAC 3M5LA 1TGTA 3ITIA 1E35B 3PTNA 1ELTA 2OLGA 1QA7A 1TMTH 2JKHA 2P93A 1AMHA 1SR5C 1CSOE 3PTBA 1O3NA 2BMGB 1K1NA 2V6NA 1HB0B 1AY6H 4KELA 1E36B 1GBJA 4ZKRU 3NPSA 2UUFB 1Z8JB 4IGDA 4BTTB 1ZHRA 3L3TA 4B73A 1G3EA 1Z8GA 2QC2A 1O2TA 3BTGE 2VVVA 4RN6A 1SMFE 1S82A 1C2LA 3O8CA 1ZMNA 3MO3A 4DJZB 3T28A 1MKWH 2G8TA 2EI6A 1P9SA 2QA9E 1FAXA 2B0FA 1V2LT 3SOSA 5HYOA 3KCGH 5ESBA 1RTFB 3RXMA 3U8TH 2ZGHA 1EAUA 4IW4E 1GVZA 1Z1IA 3D65E 4U2WA 2BOKA 1TGSZ 3STIA 4OS7A 1K9OE 4MNXA 2PV9B 1DWEH 2VJ1A 1W11U 2WYGA 3VB5A 4XDEA 1EZUC 4AN7A 4XOJA 2ZA5A 2RA3A 1HAVA 1XUGA 1ARCA 1FJSA 4YT6H 5CHAB 1KLIH 4WF8A 4X1SU 1V2QT 1THSH 1O2QA 2UUYA 2VWLA 1GHXH 3A8AA 2JETB 4UDWH 1HNEE 1CVWH 1EX3A 4K3JA 2OC8A 4HZHA 1SGQE 5T3HA 1IQLA 1F0UA 1ID5H 1GDQA 1GMDF 5T6GA 1O2HA 1SLUB 1NC6A 1O3BA 2ODYB 1ZRBA 1W0ZU 1EJNA 3P8FA 5JBTA 3LU9B 1ETTH 2OBQA 5F8ZA 4Q7YA 3DA9B 1P2QA 1ZLRA 2QXGA 3MNXA 1AVWA 1BJVA 1TMBH 1OKXA 3Q3XA 2CV3A 1EP5A 1JIRA 2BVRH 2CHAB 2FWWA 2ZNKH 3P70B 1L0ZA 2ZDNA 1O3MA 2VIPA 3T26A 3TJUA 5A8ZA 2FM2A 5EU8A 2RDLA 2GZ9A 3VB6A 1C2FA 1BTYA 3TK9A 1YCPM 4YTAA 1S6HA 2HALA 4A1TA 4ZXYH 3SU1A 1CBWC 2R0KA 2XW9A 4B2CA 3CS0A 1NM6A 3SU6A 2ZHDA 1UCYK 4CRDA 5LPEA 2AFQB 2ZCKP 1FIWA 2NWNA 1P2IA 3QZRA 2G5VA 3ZVGA 2J4IA 3O8DA 4ZH8A 4ABEA 1QA0A 4KKDA 1SPJA 1GPZA 2BQWB 2A31A 1VITH 4BANB 5FBIA 2P95A 2EI8A 1P01A 2VVUA 3SGAE 5LGOA 1TX6A 1GBTA 4GPGA 4TYDA 7LPRA 3F9FA 3PM3A 1AUTC 1GJ7B 2C3SA 2ZTYA 1N8OC 3M5MA 1P10A 2FXRA 1AQ7A 1QQ4A 1TBZH 1UTMA 1YLCA 3FFGA 1ARBA 1KLTA 3BTQE 4ISNA 3F9EA 3M7TA 3RM0H 3MOCA 2PSXA 2SGAA 5FPSA 1HIAB 4GAWA 4ISLA 2HPPH 1AHTH 3PO1C 1SSXA 1P09A 4BAKB 3T5FH 4FVBA 2IPHA 1T4VH 4CBOA 3A8BA 3ZZ8A 3TGJE 1IOEA 3PWCA 1ZGIA 3EE0B 3MTYA 3ZZ7A 1DDJA 3K65B 1T32A 4Z0KA 3BEIB 1HAPH 1NRSH 5E8EH 5EOKA 1O38A 1J8AA 2VGCC 1CA8B 1ZTJA 1H8IH 5J4SA 1LTOA 1OP0A 1DS2E 3MH5A 1W3CA 2CGAA 4X1RU 1H9IE 2W26A 1VCQA 1ZYOA 2FOAA 1HJAB 4MPVA 3KN2A 4LK4A 1DVAH 1C4U2 1CGJE 4GHQA 1T8LA 5CHAC 2UWPA 2ILNA 2Y81A 1MTWA 1QL7A 2GTBA 2SGPE 1HFDA 2C8XB 4X6NA 2FX4A 1WYKA 1V2JT 1TMUH 1HAIH 4ABIA 3D49H 3IITA 2UUJB 1O5GH 4BOHA 1OXGA 1TYNA 3A7TA 2XC0A 1ELCA 5I46H 1GMCG 2BLWA 3MYWA 1O2UA 2BLOA 1E38B 1SL3A 4AFQA 2FYRA 3S9BA 2O8UA 4XFQA 1SOZA 1QHRB 2A4OA 1KXAA 5EQRA 1XVOA 5G4BA 1P11E 2PSYA 3A7VA 2ZFTA 1K1PA 1O5EH 1K21H 2VVCA 4NZLA 3EA9A 1FI8A 1GHAG 1HAYB 3GDSA 4BXWA 8GCHF 3A86A 1V2RT 1P8VC 3ZZBA 1G9IE 3T62A 1AWFH 1MD7A 3VPKA 1BMNH 4CRGA 1V2MT 1WU1A 1DSTA 5BPEA 1SC8U 2XXLA 4SGBE 4UFDH 3ZVFA 1TLDA 2VNTA 1UTLM 1PPGE 5DGJA 1LMWB 2PFEA 3RXCA 1TRYA 1SGRE 1TGCA 1ELAA 2CN0H 3FP6E 5JB8S 4HFPB 2JH5D 1CT2E 1L4ZA 2AH4X 4R0IA 2UWOA 2WPMS 1C4V2 3SNBA 3UWJH 2BVSH 3GCTG 3DD2H 1ZJDA 1GBEA 4WY3A 1G2MA 2TGTA 3F6UH 2ZKSA 4WJG2 3SU3A 2AMPA 4FVDA 3TK6A 5EXLA 1Y5UT 1TNGA 3RLWH 1K1JA 2FOEA 1UVOA 2ZPQA 2BYAX 1B7XB 1O32A 3QK1A 4X8TH 4AB9A 1O0DH 2ZECA 1MH0A 3M5NA 1DT2A 2GZ8A 1GL1A 4ZUHA 2AERH 1TNLA 1EB2A 1EPTA 2GMTB 5GCHG 1NRNH 4UFEH 3S69A 1ANEA 1GJAB 1OWKA 3Q77A 2IN2A 1C5ZB 1EQ9A 1AB9C 2BY9X 1D4PB 2BDYA 1F5LA 2CF8H 2VU8E 1T31A 2XBYA 4CREA 3MU5A 1XXFA 2SGQE 4DVAU 2G4UA 1W7GH 3RDZA 4THNH 3GY2A 2QGRA 2XWAA 1MAXA 1HV7A 1LPKB 2FOCA 1IQKA 2W3IA 1O3JA 1AWHB 3RXEA 5A8XA 2G4TA 4J1YA 2WV5A 1J16A 2HNTC 2WPIS 3TPIZ 3RP2A 2ALVA 2XRCA 2P3FH 1C1RA 1FY8E 1MKXH 1VITG 3ZZ6A 1K1OA 2FPZA 1UTNA 5L6NH 2HLCA 5AVDA 5LPFA 2FZZA 2QF3A 2AIQA 1XUHA 3MU8A 1PFXC 4Y71A 5JBBS 1LKBA 2OP9A 1WCZA 1A0JA 3FVFB 1ZSKA 3P8GA 1AKSB 3ZYEA 2AGIX 1GMCF 3L6PA 3KQDA 4OS5A 1KLJH 2WPJS 2TGAA 3BTDE 4X1NU 1GCTC 1HYLA 1GHVH 1ZJKA 1P57B 1OP8A 1SLXB 2ZWLH 4NG9H 1SVPA 1IQMA 3RXGA 2O9QA 2FOBA 1O2JA 2J2UA 1GHAF 3H5CB 1BUIA 3SU0A 2DE8A 1B5GH 1O3AA 3E8LA 3TH2H 3HPTB 1YCPH 2OBOA 1GBBA 2OTVA 1BBRH 1TGBA 1ANCA 1ZHPA 1C2GA 1FPCH 1UTOA 2A4GA 3NK8A 2Z9KA 1P04A 1GJBB 1BTUA 1MU6B 1UTQA 2OQUA 3S7KB 1FN6A 2FDAA 4M7GA 3A89A 3P92A 1F92A 3LGVA 5EG4A 4FUGA 4BNRA 4INHA 1TWXB 2V3HH 2NU1E 4TPIZ 1ETSH 4ABGA 1F7ZA 1DFPA 3OTJE 1SOTA 3UNQA 1N6XA 3ZZCA 2VWOA 4WMEA 2FMJA 2Y6TA 1HJ8A 1F2SE 2BDGA 3BG8A 3EQ0H 3QO6A 4I8KA 1RD3B 3SN8A 3SUEA 4JK5A 2OC0A 1A5GH 2FS8A 4OGXA 2H2ZA 5AF9H 4ABFA 1HXEH 1OWIA 2VIOA 1O3IA 1NS3A 3MI4A 2AGGX 5E0HA 5DO4H 4MPWA 1GWAA 2FOGA 1C2HA 1GBIA 2GZ7A 1XMNB 1NROH 2B5TB 5L2YH 1G3DA 1S84A 1AO5A 1GJDB 2VIWA 5ETXA 4GLYA 4X1PU 1D3QB 3RC5A 1TE0A 1UMAH 3AW0A 4E7RG 1Y3WA 3JZ1B 3U1IB 2Y7XA 1S6FA 1AUJA 3F68H 2VH0A 2GKVE 3KL6A 2GCHG 3P17H 1GJ8B 2PUQH 2D26C 1ZMLA 4DIIH 4Y8XA 2ZDKA 4X2WA 1V2WT 2OXSA 4ZROA 1EJMA 2BZAA 1C1QA 4CRBA 1V3XA 2FLRH 4A7IB 1CE5A 1VITF 3SUFA 3MNSA 1M9UA 3SV8A 1UK3A 1O2SA 1BRCE 2HRVA 4Y76A 2GCTC 2Y5HA 1GMDG 1HAVB 1INCA 1BB0B 4AFUA 1RS0A 4YM9A 2BQ7B 3CP7A 1C5RA 1V6DA 2V0BA 3M36A 1E0FD 4H42U 4DURA 2PKSC 4K2YA 4GCHF 4FU8A 4B75A 4WMFA 2A5KA 1UTPA 2K1QA 3SUGA 4D7GA 2Y5FA 1C2DA 3E3TA 1W10U 2SNVA 3LONA 1PJPA 3I77A 1ZPCA 3LGIA 5DPAA 1CBWB 1O33A 1O2XA 4ISOA 4Y6DA 1MD8A 2AYWA 4GHTA 1DLEA 5HM9A 1NFWA 1EP6A 3TH3H 1EAXA 1TBRH 1WTGH 5C5NA 3A80A 4MTBA 3IG6B 1GBLA 1YPHC 1NN6A 