2TGDA

Lack of the transition state stabilization site is a factor in the inactivity of trypsinogen, a serine protease zymogen. structure of dfp inhibited bovine trypsinogen at 2.1 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
222
Chain Sequence
VGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Lack of the Transition State Stabilization Site is a Factor in the Inactivity of Trypsinogen, a Serine Protease Zymogen. Structure of Dfp Inhibited Bovine Trypsinogen at 2.1 Angstroms Resolution
rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 47
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1986-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgdA02
5FCRA 1ELGA 4ZHLU 2ZI2H 1AI8H 2AGEX 3RC6A 1OP0A 2ZCLP 5JBBS 2VB0A 1P05A 5ESBA 1B0EA 1OWKA 3ZZ5A 4AG1A 2ZDLA 3T62A 5E0JA 1NTPA 1UTOA 3BTQE 4BXSA 1PYTD 3Q3KA 1O3JA 3E0PB 4TWWA 1V3XA 5GDSH 2RDLA 1DSUA 2FEQH 2H6MA 4JYTA 2AEIH 1DY9A 1P04A 2UUFB 3SV7A 1ESAA 3F68H 2ZHDA 1T8NA 1W10U 4AN7A 4KTCA 1AMHA 4TY6A 1UTNA 3BEFB 5CMXH 1C9TA 2C90B 1IQHA 1O5BB 2A45B 4JK5A 2IJOB 3QZRA 2OC0A 2ZDVH 3BEIB 2GMTB 1DXWA 3KNXA 3U69H 1PPZA 2FOFA 2VVVA 4I8JA 5C67A 1E34B 1MMJN 2Z9KA 5E2PA 1HJAB 1NO9H 2GMTC 3RP2A 8GCHF 2FO9A 4GVUA 1SGFA 1AZZA 1HDTH 1ZMLA 5I46H 4UEHH 1DS2E 1GBTA 4UFEH 2BMGB 1F2SE 1DT2A 1FV9A 4Z6AH 2A4QA 1GJCB 1BTZA 2A5AA 1DWDH 3CENA 3LC3A 3SI3H 4CBNA 4ESTE 3PROA 4AFZA 4AGKA 3P8NA 3F9EA 4DG4A 1NPMA 2Z3CA 2ZA5A 3T26A 3QO6A 2G52A 5F8ZA 1AZ8A 3KF2A 1RIWB 1XXFA 1OKXA 1EAXA 6GCHG 2F83A 3GYMA 1O3FA 1SI5H 2HGTH 1V2VT 1YPMH 2ZPQA 1TRYA 3GCTF 2Q6FA 4RKJB 1GI4A 1PPHE 4MPXA 1RIWC 3T27A 3SBKA 2Y5FA 3FP7E 2CF9H 1DVAH 1QL7A 2BY6X 4X6PA 3K6ZA 2BD7A 2BVRH 1CGJE 3SW2B 1NRPH 1LVYA 1Y5UT 1RS0A 4CRCA 4JYUH 5DPAA 3ZYEA 3RXAA 3PYHA 1O2TA 1QBNA 4IBLH 1BTXA 1QJ7B 3GY6A 1C1PA 1C5XB 1YPLH 1OYQA 1L4DA 5JB8S 1XMNB 1EJMA 4DJZB 2EC9H 1P9SA 1T4VH 1UMAH 5HM2A 5CE1A 3S0NA 5G4BA 1EX3A 2PKSB 2TIOA 1ZSLA 1O34A 2AGIX 1HAGE 3V12A 3PM3A 2ZDAH 1C1NA 2XBYA 4UONA 6CHAB 5GPIB 2HWLB 4Y8XA 1HAHH 2FOBA 2PKSC 4X6MA 4CRGA 5AF9H 1J9CH 1D3PB 1ZRBA 4D76A 5GJ4B 3ZZDA 1C5VA 5FCKA 1GBIA 6CHAC 1TNLA 3RXIA 4YTAA 8GCHG 1XKBC 5AFYH 1Z8GA 3SNCA 3UR9A 5FAHA 3ZVBA 4HFPB 4Y76A 5C1UA 1UTKA 4D7GA 4ZXXH 4ZAEA 4FUHA 3B9FH 4YT6H 1O0DH 3A8DA 1K21H 3DT0H 3EDXB 3SU2A 2ZO3H 1N6XA 3MO6A 1ZTLA 4WF8A 4XOJA 1IHSH 1DLEA 1RTLA 1P2KA 1KTTB 1GBHA 1PPGE 1JBUH 1THSH 2OBQA 3KQDA 2STBE 4E7NA 4J2YB 2B8OH 4HTCH 4ISLA 2BZ6H 4OS2A 3MOCA 4MDSA 1O2RA 1G3BA 1MU8B 1P01A 3NZIA 1KYNA 4DIIH 2ILNA 1AKSB 1XX9A 3ODDA 1SHHB 3GCTG 2Q6DA 1H9LB 3UPEA 1GWAA 2OCVB 2VIWA 4CHAC 4A6LA 2BY8X 1GI9B 1Z6EA 3R3GB 3MU0A 1V2JT 4OS1A 3RXTA 1NFUA 2CMYA 3KQCA 2J9NA 3D49H 3F6UH 3VPKA 1SHYA 1NROH 1XVOA 2BX3A 5JBCS 4DGJA 4FU7A 1E37B 4FU8A 1CO7E 2WPJS 1PQ8A 2A1DB 2QXJA 1W8BH 5EXLA 1NRQH 1A61H 4U30A 1ESTA 4X2YA 2ZTXA 3UTUH 