2TGAA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords TRYPSINOGEN
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgaA02
3ESTA 1T31A 1W0YH 2IJOB 2OBOA 4DCDA 2AEIH 3LC5A 1EQ9A 2ZGHA 1ZGVA 3TU7H 1ZYOA 2WINI 2GV6A 1GBIA 2I6QA 1MBMA 4NIXA 1GHAG 3MO6A 1N6XA 1ABIH 1YGCH 3E6PH 1C1NA 3BSQA 5FBIA 1L2EA 4X8VH 3SQEE 2VIQA 1H9IE 2WPHS 3ZZ4A 1EOJA 1UK4A 2H5CA 3SU0A 1H9HE 1G32B 1ANDA 1TRYA 4JYUH 3UNQA 1OXGA 5EU8A 2P94A 4MTBA 2D1JA 1SSXA 2VIOA 1QBOA 4GCHG 1F7ZA 1GI2A 3MU5A 1N8OC 5C3NA 4BTUB 1O3IA 3ZZ6A 2VH0A 2XBWA 4CH8B 1GHBF 8ESTE 1AVWA 3PMBB 1L1JA 3FFGA 4K5ZA 2V3OH 5DP4A 1MTNC 1UVPA 1ZPBA 2RA3A 4M7GA 3OY5U 5JBBS 3O8RA 3LDXH 2ZU4A 2XYAA 4NIYA 1UMAH 4MPWA 1UTQA 1S82A 1S84A 1GBCA 2PWXA 3KL6A 5DP7A 3RXBA 4YZUA 3EGKH 1CT2E 5A8ZA 2P3TB 1GPZA 1NT1A 5ESTE 3UWJH 1ETRH 3QLPH 4JYVH 3GY8A 3P17H 1F0UA 3KF2A 4NA7A 5FCKA 1QQ4A 2BZAA 2G4UA 1TNHA 3RXOA 3UFAA 2JKHA 3RXMA 1DX5M 1UTJA 2SGQE 1QB1A 1B0FA 3VB7A 5C67A 3RMNH 1QY6A 1A1RA 3M36A 1SLWB 1TPOA 2ULLA 2Z9GA 2P93A 1NESE 3ODDA 1O2WA 1O3MA 2TGDA 2OQUA 3PYHA 1KY9A 2F9OA 4ISIH 4B73A 3ZVCA 2HWLB 4GVUA 1SGIB 1S81A 3KGPA 2SNVA 1WSSH 2O8UA 5CE1A 3LT3A 3V13A 3E16B 5DPAA 1T8LA 4K8BA 1C5UA 1OWDA 2ZKSA 3GCOA 3UIRA 4IN1A 2F9UA 1BMMH 2JH5D 2BXTH 5FPTA 2FDAA 1C4U2 4MNXA 1PQ5A 1LVMA 2OUAA 5DO4H 4A7IB 2QYIA 1SB1H 2BQWB 2O8TA 4X8UH 5C1UA 2SFAA 1P2QA 1V2JT 2PTNA 2A4RA 1IQJA 1THPB 1HB0B 4QT8C 3ATMA 1EZXC 4WMDA 1C9TA 2A1DB 1KDQA 4NWLA 5DP6A 1TMBH 3SI4H 3MO9A 1TOMH 4H42U 6ESTA 1RIWC 2ZFRH 1UCYK 1S0QA 1O3EA 1SLXB 1DS2E 4I8HA 4ABFA 3N7OA 5I46H 3UR6A 4TPYA 4JZ1A 5J4SA 3I29A 2P16A 3SI3H 1AUJA 1CA8B 3LH1A 5LH8A 2SGEE 1EP5A 3RMMH 1CA0C 2C8WB 3MI4A 4OGYA 1YP9A 2R3YA 1GBKA 1OSSA 1F5RA 4YT6H 1QTFA 1UTMA 3AAVA 4LK4A 2BD5A 1C2FA 4BXWA 4KELA 2BMGB 4AZ2B 1LCYA 3V3MA 4FXGH 1INCA 1MCTA 1HAVA 1GHWH 2SGAA 4GAWA 2PTCE 3RXJA 1GGDB 2BVSH 1YCPK 1TX6A 1BRCE 1C1VH 1C2KA 3PM3A 4B74A 4CREA 4JCNA 1VZQH 2V3HH 5C5NA 1NRQH 2Q6FA 1H8DH 2BD9A 3TLOA 1VITH 3UR9A 1ZRKA 3SJKA 1CE5A 3T28A 2H6MA 1MUEB 1HAZB 1A61H 2BVXH 2QIQA 2WPLS 2XC5A 4UEHH 4WMEA 3DHKH 4ABBA 1CHGA 2XCFA 1GMHF 2QXGA 1FONA 1H1BA 1ABJH 5C1YA 8KME2 2ZG0H 4Y8XA 1Y3YA 3EDXB 3A84A 3URDA 1SGDE 3TGIE 1DWDH 1PQ7A 5SGAE 2W7SA 3RMOH 1BITA 2ZGJA 3LJOA 2ZCLP 5GIBA 3C27B 2GX4A 1C9PA 4MNYA 4X6NA 2BD8A 3MH7A 1C5WB 4RKJB 3F9FA 3RXIA 1ELEE 1JXPA 1LHDH 4NIWA 2GV7A 1HNEE 3W95A 7ESTE 1AWHB 4B2BA 5K0HA 4AOQA 2Z3DA 2CF9H 1NROH 3KEEA 2ZDLA 5JYIA 3A7XA 4AYYB 1NU9A 3RMLH 3QGNB 2ANWA 1LPKB 1DANH 1C5SA 1GBHA 2ZTXA 3RC5A 1UJ1A 2AGGX 1O31A 3A8DA 1P09A 5PTPA 2Q6DA 5T6DA 1H8IH 2R0LA 1MTWA 1TABE 2RG3A 3NK8A 1A3EH 3SNAA 1DWCH 1OX1A 1GJBB 2J38A 1TQ7B 2QC2A 2ZFPH 1TE0A 4FUHA 3RXPA 2ZF0H 3PTNA 1VGCC 1HAYB 1HRTH 3AW0A 4D76A 2JETB 1GI4A 1UTNA 4NG9H 4YESB 2K1QA 2BQ7B 1ELCA 4FU8A 4ABJA 3BTWE 3M3VA 3Q77A 2NWNA 2I6SA 3BEIB 1NY22 1UTPA 1GBDA 2FMJA 1A2CH 3MWIU 1P3CA 4JMYA 1EZQA 1LPZB 3PMJA 5C2ZA 2A7CA 4HFPB 1ZHMA 1EKBB 1V2MT 2ZFQH 1O5EH 1TLDA 2O8WA 1W11U 3S0NA 1SGFG 3UPEA 2ODPA 3UQOA 4CR5A 2EA3A 2F9BH 3NKKA 1LKAA 5AHGH 4RKOB 3EQ0H 3L3TA 1F0RA 1QRZA 1ZTLA 1DPOA 4FVBA 1HUTH 1IQFA 1PPCE 4Q7ZA 2ZNKH 2WPMS 3Q00A 2ODYB 4J1YA 4ISLA 2BLWA 4H4FA 1K28D 1PPEE 2F83A 3MU4A 2V35A 1AZZA 1E36B 1OP8A 3ZZ3A 3MH4A 1E0FD 4UFFH 4ISNA 2XBYA 4ZUHA 1GJ9B 1HFDA 2R3UA 3RC6A 1RTKA 2FLBH 3P8NA 2G4TA 1O3NA 1YF4A 1BMLA 1NS3A 3SJ9A 1GBAA 4VGCB 1LPGB 3EE0B 2CV3A 1QBNA 3UQVA 3MU8A 1N8OB 1DWBH 2ZIQH 1YLDA 3S7KB 3SU3A 1HAHH 3A87A 1DITH 2Z3EA 1P2MA 1V2QT 2H2ZA 1FV9A 1UVUH 2AS9A 2F3CE 3M7UA 3BTKE 4X0WU 4A1VA 3RXDA 1O5FH 2UUFB 1A7SA 1Y5AT 3BTEE 3A85A 3MNXA 1QB9A 4K60A 4R0IA 5C5OA 3RXTA 3SU2A 2AIPA 1P2KA 2Z9KA 1KLJH 3SZNA 1CSOE 3HPTB 4X1SU 4ABDA 2ZCKP 1O2HA 5DKMA 3FZDA 4X2WA 4CRAA 1NRNH 4D9QA 2EI8A 2AGIX 3OY6U 4CHAC 3OSYA 4Y0YE 1RXPA 3GDVA 4FUGA 1UCYH 3RUOA 5FX6A 1YPEH 4FUDA 1V2LT 1W8BH 1O3AA 1BTHH 1TONA 4TWYA 2VVUA 4ABGA 3UREA 2A0QB 4CRDA 2BDIA 1O36A 1TX7A 2ZQ2A 4I8LA 2ZHFH 2GZ8A 2Z94A 4IMZA 4FUEA 1DY8A 2AYWA 1FDPA 3P92A 1FUJA 2ODQA 1DOJA 7KMEH 2ESTE 1HPGA 1MQ5A 1P9UA 1S6HA 1P3EA 1THSH 1O2UA 1AFQC 1K1LA 4BTIB 1BIOA 2XNIA 1C5VA 1B7XB 3K65B 5JB9S 3M37A 2PHBA 1AQ7A 4JK6A 1CHOG 2GGVB 1DY9A 4Q7XA 3VB6A 2WPIS 1HV7A 5I25A 2BX4A 2CN0H 2ILNA 1ORFA 4ZKRU 2R2MB 1DDJA 3ZVDA 1ZMNA 1OPHB 3E0PB 1AE8H 1QNJA 3UNSA 2BD3A 3DA9B 1AVXA 4IC6A 1JRTA 3ATIA 1ELGA 2AERH 2OCVB 3A8AA 3FANA 4LXBH 3ZZCA 1SQAA 4FU9A 4H6TA 3VB3A 4MDSA 1JOUB 4MVNA 4NZQA 1HGTH 1GI5A 2PGQB 3BV9B 2WYGA 1MTNB 1TOCB 5F03A 1DUAA 3RM0H 4WY3A 1IOEA 1DT2A 5EODA 3ZYDA 1JBUH 2QCYA 1EAWA 2ZU5A 1W7GH 1O5BB 1TB6H 3BEUA 4Y79A 1RJXB 1KXDA 4WXVA 2ZQ1A 2OC0A 2P59A 1KTTB 2A4QA 4CRCA 4SGBE 2OC8A 1Z8RA 4BAMB 1FMGA 1SGYE 2QF0A 5FXLA 3GY3A 3VXFH 3KQBA 1XVOA 1XKBC 3UNRA 1PYTD 1WBGB 1DSUA 1HJ8A 3S9BA 3TH3H 1ZHRA 3FP7E 2GDEH 1FPCH 4GSOA 1MKXK 2LNCA 2G55A 1TNGA 1TIOA 1K21H 1TGCA 3VFEA 1MD7A 4SGAE 3S9AA 4AGJA 2UUJB 4O3UA 3UWIA 2ZTYA 3L6PA 3EA7A 2AFQB 4U01A 2Y80A 4NFEA 4LZ4B 1EB2A 2G52A 1XUGA 5IDKA 4E05H 3ATWA 2Y5HA 1GI7B 3B8JA 1K1OA 1QL9A 1RGQA 5A09A 1UTLM 5H4IB 2AH4X 1JMOH 3M7TA 1SC8U 5E0JA 1UVSH 