3LC3A 4A92A 1O3DA 2XNIA 1EXFA 4B76A 1GBAA 1D6WA 2XC5A 2ANWA 1SGNE 5FHTA 1SLWB 3GYMA 5A09A 3MNCA 3RUOA 2OC7A 5I25A 4JZEH 7KMEH 2Z3CA 3RXKA 6GCHF 5A2MH 1PQ5A 3SI4H 1S0RA 4KTSA 4NFEA 5C1UA 1N8OB 4X1QU 4Y11E 1KDQA 1C2EA 1Y3UA 4D8NA 2ZEBA 1UCYH 1NY22 2WV4A 3MHWU 3NUMA 3RMNH 2GV7A 1O2ZA 1BRAA 5HM2A 3V7TA 2I6SA 1QCPA 1EKBB 1S85A 1CQQA 1PQAA 1H1BA 3PO1B 4FU7A 2A32A 2BHGA 2ODPA 4JZIA 3HGPA 5J4QA 3KF2A 1P05A 1FY5A 1YPGH 1L4DA 1K1IA 1A1RA 1O2YA 2A7CA 1O36A 1CO7E 2DE9A 3GISB 1GHYH 1VCWA 3K6ZA 5EGMA 2CXVA 2VGCB 1YC0A 1DM4B 1PQ8A 2PUXB 4X6PA 2C8WB 2BD2A 1JIMA 1DY9A 3UR9A 4DW2U 1X7AC 2ZDLA 1NFYA 2GCHF 2G52A 1HPGA 1Y3YA 3RU4D 3BN9A 3GCHB 4AYVB 1SFQB 2FOFA 5B6OA 1P2MA 5LPRA 3TNSA 4D9QA 3LT3A 1FIZA 3VB4A 1K2I1 1QRXA 2A0QB 3ZV8A 1ZSLA 1W12U 1D3DB 4K69A 2GV6A 5FAHA 1LKAA 4UE7H 2O8TA 3SUDA 4FUEA 1ESTA 1VGCB 4O3TA 7ESTE 1GL0E 2BB4A 1L2EA 3RXRA 1GVLA 1LVOA 4I8JA 1N6YA 1EZXC 3M3TA 1O3HA 4FU9A 1YKTA 4B1TA 4XBBA 1C1VH 3SV9A 1MU8B 2ZC9H 3MH7A 5EQQA 4CHAC 4BXSA 2B9LA 1IQHA 2SNWA 2PTNA 2Z94A 1GI9B 1AN1E 5IYTA 1GHZA 4FXGH 2ZHFH 3KQEA 4IN2A 2STBE 1HUTH 1RFNA 2R2WU 3TU7H 1MUEB 1DPOA 5A0BA 1SGDE 1TOCB 3BTKE 2FI4E 3SHCH 1AFEH 8GCHG 1GJ9B 1H8DH 2ZI2H 3V3MA 1GCDA 3UREA 4HI3A 1GHWH 1AVXA 3LGYA 1LQDB 4ZHLU 1C5OH 1ZPBA 2W3KA 3SW2B 1ZRKA 4IS5A 4E06H 7GCHF 2Z9GA 3RU4T 1LHEH 3A7WA 1RXPA 1XKAC 3GY6A 4CRFA 3UQOA 2Z9IA 2GD4B 2ZDAH 2TGDA 3F9HA 3SJ8A 1ELGA 3FZZA 1ZGVA 5F6MA 2FEQH 1TABE 3HATH 3M3SA 5JBCS 1MTSA 2A4RA 3A87A 4AX9H 3U8RH 4OGYA 2WYJA 1BITA 2Y5GA 2TRMA 1JMOH 1EZQA 1BBRE 1FLEE 1HJ9A 1O37A 5JDUB 2QN5T 1O2IA 2XBWA 2FTMA 2ZP0H 3TIUA 3B8JA 1LO6A 2ZHWH 4DOQA 3E0NB 5C67A 1BZXE 2WUBA 5A8YA 2BY7X 1LVMA 3MH6A 2ANYA 4NWLA 3RU4E 3V12A 1AB9B 1NFXA 3U8OH 2GDDA 3BEFB 1GI2A 1PPFE 1GBMA 1D9IA 1TPSA 3KNXA 1SGEE 3PMAB 4Y8ZA 1BRBE 1O2VA 2HVXA 2A2QH 1WSSH 1HCGA 1OX1A 1O35A 1KY9A 1TRMA 1C5SA 4NZQA 1IHSH 5GWZA 1JOUB 5FBEA 1GBHA 3GY7A 3GY3A 1PPBH 3SU2A 2H5DA 3ATKA 1EPTB 2WINI 5C1YA 1ACBE 1OYTH 1RRKA 3ATLA 3SNEA 1DUEA 3LH1A 3CENA 1SB1H 3B9FH 5TCCA 3RMLH 2THFB 5EPNA 3TGKE 4MG3A 1D3TB 1YPMH 3ZZ3A 1NU9A 2JH0D 1EAIA 3SU4A 4GUXA 3BF6H 1OP2A 1FUJA 5TCAA 2FI3E 4AG2A 3PMHB 4WWYA 3GCHC 2SGFE 1W0YH 3Q00A 4YOIA 2ZHQH 1SFIA 4X8UH 1HGTH 4NIWA 2QYIA 1YP9A 1TNKA 1O5FH 1VGCC 3RXVA 3NXPA 1BRUP 1P2JA 1Q2WA 1W7XH 2R3UA 3PYHA 1BMAA 4E05H 1GCTB 4PROA 1YBWA 1T8OA 1BDAA 5SGAE 2CJIA 1FY3A 2NU2E 1E34B 1MBQA 1XVMA 3KEEA 1O2MA 3TVJB 3HKJB 4FUIA 4AB8A 1PPCE 1VJ9U 1LPGB 1O3EA 1XXDA 4AGJA 1O2LA 1A5IA 4Y0YE 1AD8H 3A7YA 1ABIH 1G2LA 1O5BB 4IN1A 1G3CA 1THRH 2GDEH 3RXHA 2ZQ2A 3TH4H 3W94A 3ZVEA 1GI0A 4FUJA 5EW2H 1HLTH 4ZMAH 1MTUA 3FAOA 3A84A 1UVUH 2ALPA 2ODQA 2TPIZ 4JK6A 1QTFA 1W13U 1QIXB 2VWMA 1TPOA 2G81E 2GP9B 4DT7B 3M3VA 1TA6A 5EPYA 1T8MA 4I8HA 2XWBI 3ODDA 2F9VA 1AIXH 2ZGBH 1TRNA 1QQUA 1B0FA 1EB1H 2PGQB 3BIUH 2R0LA 2HWLB 3M61U 5JPMH 4Y79A 2R3YA 2WUCA 4DIHH 1J17T 1V2TT 1Y5AT 4A5TS 1VJAU 3ZZDA 3TJNA 2FS9A 1SGPE 1TBQH 4XE4A 3SI3H 1O2OA 4LXBH 1TB6H 3TNTA 2ZZUH 2UUKB 1GJ6A 2GGVB 2C8YB 3UOPA 1TA2A 3MU0A 1GBCA 2HPQH 1Z71A 3K2UA 5T6FA 2VIVA 2ZIQH 3RM2H 1C1MA 1GVKB 4K1EA 3NCLA 3BV9B 4NA7A 2CF9H 2A7HA 2J34A 1GI1A 1SBWA 4ZHAA 3RXTA 4AFSA 1TNIA 2IJOB 3FZDA 3WY8A 1V2PT 1RTKA 4Q80A 4CRCA 2BDHA 1SQAA 5A0CA 1SGIB 4ZKOU 4X2XA 1UCYE 4UFFH 4H6TA 1GJCB 3SORA 4INKA 2PWXA 1P2NA 8LPRA 5TJXA 2H9EH 4B71A 1W14U 1DX5M 1EASA 1MMJN 2O8LA 5FPTA 1GMHF 1DWDH 2OD3B 4ZAEA 2YOLA 3LGTA 2H9TH 3RXQA 3ZZ5A 4WH6A 1C5PA 1EPTC 1QB1A 1V2NT 2BD5A 3V0XA 1EATA 4J2YB 4YOJA 2B8OH 3MMGA 2ESTE 2GCTB 1A7SA 2XYAA 1AU8A 3Q3KA 5C2ZA 5EQSA 3URDA 1C4Y2 4IC5A 1QL8A 1AE8H 1EZSC 3VXFH 3RMMH 2PKSB 3UY9A 1NPMA 1XX9A 1FZZA 3BTHE 5CMXH 1Q3XA 3SNAA 1AI8H 1SG8B 3RXAA 2Y82A 4VGCB 2D8WA 4GCHG 1H9LB 2QXJA 4U30A 1TPPA 4I8GA 2A1DB 4RKJB 3G01A 3ZVBA 2Q6FA 1KSNA 1O3LA 1L1NA 2Z9JA 1PYTD 3SHAH 3SNDA 3MFJA 2HNTE 3RXUA 1C5UA 4MPUA 1T4UH 1V2ST 1F0TA 1Z8IB 1UTKA 4YZUA 1SGFA 1FQ3A 1G3BA 2VINA 3BTTE 1HAHH 1CGHA 3MU4A 1Z8RA 2FESH 3UUZA 3OSYA 1BA8B 3PROA 4ZKNU 1O2GH 1TALA 1SGTA 4K8BA 5DP3A 2ZF0H 5JBAS 1ANDA 3D23A 1YYY1 5E2OA 1O5AB 4Y10E 3K9XB 5FPYA 2VIQA 1G30B 6GCHG 1S0QA 4NWKA 2ANKH 3BTME 4OS4A 1A4WH 2P8OC 2OINA 4CBNA 2BDAA 2UWLA 3SV6A 2HNTF 4K60A 1GGDB 1CT0E 5JB9S 1O2RA 2ZDVH 4UEHH 3P8NA 1O2WA 1BTZA 1WQSA 3M7QA 2BDCA 4OS6A 4TY6A 4K8YA 3HKIB 2Q6DA 3A81A 1Z6EA 2Q6GA 1O5CB 5GDSH 1FONA 1KDQB 1QURH 4OS2A 1JRSA 2G51A 3LJOA 1DANH 3LDXH 3E1XB 5DKMA 1O3FA 2QXHA 4MNWA 1PYTC 3FANA 1GJ5H 1K22H 1SHHB 1C5MD 2ZFFH 1C9TA 3S9CA 1OWDA 3M5OA 3QWCH 2FODA 4ABBA 2ZCHP 5EW1H 1EAWA 3BSQA 4I7YH 3Q76A 3VGCC 3FP7E 2AS9A 3RXJA 4ISIH 2EA3A 2ZG0H 1P3EA 1GI6A 5L30H 2BQ6B 1S83A 1BTPA 1C1PA 3P6ZB 1ELDE 4Y0ZE 3VB7A 2A5IA 4WVPE 1QY6A 4WH8A 1NZQH 2P16A 1HAZB 4E7NA 3RXBA 8ESTE 3QTOH 4TWYA 3OYPA 1WV7H 1KXCA 1LHCH 5DP6A 1MKXK 3GY5A 1YGCH 2PTCE 1GDNA 2A4QA 4DY7B 1T8NA 1THPB 5GIBA 3MH4A 1ZSJA 3TGIE 1GJ4H 1DE7H 4INLA 9LPRA 1LCYA 1YPKH 1H4WA 1CHGA 4CRAA 4NIYA 4DCDA 3VEQB 1GG6C 4TY7A 3H7OA 1IAUA 