2PKAB 1C2FA 2XC5A 2WPHS 1IQLA 3TK5A 3ZV9A 3H7TA 7KMEH 1SBWA 1EZXC 2SGEE 1ID5H 3RXKA 3A88A 1FNIA 2TGPZ 1LKAA 5JBTA 2ZNKH 5DP3A 5JBAS 1L1JA 2HVXA 2W3KA 5FBEA 4AZ2B 4WWYA 2ALPA 1NN6A 3RMNH 4DIHH 1QRWA 2WPLS 2GZ7A 3RXJA 1XUGA 1CA8B 4HGCA 1IQNA 2VVCA 2Y82A 3CS0A 1UCYE 1TALA 3QWCH 1IHTH 4BNRA 3RXPA 2F9VA 1DUEA 3F9FA 1OWEA 1YCPM 2H2ZA 2A2XH 1ANDA 1QJ6B 1FAKH 1OXGA 1TAWA 3A8AA 4X1RU 1SGYE 1MUEB 3F9GA 4IC5A 1G3CA 1PPCE 2DE9A 4ABIA 1TMBH 1P3EA 1TGBA 3H7OA 2STAE 4FVBA 2EI8A 1DITH 3W95A 1U6QA 1XUHA 3SQEE 1C2MA 1GJAB 2SNWA 4SGAE 4DW2U 3QTVH 2AYWA 1UVTH 4JCNA 3NK8A 1NRRH 3C27B 1O3MA 4ZROA 5EQQA 2FOMB 3SJKA 1WQSA 4DY7B 2J94A 4CRFA 1E38B 1C5LH 1EOLA 2O9QA 2BB4A 1ETRH 5DP8A 4NFFA 1BBRE 4NA7A 2Z3DA 2VU8E 1A3BH 4A1XA 4ASHA 3ZYDA 2ODYB 3PO1B 5EXMA 1RTFB 1NU9A 4KELA 1ELAA 3MNCA 1O35A 4BTUB 2FYRA 1RXPA 2R9PA 1BMAA 1UTPA 3T5FH 1ZYOA 5FX6A 2GP9B 3A89A 3PO1C 5L6NH 2BOHB 4X2WA 3U8OH 3EQ0H 3UOUA 1WV7H 3ATLA 2BQ6B 2WYGA 1FY5A 1AIXH 1YPGH 1SLXB 3Q00A 1V2UT 1T8LA 1ANEA 1GVKB 1P2NA 3RM0H 2O8LA 2H5DA 3GY5A 3R0FA 1PQ7A 4DURA 2QXHA 4YESB 2ZKSA 4FU9A 1GL1A 5GCHG 2BTCE 1J14A 4JZ1A 1LPKB 1F5KU 2F91A 2ZFFH 4OGYA 4MTBA 4FUBA 2A5KA 1ELCA 3SGQE 1VCQA 2BVXH 1O2VA 3D62A 1O5CB 3O8RA 1O2NA 3ZZ7A 3LGYA 2Y7XA 3RXHA 1CGIE 3A8CA 2FTMA 1LCYA 1P12E 2ZTZA 3RXOA 4CRAA 2BDIA 3TGKE 1DX5M 1UVUH 3P6ZB 4YO9A 1GBKA 1P09A 1C5YB 1ELBA 4J1YA 1GG6B 2OC8A 1O2HA 2OXSA 4WH6A 1HUTH 2BYAX 1LKBA 4WMEA 4LZ4B 1F92A 1GMHG 2BLQA 2ZU3A 5AVDA 3BTDE 3M35A 4B2BA 1GG6C 1LDTT 3GY3A 1QHRB 1J15A 1GHZA 3QZQA 1UHBA 4ABGA 6ESTA 1GI5A 5T3HA 3UUZA 2R3YA 1DY8A 4CBOA 4E05H 1CSOE 3MHWU 4MVNA 2VIDA 2C4FH 2KAIB 3AW0A 3KHVA 1C5WB 2GV6A 3ATKA 4GLYA 1GGDC 2A4RA 2W26A 2BXTH 4XFQA 5HXFA 3A83A 1TPOA 1DANH 4H6TA 4X1SU 2SGQE 3NWUA 5E0HA 5EQSA 2ZZUH 5E8EH 3SV6A 3QX5H 3M7TA 1XM1A 2ZFQH 2O8WA 4UD9H 4NSVA 4I32A 5DP4A 1Y5BT 1KLTA 3LKWA 4X2XA 1HJ9A 2P94A 3QUMP 3UNSA 1AKSA 1TNIA 2BD4A 4Y10E 2G51A 1UK2A 3KQEA 5AHGH 1GBCA 5GIBA 3SV2H 1PQ5A 4ZHMU 3D23A 3RLWH 1AHTH 5EW2H 4NA8A 3SNDA 1MD7A 2UUYA 1P0SH 2BOKA 4INKA 1AVXA 5F8TA 1JRSA 2WV4A 3PMHB 2FMJA 4CR5A 2ZC9H 1DOJA 1AGJA 2HPPH 2WYJA 2OQUA 1TNHA 4X1NU 3GISB 2FYQA 2PTCE 3MU5A 1HAYB 3FP8E 3SNBA 3LGTA 1ZRKA 1TA6A 2BDAA 4I33A 1S82A 2R2MB 1W0ZU 2PKAA 3VXEH 1HJ8A 2JH6D 2BY5X 1WUNH 2EA3A 1UJ1A 3VFEA 5C20A 3QTOH 4ABJA 1FN6A 3BIUH 2AIQA 2O8UA 2ZGXH 3SHAH 5E2OA 3N7OA 3F9HA 1V2NT 4ZMAH 1GBMA 1LPGB 4IS5A 1VR1H 2GCTB 2BX4A 3IG6B 5EPYA 2XBVA 3MU4A 1V2TT 2PUQH 1AWHB 1TIOA 1O37A 2EEKA 4B2AA 2G4UA 2GCTC 1TNKA 2QIQA 1D6RA 3A81A 1P57B 1S6FA 3RU4T 3HK3B 3UNRA 1BRBE 1O2IA 1O2QA 3L33A 3Q76A 1P06A 4CREA 1NT1A 1S81A 1HFDA 2BD2A 2ZGBH 4AB9A 3E8LA 3TNTA 1XKAC 1O30A 3ATWA 4Y11E 4ZKOU 1MD8A 4FVDA 5FHTA 2VH0A 1PPBH 5HMAA 1GVLA 5J4SA 3GCOA 4U01A 3V13A 5A2MH 1SLUB 2A4GA 1OX1A 1MAYA 1LHGH 3U1IB 1SGDE 3BF6H 5JB9S 2PWXA 1CU1A 1WTGH 1FDPA 4ABBA 