3ZV8A 4B75A 1A5GH 1L4DA 3P8GA 1T8OA 3SV9A 4UD9H 3KQEA 4A6LA 2FOBA 3GY7A 4CRGA 1FQ3A 3RXKA 3SJ8A 7GCHG 4OGXA 3E3TA 3P95A 2BYAX 3OTJE 1CU1A 4OS5A 4IW4E 1TNKA 3EYDA 2DUCA 1D9IA 4O9VA 4I7YH 5HMAA 4Y8YA 4D7GA 1ETSH 3BTME 1EUFA 3RXRA 4UFDH 1FI8A 3QX5H 3D62A 1LDTT 3WY8A 1GI6A 5LPEA 1TX8A 4HGCA 1O3KA 1CHOF 4X1RU 1ESBA 1TGSZ 2QXHA 2FI5E 1SBWA 1XMNB 3RU4D 1FLEE 1G30B 2FS8A 1W12U 1WU1A 1SGPE 4ZHAA 4BXSA 4IC5A 2CHAB 2XXLA 2O8LA 1VCQA 1FN6A 1E34B 3SOSA 5EQRA 4F49A 1Q3XA 3RXSA 1CO7E 2XC0A 1GHXH 2VIPA 1DSTA 1TRNA 2THFB 1Y3VA 2FYRA 5FPSA 1K1IA 1BTWA 2A2QH 1SR5C 4ZMAH 5AF9H 3ZZ7A 3P8OA 1P03A 2C8XB 2VB0A 2A2XH 1IAUA 4K1EA 1QJ6B 3TITA 2XBXA 4IS5A 3AAUA 5JDUB 4MLFB 1WYKA 2W5EA 3MTYA 3NCLA 1MQ6A 3OYPA 1S0RA 4U2WA 1O2ZA 3R3GB 3O8DA 4IN2A 3FAOA 2AMPA 4HZHA 1F92A 2BLQA 5C1XA 1MKWH 1P06A 5GDSH 1GVLA 4DVAU 1H4WA 1O2LA 1SGCA 2SGDE 3ZV9A 2GT7A 5HXFA 3SO3A 4ZXYH 1O3OA 4O97A 1BQYA 2J9NA 4OS7A 5C20A 2HLCA 1HLTH 4XBBA 3NXPA 3F6UH 4I8JA 3SNBA 3QZQA 1J16A 5EPNA 1IHSH 1AFEH 3MU0A 3PV4A 1DICA 1O2QA 3BTHE 1GCTB 3IG6B 4WMFA 1SGRE 1WTGH 2QXJA 1NN6A 4GPGA 2XWAA 2FOHA 1FAXA 1N6YA 3BG8A 4IMQA 2G00A 4XOJA 2TPIZ 4X2VA 5ESBA 2HPPH 1EXFA 1C1RA 2ANYA 1QBVH 1DLKB 1HAGE 3GCHC 3SV7A 6GCHG 2FOGA 1OWKA 2VH6A 3RXVA 1ACBE 4BAQB 2ALPA 3T62A 4AX9H 1TPPA 1Z8IB 5A0AE 3Q3KA 4KGAA 1SPJA 1AGJA 1EPTA 7GCHF 5ABWA 2GCHF 3RDZA 4UONA 3PO1C 2GD4B 3VXEH 2ZWLH 4DG4A 2R2WU 1KIGH 3A86A 1SHHB 2HNTE 1TRMA 1THRH 4K69A 3SV2H 1RIWB 1BCUH 4MPXA 1EZSC 1OYTH 2PGBB 3KQDA 3ZVFA 1PQAA 2OD3B 1GCDA 5G4BA 1OYQA 5EXNA 4YOIA 1TBRH 4JZIA 3SU6A 2CF8H 1GBFA 4MQAA 2A7JA 1Z6JH 4GLYA 4E7RG 2ZTZA 3ATKA 1VCPA 1C2MA 1JWTA 1YPHE 1GG6B 3BTFE 2XCNA 2Y5FA 1TALA 8GCHG 1Z7KA 2FO9A 3ATLA 2PKSC 1B0EA 4B1TA 5E0GA 1SFQB 1A5HA 2QN5T 1AY6H 1ZSJA 2QA9E 3U69H 1J9CH 1ZOMA 1EJNA 4IBLH 1W0ZU 3SUDA 1GG6C 1Z1IA 1HAVB 2VWNA 1WAYB 1OP2A 4J2YB 2ZA5A 4Y0ZE 1C5LH 1UCYE 1BTUA 4NA9H 1KTSB 4OS4A 1O38A 4JZFH 2STAE 2VGCC 1OKXA 4ABEA 2UUYA 4ZHLU 1TNJA 2P3UB 4TY6A 2A7HA 4U30A 3RLWH 3U9AH 1BTYA 1C5OH 1EATA 1C4V2 2QGRA 3GYMA 2VIWA 3TK5A 2FS9A 1GBBA 4AGKA 2PKAB 5TJXA 1W3CA 3SNDA 1UVTH 2VVCA 4FUBA 2NU2E 4TY7A 1KXAA 1C5PA 4YLQH 2HVXA 1V2NT 3SGBE 1O5GH 1FIZA 4CBOA 1KLIH 5T3HA 4GHTA 1WUNH 5BRRE 1T8NA 1O2XA 3IITA 4UE7H 1V2VT 1SI5H 3SN8A 1BRUP 1GMHG 1KDQB 1ZTKA 5EG4A 4A92A 1XXDA 1QA7A 1GMCG 4YTAA 3UOPA 2FLRH 1C5QA 1IQKA 3S9CA 2JH6D 3PO1B 1DLEA 1ANEA 3PLKA 4NGAH 5GXPA 1ZPZA 4CHAB 4Y7BA 2ZU2A 4K1SA 5E8EH 1S6FA 3K6YA 2WUBA 1Y5UT 2C90B 1PYTC 4BNRA 1GBTA 3GY2A 1AUTC 2PSXA 3NPSA 1YPJH 2KAIB 1ANBA 3G01A 1TMTH 1AZ8A 5A2MH 4AB8A 1ARCA 1EAXA 1FJSA 4JYTA 5L6NH 3LIWA 3SNEA 2BDYA 2ZP0H 1LHFH 3T26A 4X6OA 1G2MA 2H1UA 4XFQA 1XKAC 2V0BA 3NUMA 2HNTC 5T6GA 3SHCH 3ZVAA 1A0JA 3ENSB 1PPFE 1K9OE 1SGQE 2QV1A 3LGTA 3MHWU 4XBCA 3RXHA 1ZMJA 1GDNA 1UHBB 1E38B 1E35B 1WQSA 3T29A 1TMUH 3UOUA 3PLPA 4MPVA 3SHAH 1TGNA 7LPRA 1VJAU 4K8YA 1GJ5H 3FZZA 4INLA 1MKWK 3V12A 3VEQB 2Z3CA 3QZRA 1NFXA 3E1XB 5EQSA 1F0SA 1YPKH 1O3BA 1TNIA 4MPUA 1ZJKA 3F68H 1W14U 4JZEH 2BQ6B 5GCHG 4A5TS 2ZDKA 3UY9A 3URCA 2GCTB 3FVFB 3NWUA 1DWEH 2TBSA 3RP2A 4WF8A 1NU7B 1O3LA 4R8TB 1GL1A 3H7TA 1KXBA 3A83A 5CMXH 1FY4A 2BB4A 2ZFSA 3VB5A 5F8TA 1WQVH 5DP8A 4ZROA 1EAIA 4I8KA 2ANMH 3CP7A 3U98H 2AGEX 1BJUA 4Y10E 5EPYA 1P11E 4ZH8A 2FI4E 1C2EA 2VWLA 1GI0A 2RCEA 4XE4A 2WPKS 2FESH 2C93B 3HKJB 3ZZDA 3FP8E 2H5DA 3CS0A 3UUZA 3LKWA 1AI8H 5E0HA 3PWCA 1F5LA 1L4ZA 2PW8H 1AKSA 1C2LA 2VWMA 5FPYA 4O03A 4UFGH 4GHQA 1FAKH 1GJ4H 1RTFB 1GJ7B 1C2IA 4AG1A 1P04A 3SUFA 2ANKH 3TNSA 6LPRA 1O3HA 4DY7B 2ZDVH 2NU0E 3LGVA 1LVOA 2CXVA 2J92A 3PLBA 1QFKH 1AD8H 1ZRBA 2VJ1A 2J94A 3CENA 1O2TA 2Y82A 4KKDA 1OWHA 4YM9A 6GCHF 2ZDAH 3LONA 1MU6B 3A88A 1DM4B 2R0KA 3ZVBA 5EXMA 1C2JA 1AKSB 1VCWA 1C1WH 1ZGIA 2F91A 6CHAC 4D7FA 2O8MA 1SQTA 1GBJA 2LPRA 3E91A 2D2DA 2VINA 2A5AA 3DFLA 1T32A 4ZXXH 4YT7H 1P8VC 4K3JA 4AORA 2YNAA 1UTKA 1Y8TA 1O2KA 1AB9B 1BB0B 4ZHMU 4AG2A 4WXIA 4NSYA 1UK3A 1SLVB 2XTTB 2GZ9A 3EA8A 1SG8B 5TCAA 2UUKB 2A32A 1QURH 3TPIZ 1RRKA 3RXAA 3PB1E 4E7NA 3DFJA 1Z8GA 2GZ7A 3P8FA 3O8BA 3RXQA 1K2I1 1OS8A 4X6PA 3ZYEA 3S69A 2ZGCA 1PFXC 3BIUH 3PMHB 5E2PA 2VIDA 1GL0E 4X1QU 1FN8A 4Y71A 1GJ6A 5L2ZH 1JRSA 5JPMH 3K6ZA 1GBMA 2FPZA 3MO3A 3TJVA 1SGFA 2AMDA 3I78A 1NZQH 3M5OA 1BRBE 1VITF 2JH0D 1SOTA 3LGIA 1DFPA 4FUFA 1HIAA 2TRMA 3V0XA 1LMWB 3GCTG 4AFZA 1PPGE 1GMDF 3SU5A 2A4GA 4UDWH 1NFWA 2FI3E 3QDZB 2XC4A 2WV5A 5FAHA 1VJ9U 1L1NA 1GHBG 3RXGA 2HNTF 2YOLA 3PMAB 1G9IE 1NRSH 1MTVA 1P12E 1S85A 4NWKA 1Q2WA 1Z8JB 2FOEA 3B23B 2FIRH 2BD2A 1V2UT 2DE8A 1O2NA 2H9TH 3F9GA 1U6QA 2KAIA 1A5IA 3P6ZB 1YLCA 3ELAH 4BAKB 3HKIB 1CBWC 1EJMA 2WV4A 2FYQA 3M5NA 5EGMA 1C1TA 2WPJS 2ZFTA 3BF6H 1OOKB 1HAOH 5DJ7A 4D8NA 2ZU3A 3S7HB 1O3GA 2FXRA 1SVPA 4CRFA 2BXUH 2A31A 1C1UH 2FTLE 3LOXA 2ZECA 2Z9LA 1MH0A 1GCTC 1MZAA 1NFYA 5GCHF 3MYWA 1F2SE 4X6MA 4XBDA 1D3PB 3W94A 2J2UA 2Z9IA 1GGDC 2W3KA 2VNTA 1XX9A 4ABIA 1ZTJA 3D49H 1LTOA 3RC4A 1GJDB 3M5LA 4RSPA 2C8ZB 1HCGA 4BTTB 4YLUA 3STJA 1O2RA 1O2YA 2V6NA 3GCHB 2NU1E 3TH2H 2FOCA 1GJAB 2PUQH 3ITIA 3TK6A 3BG4C 3QTVH 2A45B 3STIA 3HATH 4GUXA 