1ZOMA 4CHAB 1BTWA 5EODA 2NU3E 5EXMA 4A1VA 2FOHA 1DSUA 1HRTH 1XUJA 1D3PB 1ELBA 1ANBA 1BTHH 3MO6A 1LHFH 2CMYA 1UK2A 2Z3EA 4KP0A 3U9AH 5A0AE 2QF0A 2TGPZ 5HMAA 1KXBA 1YPEH 2P94A 2YNAA 5DP4A 1V2UT 1F5RA 2FTLE 4VGCC 2Z6BD 1Z7KA 4Q2KA 2PKAA 2ZPSA 1TAWA 1C5QA 5DK1A 2GT7A 2KAIA 4JMYA 1YCPK 4TPYA 1BBRK 2BZ6H 1OSSA 3OX7U 1FNIA 3ZVAA 1SHYA 3C27B 3E0PB 3MO9A 3R0FA 3RLYH 2ZHEH 3RXIA 1TFXA 7GCHG 5C5OA 2BY5X 1HXFH 1J14A 1FDPA 3DHKH 1P9UA 1JXPA 3LKWA 2BD4A 2RCEA 1P3CA 1NT1A 3GY4A 2G00A 3RXSA 3QGNB 2NU0E 3R3GB 3QGJA 4AG1A 1TQ7B 1XUKA 1KXDA 1AFQC 1ZPZA 3QLPH 1C5YB 1GGDC 1O3OA 1O2PA 2BX4A 3A88A 3PWBA 4X8VH 1NRPH 4U32A 4RKOB 3ELAH 1QRZA 4JZFH 1EOLA 3DFLA 1YPHE 5K0HA 1MTNC 1A0HB 1CU1A 4BTUB 4AORA 1BQYA 1GI3A 1P02A 1QL9A 3F1SB 3AAVA 2ZU1A 2BM2A 1OPHB 4WXIA 3BIVH 2D2DA 4O03A 2F9BH 4YLUA 3VFEA 4YESB 3FP8E 3KQBA 4QT8C 3TLOA 2Z9LA 2ZFRH 1Q31A 2A5AA 5FX5A 5AHGH 3LGWA 1P03A 3PMJA 1O5DH 1BT7A 2BTCE 2RG3A 2FLBH 1RTLA 1C2JA 3PLPA 1QB6A 1BHXB 1P2KA 2A2XH 2F83A 2F9OA 1BOQA 2BD7A 3O8RA 1QRWA 4AFZA 3NKKA 4ESTE 3EDXB 1CA0C 4B2BA 4ISHH 4AYYB 2FYQA 4WXVA 1SLVB 3SNCA 3ZVCA 1F0RA 1HBTH 4FUFA 5LH8A 2F91A 4KTCA 3U69H 4ABHA 3DFJA 1Y8TA 1ZZZA 1YM0A 5ABWA 3B23B 1XM1A 3A7XA 3A83A 2ULLA 5PTPA 1IQEA 1DXWA 2AIPA 1BMLA 1ZTKA 1O34A 3GICB 3RXOA 1N1LA 3GOVB 3K6YA 3SO3A 3EA7A 3SU5A 1AE5A 2Y7ZA 3SQEE 1TQ0B 1GI7B 3SJOA 1IQNA 1NTPA 2ASUB 1LHGH 1O3PB 3ATIA 1O30A 4NSVA 1UHBA 3OU0A 1HDTH 3BEUA 4Y7BA 1SI5H 1WBGB 3ESTA 3EYDA 2XC4A 1WAYB 1XUFA 1C5LH 3QTVH 1DITH 1QJ7B 2ZFPH 3ZV9A 1TNJA 4I32A 3W95A 2ZDMA 1P0SH 1YPJH 1KYNA 2SGEE 3UPEA 1W8BH 3ENSB 4BTIB 2W5EA 4UFGH 1DUAA 2O8WA 4IBLH 2AMDA 3GCOA 2TIOA 2I6QA 3SZNA 2P59A 3H7TA 3LGUA 3BG4C 4OS1A 1UK4A 4CR5A 1XKBC 1MZDA 2BDIA 2AGEX 1DWCH 1C1NA 1GI4A 3NZIA 1C2KA 4FUBA 2J94A 1JRTA 2PR3A 1V2OT 3DUXH 1PPHE 2FO9A 2JH6D 1C2MA 2H5CA 3I78A 3PLKA 3PV4A 1OYQA 4O3UA 5T6DA 1IQIA 1FMGA 1GI5A 2W7UA 3KHVA 5DP7A 3D62A 4JCNA 3SJ9A 1S5SA 3SV7A 4IMZA 1MKWK 1LDTT 1MTVA 2H1UA 1BCUH 3LH3A 2F9UA 1G32B 2BD9A 1OOKB 2ZQ1A 2DUCA 2H6MA 3RMOH 4AZ2B 5E2PA 1T7CA 1DOJA 4AGKA 3GCNA 3IWMA 2R9PA 2O8MA 3ODFA 1C1SA 1QFKH 3RXPA 3NWUA 4O97A 1ABJH 4FUDA 2Y80A 3TITA 5F8TA 2FP7B 1MCTA 1P06A 1GMHG 3AASA 3SGQE 4CR9A 3ZZ9A 3LIWA 4NCYA 4H6SB 4NIXA 9ESTA 1QBVH 2YNBA 1TOMH 2VIDA 2ZGXH 3ZVDA 3TK5A 1GBKA 2BX3A 4Y7AA 1WQVH 1GI8B 2HOBA 3E6PH 2C90B 2BDBA 1JWTA 1RIWB 1O39A 1NESE 4NA9H 4X6OA 1C5XB 1JBUH 1KTSB 1AZ8A 1J9CH 3OY6U 1FN8A 2PW8H 3E16B 2ZO3H 2XBXA 1PPEE 2C8ZB 1O3GA 5E0JA 5IDKA 3QX5H 4MDSA 3BTWE 4NFFA 1DWBH 4YT7H 2BLQA 3UFAA 2ZFQH 3V13A 1VZQH 3MNBA 1H9HE 1NRQH 3PLBA 3UIRA 1Y59T 1G36A 3T29A 4YLQH 3BTEE 1SQOA 2P3TB 3AW1A 2JETC 1A46H 3LOXA 3EGKH 1VR1H 4BAQB 3VXEH 1SQTA 4ABAA 1V2KT 1QNJA 4K5ZA 5F03A 4IMQA 3QN7A 3QDZB 3MWIU 1ETRH 1AGJA 4D9RA 3PB1E 1A3EH 2G5NA 2AEIH 3QUMP 4GSOA 4Q7XA 4XSKU 1BIOA 1GDUA 2BVXH 4YO9A 4X2VA 2BXTH 2G55A 2EEKA 2P3UB 4MVNA 1OWJA 3MU1A 3ZZAA 1IQGA 4BAHB 3P95A 1MQ6A 2OQ5A 3E90B 1MAYA 2CHAC 1C5WB 2P8OB 1UVTH 4A6LA 5K7RA 3M35A 4DG4A 2R2MB 1C1OA 3UR6A 4X2YA 3SJIA 4I8LA 1DLKB 5DP8A 4JZDH 1ZMJA 1C5NH 1KXFA 1QJ6B 1LHDH 3BTFE 1TPAE 3GDVA 1EUFA 5GXPA 1V2VT 1BHXF 8KME2 1L1GA 2ZFSA 1G37A 2A45B 1FXYA 1NRRH 3S7HB 1QBNA 4DGJA 2V3OH 2BY8X 3I29A 3VGCB 1Y5BT 2XCFA 4F4OC 3SBKA 2HGTH 4H4FA 4XBCA 2B7DH 6ESTA 1HIAA 5HXFA 4CH2B 2OCVB 2BD8A 2WPKS 3L33A 4LOYH 4TWWA 4F49A 2NU4E 1C9PA 3SGBE 2QCYA 2STAE 4JYTA 4FUHA 2J92A 3A8DA 1WTHD 2F9NA 2QAAA 3M7UA 4LZ1H 2GT8A 1IHTH 3URCA 1DXPA 2J38A 4GVUA 1YPLH 5CE1A 1IQJA 1WUNH 4MLFB 2C4FH 1K28D 1MCVA 3CS7A 4K1TA 4ZKSU 2SGDE 2TBSA 1GG6B 4JZ1A 2FI5E 3STJA 3E91A 4R8TB 3T27A 1RIWC 1UVPA 3EA8A 1L1JA 2PGBB 1TONA 1SGYE 2VB0A 3EAJA 3KQCA 2ZCLP 1RGQA 3SV2H 1F5KU 3JZ2B 4JYUH 1SGFG 1J15A 2PLXA 4NSYA 5C1XA 3KGPA 1HJAC 4B2AA 1OWEA 1NU7B 1MBMA 5GPIB 1HAOH 1O2KA 4UD9H 2PHBA 1FV9A 2WPLS 1OS8A 2ZGJA 4ZXXH 3UNRA 3S9AA 5DG6A 3LC5A 2Z7FE 1NO9H 4MNVA 4WMDA 5F8XA 3UTUH 1VCPA 2ZU4A 1O2NA 5L2ZH 1C1WH 1W2KH 4IC6A 1KTTB 1YF4A 4X8SH 1A61H 4BAOB 2PKAB 1KIGH 1CHOG 2KAIB 1ELFA 5FXLA 4ABJA 2J9NA 5FX6A 5ESTE 4I31A 4XBDA 1EOJA 1AVGH 1O3CA 1S81A 2WPHS 4JYVH 2FIRH 1ELEE 4MQAA 4NIVA 1C1UH 1Y3VA 5BRRE 2IOTA 3UWIA 4CH8B 1U6QA 2EC9H 4Y8YA 1AFQB 3HK3B 5DP9A 3LPRA 2FX6A 3KIDU 1GHBG 1LVBA 1O3KA 2C93B 6CHAB 2EI7A 2RA0A 1A0LA 4AOQA 1PPZA 1QBOA 2ZU2A 3HK6B 1GBDA 2ZU3A 1MTNB 2AMQA 3GY8A 1ELVA 4K1SA 3GCTF 3ATWA 3RXFA 5FCRA 3ATMA 4KGAA 2BD3A 5JYIA 5FCKA 2SFAA 4LZ4B 3OY5U 1AZZA 2BOHB 3TJVA 3RXLA 1A3BH 1TX8A 1UJ1A 1XUIA 4MNYA 1O31A 5E0GA 4UONA 4Q7ZA 2ZTXA 3RXDA 3PMBB 1ORFA 1BMMH 1FPHH 2VH6A 2Q1JA 2F9PA 5HGGA 3A8CA 4RSPA 3ZZ4A 1Y3XA 1TIOA 1GBFA 3GYLB 2V35A 1FY4A 2GVFA 4NA8A 3ZYDA 2W7SA 5GCHF 1OWHA 2QV1A 3A7ZA 3S0NA 4SGAE 1CA0B 5C3NA 4NGAH 1HAGE 2J95A 2GMTC 4X0WU 5AFYH 1ZR0A 3N7OA 2ZGCA 1Z1JA 1BTXA 2BXUH 3SQHE 2LPRA 1CT4E 1FY1A 4ASHA 1DICA 1C5VA 1EJAA 4HTCH 2QXIA 1K1MA 1C1TA 1UO6A 4X6MA 4A1XA 2QIQA 1QJ1B 3RC6A 5H4IB 1DY8A 3A85A 1Z6JH
chains in the Genus database with same CATH superfamily