1IOEA 3KEEA 2JH0D 3M61U 5A0CA 4Y0ZE 3TJNA 1QJ1B 2PGBB 2Q1JA 1CBWB 1HAZB 2PW8H 4TPIZ 4FUCA 4VGCB 2W7UA 1D4PB 2GKVE 3BTTE 1J16A 1X7AC 2RA0A 1ZTJA 5C2ZA 1GDUA 1LHFH 1P2OA 1CBWC 1QY6A 1AN1E 3M7UA 2A0QB 1QGFA 1O3DA 4VGCC 4CRBA 2OQ5A 1GHYH 1NU7B 2XBWA 2BQ7B 1GHWH 1MKXH 2ZGJA 4THNH 1H8DH 1GPZA 3E1XB 2TGAA 1BA8B 1S83A 4K1TA 1TPPA 4CRDA 1FI8A 1QBOA 1G9IE 3PWBA 2BLWA 2P59A 1C5ZB 3FANA 1HAPH 4IW4E 4RN6A 2CF8H 4HZHA 3BSQA 1O5EH 1BQYA 2BHGA 1ZHMA 1Q2WA 3SQHE 8LPRA 5CHAB 3T2NA 1KXCA 3HATH 4I8KA 4XE4A 4JK6A 5B6OA 1O2MA 3VB6A 1DFPA 1QA7A 2EI7A 5CHAC 3TH4H 2FX4A 1AFEH 4AYYB 3BTEE 1F5RA 1BJUA 1D3QB 4YZUA 3E0NB 1TBRH 2V3OH 1FN8A 1GBAA 3MYWA 3UIRA 4LOYH 3OX7U 3ELAH 1SL3A 5FX5A 3AVZA 2GD4B 4SGBE 3ZVDA 3ZVAA 2ZDKA 1PQAA 1L0ZA 1L2EA 4Z0KA 4WXVA 1HYLA 2AMQA 2F9OA 2BVSH 1S84A 1GI6A 2KAIA 4ZHAA 1NFWA 4MNYA 4B73A 1GJ5H 2QCYA 4HI3A 1TRMA 1O5GH 1E35B 3OY5U 1VZQH 1GI1A 1WAYB 1ZJKA 4BAQB 1C1MA 3EA8A 1LQEA 4K2YA 1HAOH 2BD8A 3M37A 1P02A 1RGQA 2C3SA 4BAMB 2IN2A 2ZCKP 1K22H 1TYNA 1KXAA 2FI4E 1E0FD 2ZFRH 4UFDH 1ZOMA 2AFQB 3LU9B 1FY1A 2GTBA 5K7RA 3FFGA 1V2WT 4TWYA 4K60A 1FIZA 1YPHC 3A7YA 2PGQB 1HGTH 4B2CA 1VGCC 2ZGCA 1OP8A 3STJA 1OS8A 3UQOA 1IQIA 1MTUA 4FUFA 1S0QA 1C1UH 1GJ7B 2V3HH 1K1PA 1WCZA 1ZGIA 4JZFH 1RFNA 1EB2A 1EXFA 1YPJH 1EPTB 1QA0A 2HNTF 4OS5A 3SI4H 1H1BA 1A4WH 1T7CA 2FESH 5J4QA 5T6DA 2Y5HA 5EODA 1FQ3A 1FAXA 1NFXA 2F9NA 3S7HB 1EPTC 2HPQH 2UWPA 1K1JA 1LO6A 1YLCA 2ZHFH 4MNWA 3RU4E 3I29A 4A7IB 3I77A 2HLCA 2LPRA 5C1XA 2QV1A 3LPRA 4ZUHA 4F4OC 3UREA 1C1RA 2Y6TA 1ARCA 1LHCH 1ZSKA 1KIGH 1KXEA 3A87A 3H5CB 3OY6U 1ZHRA 4YOGA 2HNTE 3PTNA 5EXNA 1VCWA 4NIWA 5FXLA 4INHA 3EYDA 2R0KA 3GY8A 6LPRA 1AFQC 1CE5A 1MBQA 1GDQA 4Y7BA 4ZH8A 3PMJA 4E7RG 1BTUA 1EAIA 2G55A 3IITA 3VXFH 4Y0YE 1EJAA 2WUBA 5EG4A 2NU0E 3U8TH 3TJUA 1O38A 3SO3A 1BTYA 5DK1A 3BG8A 1SGIB 4Y6DA 1ZMNA 1XUJA 9ESTA 3LT3A 2ZU2A 1PFXC 2ZTYA 1MCVA 3GDSA 4NIVA 1YYY1 1NFYA 1E36B 3HPTB 4X8TH 4WJG2 3M3SA 1GBLA 2ZFSA 4WXIA 2H1UA 1G2LA 1O2PA 3LGIA 3SOSA 1SGFG 1O2ZA 1C5OH 3RXLA 3LGWA 3QDZB 5AFZH 1MH0A 1SGNE 1S85A 1BBRH 1YKTA 2ZU1A 1UK4A 2AMPA 1YCPH 1C1WH 5IYTA 1CHOF 3GCHB 2FPZA 3ODFA 5PTPA 2ASUB 2VIOA 1NRSH 2OTVA 2D1JA 3E91A 2VWOA 5EOKA 1G2MA 1K28D 1SLWB 3GCHC 4CHAB 3RC4A 3ATIA 3HKJB 3P92A 4RKOB 1SC8U 1CT2E 1IQGA 3ZZBA 2Z6BD 1OSSA 3HGNA 1BZXE 3TITA 1O2XA 2D8WA 3K6YA 3VGCC 1Z1JA 2BD5A 2ZF0H 2J95A 3TVJB 1TGTA 2D2DA 3RXUA 5LPRA 1QCPA 3Q3XA 3A85A 1DM4B 1GI0A 1SMFE 4K1EA 4Y8YA 2FM2A 3BTFE 2QC2A 1TNJA 2VGCC 1IQFA 1BTPA 1KXFA 1MU6B 3BTKE 2AMDA 2OUAA 1FMGA 4D8NA 3M5LA 4ZXYH 3LH3A 3TGIE 3ZZ8A 2P3TB 2F9PA 3MMGA 4H42U 3EAJA 4X0WU 1F5LA 4NWKA 1C9PA 2GGVB 3A82A 4XBBA 5LPFA 2NU3E 4X8UH 1C4U2 3SU1A 1NZQH 1O3NA 5DP9A 1GDNA 2QY0B 1GBEA 2R2WU 3PLBA 1GI2A 1MKXK 2WPKS 3TK6A 3NKKA 1A0HB 1EAUA 1ZLRA 2QXGA 1GJ9B 1VCPA 2TBSA 1BITA 1UTQA 1GI8B 5IDKA 1Y59T 1OWIA 1FIWA 1C2GA 