4CBNA 1WOFA 1BA8B 4WVPE 1T8MA 1QL8A 2ZHQH 4D9RA 2EC9H 1BMNH 1QJ1B 1W10U 5JBTA 2EI6A 3LGYA 4VGCC 3GY6A 3PROA 3GISB 2IPHA 4NCYA 3BTQE 2YNBA 3DT0H 1BBRH 2SGPE 1IQMA 3Q3YA 3OU0A 1IHTH 1ZHPA 1YBWA 1NPMA 3QWCH 4K1TA 3A7YA 2B8OH 1W7XH 5DG6A 3CS7A 1GHVH 2ZZUH 1LVBA 1CT4E 3TVJB 2AMQA 5AFZH 2BY8X 4AB9A 1O35A 1D6WA 2JETC 4E06H 1EP6A 3E90B 1SGTA 2HOBA 2BY9X 1XVMA 2NU3E 1PJPA 4OS6A 2ZDNA 3NZIA 1OWJA 1Y59T 4ZKSU 1Y3XA 1G3EA 2EI7A 8GCHF 3T25A 1ELBA 4XDEA 5F8ZA 1GI8B 2D26C 1SGNE 1W13U 1LHGH 2ZFFH 1DUEA 1TA2A 1O2PA 4KTSA 4O3TA 3VGCB 1GBEA 1HDTH 1WTHD 1MZDA 4WWYA 1HBTH 1V2TT 2PUXB 2VGCB 1EPTC 1ZR0A 1ZPCA 1ELTA 4ZAEA 9LPRA 1K1MA 2ZEBA 2BDBA 1ETTH 2HALA 3F1SB 3HK6B 1P2OA 1RTLA 1O3JA 1LO6A 1TPSA 1CGJE 2ZHWH 4NSVA 2HRVA 1TPAE 3QK1A 1YPGH 1NRPH 4Z6AH 1KLTA 3SV8A 1IQEA 4WH6A 3MOCA 2ZGBH 1SOZA 2ZO3H 1O5CB 2C3SA 2PLXA 3MU1A 1Z6EA 3SJOA 1XUHA 1ZLRA 1LQEA 1O39A 2ZDMA 1MAXA 4DJZB 1BJVA 2FODA 2VWOA 1DXWA 3BG4B 1C5YB 1HJAC 2TGAA 2Y6TA 1MU8B 3BN9A 2FZZA 3QTOH 1GJCB 4B76A 3LGUA 4ISHH 1YCPH 3JZ1B 2FOMB 5A0CA 2G51A 4CR9A 3SU4A 1XM1A 1K1JA 4X8SH 1XXFA 3QO6A 1ZZZA 1ESAA 4FU7A 1NM6A 3BEFB 1TAWA 1V2PT 2OLGA 4Q2KA 1RFNA 3A7VA 1HXEH 3Q76A 1P2JA 5GPIB 1GI1A 3BTDE 1HAPH 5HYOA 2J4IA 4NZLA 1TWXB 2ZPRA 1MTUA 2XRCA 4B2CA 4LOYH 3FP6E 3MNCA 3A89A 1O37A 4Y6DA 1QHRB 2GCHG 1P10A 2Q1JA 2BDHA 5JBCS 2BTCE 3R0FA 3LH3A 5CHAC 2FOAA 1YCPM 2PKAA 4AYVB 4B71A 1GVZA 4ZKNU 2XWBI 4I32A 3PTBA 1TYNA 5B6OA 1C2DA 3HGPA 4X8TH 1M9UA 2EEKA 5AVDA 1P57B 4CH2B 2RDLA 1GHAF 9ESTA 1PPHE 1QRWA 3ZZ9A 3TJUA 2OXSA 5FHTA 5T6FA 1A4WH 2BVRH 4TWWA 5L2YH 1HAIH 1HAXB 1LHCH 2ZHDA 5JBAS 1J14A 2G5NA 4KP0A 3TH4H 5LGOA 2VVVA 1Y3UA 1O5AB 4TYDA 3RU4E 3ZVGA 4BAOB 1G37A 1VR1H 3MMGA 4X1NU 1P05A 1O0DH 4WH8A 5EW1H 2GMTB 2BDAA 2BLOA 3A7TA 1YPHC 5F8XA 5HM2A 4DGJA 1ELDE 1QCPA 2W3IA 2J34A 3GDSA 4INKA 3RU4T 4KTCA 4A1XA 3MNSA 1CGIE 1ELFA 1B5GH 4ZKOU 2A5KA 1BZXE 2NU4E 2CHAC 4DW2U 1C1OA 2OP9A 3A80A 1BTZA 2FEQH 1NO9H 1O2VA 1Y3WA 4BOHA 1JIMA 3MH5A 1O32A 4NFFA 3A7ZA 5ETXA 4JK5A 1BT7A 4LZ1H 1C4Y2 1C1QA 1SL3A 2C4FH 1YC0A 1ZSKA 3A8CA 3U8TH 3GY5A 1GDUA 2BM2A 1O2MA 1QR3E 1KYNA 1LQDB 1ELVA 5A8XA 5LPFA 2GVFA 2IOTA 1AO5A 1CA0B 3C1KA 1GHZA 2H9EH 1ANCA 1FNIA 3GYLB 3QUMP 1Z1JA 4FVDA 3RLYH 4RN6A 4INHA 3LJJA 1CBWB 1AHTH 3LPRA 1BRAA 1XUKA 3A7WA 1TA6A 1CQQA 1NC6A 1T7CA 2ALVA 1FPHH 1Q31A 4ESTE 1V2WT 4I8GA 1LHEH 5CHAB 1RD3B 3M35A 2BOHB 4AFSA 1E37B 1DXPA 2Q6GA 3GICB 2A4OA 1AB9C 1A0LA 3OX7U 2O9QA 5EW2H 1HYLA 5K7RA 3AW1A 3A81A 3M3SA 2R9PA 1J15A 5A8YA 1TFXA 5FCRA 3V7TA 4I31A 3DD2H 4TPIZ 2HPQH 1QQUA 1O30A 2BD4A 3GCTF 4X2XA 3SQHE 2RA0A 1K1PA 1IQLA 1PPBH 1K22H 1SMFE 3BTTE 1UHBA 3ZZ5A 1D3TB 1C2GA 3TGKE 6CHAB 1BBRE 2D8WA 1AFQB 1N1LA 1H9LB 2BDGA 2Y81A 3ZZBA 3B9FH 5FX5A 2B7DH 1F0TA 4B2AA 2GMTC 2G5VA 3I77A 1KXCA 1FZZA 8LPRA 1QJ7B 4Z0KA 4AFUA 1AMHA 1SGEE 1OWEA 1XUFA 4ABAA 1D6RA 1XUJA 2BZ6H 1A3BH 1BBRK 1FY1A 3AASA 2A5IA 3EA9A 2FX4A 1QIXB 1ELAA 1TBZH 3QN7A 1A46H 1C5XB 2QXIA 1QRXA 1C1SA 3DUXH 2PR3A 1OWIA 2FP7B 1UVOA 3JZ2B 4HTCH 1WCZA 2VU8E 3D65E 1EJAA 1GJ8B 4Q80A 5HGGA 1BHXB 1FY5A 2GDDA 3VB4A 3L33A 5TCCA 1TQ0B 4Y8ZA 4K2YA 2PSYA 2UWLA 3EAJA 1P02A 2Z9JA 4OS1A 3LC3A 1SQOA 1PPZA 5DP3A 1BTPA 1BUIA 1C1MA 1GMCF 2BLVA 1FY3A 3SNCA 1AN1E 3E8LA 3SU1A 3TIUA 1S5SA 1LKBA 3MNBA 2G81E 2BHGA 4Q7YA 3VGCC 3TJNA 2PFEA 4KTUA 5HM9A 4IGDA 1C1PA 3D23A 1UTOA 1Z71A 1V3XA 2OTVA 3M61U 4JZDH 2ZU1A 1YYY1 1EZUC 1GWAA 1V2RT 2F9PA 1O3FA 3TJOA 4XSKU 2FWWA 1A0HB 2QAAA 3GOVB 5IYTA 4UFEH 5A0BA 1P0SH 3M3TA 3RXUA 1IQIA 1QA0A 1O34A 1D3QB 4WJG2 5DK1A 4Y11E 5EOKA 2W26A 4ABHA 3U8OH 1GDQA 4YOJA 2OQ5A 1O3CA 1S83A 2B5TB 2ZCHP 2OC7A 3KIDU 5DP9A 1DE7H 1G3DA 5E2OA 2BX3A 1WV7H 1ESTA 1SHYA 1EOLA 1O5DH 1X7AC 5J4QA 3BTGE 3K2UA 3RM2H 1UK2A 3H5CB 1XUIA 1EAUA 1CGHA 3MFJA 3RXCA 1HJAB 2P95A 2QF3A 3GY4A 3T5FH 4A1TA 3BIVH 3VPKA 5EXLA 4Y7AA 4FUCA 5LPRA 2BY5X 1C2HA 1W2KH 2AIQA 1AWFH 4FUIA 1C5NH 1YPMH 3PWBA 4ISOA 2OINA 1YKTA 3F9EA 1G2LA 1O2SA 1CT0E 1O33A 1CVWH 1AU8A 2UWOA 2XBVA 5AFYH 1MMJN 3AVZA 1L1GA 1ID5H 2WYJA 2ASUB 2GP9B 1EB1H 1G3CA 2GTBA 2STBE 5DGJA 2VIVA 4MNWA 5F6MA 1QB6A 1T4VH 2DE9A 3P70B 3U1IB 4THNH 1MBQA 2BDCA 1C5RA 2FTMA 2PKSB 1HJ9A 2XW9A 3TNTA 1PQ8A 1QGFA 3E0NB 1P01A 2BOKA 4HI3A 1BTXA 3ODFA 1MAYA 1DVAH 1EPTB 2TGPZ 1O2OA 1IQGA 3ZVEA 2CJIA 2HGTH 3HGNA 2CMYA 4YO9A 2F9NA 4OS2A 1TNLA 1GI3A 2FOFA 1GVKB 1ZJDA 1AVGH 2FM2A 1VGCB 1EASA 4DOQA 1KXEA 1AE5A 1FY8E 3TK9A 1C5TA 2F9VA 1TGTA 3M5MA 3Q3XA 4NIVA 3U1JB 5EQQA 1YPLH 3SBKA 1GMDG 1V2KT 3SJIA 2QY0B 1ZMLA 4AFQA 3M7QA 1BDAA 2M5TA 2BY6X 5GWZA 3T27A 1VITG 1GI9B 2J95A 3IWMA 1KXFA 3RXFA 1YM0A 2GCTC 1O2IA 3O8CA 5L30H 4FUJA 3SGAE 3KCGH 4ASHA 1D3DB 3SV6A 2CGAA 2Y7ZA 1J17T 1ARBA 1V6DA 2W7UA 2P3FH 1MCVA 3SUEA 2Y5GA 1HIAB 1IQHA 3RXLA 1KSNA 2B9LA 2IN2A 2Z6BD 3RXEA 3SW2B 5DP5A 4Y76A 3GDUA 1OP0A 4DT7B 4PROA 3SGQE 3ZZAA 1JIRA 2ZGXH 2OC1A 1G3BA 2ZHEH 1GBLA 1FIWA 4NA8A 2Y7XA 2B0FA 1T4UH 3T2NA 1P2IA 1P9SA 1V2ST 2TIOA 2ZC9H 1V2OT 4MNVA 1RS0A 1C5ZB 5BPEA 3GCNA 2BY7X 1O2JA 2ZI2H 2PV9B 3TGJE 1NTPA 1AIXH 1SFIA 1TGBA 2ZPSA 1QL7A 4CRBA 3KQCA 1O2GH 1K1NA 4I33A 2WUCA 3HK3B 1FXYA 1F5KU 3A8BA 2TGTA 3LU9B 1ZSLA 2Z7FE 1BMAA 1GHYH 3SUGA 2C8YB 2G8TA 1O3DA 4DURA 4F4OC 4H6SB 4DIHH 1NRRH 2FX6A 3QGJA 3F9HA 2UWPA 1NFUA 1HXFH 1C5MD 4YOGA 3ZZ8A 2BD7A 1LVYA 3H7OA 1L0ZA 4X2YA 2P8OC 2SNWA 1UO6A 5JB8S 3KHVA 3KNXA 5FBEA 3A82A 1EX3A 3SORA 4BAHB 2GKVE 4MG3A 1D4PB 1G36A 3K9XB 4AN7A 1J8AA 4U32A 4X1PU 1O3PB 2H9HA 3UTUH 4DIIH 3KN2A 3MH6A 2P8OB 1Y5BT 2OBQA 2ZPQA 1IQNA 1MTSA 2GT8A 5GJ4B 1TBQH 3U8RH 1BHXF 1BOQA 1MD8A 4GCHF 3LGWA 1SLUB 4BANB 1MKXH 2SGFE 1P2NA