1EFRD 1SGCA 4Z6AH 3F2HA 5GJ4B 3T2NA 1NFUA 1AKSA 2Z3DA 2M5TA 2ANMH 1LVYA 3TJOA 3WWBA 1TGNA 4D7FA 3U1JB 2F43B 1HAXB 3AVZA 1CGIE 1QB9A 2KFWA 1LPZB 4YOGA 5DJ7A 2OUAA 1ESAA 3VB3A 2LNCA 2H9HA 3T25A 1PQ7A 1E37B 4O9VA 4Q63A 4BAMB 1YLDA 3U98H 3F9GA 1ZHMA 5DP5A 1ZTLA 1LQEA 3QZQA 1A2CH 3P8OA 1UTJA 2ZTZA 5EJZA 4U01A 2VWNA 1C2IA 2XBVA 1BJUA 1UHBB 2ZPRA 5EXNA 3GDUA 4ABDA 3SJKA 1CHOF 1D6RA 1P2OA 1F0SA 2BY6X 3A82A 2D1JA 1QGFA 3BG4B 3UQVA 2ZU5A 1MQ5A 1QR3E 1TX7A 1IQFA 4KTUA 1RJXB 5C20A 2FOMB 5AFZH 1WOFA 4ASUD 1UVSH 2W6ID 1A5HA 3O8BA 2BLVA 2A7JA 3DT0H 1ESBA 3RC4A 2OC1A 2F3CE 3C1KA 4I33A 6LPRA 1B0EA 2GX4A 1P12E 3HGNA 1C5TA 3M37A 4ZHMU 1K1LA 3UNSA 3UOUA 4D76A 1KXEA 2XTTB 2QY0B 1GHBF 4MPXA 4B74A 3AAUA 3Q3YA 1MZAA 2XCNA 1TNHA 1FAKH 3LJJA 4FUCA 4HGCA 6CHAC 3M5LA 1TGTA 3ITIA 1E35B 3PTNA 1ELTA 1QA7A 2OLGA 1TMTH 2JKHA 2P93A 2HVYB 1AMHA 1SR5C 1CSOE 3PTBA 1O3NA 2BMGB 1K1NA 2V6NA 1HB0B 1AY6H 2J98B 1E36B 1GBJA 4KELA 4ZKRU 3NPSA 2UUFB 1Z8JB 4IGDA 4BTTB 1ZHRA 3L3TA 4B73A 1G3EA 1Z8GA 2QC2A 1O2TA 3BTGE 2VVVA 4RN6A 1SMFE 1S82A 1C2LA 3O8CA 1ZMNA 3MO3A 4DJZB 1SKYE 3T28A 3F2FA 1MKWH 2G8TA 2EI6A 1P9SA 2QA9E 1FAXA 2B0FA 1V2LT 3SOSA 5HYOA 3KCGH 5ESBA 1RTFB 3RXMA 3U8TH 2ZGHA 1EAUA 4IW4E 1GVZA 1Z1IA 3D65E 4U2WA 2BOKA 1TGSZ 3STIA 4OS7A 1K9OE 4MNXA 2PV9B 1DWEH 2V7QD 2VJ1A 1W11U 2WYGA 3VB5A 4XDEA 1EZUC 4AN7A 4XOJA 2ZA5A 2RA3A 1HAVA 1XUGA 1ARCA 1FJSA 4YT6H 5CHAB 1KLIH 4WF8A 4X1SU 1V2QT 1THSH 1O2QA 2IJD1 2UUYA 2VWLA 1GHXH 3A8AA 2JETB 4UDWH 1HNEE 1CVWH 1EX3A 4K3JA 2OC8A 4HZHA 1SGQE 5T3HA 1IQLA 1F0UA 1ID5H 1GDQA 5KECA 1GMDF 5T6GA 1O2HA 1SLUB 2GJGA 1NC6A 1O3BA 2ODYB 1ZRBA 1W0ZU 1EJNA 3P8FA 5JBTA 3LU9B 1ETTH 2OBQA 5F8ZA 4Q7YA 3DA9B 1P2QA 1ZLRA 2QXGA 3MNXA 4I86A 1AVWA 1BJVA 4F55A 1TMBH 1OKXA 3Q3XA 2CV3A 2WHXA 1EP5A 1JIRA 2BVRH 2CHAB 2FWWA 2ZNKH 3P70B 1L0ZA 2ZDNA 1O3MA 2VIPA 3VG8A 3T26A 3TJUA 5A8ZA 2FM2A 5EU8A 2RDLA 2GZ9A 3VB6A 1C2FA 1BTYA 3TK9A 1YCPM 4YTAA 1S6HA 2HALA 4A1TA 4ZXYH 3SU1A 1CBWC 2R0KA 2XW9A 4B2CA 3CS0A 1NM6A 3SU6A 2ZHDA 1UCYK 4CRDA 5LPEA 2KM0A 2AFQB 2ZCKP 1FIWA 2NWNA 1P2IA 3QZRA 2G5VA 3ZVGA 2J4IA 3O8DA 4ZH8A 4ABEA 1QA0A 2WV9A 4KKDA 1SPJA 1GPZA 2BQWB 2A31A 1VITH 4BANB 5FBIA 2P95A 2EI8A 1P01A 4FOUC 2VVUA 3SGAE 5LGOA 1TX6A 2XOKD 1GBTA 4GPGA 4TYDA 7LPRA 3F9FA 3PM3A 1AUTC 1GJ7B 2C3SA 2ZTYA 1N8OC 3M5MA 1P10A 2FXRA 1AQ7A 1QQ4A 1TBZH 1UTMA 1YLCA 3FFGA 1ARBA 1KLTA 3BTQE 4ISNA 3F9EA 3M7TA 3RM0H 3MOCA 2PSXA 4HG6A 2SGAA 5FPSA 1HIAB 4GAWA 1E1RD 4ISLA 2HPPH 1AHTH 3PO1C 1SSXA 1P09A 4BAKB 3T5FH 4FVBA 2IPHA 1T4VH 4CBOA 3A8BA 2KCPA 3ZZ8A 5C0UA 3TGJE 1IOEA 3PWCA 1ZGIA 3EE0B 3MTYA 3ZZ7A 1DDJA 3K65B 1T32A 4Z0KA 3BEIB 1HAPH 1NRSH 5E8EH 5EOKA 1O38A 1J8AA 2KCAA 2VGCC 1CA8B 1ZTJA 1H8IH 5J4SA 1LTOA 1OP0A 1DS2E 3MH5A 1W3CA 2CGAA 4X1RU 1H9IE 2W26A 1VCQA 1ZYOA 2FOAA 1HJAB 4OM9A 4MPVA 3GS9A 3KN2A 4LK4A 1DVAH 1C4U2 1CGJE 4GHQA 1T8LA 5CHAC 2UWPA 2ILNA 2Y81A 1MTWA 5HIZA 1QL7A 2GTBA 2SGPE 1HFDA 2C8XB 4X6NA 2FX4A 1WYKA 1V2JT 1TMUH 1HAIH 4ABIA 3D49H 3IITA 2UUJB 1O5GH 4BOHA 1OXGA 1TYNA 3A7TA 2XC0A 2L6OA 1ELCA 5I46H 1GMCG 2BLWA 3MYWA 1O2UA 2BLOA 1E38B 1SL3A 4AFQA 2FYRA 3S9BA 2O8UA 4XFQA 1SOZA 1QHRB 2A4OA 2VBCA 2YMSC 1KXAA 5EQRA 1XVOA 5G4BA 1P11E 2PSYA 3A7VA 2ZFTA 1K1PA 1O5EH 1K21H 2VVCA 4NZLA 3EA9A 1FI8A 1GHAG 4FETA 1HAYB 3GDSA 4BXWA 8GCHF 3A86A 1V2RT 1P8VC 3ZZBA 1G9IE 3T62A 1AWFH 1MD7A 3VPKA 1BMNH 4CRGA 1V2MT 1WU1A 1DSTA 5BPEA 1SC8U 2XXLA 4SGBE 4UFDH 3ZVFA 1TLDA 2VNTA 1UTLM 5T1VA 1PPGE 5DGJA 1LMWB 2PFEA 4M9FA 3RXCA 1TRYA 1SGRE 1TGCA 1ELAA 2CN0H 3F3BA 3FP6E 5JB8S 4F48B 4HFPB 2JH5D 1CT2E 1L4ZA 2AH4X 4R0IA 2UWOA 2WPMS 1C4V2 3SNBA 3UWJH 2BVSH 3GCTG 3DD2H 2LP6A 1ZJDA 1GBEA 4WY3A 1G2MA 2JJ2D 2TGTA 3F6UH 2ZKSA 2F4LA 4WJG2 5HKKD 3SU3A 2AMPA 4FVDA 3TK6A 1OHHD 5EXLA 1Y5UT 1TNGA 3RLWH 1K1JA 2FOEA 1UVOA 2ZPQA 2BYAX 1B7XB 1O32A 3QK1A 4X8TH 4AB9A 1O0DH 2ZECA 1MH0A 4ZCNA 3M5NA 1DT2A 5C0TA 2GZ8A 1GL1A 4ZUHA 2AERH 1TNLA 1EB2A 1EPTA 2GMTB 5GCHG 4Z1MD 1NRNH 4UFEH 3S69A 1ANEA 1GJAB 1OWKA 3Q77A 5KGOA 2IN2A 1C5ZB 1EQ9A 1AB9C 2BY9X 1D4PB 2BDYA 1F5LA 2CF8H 2VU8E 1T31A 2XBYA 4RI0A 4CREA 3MU5A 1XXFA 2SGQE 4DVAU 2G4UA 1W7GH 3RDZA 4THNH 3GY2A 2QGRA 2XWAA 1MAXA 1HV7A 1LPKB 2FOCA 1IQKA 2W3IA 1O3JA 1AWHB 3RXEA 5A8XA 2G4TA 4J1YA 2WV5A 1J16A 2HNTC 2WPIS 3TPIZ 3RP2A 2ALVA 2XRCA 2P3FH 1C1RA 1QZ8A 4XD7D 1FY8E 1MKXH 1VITG 3ZZ6A 1K1OA 2FPZA 1UTNA 5L6NH 2HLCA 5AVDA 5LPFA 2FZZA 2QF3A 2AIQA 1XUHA 3MU8A 1PFXC 4Y71A 5JBBS 1LKBA 2WPDD 2OP9A 1WCZA 1A0JA 3FVFB 1ZSKA 5CHBA 3P8GA 2PP6A 1AKSB 3ZYEA 2AGIX 1GMCF 3L6PA 5EIYA 3KQDA 4OS5A 1KLJH 2WPJS 2TGAA 3BTDE 4X1NU 1GCTC 1HYLA 1GHVH 5EJLA 1ZJKA 1P57B 1OP8A 1SLXB 2ZWLH 4NG9H 1SVPA 1IQMA 3RXGA 2O9QA 2FOBA 1O2JA 2J2UA 1GHAF 3H5CB 1BUIA 3SU0A 2DE8A 1B5GH 1O3AA 3E8LA 3TH2H 3HPTB 1YCPH 2OBOA 1GBBA 2OTVA 1BBRH 1TGBA 1ANCA 4P02A 1ZHPA 1C2GA 1FPCH 1UTOA 2A4GA 3NK8A 5GNDA 2Z9KA 1P04A 1GJBB 1BTUA 1MU6B 1UTQA 2OQUA 3S7KB 1FN6A 2FDAA 4M7GA 3A89A 3P92A 