1K2I1 1Y3WA 3ZZAA 3FZDA 1TGNA 1GBBA 1BTHH 1TNGA 1ZPZA 4AX9H 2SFAA 4R0IA 1QRZA 2OLGA 1BCUH 2XRCA 2CXVA 4GHTA 1QTFA 4LXBH 3ZZ3A 2ZP0H 1P3CA 2PUXB 4FUIA 2A2QH 1WSSH 1GMDF 2C8YB 1SFQB 4PROA 3LOXA 4UDWH 2CHAC 4YLUA 1TBZH 1EZUC 1GVZA 2OD3B 3SJ8A 1W3CA 2P16A 1DE7H 1HB0B 3A86A 2XWAA 1INCA 5ESTE 1GMCF 2H9HA 4Q2KA 1KXDA 2GT8A 2XC4A 4X1PU 3TK9A 4Q7XA 1KSNA 3G01A 1HAXB 4KP0A 4R8TB 3E6PH 1O3HA 3QLPH 2ZFTA 1C1QA 1LVMA 2P8OB 1LVBA 2CGAA 1ELTA 4ZKNU 1CHGA 1V2OT 1ACBE 2J2UA 3T29A 3MO3A 2G4TA 2P8OC 1MQ6A 2GCHF 1NC6A 1OWJA 3S9BA 1F0UA 1B7XB 1ZPCA 2ZIQH 1ZHPA 2THFB 2SGPE 2AIPA 1C5PA 2PSYA 3RXFA 1YC0A 1TMUH 2BDBA 1BHXB 1FY8E 1H4WA 1C5SA 2WV5A 1QB6A 3P8GA 1BMLA 3EA7A 4FUEA 3UFAA 5H4IB 5HM9A 4X8VH 5A09A 3GY4A 5GWZA 2XTTB 1IQMA 2J34A 3ITIA 1VITH 1Z7KA 3RXBA 2YOLA 1SQTA 1MZDA 1WBGB 1K1IA 1WYKA 2PFEA 2Y81A 3MH6A 3VEQB 1C2IA 3SJOA 4Q80A 1RD3B 1BRCE 2ZDMA 3DA9B 1MTVA 3O8CA 2SGAA 1CT0E 4O97A 5T6FA 2A32A 2A7CA 4LZ1H 4A5TS 3U98H 1GGDB 2W5EA 4GSOA 1GMDG 2PV9B 3PTBA 1EUFA 1LMWB 2VIQA 3M5OA 3MH4A 3SGBE 2ZQ1A 2BXUH 1Y8TA 1TPSA 2BLOA 4AYVB 2ODQA 4A1TA 1NM6A 1AUJA 1O5AB 1GMCG 4UE7H 2F9BH 3LJOA 1C1OA 1Z8RA 1TA2A 1KXBA 1NESE 4Y79A 5F6MA 4IN2A 4Y7AA 1F0SA 3GDUA 3WY8A 1GBDA 1UTLM 3M36A 1F7ZA 5HYOA 3JZ1B 1XUKA 4MLFB 1OYTH 3SUFA 1CA0B 3TJVA 1EB1H 3RXMA 4ABAA 4DOQA 3ZZ6A 2BM2A 2GCHG 2UUKB 1D6WA 4O03A 3PMBB 1O32A 4FXGH 5K0HA 1CA0C 1ZMJA 2DE8A 2FZZA 1BBRK 1MKWH 2PSXA 1YCPK 2ULLA 1GJ8B 1ABJH 1P10A 2B5TB 1QQ4A 3ATMA 3GCNA 1D3DB 1EP6A 1AU8A 1TGSZ 1GHBF 3ZZ9A 2XCFA 2AS9A 3BTME 3GICB 5FBIA 3RXVA 2P95A 2TPIZ 2VJ1A 4DT7B 4ZKSU 1ZJDA 4CH2B 5SGAE 1UK3A 5L2ZH 1XUIA 1C1SA 1AWFH 2XC0A 2OINA 3BG4B 2UWOA 1C2HA 2BDHA 4K8BA 4ABFA 1TX7A 4AOQA 4K8YA 4BTTB 1HAVB 3LGUA 3MI4A 4AGJA 1CGHA 2FWWA 1QFKH 3SU4A 3BG4C 2FI3E 3KN2A 2OP9A 2BZAA 1FPCH 3SN8A 3E90B 5ETXA 3AW1A 4D9QA 1HNEE 2FODA 3GYLB 2NU4E 2ANYA 1SFIA 2ZECA 3A7TA 5EGMA 4E06H 1TGCA 2G5NA 1B0FA 2ZQ2A 1DLKB 1SPJA 2Z9GA 1C4Y2 3OSYA 2AH4X 2I6QA 2TRMA 4NGAH 7ESTE 1F0RA 3W94A 1RRKA 2HALA 3A7XA 3ZZCA 1HPGA 4YT7H 1SG8B 1MQ5A 3RXEA 1GBJA 3I78A 3GDVA 4A92A 1YGCH 1YLDA 5FPTA 1V2QT 1MTNC 1MZAA 4XDEA 5JYIA 2NWNA 1ZZZA 1A0JA 3S9CA 7GCHF 2PR3A 1SGQE 1T8MA 4JZEH 1H9HE 1BMMH 1QB1A 4JYVH 4UFGH 2GT7A 2XCNA 2RCEA 1ZTKA 4Y8ZA 3B23B 3PLPA 5BRRE 3MWIU 3SNAA 1VJ9U 1L4ZA 3GOVB 3C1KA 2V0BA 4MQAA 1JIMA 3BEUA 1IQKA 1V2MT 1SOTA 1O3LA 4NCYA 3LDXH 3UR6A 1N1LA 3DUXH 4NA9H 1V6DA 1O2KA 1JOUB 2OBOA 4DVAU 2JKHA 3MO9A 1HRTH 2ZFPH 4FUDA 1ZPBA 4DCDA 3NPSA 4FUGA 1O3AA 2ANWA 3KIDU 1MBMA 3URCA 3UWIA 1Q3XA 1BIOA 1D3TB 2PTNA 3PV4A 2LNCA 1W7XH 3LH1A 3CP7A 1TQ0B 2FOEA 4H6SB 3VB7A 2VWLA 1KY9A 2ANMH 5DJ7A 1QURH 3TH3H 3P95A 3MH5A 3VB4A 1EZQA 1JIRA 1TABE 4Y71A 1M9UA 1J8AA 2OC7A 3GY7A 3RXQA 1NY22 2B9LA 1N6YA 1DWBH 3LC5A 4JZIA 4YOJA 2QAAA 3O8DA 2H5CA 1P8VC 4JZDH 3M7QA 1P11E 1P2MA 1O39A 1TBQH 3B8JA 2QF3A 2ANKH 