chains in the Genus database with same CATH superfamily
3ESTA 1T31A 1W0YH 2IJOB 2OBOA 4DCDA 2AEIH 3LC5A 1EQ9A 2ZGHA 1ZGVA 3TU7H 1ZYOA 2WINI 2GV6A 1GBIA 2I6QA 1MBMA 4NIXA 1GHAG 3MO6A 1N6XA 1ABIH 1YGCH 2WV9A 3E6PH 1C1NA 3BSQA 5FBIA 1L2EA 2KR7A 1MABB 2KCPA 4X8VH 3SQEE 2VIQA 1H9IE 2WPHS 3ZZ4A 1EOJA 1UK4A 2H5CA 3SU0A 1H9HE 1G32B 1ANDA 1TRYA 4JYUH 3UNQA 1OXGA 2YMSB 5EU8A 2P94A 4MTBA 2D1JA 1YLNA 1SSXA 2VIOA 1QBOA 4GCHG 1F7ZA 1GI2A 3MU5A 5DN6D 1N8OC 5C3NA 4BTUB 1O3IA 3ZZ6A 2VH0A 2XBWA 4CH8B 1GHBF 8ESTE 1AVWA 2YMSC 3PMBB 1L1JA 3FFGA 4K5ZA 2V3OH 5DP4A 1MTNC 1UVPA 1ZPBA 2RA3A 4M7GA 3OY5U 5JBBS 3O8RA 3LDXH 2ZU4A 2XYAA 4NIYA 1UMAH 4MPWA 1UTQA 1S82A 1S84A 1GBCA 2PWXA 3KL6A 5DP7A 3RXBA 2KFWA 4YZUA 3EGKH 1CT2E 5A8ZA 2HLDD 2P3TB 1GPZA 1NT1A 5ESTE 3UWJH 1ETRH 3QLPH 4JYVH 3GY8A 3P17H 1F0UA 3KF2A 4NA7A 5FCKA 1QQ4A 2BZAA 2G4UA 1TNHA 3RXOA 3UFAA 2JKHA 3RXMA 1DX5M 1UTJA 2SGQE 1QB1A 1B0FA 3VB7A 5C67A 3RMNH 1QY6A 1A1RA 3M36A 1SLWB 1TPOA 2ULLA 2Z9GA 2P93A 1NESE 3ODDA 1O2WA 1O3MA 2TGDA 2OQUA 3PYHA 1KY9A 2RFKC 2F9OA 4ISIH 4B73A 3ZVCA 2HWLB 4GVUA 1SGIB 1S81A 3KGPA 2SNVA 1WSSH 2O8UA 5CE1A 3LT3A 3V13A 3ZIAD 3E16B 5DPAA 1T8LA 3FKSD 4K8BA 1C5UA 1OWDA 2ZKSA 3GCOA 4M9FA 3UIRA 4TT3D 3N7DA 4IN1A 2F9UA 1BMMH 2JH5D 2BXTH 5FPTA 2FDAA 1C4U2 4MNXA 1PQ5A 1LVMA 2OUAA 5DO4H 4A7IB 2QYIA 1SB1H 2BQWB 2KZ4A 2O8TA 4X8UH 5C1UA 2W6ID 2SFAA 1P2QA 1V2JT 2PTNA 2A4RA 1IQJA 1THPB 1HB0B 4QT8C 3ATMA 1EZXC 4WMDA 1C9TA 2A1DB 1KDQA 4NWLA 5DP6A 1TMBH 3SI4H 3MO9A 1TOMH 4H42U 6ESTA 1RIWC 2ZFRH 1UCYK 1S0QA 1O3EA 1SLXB 1DS2E 4I8HA 4ABFA 3N7OA 5I46H 3UR6A 4TPYA 1EFRD 4JZ1A 5J4SA 3I29A 2P16A 3SI3H 1AUJA 1CA8B 3LH1A 5LH8A 2SGEE 1EP5A 3RMMH 1CA0C 2C8WB 3MI4A 4OGYA 1YP9A 2R3YA 1GBKA 1OSSA 1F5RA 4YT6H 1QTFA 1UTMA 3AAVA 4LK4A 2BD5A 1C2FA 4P00A 4BXWA 4KELA 2BMGB 4AZ2B 1LCYA 3V3MA 4FXGH 1INCA 1MCTA 1HAVA 1GHWH 2SGAA 4GAWA 2PTCE 3RXJA 1GGDB 2BVSH 1YCPK 1TX6A 1BRCE 1C1VH 1C2KA 3PM3A 4B74A 4CREA 4JCNA 1VZQH 2V3HH 5C5NA 4DT4A 1NRQH 2Q6FA 1H8DH 2BD9A 3TLOA 1VITH 3UR9A 1ZRKA 3SJKA 1CE5A 3T28A 2H6MA 1MUEB 1HAZB 1A61H 2BVXH 2JIZD 2QIQA 2JDID 2WPLS 2XC5A 4UEHH 2J5UA 4WMEA 3DHKH 4ABBA 1CHGA 2XCFA 1GMHF 2QXGA 1FONA 1H1BA 1ABJH 5C1YA 8KME2 2ZG0H 4Y8XA 1Y3YA 3EDXB 3A84A 3URDA 1SGDE 3TGIE 1DWDH 1PQ7A 5SGAE 2W7SA 3RMOH 1BITA 2ZGJA 3LJOA 2ZCLP 5GIBA 3C27B 2GX4A 1C9PA 4MNYA 4X6NA 2BD8A 3MH7A 1C5WB 3DSGA 4RKJB 3F9FA 3RXIA 1ELEE 1JXPA 1LHDH 4NIWA 2GV7A 1HNEE 3W95A 7ESTE 1AWHB 4B2BA 5K0HA 4AOQA 2Z3DA 2CF9H 1NROH 2J98A 3KEEA 2ZDLA 5JYIA 3A7XA 4AYYB 1NU9A 3RMLH 3QGNB 4F48B 2ANWA 1LPKB 1DANH 1C5SA 3PRDA 1GBHA 2ZTXA 3RC5A 1UJ1A 2AGGX 1O31A 3FOAA 3A8DA 1P09A 5PTPA 2Q6DA 2WSSD 1H8IH 2R0LA 5T6DA 1MTWA 1TABE 2RG3A 3NK8A 1A3EH 3SNAA 1DWCH 1OX1A 1GJBB 2J38A 1TQ7B 2QC2A 2ZFPH 1TE0A 4FUHA 3RXPA 2ZF0H 3PTNA 1VGCC 1YY3A 1HAYB 1HRTH 5T1VA 3AW0A 4D76A 2JETB 1GI4A 1UTNA 4NG9H 4YESB 3N99A 3OEED 4Z1MD 2K1QA 3OFND 1E1RD 2BQ7B 1ELCA 4FU8A 4ABJA 3BTWE 3M3VA 3Q77A 2NWNA 5DSFA 2I6SA 3BEIB 1NY22 1YWUA 3SZEA 1UTPA 1GBDA 2FMJA 1A2CH 3MWIU 1P3CA 4JMYA 1EZQA 1LPZB 3PMJA 5C2ZA 2A7CA 4HFPB 1ZHMA 1EKBB 3OEHD 1V2MT 2ZFQH 1O5EH 1TLDA 2O8WA 1W11U 3S0NA 1SGFG 3UPEA 2ODPA 4I86A 3UQOA 4CR5A 2EA3A 2F9BH 3NKKA 1LKAA 5AHGH 4RKOB 3EQ0H 3L3TA 1F0RA 1QRZA 1ZTLA 1DPOA 4FVBA 1HUTH 1IQFA 1PPCE 1WDIA 4Q7ZA 2ZNKH 2WPMS 3Q00A 2ODYB 4J1YA 4ISLA 2BLWA 4H4FA 1K28D 1PPEE 2F83A 3F2GA 3MU4A 2V35A 1AZZA 1E36B 1OP8A 3ZZ3A 3MH4A 1E0FD 4UFFH 4ISNA 2XBYA 4ZUHA 1GJ9B 1HFDA 2R3UA 3RC6A 1RTKA 2FLBH 3P8NA 2G4TA 1O3NA 1FX0B 1YF4A 1BMLA 1NS3A 3SJ9A 1GBAA 4VGCB 1LPGB 3EE0B 2CV3A 1QBNA 3UQVA 3MU8A 1N8OB 1DWBH 2ZIQH 1YLDA 3S7KB 3SU3A 5EJ1A 1HAHH 3A87A 1DITH 2Z3EA 1P2MA 1V2QT 2H2ZA 1FV9A 1UVUH 2AS9A 2F3CE 3M7UA 3BTKE 4X0WU 4A1VA 3RXDA 1O5FH 2UUFB 1A7SA 2IPQX 1Y5AT 3BTEE 3A85A 3MNXA 1QB9A 4K60A 4R0IA 5C5OA 2V3MA 3RXTA 3SU2A 2AIPA 1P2KA 2Z9KA 1KLJH 3SZNA 1CSOE 3HPTB 4X1SU 4ABDA 2ZCKP 1O2HA 5DKMA 3FZDA 4X2WA 4CRAA 1NRNH 4D9QA 2EI8A 2AGIX 3OY6U 4CHAC 3OSYA 4Y0YE 1RXPA 3GDVA 4FUGA 1UCYH 3RUOA 5FX6A 1YPEH 4FUDA 1V2LT 1W8BH 1O3AA 1BTHH 1TONA 4TWYA 2VVUA 4ABGA 3UREA 2A0QB 4CRDA 2BDIA 1O36A 3N7EA 1TX7A 2ZQ2A 4I8LA 2ZHFH 2GZ8A 2Z94A 4IMZA 4FUEA 1DY8A 2AYWA 2VBCA 1FDPA 3P92A 1FUJA 2ODQA 1DOJA 7KMEH 2ESTE 1HPGA 1MQ5A 1P9UA 1S6HA 1P3EA 1THSH 1O2UA 1AFQC 1K1LA 4BTIB 1BIOA 3OE7D 2XNIA 1C5VA 3U28C 1B7XB 2KCAA 3K65B 5JB9S 3M37A 2PHBA 1AQ7A 4JK6A 1CHOG 2GGVB 1DY9A 4Q7XA 3VB6A 2WPIS 1HV7A 5I25A 2BX4A 4FETA 2CN0H 2ILNA 3VG8A 1ORFA 4ZKRU 2R2MB 1DDJA 3ZVDA 1ZMNA 1OPHB 3E0PB 1AE8H 1QNJA 3UNSA 2BD3A 