1F92A 3LGVA 5EG4A 4FUGA 4BNRA 4INHA 1TWXB 2V3HH 2NU1E 4TPIZ 1ETSH 4ABGA 1F7ZA 1DFPA 2QE7D 3OTJE 1SOTA 3UNQA 1N6XA 3ZZCA 2VWOA 4WMEA 1YLNA 2FMJA 2Y6TA 1HJ8A 1F2SE 2BDGA 3BG8A 3EQ0H 3QO6A 4I8KA 1RD3B 3SN8A 3SUEA 4JK5A 2OC0A 1A5GH 2FS8A 4OGXA 2H2ZA 5AF9H 4ABFA 1HXEH 1OWIA 2VIOA 1O3IA 1NS3A 3MI4A 2AGGX 5E0HA 5DO4H 4MPWA 1GWAA 2FOGA 1C2HA 1GBIA 2GZ7A 1XMNB 1NROH 2B5TB 5L2YH 1G3DA 1S84A 1AO5A 1GJDB 2VIWA 5ETXA 4GLYA 4X1PU 5F53A 1D3QB 3RC5A 1TE0A 1UMAH 3AW0A 4E7RG 1Y3WA 3JZ1B 3MQKC 3U1IB 2Y7XA 1S6FA 1AUJA 3F68H 2VH0A 2GKVE 3KL6A 2GCHG 3P17H 1GJ8B 2PUQH 2D26C 1ZMLA 4DIIH 4Y8XA 2ZDKA 4X2WA 1V2WT 2OXSA 4ZROA 1EJMA 2BZAA 1C1QA 4CRBA 1V3XA 3OEED 2FLRH 4A7IB 1CE5A 1VITF 4TSFD 3MNSA 3SUFA 1M9UA 3SV8A 1UK3A 1O2SA 1BRCE 2HRVA 4Y76A 2GCTC 2Y5HA 1GMDG 3F0PA 1HAVB 1INCA 1BB0B 4AFUA 1RS0A 4YM9A 2BQ7B 3CP7A 1C5RA 1V6DA 2V0BA 3M36A 1E0FD 4H42U 4DURA 2PKSC 4K2YA 4GCHF 4FU8A 4B75A 4WMFA 2A5KA 1UTPA 2K1QA 3SUGA 4D7GA 2Y5FA 1C2DA 3E3TA 2KR7A 1W10U 2SNVA 3LONA 1PJPA 3I77A 1ZPCA 3LGIA 5DPAA 1CBWB 5FL7D 1O33A 1O2XA 4ISOA 4Y6DA 1MD8A 2AYWA 4GHTA 1DLEA 5HM9A 1NFWA 1EP6A 3TH3H 1EAXA 1TBRH 1WTGH 5C5NA 3A80A 4MTBA 3IG6B 1GBLA 1YPHC 1NN6A 3LC3A 4A92A 1O3DA 2XNIA 1EXFA 4B76A 1GBAA 1D6WA 1E1QD 2XC5A 3FO8D 2ANWA 1SGNE 2M2AA 5FHTA 3ZIAD 1SLWB 3GYMA 5A09A 3MNCA 3RUOA 2OC7A 5I25A 4JZEH 7KMEH 2Z3CA 3RXKA 6GCHF 5A2MH 1PQ5A 3SI4H 1S0RA 4KTSA 4NFEA 5C1UA 1N8OB 4X1QU 4Y11E 1KDQA 1C2EA 1Y3UA 4D8NA 2ZEBA 1UCYH 1NY22 2WV4A 3MHWU 3NUMA 3RMNH 2GV7A 1O2ZA 1BRAA 5HM2A 3V7TA 2I6SA 3WW7A 1QCPA 1EKBB 1S85A 1CQQA 1PQAA 1H1BA 3PO1B 4FU7A 2A32A 2BHGA 2ODPA 4JZIA 3HGPA 5J4QA 3KF2A 1P05A 1FY5A 1YPGH 1L4DA 1K1IA 1A1RA 1O2YA 2A7CA 1O36A 1CO7E 2DE9A 3GISB 1GHYH 1VCWA 3K6ZA 5EGMA 2CXVA 4ACAA 2VGCB 1YC0A 1DM4B 2K8IA 1PQ8A 2PUXB 4X6PA 2C8WB 2BD2A 1JIMA 1DY9A 3UR9A 4DW2U 1X7AC 2ZDLA 1NFYA 2GCHF 2G52A 1HPGA 1Y3YA 3RU4D 3BN9A 3GCHB 4AYVB 1SFQB 1SQRA 2FOFA 5B6OA 1P2MA 5LPRA 2K0QA 3TNSA 4D9QA 3LT3A 1FIZA 3VB4A 1K2I1 1QRXA 2A0QB 3ZV8A 1ZSLA 1W12U 1D3DB 4K69A 2GV6A 5FAHA 1LKAA 4UE7H 2O8TA 3SUDA 4FUEA 1ESTA 1VGCB 4O3TA 7ESTE 1GL0E 2BB4A 1L2EA 3RXRA 1GVLA 1LVOA 4I8JA 1N6YA 1EZXC 3M3TA 1O3HA 4FU9A 1YKTA 4B1TA 4XBBA 1C1VH 3SV9A 1MU8B 2ZC9H 2YMSB 3MH7A 5EQQA 4CHAC 4BXSA 2B9LA 1IQHA 3N7EA 2SNWA 2PTNA 2Z94A 1GI9B 1AN1E 5IYTA 1GHZA 4FXGH 2ZHFH 3KQEA 4IN2A 2STBE 1HUTH 1RFNA 2R2WU 3TU7H 1MUEB 1DPOA 5A0BA 1SGDE 1TOCB 3BTKE 2FI4E 2IPQX 3SHCH 1AFEH 8GCHG 1GJ9B 1H8DH 2ZI2H 3V3MA 1GCDA 3UREA 4HI3A 1GHWH 1AVXA 3LGYA 1LQDB 4ZHLU 1C5OH 1ZPBA 2W3KA 3SW2B 1ZRKA 4IS5A 4E06H 1FX0B 2Z9GA 3RU4T 7GCHF 1LHEH 3A7WA 1RXPA 1XKAC 2QF5A 3GY6A 4CRFA 3UQOA 2Z9IA 2GD4B 2ZDAH 2TGDA 3F9HA 3SJ8A 1ELGA 3FZZA 1ZGVA 5F6MA 2FEQH 1TABE 3HATH 3M3SA 5JBCS 1MTSA 2A4RA 3A87A 4AX9H 3U8RH 4OGYA 2WYJA 1BITA 2Y5GA 2TRMA 1JMOH 1EZQA 1BBRE 1FLEE 1HJ9A 1O37A 5JDUB 2QN5T 1O2IA 2XBWA 1W0JD 2FTMA 2V3MA 2ZP0H 3TIUA 3B8JA 1LO6A 2ZHWH 4DOQA 3E0NB 5C67A 1BZXE 1WDIA 2LELA 2WUBA 5A8YA 2BY7X 1LVMA 3FN8A 2ANYA 3MH6A 4NWLA 2KCYA 3RU4E 3V12A 1AB9B 1NFXA 3SZEA 3U8OH 2GDDA 3BEFB 1GI2A 3F0OA 1PPFE 1GBMA 1D9IA 2YMSD 1TPSA 3KNXA 1SGEE 3PMAB 4Y8ZA 1BRBE 1O2VA 2HVXA 2A2QH 1WSSH 1HCGA 1OX1A 1O35A 1KY9A 1TRMA 1C5SA 4NZQA 1IHSH 5GWZA 1JOUB 5FBEA 1GBHA 3GY7A 3GY3A 1PPBH 3SU2A 2H5DA 3ATKA 1EPTB 2WINI 5C1YA 1ACBE 1OYTH 1RRKA 3ATLA 3SNEA 1DUEA 3LH1A 3CENA 1SB1H 3B9FH 5TCCA 3RMLH 2THFB 5EPNA 3TGKE 4MG3A 1D3TB 1YPMH 3ZZ3A 1NU9A 2JH0D 1EAIA 3N99A 3SU4A 4GUXA 3BF6H 1OP2A 1FUJA 5TCAA 2FI3E 4AG2A 3PMHB 4WWYA 3GCHC 2SGFE 1W0YH 3Q00A 4YOIA 2ZHQH 1SFIA 4X8UH 1HGTH 4YXWD 4NIWA 4Q4LA 2QYIA 1YP9A 1TNKA 1O5FH 1VGCC 3RXVA 3NXPA 1BRUP 1P2JA 1Q2WA 1W7XH 2R3UA 3PYHA 1BMAA 4E05H 1GCTB 4PROA 1YBWA 1T8OA 1BDAA 5SGAE 2CJIA 2OK5A 4DT4A 1FY3A 3KYGA 2NU2E 1E34B 1MBQA 5CDFE 1XVMA 3KEEA 1O2MA 3TVJB 3HKJB 4FUIA 4AB8A 1PPCE 5DN6D 1VJ9U 1LPGB 1O3EA 1XXDA 4AGJA 4B6FA 1O2LA 1A5IA 4Y0YE 1AD8H 3A7YA 1ABIH 1G2LA 1O5BB 4IN1A 1G3CA 1THRH 1NBMD 2GDEH 2ZQ2A 3RXHA 3OFND 3TH4H 3W94A 3ZVEA 1GI0A 4FUJA 5EW2H 1HLTH 4ZMAH 1MTUA 3FAOA 3A84A 1UVUH 2ALPA 2ODQA 2TPIZ 4JK6A 1QTFA 1W13U 1QIXB 2VWMA 1TPOA 2G81E 2GP9B 4DT7B 3M3VA 1TA6A 5EPYA 1T8MA 4I8HA 2XWBI 3ODDA 2F9VA 1AIXH 2ZGBH 1TRNA 4RT0A 1QQUA 1B0FA 1EB1H 2PGQB 3BIUH 2R0LA 2HWLB 3M61U 5JPMH 4Y79A 2R3YA 2WUCA 4DIHH 1J17T 1V2TT 1Y5AT 4A5TS 1VJAU 3ZZDA 3TJNA 2FS9A 1SGPE 1TBQH 4XE4A 3SI3H 1YWUA 1O2OA 4LXBH 1TB6H 3TNTA 2ZZUH 2UUKB 1GJ6A 2GGVB 2C8YB 3UOPA 1TA2A 3MU0A 1GBCA 2HPQH 1Z71A 3K2UA 5T6FA 2VIVA 2ZIQH 3RM2H 1C1MA 1GVKB 4K1EA 3NCLA 3BV9B 4NA7A 2CF9H 2A7HA 2J34A 1GI1A 1SBWA 3PRDA 4ZHAA 3RXTA 4AFSA 1TNIA 2IJOB 3FZDA 2KX4A 3WY8A 1V2PT 1RTKA 4Q80A 4CRCA 2BDHA 1SQAA 5A0CA 1SGIB 4ZKOU 4X2XA 1UCYE 4UFFH 4H6TA 1GJCB 3SORA 4INKA 2PWXA 3U28C 1P2NA 8LPRA 5TJXA 3DSGA 2H9EH 4B71A 1W14U 1DX5M 3CNRA 1EASA 1MMJN 2O8LA 5FPTA 1GMHF 1DWDH 2OD3B 4ZAEA 2YOLA 3LGTA 2H9TH 3RXQA 3ZZ5A 4WH6A 1C5PA 1EPTC 1QB1A 1V2NT 2BD5A 1UW7A 3V0XA 1EATA 2KZ4A 4J2YB 