1DPOA 4ABDA 1GI7B 2QA9E 3TLOA 1P9UA 1ARBA 1W2KH 1OWDA 1AVGH 4O3UA 4BAOB 4ISIH 3FVFB 3DFJA 1LHDH 1W7GH 1LPZB 3QGJA 1SOZA 4X6NA 2ZHEH 4A1VA 2BY9X 2GV7A 1C5TA 4KKDA 1FXYA 4GCHF 1DXPA 1ELDE 1EOJA 3ENSB 3V3MA 3RU4D 1BJVA 3OYPA 4O3TA 3AAUA 3SV8A 4ISNA 3RXDA 3ZV8A 4YOIA 3QN7A 7GCHG 1O3IA 2C93B 2BY7X 4Q7ZA 2O8MA 3RMMH 2ZCHP 1G36A 3RXCA 4AFUA 1A0LA 2HRVA 2WUCA 4B1TA 5C5OA 1A5HA 5EQRA 1GHVH 2A7HA 1O2JA 1C4V2 1HLTH 1ANBA 1AUTC 4OS7A 5A8XA 1G37A 1AD8H 1VGCB 1ELVA 1ANCA 2NU2E 2ZDNA 3ZVEA 1GCDA 1KDQB 3SORA 4UFFH 3SZNA 1FY3A 2BD9A 1EQ9A 3A84A 1LTOA 2FOGA 4K1SA 1P2IA 1A7SA 1SGRE 1TX8A 1OPHB 1DSTA 2DUCA 1O33A 4WVPE 4IC6A 4BAHB 2ZU5A 4YM9A 1HAIH 4XSKU 2W7SA 1D9IA 2A4OA 3S69A 4BXWA 1KLJH 2UUJB 4AB8A 1C2JA 1TPAE 2HOBA 1UTMA 1W13U 1P2JA 1J17T 2B7DH 1SLVB 1AQ7A 1HJAC 2Z7FE 1AO5A 2FP7B 3Q77A 3PLKA 5GXPA 2G8TA 1A3EH 4TYDA 4X2VA 4IGDA 2XYAA 2FDAA 3GY2A 2Y5GA 1TWXB 5DG6A 1TE0A 2VIVA 4QT8C 4U32A 2JETB 1AFQB 1WU1A 2VVUA 2A31A 5TCAA 1K1OA 1SGPE 4K3JA 1BRAA 2JH5D 1T4UH 4ZKRU 1SGTA 1HAVA 2JETC 1ESBA 2TGTA 1UCYH 3HK6B 1MKWK 1THRH 3MNXA 4GCHG 4ISHH 3ZZ4A 1FZZA 3S9AA 3MNBA 3UNQA 3P17H 2YNAA 3LJJA 1WQVH 4X1QU 1S6HA 5A0BA 2H9TH 3NUMA 2GDEH 1Z8JB 4KTSA 3TH2H 3OTJE 4B76A 1AE5A 1EKBB 4TPYA 7LPRA 1ZSJA 1B5GH 1O3GA 2QF0A 3MFJA 1BT7A 3MH7A 5DO4H 3F1SB 3TPIZ 1Z8IB 2CV3A 1V2PT 1N8OB 2YNBA 3LIWA 1A5GH 1O2GH 3M5NA 4GUXA 5T6GA 1K9OE 4OGXA 4I7YH 2RA3A 2PLXA 1MTWA 1UVSH 3FZZA 4WY3A 1N8OC 1QNJA 1Z1IA 4ABEA 4LK4A 2BDGA 4GAWA 3NCLA 4NZLA 5E0GA 1GJ4H 3RXSA 4AFSA 1XUFA 1S5SA 1UHBB 1SGEE 3O8BA 3VGCB 5BPEA 3SUEA 3MTYA 3DHKH 1GL0E 1OWHA 3IWMA 3TIUA 1ELFA 2FOCA 4AFQA 2B0FA 4WMFA 1PPEE 3TGJE 4NIXA 1FLEE 1THPB 1C2DA 1ABIH 3BV9B 1P2QA 5LH8A 1WOFA 2Z3EA 1Z71A 1C5MD 4B75A 1EASA 4MNXA 4NSYA 1VJAU 1BRUP 1H9IE 2V6NA 2VGCB 2V35A 1SR5C 3HGPA 5C5NA 2J92A 1O2LA 2O8TA 1HXFH 4K69A 1A46H 3QGNB 3KGPA 3SHCH 3M3TA 1A5IA 3DD2H 2Z94A 4X6OA 1GJDB 2ZG0H 1GHAF 3VB5A 3RMLH 3A7ZA 5L2YH 1W14U 2WPIS 1XVMA 2VH6A 5DGJA 2H9EH 1BTWA 4O9VA 1TFXA 3EE0B 3ESTA 3URDA 4CR9A 2TGDA 2VNTA 2XWBI 1WTHD 3RUOA 3L6PA 2C8XB 4B74A 1O3PB 1O3EA 3U9AH 5DP7A 2BDCA 1C1VH 1GCTB 3RMOH 3TNSA 1W12U 4MNVA 3AASA 5EU8A 4ISOA 1O36A 1UVOA 3V0XA 1GCTC 2P3FH 2XBXA 3M3VA 2VWMA 1C2KA 1C2LA 5GCHF 5A8ZA 1O3BA 2RG3A 2PHBA 4I31A 1UVPA 1G3EA 1O2YA 1CHOG 1DWEH 4MPVA 2FS8A 1BB0B 1EZSC 2ZWLH 2CHAB 2BDYA 1QL8A 1C2EA 1EJNA 3PMAB 3CS7A 1CT4E 2C8ZB 2BQWB 4FUJA 3K65B 5FPSA 1TX6A 4IMZA 1KDQA 3U8RH 1BUIA 2XXLA 3SUGA 3K2UA 1O3CA 1A2CH 2WPMS 4KTUA 8ESTE 1CQQA 4NZQA 1Z6JH 3SU6A 1HIAB 1O2UA 1IAUA 1G3DA 2J4IA 1HXEH 1GMHF 3P8FA 1GI3A 1T32A 1FJSA 4M7GA 2ZU4A 2QXIA 3A8BA 1HCGA 1EPTA 2QYIA 1LVOA 3D65E 1TQ7B 1GHAG 1O2WA 2GDDA 5DKMA 1G30B 9LPRA 4INLA 4ABHA 2FIRH 1YPHE 1FY4A 1A1RA 2FI5E 4XBDA 1AE8H 1EATA 5DP6A 1HBTH 3T28A 1TOMH 1JWTA 1AB9B 1O3KA 1ETTH 2R3UA 2ZPRA 3DFLA 1Y3XA 2FOHA 3LGVA 1S0RA 3RDZA 