3DA9B 2WHXA 1AVXA 4IC6A 1JRTA 3ATIA 1ELGA 3KYGA 2AERH 2OCVB 3A8AA 3FANA 4LXBH 3ZZCA 1SQAA 4FU9A 4H6TA 3VB3A 4MDSA 1JOUB 4MVNA 4NZQA 1HGTH 1GI5A 2PGQB 3BV9B 2WYGA 1MTNB 1TOCB 5F03A 1DUAA 3RM0H 4WY3A 1IOEA 1DT2A 5EODA 3ZYDA 1JBUH 2QCYA 1EAWA 2ZU5A 1W7GH 1O5BB 1TB6H 3BEUA 4Y79A 1RJXB 1KXDA 4WXVA 2ZQ1A 2OC0A 2P59A 1KTTB 2A4QA 4CRCA 5C0TA 4SGBE 2OC8A 1Z8RA 4BAMB 1FMGA 1SGYE 2QF0A 5FXLA 3GY3A 3VXFH 3KQBA 1XVOA 1XKBC 3UNRA 1PYTD 1WBGB 1DSUA 1HJ8A 3S9BA 3TH3H 1ZHRA 3FP7E 2GDEH 1FPCH 4GSOA 1MKXK 2LNCA 2G55A 1TNGA 1TIOA 1K21H 1TGCA 3VFEA 1MD7A 4SGAE 3S9AA 4AGJA 2UUJB 4O3UA 3UWIA 2HVYB 2ZTYA 3L6PA 3EA7A 2AFQB 4U01A 2Y80A 4NFEA 4LZ4B 1EB2A 2G52A 1XUGA 5IDKA 4E05H 3ATWA 1E79D 2Y5HA 1GI7B 3B8JA 2AHME 1K1OA 1QL9A 2LELA 1RGQA 5A09A 2WPDD 1UTLM 1K0HA 5H4IB 2AH4X 1JMOH 3M7TA 1SC8U 5E0JA 1UVSH 3ZV8A 4B75A 2EY4C 1A5GH 1L4DA 3P8GA 1T8OA 3SV9A 4UD9H 3KQEA 4A6LA 2FOBA 3GY7A 4CRGA 1FQ3A 3RXKA 1SKYE 3SJ8A 7GCHG 4OGXA 3E3TA 3P95A 2BYAX 3OTJE 1CU1A 4OS5A 4IW4E 1TNKA 3EYDA 2DUCA 2F4LA 1D9IA 4O9VA 4I7YH 5HMAA 4Y8YA 4D7GA 1ETSH 3BTME 1EUFA 3RXRA 4UFDH 1FI8A 3QX5H 3D62A 1LDTT 3WY8A 2K0QA 1GI6A 5LPEA 1TX8A 4HGCA 4OM9A 1O3KA 1CHOF 4X1RU 1ESBA 1TGSZ 2QXHA 2FI5E 1SBWA 1XMNB 3RU4D 1FLEE 1G30B 2FS8A 1W12U 1WU1A 1SGPE 4ZHAA 4BXSA 4IC5A 2CHAB 2XXLA 2O8LA 1VCQA 1FN6A 1E34B 3SOSA 5EQRA 4F49A 3PV2A 1Q3XA 3RXSA 1CO7E 2XC0A 1GHXH 2VIPA 1DSTA 1TRNA 2THFB 1Y3VA 2FYRA 5C17A 5FPSA 1K1IA 1BTWA 2A2QH 1SR5C 4ZMAH 5AF9H 3ZZ7A 3P8OA 1P03A 2C8XB 2VB0A 2A2XH 1IAUA 4K1EA 1QJ6B 3TITA 2XBXA 2YMSD 4IS5A 3AAUA 4ZCNA 5JDUB 4MLFB 1WYKA 2W5EA 3MTYA 2QE7D 3NCLA 1MQ6A 3OYPA 1S0RA 4U2WA 1O2ZA 3R3GB 3O8DA 4IN2A 3FAOA 4XD7D 2AMPA 4HZHA 1F92A 2BLQA 5C1XA 3FO8D 5EIYA 1MKWH 1P06A 5GDSH 1GVLA 4DVAU 1H4WA 1O2LA 1SGCA 2SGDE 3ZV9A 2GT7A 5HXFA 3SO3A 4ZXYH 1O3OA 4O97A 1BQYA 2J9NA 4OS7A 4B6EA 5C20A 2HLCA 2PP6A 1HLTH 4XBBA 3NXPA 3F6UH 4I8JA 3SNBA 3QZQA 3W1EA 1J16A 5EPNA 1IHSH 1AFEH 3MU0A 3PV4A 1DICA 1O2QA 3BTHE 1VKYA 1GCTB 3IG6B 4WMFA 1SGRE 1WTGH 4RT1A 2QXJA 1NN6A 4GPGA 2XWAA 2FOHA 1FAXA 1N6YA 3BG8A 4IMQA 2G00A 4XOJA 2TPIZ 4X2VA 5ESBA 2HPPH 1EXFA 1C1RA 2ANYA 1QBVH 1DLKB 1HAGE 3GCHC 3SV7A 6GCHG 2FOGA 1OWKA 2VH6A 3RXVA 1ACBE 4BAQB 2ALPA 3T62A 2RDEA 4AX9H 1TPPA 1Z8IB 5A0AE 3Q3KA 4KGAA 1SPJA 1AGJA 1EPTA 7GCHF 5ABWA 2GCHF 3RDZA 4UONA 3PO1C 2GD4B 3VXEH 2ZWLH 4DG4A 2R2WU 1KIGH 3A86A 1SHHB 2HNTE 1TRMA 1THRH 2J98B 4K69A 3SV2H 1RIWB 1BCUH 4MPXA 1EZSC 1OYTH 2PGBB 3KQDA 3ZVFA 1PQAA 2OD3B 1GCDA 5G4BA 1OYQA 5EXNA 4YOIA 1TBRH 4JZIA 3SU6A 2CF8H 1GBFA 4MQAA 2A7JA 1Z6JH 4GLYA 4E7RG 2ZTZA 3ATKA 4ACBA 1VCPA 1E1QD 1C2MA 1JWTA 1YPHE 1GG6B 3BTFE 2XCNA 2Y5FA 1TALA 8GCHG 1Z7KA 2FO9A 2IJD1 3ATLA 2PKSC 1B0EA 4B1TA 5E0GA 1SFQB 1A5HA 2QN5T 1AY6H 1ZSJA 1H8HD 2QA9E 3OAAD 3U69H 1J9CH 3PV5A 1ZOMA 1EJNA 4IBLH 1W0ZU 3SUDA 1GG6C 1Z1IA 5HKKD 1HAVB 2VWNA 1WAYB 1OP2A 4J2YB 2ZA5A 1UW7A 4Y0ZE 1C5LH 1UCYE 1BTUA 4NA9H 1KTSB 4OS4A 1O38A 4JZFH 3WWBA 2STAE 2VGCC 1OKXA 4ABEA 2UUYA 4ZHLU 1TNJA 2P3UB 4TY6A 2A7HA 4U30A 3RLWH 3U9AH 1BTYA 1C5OH 1EATA 1C4V2 2QGRA 5CDFE 3GYMA 2VIWA 3TK5A 2FS9A 1GBBA 4AGKA 2PKAB 5TJXA 1W3CA 3SNDA 1UVTH 2VVCA 4FUBA 2NU2E 4TY7A 1KXAA 5KGOA 1C5PA 4YLQH 2HVXA 1V2NT 3SGBE 1O5GH 1FIZA 4CBOA 1KLIH 1S6LA 4GHTA 5T3HA 1WUNH 5BRRE 1T8NA 1O2XA 3IITA 4UE7H 1V2VT 1SI5H 3SN8A 1BRUP 1GMHG 1KDQB 1ZTKA 5EG4A 4A92A 1XXDA 1QA7A 1GMCG 4YTAA 3UOPA 2FLRH 1W0JD 1C5QA 1IQKA 3S9CA 2JH6D 3PO1B 1DLEA 1ANEA 3PLKA 4NGAH 5GXPA 1ZPZA 4CHAB 4Y7BA 2ZU2A 4K1SA 5CHBA 5E8EH 1S6FA 3K6YA 2WUBA 1Y5UT 2C90B 1PYTC 4BNRA 1GBTA 3GY2A 1AUTC 2EQNA 4HG6A 2PSXA 3NPSA 1YPJH 2KAIB 1ANBA 3G01A 1TMTH 1AZ8A 5A2MH 4AB8A 1ARCA 1EAXA 1FJSA 4JYTA 5L6NH 3LIWA 3SNEA 2BDYA 2ZP0H 1LHFH 3T26A 4X6OA 1G2MA 2H1UA 4XFQA 1XKAC 2V0BA 3NUMA 2HNTC 5T6GA 3SHCH 3ZVAA 1A0JA 3ENSB 1PPFE 1K9OE 1SGQE 2QV1A 3LGTA 3MHWU 4XBCA 3RXHA 1ZMJA 1GDNA 1UHBB 1E38B 1E35B 1WQSA 3T29A 1TMUH 3UOUA 3PLPA 4MPVA 3SHAH 1TGNA 7LPRA 1VJAU 4K8YA 1GJ5H 3FZZA 4INLA 1MKWK 3V12A 3VEQB 2Z3CA 3QZRA 1NFXA 3E1XB 5EQSA 1F0SA 1YPKH 1O3BA 1TNIA 4MPUA 1ZJKA 2JJ1D 3F68H 1W14U 4JZEH 2BQ6B 5GCHG 4A5TS 2ZDKA 3UY9A 1OHHD 3URCA 2GCTB 3FVFB 3NWUA 1DWEH 2TBSA 3RP2A 4WF8A 1NU7B 1O3LA 4R8TB 1GL1A 3H7TA 1KXBA 3UAIC 3A83A 5CMXH 1FY4A 2BB4A 2CK3D 2ZFSA 3VB5A 5F8TA 1WQVH 4B6FA 5DP8A 4ZROA 1EAIA 4I8KA 2ANMH 1COWD 3CP7A 3U98H 2AGEX 1BJUA 4Y10E 5EPYA 1P11E 4ZH8A 2FI4E 1C2EA 2VWLA 1GI0A 2RCEA 3UB0A 4XE4A 2WPKS 2FESH 2C93B 3HKJB 3ZZDA 3FP8E 3NRLA 2H5DA 3CS0A 3UUZA 3LKWA 1AI8H 5E0HA 3PWCA 1F5LA 1L4ZA 2PW8H 1AKSA 1C2LA 2VWMA 5FPYA 4O03A 4UFGH 4GHQA 1FAKH 1GJ4H 1RTFB 1GJ7B 1C2IA 4AG1A 1P04A 3SUFA 2ANKH 3TNSA 6LPRA 2XNDD 4YXWD 1O3HA 4DY7B 2ZDVH 2NU0E 3LGVA 1LVOA 2CXVA 2J92A 3PLBA 1QFKH 1AD8H 1ZRBA 2VJ1A 2J94A 3CENA 1O2TA 3DCLA 2Y82A 4KKDA 1OWHA 4YM9A 6GCHF 2ZDAH 3LONA 2M2AA 3CNRA 1MU6B 3A88A 1DM4B 2R0KA 3ZVBA 5EXMA 1C2JA 1AKSB 1VCWA 1C1WH 1ZGIA 2F91A 6CHAC 4D7FA 2O8MA 1SQTA 1GBJA 2LPRA 3E91A 2D2DA 2VINA 2A5AA 3DFLA 1T32A 4ZXXH 4YT7H 1P8VC 4K3JA 4AORA 2YNAA 1UTKA 1Y8TA 1O2KA 1AB9B 1BB0B 4ZHMU 4AG2A 4WXIA 4NSYA 1UK3A 