4YOJA 2B8OH 3MMGA 2ESTE 3NRLA 2GCTB 1A7SA 2XYAA 1AU8A 3Q3KA 5C2ZA 5EQSA 3URDA 1C4Y2 4IC5A 1QL8A 1AE8H 1EZSC 3VXFH 3RMMH 2PKSB 3UY9A 1NPMA 1XX9A 1FZZA 3BTHE 5CMXH 1Q3XA 3SNAA 1AI8H 3OE7D 1SG8B 3RXAA 2Y82A 4VGCB 2D8WA 4GCHG 1H9LB 2QXJA 4U30A 1TPPA 4I8GA 2A1DB 4TT3D 4RKJB 3G01A 4RT1A 3ZVBA 2Q6FA 1KSNA 1O3LA 1L1NA 2Z9JA 1PYTD 3SHAH 3SNDA 3MFJA 2HNTE 2RFKC 3RXUA 1C5UA 4MPUA 1T4UH 1V2ST 1F0TA 1Z8IB 1UTKA 4YZUA 1SGFA 1FQ3A 1G3BA 2VINA 3BTTE 1HAHH 1CGHA 3MU4A 1Z8RA 2FESH 3UUZA 3OSYA 1BA8B 3PROA 4ZKNU 1O2GH 1TALA 1SGTA 4K8BA 3OEHD 5DP3A 2ZF0H 5JBAS 1ANDA 3D23A 1YYY1 5E2OA 1O5AB 4Y10E 2EY4C 3K9XB 5FPYA 2VIQA 1G30B 6GCHG 1S0QA 4NWKA 2ANKH 3BTME 2JIZD 4OS4A 1A4WH 2P8OC 2OINA 4CBNA 2BDAA 2UWLA 2HLDD 3SV6A 2HNTF 4K60A 1GGDB 1CT0E 5JB9S 1O2RA 2ZDVH 4UEHH 1WXRA 3P8NA 1O2WA 1BTZA 1WQSA 3M7QA 2BDCA 4OS6A 4TY6A 4K8YA 3HKIB 2Q6DA 3A81A 1Z6EA 2Q6GA 1O5CB 5GDSH 1FONA 1KDQB 1QURH 4OS2A 1JRSA 2G51A 3LJOA 1DANH 3LDXH 3E1XB 5DKMA 1O3FA 2QXHA 4MNWA 1PYTC 3FANA 1GJ5H 1K22H 1SHHB 1C5MD 2ZFFH 1C9TA 3S9CA 1OWDA 3M5OA 3QWCH 2FODA 4ABBA 2ZCHP 5EW1H 1EAWA 3BSQA 4I7YH 3Q76A 3VGCC 3FP7E 2AS9A 3RXJA 4ISIH 2EA3A 2ZG0H 1P3EA 1GI6A 5L30H 2JJ1D 2BQ6B 1S83A 1BTPA 1C1PA 3P6ZB 1ELDE 4Y0ZE 3VB7A 2A5IA 4WVPE 1QY6A 4WH8A 1NZQH 2P16A 1HAZB 4E7NA 3RXBA 8ESTE 3QTOH 4TWYA 3OYPA 1WV7H 1KXCA 1LHCH 5DP6A 1MKXK 3GY5A 1YGCH 2PTCE 1GDNA 2A4QA 4DY7B 1T8NA 1THPB 5GIBA 3MH4A 1ZSJA 3TGIE 1GJ4H 1DE7H 4INLA 9LPRA 1LCYA 1YPKH 1H4WA 1CHGA 4CRAA 4NIYA 4DCDA 3VEQB 1GG6C 4TY7A 3H7OA 1IAUA 1ZOMA 3FOAA 4CHAB 1BTWA 3EE7A 5EODA 5C17A 2NU3E 5EXMA 4A1VA 2FOHA 1DSUA 1HRTH 1XUJA 1D3PB 1ELBA 1ANBA 1BTHH 3MO6A 1LHFH 2CMYA 2J97A 1UK2A 2Z3EA 4KP0A 3U9AH 5A0AE 2QF0A 2TGPZ 5HMAA 1KXBA 1YPEH 2P94A 2YNAA 5DP4A 1V2UT 1F5RA 2FTLE 4VGCC 2Z6BD 1Z7KA 4Q2KA 2PKAA 2ZPSA 1TAWA 1C5QA 5DK1A 2GT7A 2KAIA 4JMYA 1YCPK 4TPYA 3AK5A 1BBRK 2BZ6H 1OSSA 3OX7U 1FNIA 3ZVAA 1SHYA 3C27B 3E0PB 3MO9A 5EJ1A 3R0FA 1K0HA 3RLYH 2ZHEH 3RXIA 1TFXA 7GCHG 5C5OA 2BY5X 1HXFH 1J14A 4P00A 1FDPA 3DHKH 1P9UA 1JXPA 3LKWA 2BD4A 2RCEA 1P3CA 1NT1A 3GY4A 2G00A 3RXSA 3QGNB 2NU0E 3R3GB 3QGJA 4AG1A 1TQ7B 1XUKA 1KXDA 1AFQC 1ZPZA 3QLPH 1C5YB 1GGDC 1O3OA 1O2PA 2BX4A 3A88A 3PWBA 4X8VH 1NRPH 4U32A 4RKOB 3ELAH 1QRZA 5KEDA 4JZFH 1EOLA 3DFLA 1YPHE 5K0HA 1MTNC 1A0HB 1YY3A 1CU1A 4BTUB 4AORA 1BQYA 1GI3A 2KCOA 1P02A 1QL9A 3F1SB 3AAVA 2ZU1A 2BM2A 1OPHB 4WXIA 3BIVH 2D2DA 4O03A 2F9BH 4YLUA 3VFEA 4YESB 3FP8E 3KQBA 4QT8C 3TLOA 2Z9LA 2ZFRH 1Q31A 2A5AA 5FX5A 5AHGH 3LGWA 1P03A 3PMJA 3DCLA 1O5DH 1BT7A 2BTCE 2RG3A 2FLBH 1RTLA 1C2JA 3PLPA 1QB6A 1BHXB 1P2KA 2A2XH 2F83A 2F9OA 1BOQA 2BD7A 3O8RA 1QRWA 4AFZA 3NKKA 4ESTE 1MABB 3EDXB 1CA0C 4B2BA 1H8HD 4ISHH 3UAIC 4AYYB 2FYQA 4WXVA 1SLVB 3SNCA 3ZVCA 1F0RA 1HBTH 4FUFA 5LH8A 2F91A 4KTCA 3U69H 2W6JD 4ABHA 3DFJA 1Y8TA 1ZZZA 3W1EA 1YM0A 5ABWA 3B23B 1XM1A 3A7XA 3A83A 2ULLA 5PTPA 1IQEA 1DXWA 2AIPA 1BMLA 1ZTKA 1O34A 3GICB 3RXOA 1N1LA 3GOVB 3K6YA 3SO3A 3EA7A 3SU5A 1AE5A 2Y7ZA 3SQEE 1TQ0B 1GI7B 3SJOA 1IQNA 1NTPA 2ASUB 1LHGH 1O3PB 3ATIA 1O30A 4NSVA 1UHBA 3OU0A 1HDTH 3N7DA 3BEUA 3H09A 4Y7BA 1SI5H 1WBGB 3ESTA 3EYDA 2XC4A 1WAYB 1XUFA 1C5LH 3QTVH 1DITH 1QJ7B 2ZFPH 3ZV9A 1TNJA 4I32A 3W95A 2ZDMA 1P0SH 1YPJH 1KYNA 2SGEE 5IK2D 3UPEA 1W8BH 3ENSB 4BTIB 2W5EA 4UFGH 1DUAA 2O8WA 4IBLH 2AMDA 3GCOA 2TIOA 2I6QA 3SZNA 2P59A 3H7TA 3LGUA 3BG4C 4OS1A 1UK4A 4CR5A 1XKBC 1MZDA 4AC9A 2BDIA 2AGEX 1DWCH 1C1NA 1GI4A 3NZIA 1C2KA 4FUBA 2J94A 1JRTA 2PR3A 1V2OT 3DUXH 1PPHE 2FO9A 2JH6D 1C2MA 2H5CA 2J98A 3I78A 3PLKA 3PV4A 1OYQA 4O3UA 5T6DA 1IQIA 1FMGA 1GI5A 2W7UA 3KHVA 5DP7A 3D62A 4JCNA 3SJ9A 1S5SA 3SV7A 4IMZA 1MKWK 1LDTT 1MTVA 2H1UA 1BCUH 3LH3A 2F9UA 3PV5A 1G32B 2BD9A 1OOKB 2ZQ1A 2DUCA 2H6MA 3RMOH 4AZ2B 5E2PA 1T7CA 1DOJA 4AGKA 3GCNA 3IWMA 2R9PA 2O8MA 3ODFA 1C1SA 1QFKH 3RXPA 3NWUA 4O97A 1ABJH 4FUDA 2Y80A 3TITA 5F8TA 2FP7B 1MCTA 1P06A 1GMHG 3AASA 3SGQE 4CR9A 3ZZ9A 3LIWA 4NCYA 4H6SB 4NIXA 3WWFA 9ESTA 1QBVH 2YNBA 1TOMH 2VIDA 2ZGXH 3ZVDA 3TK5A 1GBKA 2BX3A 4Y7AA 1WQVH 1H8ED 1GI8B 2HOBA 3E6PH 2C90B 2BDBA 1JWTA 1RIWB 1O39A 2WZQA 1NESE 4NA9H 4X6OA 1C5XB 1JBUH 1KTSB 1AZ8A 1J9CH 3OY6U 1FN8A 2PW8H 3F2GA 3E16B 2ZO3H 2RDEA 2XBXA 3KQ5A 1PPEE 2C8ZB 1O3GA 3PV2A 5E0JA 5IDKA 3QX5H 4MDSA 3BTWE 4NFFA 1DWBH 4YT7H 2BLQA 3UFAA 2ZFQH 3V13A 1VZQH 3MNBA 1H9HE 1NRQH 3PLBA 3UIRA 1Y59T 1G36A 3T29A 4YLQH 3BTEE 1SQOA 2P3TB 3AW1A 2JETC 1A46H 3LOXA 3EGKH 1VR1H 4BAQB 3VXEH 1SQTA 4ABAA 1V2KT 1QNJA 4K5ZA 5F03A 4IMQA 3QN7A 3QDZB 3MWIU 1ETRH 1AGJA 4D9RA 3PB1E 1A3EH 2G5NA 2AEIH 3QUMP 4GSOA 4Q7XA 4XSKU 1BIOA 1GDUA 2BVXH 4YO9A 4X2VA 2BXTH 2G55A 2EEKA 2P3UB 4MVNA 1OWJA 3MU1A 3ZZAA 5DSFA 1IQGA 4BAHB 3P95A 1MQ6A 2OQ5A 3E90B 1MAYA 2CHAC 1C5WB 2P8OB 1UVTH 4A6LA 5K7RA 3M35A 4DG4A 2R2MB 2EQNA 1C1OA 3UR6A 4X2YA 3SJIA 4I8LA 1DLKB 5DP8A 4JZDH 1ZMJA 1C5NH 1KXFA 1QJ6B 1LHDH 3BTFE 1TPAE 3GDVA 1EUFA 5GXPA 1V2VT 1BHXF 8KME2 1L1GA 2ZFSA 1G37A 2A45B 5C94A 1FXYA 1NRRH 3S7HB 1QBNA 4DGJA 2V3OH 