1NS3A 2NU1E 3SJ9A 3SUDA 3BN9A 3E3TA 2K1QA 3L3TA 1AB9C 3A7WA 4BOHA 2GVFA 2CJIA 1O5DH 2BD3A 1C5QA 5C3NA 2SGDE 4X8SH 1EP5A 1GJBB 2D26C 1G32B 1FONA 3LONA 1ELEE 1GJ6A 5L30H 1PJPA 1V2RT 3MNSA 3RXGA 2ZGHA 1ORFA 2GZ9A 1JMOH 2BLVA 3OU0A 3UQVA 1C1TA 5ABWA 2VINA 1QQUA 2SGFE 3PB1E 1T31A 3E16B 5TCCA 2UWLA 1C5UA 1TMTH 4MPUA 2ALVA 1UCYK 1TOCB 4D7FA 3UWJH 3S7KB 3STIA 4OS4A 2G5VA 3MU8A 3SJIA 4NIYA 1YF4A 3T25A 2EI6A 2Z9LA 1BDAA 4BANB 5C1YA 4BTIB 1Y3YA 2ODPA 3ZVCA 2VWNA 3JZ2B 1MTSA 1OP2A 3EA9A 4IN1A 2ESTE 2FTLE 3BTWE 3PWCA 3KQBA 4F49A 1L1NA 3P70B 4WH8A 1DICA 1IQJA 3AAVA 1LQDB 4XBCA 1NRNH 1IQEA 1C5NH 3UOPA 4K5ZA 4MG3A 1RTKA 3K9XB 4YLQH 1OOKB 3M5MA 5F03A 3U1JB 3MU1A 5HGGA 1KTSB 3VB3A 4B71A 1PYTC 1T8OA 5LGOA 1V2ST 2I6SA 3BTGE 1O2OA 1Y3VA 2M5TA 3A80A 5EPNA 5I25A 4NG9H 1SGCA 1L1GA 1O31A 2Q6GA 1K1NA 4U2WA 1DWCH 3EGKH 1P03A 4AG2A 2QN5T 1SVPA 2HNTC 1W11U 4NFEA 1FPHH 4I8HA 4I8GA 1W0YH 2G81E 2AGGX 5A8YA 1YPKH 2J38A 2P93A 2ZEBA 1ETSH 5LPEA 1JXPA 2R0LA 2IOTA 1Q31A 2F9UA 3TJOA 2OC1A 2FOAA 4AORA 1UO6A 3RC5A 1SB1H 1V2LT 1FUJA 2FLRH 1JRTA 2A5IA 3TU7H 1EAWA 4BAKB 3A7VA 4MPWA 3SU3A 1VITF 3FP6E 2SNVA 1F0TA 4WMDA 1K1MA 3KCGH 1BMNH 1O5FH 1CVWH 3SU0A 3Q3YA 4H4FA 5JPMH 3SV9A 1AVWA 1GHXH 4TY7A 5EW1H 3RLYH 1MTNB 2QGRA 1V2KT 3ZVGA 1SQAA 1TONA 5A0AE 1TRNA 1Y3UA 3SGAE 8KME2 1TLDA 2C8WB 2G00A 1SSXA 2IPHA 4CH8B 1KLIH 3HKIB 2Y7ZA 1Y5AT 4GPGA 3V7TA 5TJXA 3P8OA 1SQOA 3SNEA 1HIAA 2A7JA 2GX4A 2FS9A 3FAOA 1MCTA 3BTHE 2ZHWH 3NXPA 1MAXA 4NWLA 3RM2H 1QR3E 1TB6H 1DUAA 2P3UB 1UTJA 1QBVH 2CN0H 2F3CE 3KL6A 2ZHQH 3SU5A 1GBFA 1DDJA 4OS6A 1GHBG 1QL9A 1C5RA 2XNIA 1LHEH 4D9RA 4RSPA 2FX6A 2Z9IA 2FLBH 2Z9JA 1ZGVA 4Q7YA 4GHQA 3UY9A 1BOQA 1RJXB 4IMQA 2WINI 3RXRA 1XXDA 1QRXA 4I8LA 2GZ8A 4KGAA 1YP9A 1AY6H 2AERH 3BIVH 2VIPA 1O2SA 5F8XA 1K1LA 2W3IA 3QK1A 2Y80A 1ZR0A 4JMYA 3ZVFA 1HV7A 1YPEH 1QB9A 1YBWA 2ZPSA 1PPFE 1BHXF 5JDUB 5FPYA 2XW9A 1YM0A 2FXRA 5DP5A 1O3OA 1VITG 1H8IH 1QIXB 6GCHF
chains in the Genus database with same CATH superfamily
5FCRA 1ELGA 4ZHLU 2ZI2H 1AI8H 2AGEX 3RC6A 1OP0A 2ZCLP 5JBBS 2VB0A 1P05A 2LP6A 5ESBA 1B0EA 1OWKA 3ZZ5A 4AG1A 2ZDLA 3T62A 5E0JA 1NTPA 1UTOA 3BTQE 4BXSA 1PYTD 3Q3KA 1O3JA 1FX0B 3E0PB 4TWWA 1V3XA 5GDSH 2RDLA 2WSSD 1DSUA 2FEQH 2H6MA 5HIZA 4JYTA 2AEIH 1DY9A 1P04A 2UUFB 3SV7A 1EFRD 1ESAA 3F68H 2ZHDA 1T8NA 1W10U 4AN7A 4KTCA 1AMHA 2JDID 4TY6A 1UTNA 3BEFB 5CMXH 1C9TA 2C90B 1IQHA 1O5BB 2A45B 4JK5A 2IJOB 3QZRA 2OC0A 2ZDVH 3BEIB 2GMTB 1DXWA 3KNXA 3U69H 1PPZA 2FOFA 2VVVA 4I8JA 5C67A 1E34B 1MMJN 2Z9KA 5E2PA 1HJAB 1NO9H 2GMTC 3RP2A 8GCHF 2FO9A 4GVUA 1SGFA 1AZZA 1HDTH 1ZMLA 5I46H 4UEHH 1DS2E 1GBTA 4UFEH 2BMGB 1F2SE 1DT2A 1FV9A 4Z6AH 2A4QA 1GJCB 1BTZA 2A5AA 3OEED 1DWDH 3CENA 3LC3A 3SI3H 4CBNA 4ESTE 3PROA 4AFZA 4AGKA 3P8NA 3F9EA 4DG4A 1NPMA 2Z3CA 2ZA5A 3T26A 3QO6A 2G52A 5F8ZA 1AZ8A 3KF2A 1RIWB 1XXFA 1OKXA 1EAXA 