1SLVB 2XTTB 2GZ9A 3EA8A 1SG8B 5TCAA 2UUKB 2A32A 1QURH 3TPIZ 1RRKA 3F2HA 3RXAA 3PB1E 4E7NA 3DFJA 1Z8GA 2GZ7A 3P8FA 3O8BA 3RXQA 1K2I1 1OS8A 4X6PA 3ZYEA 3S69A 2ZGCA 1PFXC 3BIUH 3PMHB 5E2PA 2VIDA 1GL0E 4X1QU 1FN8A 4Y71A 2OK5A 1GJ6A 5L2ZH 1JRSA 5JPMH 3K6ZA 1GBMA 2FPZA 3MO3A 3TJVA 1SGFA 4RT0A 2AMDA 3I78A 3GS9A 1NZQH 3M5OA 1BRBE 1VITF 2JH0D 1SOTA 3LGIA 1DFPA 4FUFA 1HIAA 2TRMA 3V0XA 1LMWB 3GCTG 4AFZA 1PPGE 1GMDF 3SU5A 2A4GA 4UDWH 1NFWA 2FI3E 3QDZB 2WV5A 2XC4A 5FAHA 1VJ9U 1L1NA 1GHBG 3RXGA 2HNTF 2YOLA 1KMHB 3PMAB 2KM0A 2QF4A 1G9IE 1NRSH 1MTVA 1P12E 1S85A 4NWKA 1Q2WA 1Z8JB 2FOEA 3B23B 2FIRH 2BD2A 1V2UT 2DE8A 1O2NA 2H9TH 3F9GA 1U6QA 2KAIA 1A5IA 3P6ZB 1YLCA 3DSOA 3ELAH 4BAKB 3HKIB 1CBWC 1EJMA 2WV4A 2FYQA 3M5NA 5EGMA 1C1TA 2WPJS 2ZFTA 3BF6H 1OOKB 1HAOH 5DJ7A 4D8NA 2ZU3A 3S7HB 1O3GA 2FXRA 1SVPA 4CRFA 2BXUH 2A31A 1C1UH 2FTLE 3LOXA 2ZECA 2Z9LA 1MH0A 1GCTC 1MZAA 1NFYA 5GCHF 3MYWA 1F2SE 4X6MA 1H8ED 4XBDA 1D3PB 3W94A 2J2UA 2Z9IA 1GGDC 2W3KA 2VNTA 1XX9A 4ABIA 1ZTJA 3D49H 1LTOA 3RC4A 1GJDB 3M5LA 4RSPA 2C8ZB 1HCGA 4BTTB 4YLUA 3STJA 2JJ2D 1O2RA 1O2YA 2V6NA 3GCHB 2NU1E 3TH2H 2FOCA 1GJAB 2PUQH 3ITIA 3TK6A 3BG4C 3QTVH 2A45B 3STIA 3HATH 4GUXA 4CBNA 1WOFA 1BA8B 4WVPE 1T8MA 1QL8A 2ZHQH 4D9RA 2EC9H 1BMNH 1QJ1B 1W10U 5JBTA 2EI6A 3LGYA 4VGCC 4XRNA 3GY6A 3PROA 3GISB 2IPHA 4NCYA 3BTQE 2YNBA 3DT0H 1BBRH 2SGPE 1IQMA 3Q3YA 3OU0A 1IHTH 1ZHPA 1YBWA 1NPMA 3QWCH 4K1TA 3A7YA 2B8OH 1W7XH 5DG6A 3CS7A 1GHVH 2ZZUH 1LVBA 1CT4E 3TVJB 2AMQA 5AFZH 2BY8X 4AB9A 1O35A 1D6WA 2JETC 4E06H 1EP6A 3E90B 1SGTA 2HOBA 2BY9X 1XVMA 2NU3E 1PJPA 4OS6A 2ZDNA 3NZIA 1OWJA 1Y59T 4ZKSU 1Y3XA 1G3EA 2EI7A 8GCHF 3T25A 1ELBA 4XDEA 5F8ZA 4ACAA 1GI8B 2D26C 1SGNE 1W13U 1LHGH 2ZFFH 1DUEA 1TA2A 1O2PA 3KQ5A 4KTSA 4O3TA 3VGCB 1GBEA 1HDTH 5B6LA 1WTHD 1MZDA 4WWYA 1HBTH 1V2TT 2PUXB 2VGCB 1EPTC 1ZPCA 1ZR0A 1ELTA 4ZAEA 9LPRA 1K1MA 2ZEBA 2BDBA 1ETTH 2HALA 3F1SB 3HK6B 1P2OA 1RTLA 1O3JA 1LO6A 1TPSA 1CGJE 2ZHWH 4NSVA 2HRVA 1TPAE 3QK1A 1YPGH 1NRPH 4Z6AH 1KLTA 3SV8A 1IQEA 4WH6A 3MOCA 1BMFD 2ZGBH 2WZQA 1SOZA 2ZO3H 2W6JD 1O5CB 2C3SA 2PLXA 3MU1A 1Z6EA 3SJOA 1XUHA 1ZLRA 1LQEA 1O39A 2ZDMA 5IK2D 1MAXA 4DJZB 1BJVA 2FODA 2VWOA 1DXWA 3BG4B 1C5YB 1HJAC 2TGAA 2Y6TA 1MU8B 3BN9A 5EJLA 2FZZA 3QTOH 1GJCB 4B76A 3AK5A 3LGUA 4ISHH 1YCPH 3JZ1B 2FOMB 5A0CA 2G51A 4CR9A 3SU4A 1XM1A 1K1JA 4X8SH 1XXFA 3QO6A 1ZZZA 1ESAA 4FU7A 1NM6A 3BEFB 1TAWA 1V2PT 2OLGA 4Q2KA 3WWFA 1RFNA 3A7VA 1HXEH 3Q76A 1P2JA 2KCYA 5GPIB 1GI1A 3BTDE 1HAPH 5HYOA 2J4IA 4NZLA 1TWXB 2ZPRA 1MTUA 2XRCA 4B2CA 4LOYH 3FP6E 3MNCA 3A89A 2XOKD 1O37A 4Y6DA 1QHRB 2GCHG 1P10A 2Q1JA 2BDHA 5JBCS 2BTCE 3R0FA 3LH3A 5CHAC 2FOAA 1YCPM 2PKAA 4AYVB 4B71A 1GVZA 1NBME 4ZKNU 2XWBI 4I32A 3PTBA 1TYNA 5B6OA 1C2DA 3HGPA 4X8TH 1M9UA 2EEKA 5AVDA 1P57B 4CH2B 2RDLA 1GHAF 9ESTA 1W0KD 1PPHE 1QRWA 3ZZ9A 3TJUA 2OXSA 5FHTA 5T6FA 1A4WH 3F0OA 2BVRH 4TWWA 5L2YH 2LP6A 1HAIH 5FL7D 1HAXB 4F55A 1LHCH 2ZHDA 5JBAS 1J14A 2G5NA 4KP0A 4ASUD 3TH4H 5LGOA 2VVVA 1Y3UA 1O5AB 4TYDA 3RU4E 3ZVGA 4BAOB 1G37A 1VR1H 3MMGA 4X1NU 1P05A 1O0DH 4WH8A 5EW1H 2GMTB 2BDAA 2L6OA 2BLOA 2L74A 3A7TA 1YPHC 5F8XA 5HM2A 4DGJA 1ELDE 1QCPA 2W3IA 2J34A 3GDSA 4INKA 3RU4T 4KTCA 4A1XA 3MNSA 1CGIE 1ELFA 1B5GH 4ZKOU 2A5KA 1BZXE 2NU4E 2CHAC 4DW2U 1C1OA 2OP9A 3A80A 1BTZA 2FEQH 1NO9H 1O2VA 1Y3WA 4BOHA 1JIMA 3MH5A 1O32A 4NFFA 3A7ZA 4P02A 5C94A 5ETXA 4JK5A 1BT7A 4LZ1H 1C4Y2 1C1QA 1SL3A 2C4FH 1YC0A 1ZSKA 3A8CA 5F53A 3U8TH 3GY5A 1GDUA 2BM2A 1O2MA 1QR3E 1KYNA 1LQDB 1ELVA 5A8XA 5LPFA 2GVFA 2IOTA 1AO5A 1CA0B 3C1KA 1GHZA 2H9EH 1ANCA 1FNIA 3GYLB 3QUMP 1Z1JA 4FVDA 3RLYH 4RN6A 3DSPA 4INHA 3LJJA 1CBWB 1AHTH 3LPRA 1BRAA 1XUKA 3A7WA 1TA6A 1CQQA 1NC6A 1T7CA 2ALVA 1FPHH 1Q31A 4ESTE 1V2WT 4I8GA 4Q4LA 1LHEH 5CHAB 1RD3B 3M35A 2BOHB 4AFSA 1E37B 1DXPA 2Q6GA 3GICB 2A4OA 1AB9C 1A0LA 3OX7U 2O9QA 5EW2H 1HYLA 5K7RA 3AW1A 3A81A 3M3SA 2R9PA 1J15A 5A8YA 1TFXA 5FCRA 3V7TA 4I31A 3DD2H 5KEDA 4TPIZ 2HPQH 1QQUA 1O30A 2BD4A 3GCTF 4X2XA 3SQHE 2RA0A 1K1PA 1IQLA 1PPBH 1K22H 1SMFE 3BTTE 1UHBA 3ZZ5A 1D3TB 1C2GA 3TGKE 6CHAB 1BBRE 2D8WA 1AFQB 1N1LA 1H9LB 2BDGA 2Y81A 3ZZBA 3MQKC 3WW7A 3B9FH 5FX5A 2B7DH 1F0TA 2F43B 4B2AA 2GMTC 2G5VA 3FN8A 3I77A 1KXCA 1FZZA 8LPRA 1QJ7B 4Z0KA 4AFUA 1AMHA 1SGEE 1OWEA 1XUFA 4ABAA 1D6RA 1XUJA 2BZ6H 4AC9A 1A3BH 1BBRK 1FY1A 3AASA 2A5IA 3EA9A 2FX4A 1QIXB 1ELAA 1TBZH 3QN7A 1A46H 1C5XB 2QXIA 1NBMD 1QRXA 1C1SA 3DUXH 2PR3A 1OWIA 3F2FA 2FP7B 1UVOA 3JZ2B 4HTCH 1WCZA 2VU8E 3D65E 4FOUC 1EJAA 1GJ8B 4Q80A 5HGGA 1BHXB 1FY5A 2GDDA 3VB4A 3L33A 2QF5A 5TCCA 1TQ0B 4Y8ZA 4K2YA 2PSYA 2UWLA 3EAJA 1P02A 2Z9JA 4OS1A 3LC3A 1SQOA 1PPZA 5DP3A 1BTPA 1BUIA 1C1MA 1GMCF 2BLVA 1FY3A 3SNCA 1AN1E 3E8LA 3SU1A 4RI0A 3TIUA 1S5SA 1LKBA 3MNBA 2G81E 2BHGA 4Q7YA 5C0UA 3VGCC 3TJNA 2PFEA 5HIYA 4KTUA 5HM9A 4IGDA 1C1PA 3D23A 1UTOA 1Z71A 1V3XA 2OTVA 3M61U 4JZDH 2ZU1A 1YYY1 1EZUC 1GWAA 1V2RT 2F9PA 1O3FA 3TJOA 4XSKU 2FWWA 1A0HB 2QAAA 3GOVB 2K8IA 5IYTA 4UFEH 5A0BA 1P0SH 3M3TA 3RXUA 1IQIA 3SYJA 1QA0A 1O34A 1D3QB 4WJG2 5DK1A 4Y11E 5EOKA 2W26A 5HIZA 4ABHA 3U8OH 1GDQA 4YOJA 2OQ5A 