2BY8X 3I29A 3VGCB 1Y5BT 2XCFA 4F4OC 3SBKA 2HGTH 4H4FA 4XBCA 2B7DH 6ESTA 1HIAA 5HXFA 4CH2B 2OCVB 2BD8A 2WPKS 3L33A 2JDID 4LOYH 4TWWA 4F49A 2NU4E 1C9PA 3SGBE 2QCYA 2STAE 4JYTA 4FUHA 1W0KD 2J92A 3A8DA 1WTHD 2F9NA 2QAAA 4XRNA 3DSPA 3M7UA 4LZ1H 2GT8A 1IHTH 3URCA 2L74A 1DXPA 2J38A 4GVUA 1YPLH 5CE1A 1IQJA 2XNDD 1WUNH 4MLFB 2C4FH 1K28D 1MCVA 3CS7A 4K1TA 4ZKSU 2SGDE 2TBSA 1GG6B 4JZ1A 2FI5E 3STJA 3E91A 4R8TB 3T27A 1RIWC 1UVPA 3EA8A 1L1JA 2PGBB 1TONA 3FKSD 3OTPA 1NBME 1S6LA 1SGYE 3SYJA 2VB0A 3EAJA 3KQCA 2ZCLP 1RGQA 3SV2H 1F5KU 3JZ2B 4JYUH 1SGFG 1J15A 2PLXA 4NSYA 5C1XA 2J5UA 3KGPA 1HJAC 4B2AA 1OWEA 1NU7B 1MBMA 3PRBA 5GPIB 1HAOH 1O2KA 4UD9H 2PHBA 1FV9A 2AHME 2QF4A 2WPLS 1OS8A 2ZGJA 4ZXXH 3UNRA 4ACBA 3S9AA 5DG6A 3LC5A 2CK3D 2Z7FE 1NO9H 4MNVA 4WMDA 5F8XA 3UTUH 1VCPA 1COWD 2ZU4A 1O2NA 5L2ZH 1C1WH 1W2KH 4IC6A 1KTTB 1YF4A 4X8SH 1A61H 4BAOB 2PKAB 1KIGH 1CHOG 2KAIB 1ELFA 5FXLA 4ABJA 2J9NA 5FX6A 5ESTE 4I31A 4XBDA 1EOJA 1AVGH 1O3CA 1S81A 2WPHS 4JYVH 2FIRH 1ELEE 4MQAA 4NIVA 1C1UH 1Y3VA 5BRRE 2IOTA 3UWIA 4CH8B 1U6QA 2EC9H 4Y8YA 1AFQB 3HK3B 5DP9A 3LPRA 2FX6A 3KIDU 1GHBG 1LVBA 1O3KA 2C93B 6CHAB 2EI7A 2RA0A 1A0LA 4AOQA 1PPZA 1QBOA 2ZU2A 5HIYA 3HK6B 1GBDA 2ZU3A 1MTNB 2AMQA 3GY8A 1ELVA 4K1SA 3GCTF 3ATWA 3RXFA 5FCRA 3ATMA 4KGAA 5B6LA 2BD3A 1E79D 5JYIA 3DSOA 5FCKA 2SFAA 4LZ4B 3OY5U 1AZZA 2BOHB 3TJVA 3RXLA 1A3BH 1TX8A 1UJ1A 1XUIA 4MNYA 1O31A 5E0GA 4UONA 4Q7ZA 2ZTXA 3RXDA 3PMBB 1ORFA 1BMMH 3UB0A 1FPHH 2VH6A 2Q1JA 2F9PA 5HGGA 1KMHB 3A8CA 4RSPA 3ZZ4A 1Y3XA 1TIOA 1GBFA 3GYLB 2V35A 1FY4A 2GVFA 3KYFA 4NA8A 3ZYDA 2W7SA 5GCHF 1OWHA 3OAAD 2QV1A 3A7ZA 3S0NA 4SGAE 1CA0B 5C3NA 4NGAH 1HAGE 2J95A 2GMTC 4X0WU 5AFYH 1BMFD 4B6EA 1ZR0A 3N7OA 2ZGCA 1Z1JA 1BTXA 1VKYA 2BXUH 3SQHE 2LPRA 1CT4E 1FY1A 4ASHA 1DICA 2WSSD 1C5VA 1EJAA 4HTCH 2QXIA 1K1MA 1C1TA 1UO6A 4X6MA 4A1XA 2QIQA 1QJ1B 3RC6A 5H4IB 1DY8A 3A85A 1Z6JH
chains in the Genus database with same CATH topology
4Z6AH 1SGCA 5GJ4B 3T2NA 1NFUA 1AKSA 2Z3DA 2M5TA 2ANMH 1LVYA 3TJOA 1TGNA 4D7FA 3U1JB 1HAXB 3AVZA 1CGIE 1QB9A 1LPZB 4YOGA 5DJ7A 2OUAA 1ESAA 3VB3A 2LNCA 2H9HA 3T25A 1PQ7A 1E37B 4O9VA 4BAMB 1YLDA 3U98H 3F9GA 1ZHMA 5DP5A 1ZTLA 1LQEA 3QZQA 1A2CH 3P8OA 1UTJA 2ZTZA 4U01A 2VWNA 1C2IA 2XBVA 1BJUA 1UHBB 2ZPRA 5EXNA 3GDUA 4ABDA 3SJKA 1CHOF 1D6RA 1P2OA 1F0SA 2BY6X 3A82A 2D1JA 1QGFA 3BG4B 3UQVA 2ZU5A 1MQ5A 1QR3E 1TX7A 1IQFA 4KTUA 1RJXB 5C20A 2FOMB 5AFZH 1WOFA 1UVSH 1A5HA 3O8BA 2BLVA 2A7JA 3DT0H 1ESBA 3RC4A 2OC1A 2F3CE 3C1KA 4I33A 6LPRA 1B0EA 2GX4A 1P12E 3HGNA 1C5TA 3M37A 4ZHMU 1K1LA 3UNSA 3UOUA 4D76A 1KXEA 2XTTB 2QY0B 1GHBF 4MPXA 4B74A 3AAUA 3Q3YA 1MZAA 2XCNA 1TNHA 1FAKH 3LJJA 4FUCA 4HGCA 6CHAC 3M5LA 1TGTA 3ITIA 1E35B 3PTNA 1ELTA 2OLGA 1QA7A 1TMTH 2JKHA 2P93A 1AMHA 1SR5C 1CSOE 3PTBA 1O3NA 2BMGB 1K1NA 2V6NA 1HB0B 1AY6H 4KELA 1E36B 1GBJA 4ZKRU 3NPSA 2UUFB 1Z8JB 4IGDA 4BTTB 1ZHRA 3L3TA 4B73A 1G3EA 1Z8GA 2QC2A 1O2TA 3BTGE 2VVVA 4RN6A 1SMFE 1S82A 1C2LA 3O8CA 1ZMNA 3MO3A 4DJZB 3T28A 1MKWH 2G8TA 2EI6A 1P9SA 2QA9E 1FAXA 2B0FA 1V2LT 3SOSA 5HYOA 3KCGH 5ESBA 1RTFB 3RXMA 3U8TH 2ZGHA 1EAUA 4IW4E 1GVZA 1Z1IA 3D65E 4U2WA 2BOKA 1TGSZ 3STIA 4OS7A 1K9OE 4MNXA 2PV9B 1DWEH 2VJ1A 1W11U 2WYGA 3VB5A 4XDEA 1EZUC 4AN7A 4XOJA 2ZA5A 2RA3A 1HAVA 1XUGA 1ARCA 1FJSA 4YT6H 5CHAB 1KLIH 4WF8A 4X1SU 1V2QT 1THSH 1O2QA 2UUYA 2VWLA 1GHXH 3A8AA 2JETB 4UDWH 1HNEE 1CVWH 1EX3A 4K3JA 2OC8A 4HZHA 1SGQE 5T3HA 1IQLA 1F0UA 1ID5H 1GDQA 1GMDF 5T6GA 1O2HA 1SLUB 1NC6A 1O3BA 2ODYB 1ZRBA 1W0ZU 1EJNA 3P8FA 5JBTA 3LU9B 1ETTH 2OBQA 5F8ZA 4Q7YA 3DA9B 1P2QA 1ZLRA 2QXGA 3MNXA 1AVWA 1BJVA 1TMBH 1OKXA 3Q3XA 2CV3A 1EP5A 1JIRA 2BVRH 2CHAB 2FWWA 2ZNKH 3P70B 1L0ZA 2ZDNA 1O3MA 2VIPA 3T26A 3TJUA 5A8ZA 2FM2A 5EU8A 2RDLA 2GZ9A 3VB6A 1C2FA 1BTYA 3TK9A 1YCPM 4YTAA 1S6HA 2HALA 4A1TA 4ZXYH 3SU1A 1CBWC 2R0KA 2XW9A 4B2CA 3CS0A 1NM6A 3SU6A 2ZHDA 1UCYK 4CRDA 5LPEA 2AFQB 2ZCKP 1FIWA 2NWNA 1P2IA 3QZRA 2G5VA 3ZVGA 2J4IA 3O8DA 4ZH8A 4ABEA 1QA0A 4KKDA 1SPJA 1GPZA 2BQWB 2A31A 1VITH 4BANB 5FBIA 2P95A 2EI8A 1P01A 2VVUA 3SGAE 5LGOA 1TX6A 1GBTA 4GPGA 4TYDA 7LPRA 3F9FA 3PM3A 1AUTC 1GJ7B 2C3SA 2ZTYA 1N8OC 3M5MA 1P10A 2FXRA 1AQ7A 1QQ4A 1TBZH 1UTMA 1YLCA 3FFGA 1ARBA 1KLTA 3BTQE 4ISNA 3F9EA 3M7TA 3RM0H 3MOCA 2PSXA 2SGAA 5FPSA 1HIAB 4GAWA 4ISLA 2HPPH 1AHTH 3PO1C 1SSXA 1P09A 4BAKB 3T5FH 4FVBA 2IPHA 1T4VH 4CBOA 3A8BA 3ZZ8A 3TGJE 1IOEA 3PWCA 1ZGIA 3EE0B 3MTYA 3ZZ7A 1DDJA 3K65B 1T32A 4Z0KA 3BEIB 1HAPH 1NRSH 5E8EH 5EOKA 1O38A 1J8AA 2VGCC 1CA8B 1ZTJA 1H8IH 5J4SA 1LTOA 1OP0A 1DS2E 3MH5A 1W3CA 2CGAA 4X1RU 1H9IE 2W26A 1VCQA 1ZYOA 2FOAA 1HJAB 4MPVA 3KN2A 4LK4A 1DVAH 1C4U2 1CGJE 4GHQA 1T8LA 5CHAC 2UWPA 2ILNA 2Y81A 1MTWA 1QL7A 2GTBA 2SGPE 1HFDA 2C8XB 4X6NA 2FX4A 1WYKA 1V2JT 1TMUH 1HAIH 4ABIA 3D49H 3IITA 2UUJB 1O5GH 4BOHA 1OXGA 1TYNA 3A7TA 2XC0A 1ELCA 5I46H 1GMCG 2BLWA 3MYWA 1O2UA 2BLOA 1E38B 1SL3A 4AFQA 2FYRA 3S9BA 2O8UA 4XFQA 1SOZA 1QHRB 2A4OA 1KXAA 5EQRA 1XVOA 5G4BA 1P11E 2PSYA 3A7VA 2ZFTA 1K1PA 