6GCHG 2F83A 3GYMA 1O3FA 1SI5H 2HGTH 1V2VT 1YPMH 2ZPQA 1TRYA 3GCTF 2Q6FA 4RKJB 1GI4A 1PPHE 4MPXA 1RIWC 3T27A 3SBKA 2Y5FA 3FP7E 2CF9H 1DVAH 1QL7A 1QZ8A 2BY6X 4X6PA 3K6ZA 2BD7A 2BVRH 1CGJE 3SW2B 1NRPH 1LVYA 1Y5UT 3U28C 1RS0A 3UB0A 4CRCA 4JYUH 5DPAA 3ZYEA 3RXAA 3PYHA 1O2TA 1QBNA 4IBLH 1BTXA 1QJ7B 3GY6A 1C1PA 1C5XB 1YPLH 1OYQA 1L4DA 5JB8S 1XMNB 1EJMA 4DJZB 2EC9H 1P9SA 1T4VH 1UMAH 5HM2A 5CE1A 3S0NA 5G4BA 1EX3A 2PKSB 2TIOA 1ZSLA 1O34A 2AGIX 1HAGE 3V12A 3PM3A 2ZDAH 1C1NA 2XBYA 4UONA 6CHAB 5GPIB 2HWLB 4Y8XA 1HAHH 2FOBA 2PKSC 4X6MA 4CRGA 5AF9H 1J9CH 1D3PB 1ZRBA 4D76A 5GJ4B 3ZZDA 1C5VA 5FCKA 1GBIA 6CHAC 1TNLA 3RXIA 5HKKD 4YTAA 8GCHG 1XKBC 5AFYH 1Z8GA 3SNCA 3UR9A 5FAHA 3ZVBA 4HFPB 4Y76A 5C1UA 1UTKA 4D7GA 4ZXXH 4ZAEA 4FUHA 3B9FH 4YT6H 1O0DH 3A8DA 1K21H 3DT0H 3EDXB 3F0OA 2ZO3H 1N6XA 3SU2A 3MO6A 1ZTLA 4WF8A 4XOJA 1IHSH 1DLEA 1RTLA 1P2KA 1KTTB 1GBHA 1PPGE 1JBUH 4YXWD 3OTPA 1THSH 2OBQA 3KQDA 2STBE 4E7NA 4J2YB 2B8OH 4HTCH 4ISLA 2BZ6H 4OS2A 2VBCA 3MOCA 4MDSA 1O2RA 1G3BA 1MU8B 1P01A 3NZIA 1KYNA 5HIYA 4DIIH 2ILNA 1AKSB 1XX9A 3ODDA 1SHHB 3GCTG 5FL7D 2Q6DA 1H9LB 2CK3D 3UPEA 1GWAA 2OCVB 2VIWA 4CHAC 4A6LA 2BY8X 1GI9B 1Z6EA 3R3GB 3MU0A 1V2JT 4OS1A 3RXTA 1NFUA 2CMYA 3KQCA 2J9NA 3D49H 3F6UH 3VPKA 1SHYA 1NROH 1XVOA 2BX3A 5JBCS 4DGJA 4FU7A 1E37B 4FU8A 1CO7E 2WPJS 1PQ8A 1COWD 2A1DB 2QXJA 1W8BH 5EXLA 4ACBA 1NRQH 1A61H 4U30A 1ESTA 4X2YA 2ZTXA 3UTUH 2PKAB 1C2FA 2XC5A 3OEHD 2WPHS 1IQLA 3TK5A 3ZV9A 3H7TA 3KYGA 5KGOA 7KMEH 1SBWA 1EZXC 2SGEE 1ID5H 3RXKA 3A88A 2J5UA 1FNIA 2TGPZ 5EIYA 1LKAA 5JBTA 2ZNKH 5DP3A 5JBAS 1L1JA 2HVXA 2W3KA 5FBEA 4AZ2B 4WWYA 2ALPA 1NN6A 3PRDA 1YY3A 3RMNH 1QRWA 4DIHH 2WPLS 2GZ7A 3RXJA 1XUGA 1CA8B 4HGCA 1W0JD 1IQNA 2VVCA 2Y82A 3CS0A 1UCYE 1TALA 3QWCH 1IHTH 4BNRA 3RXPA 2F9VA 1DUEA 3F9FA 1OWEA 1YCPM 2H2ZA 2A2XH 1ANDA 1QJ6B 1FAKH 1OXGA 1TAWA 3A8AA 4X1RU 1SGYE 1MUEB 3F9GA 4IC5A 1G3CA 5EJZA 1PPCE 2DE9A 4ABIA 1TMBH 1P3EA 1TGBA 3H7OA 2STAE 4FVBA 2EI8A 1DITH 3W95A 1U6QA 1XUHA 3SQEE 1C2MA 1GJAB 2SNWA 4SGAE 4DW2U 3QTVH 2AYWA 1UVTH 4JCNA 3NK8A 1NRRH 3C27B 1O3MA 4ZROA 5EQQA 2FOMB 3SJKA 1WQSA 2RDEA 4DY7B 5C17A 2J94A 4CRFA 1E38B 1C5LH 1EOLA 2O9QA 2BB4A 1ETRH 5DP8A 4NFFA 4F55A 1BBRE 4NA7A 2Z3DA 2VU8E 1A3BH 4A1XA 4ASHA 3ZYDA 2ODYB 3PO1B 5EXMA 1RTFB 1NU9A 4KELA 1ELAA 3MNCA 1O35A 2PP6A 4BTUB 2FYRA 1RXPA 2R9PA 1BMAA 1UTPA 3GS9A 3T5FH 1ZYOA 5FX6A 5KECA 2GP9B 3A89A 3PO1C 5L6NH 2BOHB 4X2WA 3U8OH 3EQ0H 3UOUA 4ASUD 1WV7H 3ATLA 2BQ6B 2WYGA 1FY5A 1AIXH 1YPGH 1SLXB 3Q00A 1V2UT 1T8LA 1ANEA 1GVKB 1P2NA 3RM0H 2H5DA 2O8LA 3GY5A 3R0FA 1PQ7A 4DURA 2QXHA 4YESB 2ZKSA 4FU9A 1GL1A 5GCHG 2BTCE 1J14A 4JZ1A 1LPKB 1F5KU 2F91A 2ZFFH 4OGYA 4MTBA 4FUBA 2A5KA 1ELCA 3SGQE 1VCQA 2BVXH 1O2VA 3D62A 1O5CB 3O8RA 1O2NA 3ZZ7A 3LGYA 2Y7XA 3RXHA 1CGIE 3A8CA 2FTMA 1LCYA 1P12E 2ZTZA 4HG6A 3RXOA 4CRAA 2BDIA 3TGKE 1DX5M 1UVUH 