1O3CA 1S83A 2B5TB 2ZCHP 2OC7A 3KIDU 3KYFA 5DP9A 1DE7H 1G3DA 5E2OA 2BX3A 1WV7H 1ESTA 1SHYA 1EOLA 1O5DH 1X7AC 4TSFD 5J4QA 4Q63A 3BTGE 3K2UA 5GNDA 3RM2H 1UK2A 3H5CB 1XUIA 1EAUA 1CGHA 3MFJA 3RXCA 1HJAB 2P95A 2QF3A 3GY4A 3T5FH 4A1TA 3BIVH 3VPKA 5EXLA 4Y7AA 3H09A 4FUCA 5LPRA 2BY5X 1C2HA 1W2KH 2AIQA 2GJGA 2KX4A 5EJZA 1AWFH 4FUIA 1C5NH 1YPMH 3PWBA 4ISOA 2OINA 1YKTA 3F9EA 1G2LA 1O2SA 1CT0E 1O33A 1CVWH 3EE7A 1AU8A 2UWOA 2XBVA 5AFYH 1MMJN 3AVZA 1L1GA 1ID5H 2ASUB 2WYJA 2GP9B 1EB1H 1G3CA 2GTBA 2STBE 5DGJA 2VIVA 4MNWA 5F6MA 1QB6A 1T4VH 2DE9A 3P70B 3U1IB 4THNH 1MBQA 2BDCA 1C5RA 2FTMA 2PKSB 1HJ9A 2XW9A 3TNTA 1PQ8A 1QGFA 3E0NB 1P01A 2BOKA 4HI3A 1BTXA 3ODFA 1MAYA 1DVAH 1EPTB 5KECA 2TGPZ 1O2OA 1IQGA 3ZVEA 2CJIA 2HGTH 3F0PA 3HGNA 2CMYA 4YO9A 2F9NA 2V7QD 4OS2A 1TNLA 1GI3A 2FOFA 1GVKB 1ZJDA 1AVGH 2FM2A 1VGCB 1EASA 4DOQA 1KXEA 1AE5A 1FY8E 3TK9A 1C5TA 2F9VA 1TGTA 3M5MA 3Q3XA 4NIVA 3U1JB 5EQQA 1YPLH 3SBKA 1WXRA 1GMDG 1V2KT 3SJIA 2QY0B 1ZMLA 4AFQA 3M7QA 3PRBA 1BDAA 2M5TA 2BY6X 5GWZA 3T27A 1QZ8A 1VITG 1GI9B 2J95A 3IWMA 1KXFA 3RXFA 1YM0A 2GCTC 1O2IA 3O8CA 5L30H 4FUJA 3SGAE 3KCGH 4ASHA 1D3DB 3SV6A 2CGAA 2Y7ZA 1J17T 1ARBA 1V6DA 2W7UA 2P3FH 1MCVA 3SUEA 2Y5GA 1HIAB 1IQHA 3RXLA 1KSNA 2B9LA 2IN2A 2Z6BD 3RXEA 3SW2B 5DP5A 4Y76A 3GDUA 1OP0A 4DT7B 4PROA 3SGQE 3ZZAA 1JIRA 2ZGXH 2OC1A 1G3BA 2ZHEH 1GBLA 1FIWA 4NA8A 2KCOA 2Y7XA 2B0FA 1T4UH 3T2NA 1P2IA 1P9SA 1V2ST 2TIOA 2ZC9H 1V2OT 4MNVA 1RS0A 1C5ZB 5BPEA 3GCNA 2BY7X 1O2JA 2ZI2H 2PV9B 3TGJE 1NTPA 1AIXH 1SFIA 1TGBA 2ZPSA 1QL7A 4CRBA 3KQCA 1O2GH 1K1NA 4I33A 2WUCA 3HK3B 1FXYA 1F5KU 3A8BA 2TGTA 3LU9B 1ZSLA 2Z7FE 3F3BA 1BMAA 1GHYH 3SUGA 2C8YB 2G8TA 1O3DA 4DURA 4F4OC 4H6SB 4DIHH 1NRRH 2FX6A 3QGJA 3F9HA 2UWPA 1NFUA 1SQRA 1HXFH 1C5MD 4YOGA 3ZZ8A 2BD7A 1LVYA 3H7OA 1L0ZA 2J97A 2P8OC 2SNWA 1UO6A 4X2YA 3KHVA 5JB8S 3KNXA 3OTPA 5FBEA 3A82A 1EX3A 3SORA 4BAHB 2GKVE 4MG3A 1D4PB 1G36A 3K9XB 4AN7A 1J8AA 4U32A 4X1PU 1O3PB 2H9HA 3UTUH 4DIIH 3KN2A 3MH6A 2P8OB 1Y5BT 2OBQA 2ZPQA 1IQNA 1MTSA 2GT8A 5GJ4B 1TBQH 3U8RH 1BHXF 1BOQA 1MD8A 4GCHF 3LGWA 1SLUB 4BANB 1MKXH 2SGFE 1P2NA
chains in the Genus database with same CATH topology
3ESTA 1T31A 1W0YH 2IJOB 2OBOA 4DCDA 2AEIH 3LC5A 1EQ9A 2ZGHA 1ZGVA 3TU7H 1ZYOA 2WINI 2GV6A 1GBIA 2I6QA 1MBMA 4NIXA 1GHAG 3MO6A 1N6XA 1ABIH 1YGCH 3E6PH 1C1NA 3BSQA 5FBIA 1L2EA 4X8VH 3SQEE 2VIQA 1H9IE 2WPHS 3ZZ4A 1EOJA 1UK4A 2H5CA 3SU0A 1H9HE 1G32B 1ANDA 1TRYA 4JYUH 3UNQA 1OXGA 5EU8A 2P94A 4MTBA 2D1JA 1SSXA 2VIOA 1QBOA 4GCHG 1F7ZA 1GI2A 3MU5A 1N8OC 5C3NA 4BTUB 1O3IA 3ZZ6A 2VH0A 2XBWA 4CH8B 1GHBF 8ESTE 1AVWA 3PMBB 1L1JA 3FFGA 4K5ZA 2V3OH 5DP4A 1MTNC 1UVPA 1ZPBA 2RA3A 4M7GA 3OY5U 5JBBS 3O8RA 3LDXH 2ZU4A 2XYAA 4NIYA 1UMAH 4MPWA 1UTQA 1S82A 1S84A 1GBCA 2PWXA 3KL6A 5DP7A 3RXBA 4YZUA 3EGKH 1CT2E 5A8ZA 2P3TB 1GPZA 1NT1A 5ESTE 3UWJH 1ETRH 3QLPH 4JYVH 3GY8A 3P17H 1F0UA 3KF2A 4NA7A 5FCKA 1QQ4A 2BZAA 2G4UA 1TNHA 3RXOA 3UFAA 2JKHA 3RXMA 1DX5M 1UTJA 2SGQE 1QB1A 1B0FA 3VB7A 5C67A 3RMNH 1QY6A 1A1RA 3M36A 1SLWB 1TPOA 2ULLA 2Z9GA 2P93A 1NESE 3ODDA 1O2WA 1O3MA 2TGDA 2OQUA 3PYHA 1KY9A 2F9OA 4ISIH 4B73A 3ZVCA 2HWLB 4GVUA 1SGIB 1S81A 3KGPA 2SNVA 1WSSH 2O8UA 5CE1A 3LT3A 3V13A 3E16B 5DPAA 1T8LA 4K8BA 1C5UA 1OWDA 2ZKSA 3GCOA 3UIRA 4IN1A 2F9UA 1BMMH 2JH5D 2BXTH 5FPTA 2FDAA 1C4U2 4MNXA 1PQ5A 1LVMA 2OUAA 5DO4H 4A7IB 2QYIA 1SB1H 2BQWB 2O8TA 4X8UH 5C1UA 2SFAA 1P2QA 1V2JT 2PTNA 2A4RA 1IQJA 1THPB 1HB0B 4QT8C 3ATMA 1EZXC 4WMDA 1C9TA 2A1DB 1KDQA 4NWLA 5DP6A 1TMBH 3SI4H 3MO9A 1TOMH 4H42U 6ESTA 1RIWC 2ZFRH 1UCYK 1S0QA 1O3EA 1SLXB 1DS2E 4I8HA 4ABFA 3N7OA 5I46H 3UR6A 4TPYA 4JZ1A 5J4SA 3I29A 2P16A 3SI3H 1AUJA 1CA8B 3LH1A 5LH8A 2SGEE 1EP5A 3RMMH 1CA0C 2C8WB 3MI4A 4OGYA 1YP9A 2R3YA 1GBKA 1OSSA 1F5RA 4YT6H 1QTFA 1UTMA 3AAVA 4LK4A 2BD5A 1C2FA 4BXWA 4KELA 2BMGB 4AZ2B 1LCYA 3V3MA 4FXGH 1INCA 1MCTA 1HAVA 1GHWH 2SGAA 4GAWA 2PTCE 3RXJA 1GGDB 2BVSH 1YCPK 1TX6A 1BRCE 1C1VH 1C2KA 3PM3A 4B74A 4CREA 4JCNA 1VZQH 2V3HH 5C5NA 1NRQH 2Q6FA 1H8DH 2BD9A 3TLOA 1VITH 3UR9A 1ZRKA 3SJKA 1CE5A 3T28A 2H6MA 1MUEB 1HAZB 1A61H 2BVXH 2QIQA 2WPLS 2XC5A 4UEHH 4WMEA 3DHKH 4ABBA 1CHGA 2XCFA 1GMHF 2QXGA 1FONA 1H1BA 1ABJH 5C1YA 8KME2 2ZG0H 4Y8XA 1Y3YA 3EDXB 3A84A 3URDA 1SGDE 3TGIE 1DWDH 1PQ7A 5SGAE 2W7SA 3RMOH 1BITA 2ZGJA 3LJOA 2ZCLP 5GIBA 3C27B 2GX4A 1C9PA 4MNYA 4X6NA 2BD8A 3MH7A 1C5WB 4RKJB 3F9FA 3RXIA 1ELEE 1JXPA 1LHDH 4NIWA 2GV7A 1HNEE 3W95A 7ESTE 1AWHB 4B2BA 5K0HA 4AOQA 2Z3DA 2CF9H 1NROH 3KEEA 2ZDLA 5JYIA 3A7XA 4AYYB 1NU9A 3RMLH 3QGNB 2ANWA 1LPKB 1DANH 1C5SA 1GBHA 2ZTXA 3RC5A 1UJ1A 2AGGX 1O31A 3A8DA 1P09A 5PTPA 2Q6DA 5T6DA 1H8IH 2R0LA 1MTWA 1TABE 2RG3A 3NK8A 1A3EH 3SNAA 1DWCH 1OX1A 1GJBB 2J38A 1TQ7B 2QC2A 2ZFPH 1TE0A 4FUHA 3RXPA 2ZF0H 3PTNA 1VGCC 1HAYB 1HRTH 3AW0A 4D76A 2JETB 1GI4A 1UTNA 4NG9H 4YESB 2K1QA 2BQ7B 1ELCA 4FU8A 4ABJA 3BTWE 3M3VA 3Q77A 2NWNA 2I6SA 3BEIB 1NY22 1UTPA 1GBDA 2FMJA 1A2CH 3MWIU 1P3CA 4JMYA 1EZQA 1LPZB 3PMJA 5C2ZA 2A7CA 4HFPB 1ZHMA 1EKBB 1V2MT 2ZFQH 1O5EH 1TLDA 2O8WA 1W11U 3S0NA 1SGFG 3UPEA 2ODPA 3UQOA 4CR5A 2EA3A 2F9BH 3NKKA 1LKAA 