1O5EH 1K21H 2VVCA 4NZLA 3EA9A 1FI8A 1GHAG 1HAYB 3GDSA 4BXWA 8GCHF 3A86A 1V2RT 1P8VC 3ZZBA 1G9IE 3T62A 1AWFH 1MD7A 3VPKA 1BMNH 4CRGA 1V2MT 1WU1A 1DSTA 5BPEA 1SC8U 2XXLA 4SGBE 4UFDH 3ZVFA 1TLDA 2VNTA 1UTLM 1PPGE 5DGJA 1LMWB 2PFEA 3RXCA 1TRYA 1SGRE 1TGCA 1ELAA 2CN0H 3FP6E 5JB8S 4HFPB 2JH5D 1CT2E 1L4ZA 2AH4X 4R0IA 2UWOA 2WPMS 1C4V2 3SNBA 3UWJH 2BVSH 3GCTG 3DD2H 1ZJDA 1GBEA 4WY3A 1G2MA 2TGTA 3F6UH 2ZKSA 4WJG2 3SU3A 2AMPA 4FVDA 3TK6A 5EXLA 1Y5UT 1TNGA 3RLWH 1K1JA 2FOEA 1UVOA 2ZPQA 2BYAX 1B7XB 1O32A 3QK1A 4X8TH 4AB9A 1O0DH 2ZECA 1MH0A 3M5NA 1DT2A 2GZ8A 1GL1A 4ZUHA 2AERH 1TNLA 1EB2A 1EPTA 2GMTB 5GCHG 1NRNH 4UFEH 3S69A 1ANEA 1GJAB 1OWKA 3Q77A 2IN2A 1C5ZB 1EQ9A 1AB9C 2BY9X 1D4PB 2BDYA 1F5LA 2CF8H 2VU8E 1T31A 2XBYA 4CREA 3MU5A 1XXFA 2SGQE 4DVAU 2G4UA 1W7GH 3RDZA 4THNH 3GY2A 2QGRA 2XWAA 1MAXA 1HV7A 1LPKB 2FOCA 1IQKA 2W3IA 1O3JA 1AWHB 3RXEA 5A8XA 2G4TA 4J1YA 2WV5A 1J16A 2HNTC 2WPIS 3TPIZ 3RP2A 2ALVA 2XRCA 2P3FH 1C1RA 1FY8E 1MKXH 1VITG 3ZZ6A 1K1OA 2FPZA 1UTNA 5L6NH 2HLCA 5AVDA 5LPFA 2FZZA 2QF3A 2AIQA 1XUHA 3MU8A 1PFXC 4Y71A 5JBBS 1LKBA 2OP9A 1WCZA 1A0JA 3FVFB 1ZSKA 3P8GA 1AKSB 3ZYEA 2AGIX 1GMCF 3L6PA 3KQDA 4OS5A 1KLJH 2WPJS 2TGAA 3BTDE 4X1NU 1GCTC 1HYLA 1GHVH 1ZJKA 1P57B 1OP8A 1SLXB 2ZWLH 4NG9H 1SVPA 1IQMA 3RXGA 2O9QA 2FOBA 1O2JA 2J2UA 1GHAF 3H5CB 1BUIA 3SU0A 2DE8A 1B5GH 1O3AA 3E8LA 3TH2H 3HPTB 1YCPH 2OBOA 1GBBA 2OTVA 1BBRH 1TGBA 1ANCA 1ZHPA 1C2GA 1FPCH 1UTOA 2A4GA 3NK8A 2Z9KA 1P04A 1GJBB 1BTUA 1MU6B 1UTQA 2OQUA 3S7KB 1FN6A 2FDAA 4M7GA 3A89A 3P92A 1F92A 3LGVA 5EG4A 4FUGA 4BNRA 4INHA 1TWXB 2V3HH 2NU1E 4TPIZ 1ETSH 4ABGA 1F7ZA 1DFPA 3OTJE 1SOTA 3UNQA 1N6XA 3ZZCA 2VWOA 4WMEA 2FMJA 2Y6TA 1HJ8A 1F2SE 2BDGA 3BG8A 3EQ0H 3QO6A 4I8KA 1RD3B 3SN8A 3SUEA 4JK5A 2OC0A 1A5GH 2FS8A 4OGXA 2H2ZA 5AF9H 4ABFA 1HXEH 1OWIA 2VIOA 1O3IA 1NS3A 3MI4A 2AGGX 5E0HA 5DO4H 4MPWA 1GWAA 2FOGA 1C2HA 1GBIA 2GZ7A 1XMNB 1NROH 2B5TB 5L2YH 1G3DA 1S84A 1AO5A 1GJDB 2VIWA 5ETXA 4GLYA 4X1PU 1D3QB 3RC5A 1TE0A 1UMAH 3AW0A 4E7RG 1Y3WA 3JZ1B 3U1IB 2Y7XA 1S6FA 1AUJA 3F68H 2VH0A 2GKVE 3KL6A 2GCHG 3P17H 1GJ8B 2PUQH 2D26C 1ZMLA 4DIIH 4Y8XA 2ZDKA 4X2WA 1V2WT 2OXSA 4ZROA 1EJMA 2BZAA 1C1QA 4CRBA 1V3XA 2FLRH 4A7IB 1CE5A 1VITF 3SUFA 3MNSA 1M9UA 3SV8A 1UK3A 1O2SA 1BRCE 2HRVA 4Y76A 2GCTC 2Y5HA 1GMDG 1HAVB 1INCA 1BB0B 4AFUA 1RS0A 4YM9A 2BQ7B 3CP7A 1C5RA 1V6DA 2V0BA 3M36A 1E0FD 4H42U 4DURA 2PKSC 4K2YA 4GCHF 4FU8A 4B75A 4WMFA 2A5KA 1UTPA 2K1QA 3SUGA 4D7GA 2Y5FA 1C2DA 3E3TA 1W10U 2SNVA 3LONA 1PJPA 3I77A 1ZPCA 3LGIA 5DPAA 1CBWB 1O33A 1O2XA 4ISOA 4Y6DA 1MD8A 2AYWA 4GHTA 1DLEA 5HM9A 1NFWA 1EP6A 3TH3H 1EAXA 1TBRH 1WTGH 5C5NA 3A80A 4MTBA 3IG6B 1GBLA 1YPHC 1NN6A 3LC3A 4A92A 1O3DA 2XNIA 1EXFA 4B76A 1GBAA 1D6WA 2XC5A 2ANWA 1SGNE 5FHTA 1SLWB 3GYMA 5A09A 3MNCA 3RUOA 2OC7A 5I25A 4JZEH 7KMEH 2Z3CA 3RXKA 6GCHF 5A2MH 1PQ5A 3SI4H 1S0RA 4KTSA 4NFEA 5C1UA 1N8OB 4X1QU 4Y11E 1KDQA 1C2EA 1Y3UA 4D8NA 2ZEBA 1UCYH 1NY22 2WV4A 3MHWU 3NUMA 3RMNH 2GV7A 1O2ZA 1BRAA 5HM2A 3V7TA 2I6SA 1QCPA 1EKBB 1S85A 1CQQA 1PQAA 1H1BA 3PO1B 4FU7A 2A32A 2BHGA 2ODPA 4JZIA 3HGPA 5J4QA 3KF2A 1P05A 1FY5A 1YPGH 1L4DA 1K1IA 1A1RA 1O2YA 2A7CA 1O36A 1CO7E 2DE9A 3GISB 1GHYH 1VCWA 3K6ZA 5EGMA 2CXVA 2VGCB 1YC0A 1DM4B 1PQ8A 2PUXB 4X6PA 2C8WB 2BD2A 1JIMA 1DY9A 3UR9A 4DW2U 1X7AC 2ZDLA 1NFYA 2GCHF 2G52A 1HPGA 1Y3YA 3RU4D 3BN9A 3GCHB 4AYVB 1SFQB 2FOFA 5B6OA 1P2MA 5LPRA 3TNSA 4D9QA 3LT3A 1FIZA 3VB4A 1K2I1 1QRXA 2A0QB 3ZV8A 1ZSLA 1W12U 1D3DB 4K69A 2GV6A 5FAHA 1LKAA 4UE7H 2O8TA 3SUDA 4FUEA 1ESTA 1VGCB 4O3TA 7ESTE 1GL0E 2BB4A 1L2EA 3RXRA 1GVLA 1LVOA 4I8JA 1N6YA 1EZXC 3M3TA 1O3HA 4FU9A 1YKTA 4B1TA 4XBBA 1C1VH 3SV9A 1MU8B 2ZC9H 3MH7A 5EQQA 4CHAC 4BXSA 2B9LA 1IQHA 2SNWA 2PTNA 2Z94A 1GI9B 1AN1E 5IYTA 1GHZA 4FXGH 2ZHFH 3KQEA 4IN2A 2STBE 1HUTH 1RFNA 2R2WU 3TU7H 1MUEB 1DPOA 5A0BA 1SGDE 1TOCB 3BTKE 2FI4E 3SHCH 1AFEH 8GCHG 1GJ9B 1H8DH 2ZI2H 3V3MA 1GCDA 3UREA 4HI3A 1GHWH 1AVXA 3LGYA 1LQDB 4ZHLU 1C5OH 1ZPBA 2W3KA 3SW2B 1ZRKA 4IS5A 4E06H 7GCHF 2Z9GA 3RU4T 1LHEH 3A7WA 1RXPA 1XKAC 3GY6A 4CRFA 3UQOA 2Z9IA 2GD4B 2ZDAH 2TGDA 3F9HA 3SJ8A 1ELGA 3FZZA 1ZGVA 5F6MA 2FEQH 1TABE 3HATH 3M3SA 5JBCS 1MTSA 2A4RA 3A87A 4AX9H 3U8RH 4OGYA 2WYJA 1BITA 2Y5GA 2TRMA 1JMOH 1EZQA 1BBRE 1FLEE 1HJ9A 1O37A 5JDUB 2QN5T 1O2IA 2XBWA 2FTMA 2ZP0H 3TIUA 3B8JA 1LO6A 2ZHWH 4DOQA 3E0NB 5C67A 1BZXE 2WUBA 5A8YA 2BY7X 1LVMA 3MH6A 2ANYA 4NWLA 3RU4E 3V12A 1AB9B 1NFXA 3U8OH 2GDDA 3BEFB 1GI2A 1PPFE 1GBMA 1D9IA 1TPSA 3KNXA 1SGEE 3PMAB 4Y8ZA 1BRBE 1O2VA 2HVXA 2A2QH 1WSSH 1HCGA 1OX1A 1O35A 1KY9A 1TRMA 1C5SA 4NZQA 1IHSH 5GWZA 1JOUB 5FBEA 1GBHA 3GY7A 3GY3A 1PPBH 3SU2A 2H5DA 3ATKA 1EPTB 2WINI 5C1YA 1ACBE 1OYTH 1RRKA 3ATLA 3SNEA 1DUEA 3LH1A 3CENA 1SB1H 3B9FH 5TCCA 3RMLH 2THFB 5EPNA 3TGKE 4MG3A 1D3TB 1YPMH 3ZZ3A 1NU9A 2JH0D 1EAIA 3SU4A 4GUXA 3BF6H 1OP2A 1FUJA 5TCAA 2FI3E 4AG2A 3PMHB 4WWYA 3GCHC 2SGFE 1W0YH 3Q00A 4YOIA 2ZHQH 1SFIA 4X8UH 1HGTH 4NIWA 2QYIA 1YP9A 1TNKA 1O5FH 1VGCC 3RXV<