5AHGH 4RKOB 3EQ0H 3L3TA 1F0RA 1QRZA 1ZTLA 1DPOA 4FVBA 1HUTH 1IQFA 1PPCE 4Q7ZA 2ZNKH 2WPMS 3Q00A 2ODYB 4J1YA 4ISLA 2BLWA 4H4FA 1K28D 1PPEE 2F83A 3MU4A 2V35A 1AZZA 1E36B 1OP8A 3ZZ3A 3MH4A 1E0FD 4UFFH 4ISNA 2XBYA 4ZUHA 1GJ9B 1HFDA 2R3UA 3RC6A 1RTKA 2FLBH 3P8NA 2G4TA 1O3NA 1YF4A 1BMLA 1NS3A 3SJ9A 1GBAA 4VGCB 1LPGB 3EE0B 2CV3A 1QBNA 3UQVA 3MU8A 1N8OB 1DWBH 2ZIQH 1YLDA 3S7KB 3SU3A 1HAHH 3A87A 1DITH 2Z3EA 1P2MA 1V2QT 2H2ZA 1FV9A 1UVUH 2AS9A 2F3CE 3M7UA 3BTKE 4X0WU 4A1VA 3RXDA 1O5FH 2UUFB 1A7SA 1Y5AT 3BTEE 3A85A 3MNXA 1QB9A 4K60A 4R0IA 5C5OA 3RXTA 3SU2A 2AIPA 1P2KA 2Z9KA 1KLJH 3SZNA 1CSOE 3HPTB 4X1SU 4ABDA 2ZCKP 1O2HA 5DKMA 3FZDA 4X2WA 4CRAA 1NRNH 4D9QA 2EI8A 2AGIX 3OY6U 4CHAC 3OSYA 4Y0YE 1RXPA 3GDVA 4FUGA 1UCYH 3RUOA 5FX6A 1YPEH 4FUDA 1V2LT 1W8BH 1O3AA 1BTHH 1TONA 4TWYA 2VVUA 4ABGA 3UREA 2A0QB 4CRDA 2BDIA 1O36A 1TX7A 2ZQ2A 4I8LA 2ZHFH 2GZ8A 2Z94A 4IMZA 4FUEA 1DY8A 2AYWA 1FDPA 3P92A 1FUJA 2ODQA 1DOJA 7KMEH 2ESTE 1HPGA 1MQ5A 1P9UA 1S6HA 1P3EA 1THSH 1O2UA 1AFQC 1K1LA 4BTIB 1BIOA 2XNIA 1C5VA 1B7XB 3K65B 5JB9S 3M37A 2PHBA 1AQ7A 4JK6A 1CHOG 2GGVB 1DY9A 4Q7XA 3VB6A 2WPIS 1HV7A 5I25A 2BX4A 2CN0H 2ILNA 1ORFA 4ZKRU 2R2MB 1DDJA 3ZVDA 1ZMNA 1OPHB 3E0PB 1AE8H 1QNJA 3UNSA 2BD3A 3DA9B 1AVXA 4IC6A 1JRTA 3ATIA 1ELGA 2AERH 2OCVB 3A8AA 3FANA 4LXBH 3ZZCA 1SQAA 4FU9A 4H6TA 3VB3A 4MDSA 1JOUB 4MVNA 4NZQA 1HGTH 1GI5A 2PGQB 3BV9B 2WYGA 1MTNB 1TOCB 5F03A 1DUAA 3RM0H 4WY3A 1IOEA 1DT2A 5EODA 3ZYDA 1JBUH 2QCYA 1EAWA 2ZU5A 1W7GH 1O5BB 1TB6H 3BEUA 4Y79A 1RJXB 1KXDA 4WXVA 2ZQ1A 2OC0A 2P59A 1KTTB 2A4QA 4CRCA 4SGBE 2OC8A 1Z8RA 4BAMB 1FMGA 1SGYE 2QF0A 5FXLA 3GY3A 3VXFH 3KQBA 1XVOA 1XKBC 3UNRA 1PYTD 1WBGB 1DSUA 1HJ8A 3S9BA 3TH3H 1ZHRA 3FP7E 2GDEH 1FPCH 4GSOA 1MKXK 2LNCA 2G55A 1TNGA 1TIOA 1K21H 1TGCA 3VFEA 1MD7A 4SGAE 3S9AA 4AGJA 2UUJB 4O3UA 3UWIA 2ZTYA 3L6PA 3EA7A 2AFQB 4U01A 2Y80A 4NFEA 4LZ4B 1EB2A 2G52A 1XUGA 5IDKA 4E05H 3ATWA 2Y5HA 1GI7B 3B8JA 1K1OA 1QL9A 1RGQA 5A09A 1UTLM 5H4IB 2AH4X 1JMOH 3M7TA 1SC8U 5E0JA 1UVSH 3ZV8A 4B75A 1A5GH 1L4DA 3P8GA 1T8OA 3SV9A 4UD9H 3KQEA 4A6LA 2FOBA 3GY7A 4CRGA 1FQ3A 3RXKA 3SJ8A 7GCHG 4OGXA 3E3TA 3P95A 2BYAX 3OTJE 1CU1A 4OS5A 4IW4E 1TNKA 3EYDA 2DUCA 1D9IA 4O9VA 4I7YH 5HMAA 4Y8YA 4D7GA 1ETSH 3BTME 1EUFA 3RXRA 4UFDH 1FI8A 3QX5H 3D62A 1LDTT 3WY8A 1GI6A 5LPEA 1TX8A 4HGCA 1O3KA 1CHOF 4X1RU 1ESBA 1TGSZ 2QXHA 2FI5E 1SBWA 1XMNB 3RU4D 1FLEE 1G30B 2FS8A 1W12U 1WU1A 1SGPE 4ZHAA 4BXSA 4IC5A 2CHAB 2XXLA 2O8LA 1VCQA 1FN6A 1E34B 3SOSA 5EQRA 4F49A 1Q3XA 3RXSA 1CO7E 2XC0A 1GHXH 2VIPA 1DSTA 1TRNA 2THFB 1Y3VA 2FYRA 5FPSA 1K1IA 1BTWA 2A2QH 1SR5C 4ZMAH 5AF9H 3ZZ7A 3P8OA 1P03A 2C8XB 2VB0A 2A2XH 1IAUA 4K1EA 1QJ6B 3TITA 2XBXA 4IS5A 3AAUA 5JDUB 4MLFB 1WYKA 2W5EA 3MTYA 3NCLA 1MQ6A 3OYPA 1S0RA 4U2WA 1O2ZA 3R3GB 3O8DA 4IN2A 3FAOA 2AMPA 4HZHA 1F92A 2BLQA 5C1XA 1MKWH 1P06A 5GDSH 1GVLA 4DVAU 1H4WA 1O2LA 1SGCA 2SGDE 3ZV9A 2GT7A 5HXFA 3SO3A 4ZXYH 1O3OA 4O97A 1BQYA 2J9NA 4OS7A 5C20A 2HLCA 1HLTH 4XBBA 3NXPA 3F6UH 4I8JA 3SNBA 3QZQA 1J16A 5EPNA 1IHSH 1AFEH 3MU0A 3PV4A 1DICA 1O2QA 3BTHE 1GCTB 3IG6B 4WMFA 1SGRE 1WTGH 2QXJA 1NN6A 4GPGA 2XWAA 2FOHA 1FAXA 1N6YA 3BG8A 4IMQA 2G00A 4XOJA 2TPIZ 4X2VA 5ESBA 2HPPH 1EXFA 1C1RA 2ANYA 1QBVH 1DLKB 1HAGE 3GCHC 3SV7A 6GCHG 2FOGA 1OWKA 2VH6A 3RXVA 1ACBE 4BAQB 2ALPA 3T62A 4AX9H 1TPPA 1Z8IB 5A0AE 3Q3KA 4KGAA 1SPJA 1AGJA 1EPTA 7GCHF 5ABWA 2GCHF 3RDZA 4UONA 3PO1C 2GD4B 3VXEH 2ZWLH 4DG4A 2R2WU 1KIGH 3A86A 1SHHB 2HNTE 1TRMA 1THRH 4K69A 3SV2H 1RIWB 1BCUH 4MPXA 1EZSC 1OYTH 2PGBB 3KQDA 3ZVFA 1PQAA 2OD3B 1GCDA 5G4BA 1OYQA 5EXNA 4YOIA 1TBRH 4JZIA 3SU6A 2CF8H 1GBFA 4MQAA 2A7JA 1Z6JH 4GLYA 4E7RG 2ZTZA 3ATKA 1VCPA 1C2MA 1JWTA 1YPHE 1GG6B 3BTFE 2XCNA 2Y5FA 1TALA 8GCHG 1Z7KA 2FO9A 3ATLA 2PKSC 1B0EA 4B1TA 5E0GA 1SFQB 1A5HA 2QN5T 1AY6H 1ZSJA 2QA9E 3U69H 1J9CH 1ZOMA 1EJNA 4IBLH 1W0ZU 3SUDA 1GG6C 1Z1IA 1HAVB 2VWNA 1WAYB 1OP2A 4J2YB 2ZA5A 4Y0ZE 1C5LH 1UCYE 1BTUA 4NA9H 1KTSB 4OS4A 1O38A 4JZFH 2STAE 2VGCC 1OKXA 4ABEA 2UUYA 4ZHLU 1TNJA 2P3UB 4TY6A 2A7HA 4U30A 3RLWH 3U9AH 1BTYA 1C5OH 1EATA 1C4V2 2QGRA 3GYMA 2VIWA 3TK5A 2FS9A 1GBBA 4AGKA 2PKAB 5TJXA 1W3CA 3SNDA 1UVTH 2VVCA 4FUBA 2NU2E 4TY7A 1KXAA 1C5PA 4YLQH 2HVXA 1V2NT 3SGBE 1O5GH 1FIZA 4CBOA 1KLIH 5T3HA 4GHTA 1WUNH 5BRRE 1T8NA 1O2XA 3IITA 4UE7H 1V2VT 1SI5H 3SN8A 1BRUP 1GMHG 1KDQB 1ZTKA 5EG4A 4A92A 1XXDA 1QA7A 1GMCG 4YTAA 3UOPA 2FLRH 1C5QA 1IQKA 3S9CA 2JH6D 3PO1B 1DLEA 1ANEA 3PLKA 4NGAH 5GXPA 1ZPZA 4CHAB 4Y7BA 2ZU2A 4K1SA 5E8EH 1S6FA 3K6YA 2WUBA 1Y5UT 2C90B 1PYTC 4BNRA 1GBTA 3GY2A 1AUTC 2PSXA 3NPSA 1YPJH 2KAIB 1ANBA 3G01A 1TMTH 1AZ8A 5A2MH 4AB8A 1ARCA 1EAXA 1FJSA 4JYTA 5L6NH 3LIWA 3SNEA 2BDYA 2ZP0H 1LHFH 3T26A 4X6OA 1G2MA 2H1UA 4XFQA 1XKAC 2V0BA 3NUMA 2HNTC 5T6GA 3SHCH 3ZVAA 1A0JA 3ENSB 1PPFE 1K9OE 1SGQE 2QV1A 3LGTA 3MHWU 4XBCA 3RXHA 1ZMJA 1GDNA 1UHBB 1E38B 1E35B 1WQSA 3T29A 1TMUH 3UOUA 3PLPA 4MPVA 3SHAH 1TGNA 7LPRA 1VJAU 4K8YA 1GJ5H 3FZZA 4INLA 1MKWK 3V12A 3VEQB 2Z3CA 3QZRA 1NFXA 3E1XB 5EQSA 1F0SA 1YPKH 1O3BA 1TNIA 4MPUA 1ZJKA 3F68H 1W14U 4JZEH 2BQ6B 5GCHG 4A5TS 2ZDKA