3P6ZB 4YO9A 1GBKA 1P09A 1C5YB 1ELBA 4P02A 4J1YA 4XRNA 1GG6B 2OC8A 1O2HA 5C0TA 2OXSA 4WH6A 1HUTH 2BYAX 3DSOA 1LKBA 4WMEA 4LZ4B 1F92A 1GMHG 2BLQA 2ZU3A 5AVDA 3BTDE 3M35A 4B2BA 1GG6C 1LDTT 3FKSD 3GY3A 1QHRB 1J15A 1GHZA 3QZQA 1UHBA 4ABGA 6ESTA 1GI5A 5T3HA 3UUZA 2R3YA 1DY8A 5T1VA 4E05H 1CSOE 4CBOA 3MHWU 4MVNA 2VIDA 2C4FH 2KAIB 3AW0A 3KHVA 1C5WB 2GV6A 3ATKA 4GLYA 1GGDC 2A4RA 2W26A 2BXTH 4XFQA 5HXFA 3A83A 1TPOA 1DANH 4H6TA 4X1SU 2SGQE 3NWUA 5E0HA 5EQSA 2ZZUH 5E8EH 3SV6A 3QX5H 3M7TA 1XM1A 2ZFQH 2O8WA 4UD9H 4NSVA 4I32A 5DP4A 1Y5BT 1KLTA 3LKWA 4X2XA 1HJ9A 2P94A 3QUMP 3UNSA 1AKSA 1TNIA 1KMHB 2BD4A 4Y10E 2G51A 1UK2A 3KQEA 5AHGH 1GBCA 5GIBA 3SV2H 1PQ5A 4ZHMU 3D23A 3RLWH 1AHTH 5EW2H 4NA8A 3SNDA 3F2HA 1MD7A 2UUYA 1P0SH 2BOKA 4INKA 1AVXA 5F8TA 1JRSA 2WV4A 3PMHB 2FMJA 4CR5A 2ZC9H 1DOJA 1AGJA 2HPPH 2WYJA 2OQUA 1TNHA 4X1NU 3GISB 2FYQA 2PTCE 3DSGA 3MU5A 1HAYB 3FP8E 3SNBA 3LGTA 1ZRKA 1TA6A 2BDAA 4I33A 1S82A 2R2MB 1W0ZU 2PKAA 3VXEH 1HJ8A 2JH6D 2BY5X 1WUNH 2EA3A 2KR7A 1UJ1A 3VFEA 2KCOA 5C20A 3QTOH 1S6LA 4ABJA 1FN6A 3BIUH 2AIQA 2O8UA 2ZGXH 3SHAH 5E2OA 3N7OA 3F9HA 1V2NT 4ZMAH 1GBMA 1LPGB 4IS5A 1VR1H 2GCTB 2BX4A 3IG6B 5EPYA 2XBVA 3MU4A 1V2TT 2PUQH 1AWHB 1TIOA 1O37A 2HVYB 2EEKA 4B2AA 2G4UA 2GCTC 1MABB 1TNKA 2QIQA 1D6RA 3A81A 1P57B 1S6FA 3RU4T 3HK3B 3UNRA 1BRBE 1O2IA 1O2QA 3L33A 3Q76A 1P06A 2L74A 4CREA 1NT1A 1S81A 1HFDA 2BD2A 2ZGBH 4AB9A 3E8LA 3TNTA 1XKAC 1O30A 3ATWA 4Y11E 4ZKOU 3KQ5A 1MD8A 4FVDA 5FHTA 3N7EA 2JIZD 2VH0A 1PPBH 5HMAA 1GVLA 5J4SA 3GCOA 4U01A 3V13A 3OFND 5A2MH 1SLUB 2A4GA 1OX1A 1MAYA 1LHGH 3U1IB 1SGDE 3BF6H 5JB9S 2PWXA 1CU1A 1WTGH 1FDPA 4ABBA 1IOEA 3KEEA 2JH0D 3M61U 5A0CA 4Y0ZE 3TJNA 1QJ1B 2PGBB 2Q1JA 1CBWB 1HAZB 2PW8H 4TPIZ 4FUCA 4VGCB 2W7UA 1D4PB 2GKVE 3BTTE 1J16A 1X7AC 2RA0A 1ZTJA 5C2ZA 1GDUA 1LHFH 1P2OA 2L6OA 1CBWC 1QY6A 1AN1E 3M7UA 2A0QB 1QGFA 4P00A 1O3DA 4VGCC 4CRBA 2OQ5A 1GHYH 1NU7B 2XBWA 2BQ7B 1GHWH 1MKXH 2ZGJA 4THNH 1H8DH 1GPZA 3E1XB 2TGAA 1BA8B 1S83A 4K1TA 1TPPA 4CRDA 1FI8A 1QBOA 1G9IE 3PWBA 2BLWA 2P59A 1C5ZB 3FANA 1HAPH 4IW4E 4RN6A 2CF8H 4HZHA 3BSQA 1O5EH 1BQYA 2BHGA 1ZHMA 1Q2WA 3SQHE 8LPRA 5CHAB 3T2NA 1KXCA 3HATH 4I8KA 4XE4A 4JK6A 5B6OA 1O2MA 3VB6A 1DFPA 1QA7A 2EI7A 5CHAC 3TH4H 2FX4A 2W6JD 1AFEH 4AYYB 3BTEE 1F5RA 1BJUA 1D3QB 4YZUA 3E0NB 1TBRH 2V3OH 1FN8A 1GBAA 3MYWA 3UIRA 4LOYH 3OX7U 3ELAH 2EY4C 1SL3A 3W1EA 4F48B 5FX5A 3AVZA 2GD4B 4SGBE 3ZVDA 3ZVAA 2ZDKA 1PQAA 1L0ZA 1L2EA 4Z0KA 2KCYA 4WXVA 1HYLA 2AMQA 2F9OA 2BVSH 1S84A 1GI6A 2KAIA 4ZHAA 1NFWA 4MNYA 4B73A 1GJ5H 2QCYA 4HI3A 1TRMA 1O5GH 1E35B 3OY5U 1VZQH 1GI1A 1WAYB 1ZJKA 4OM9A 5EJLA 4BAQB 1C1MA 3EA8A 1LQEA 4K2YA 1HAOH 2BD8A 3M37A 1P02A 1RGQA 2C3SA 3FO8D 4BAMB 2IN2A 2ZCKP 1K22H 1TYNA 1KXAA 2FI4E 1E0FD 2ZFRH 4UFDH 3AK5A 1ZOMA 2AFQB 4Z1MD 3LU9B 1FY1A 2GTBA 5K7RA 3FN8A 3FFGA 1V2WT 4TWYA 4K60A 1FIZA 1YPHC 3A7YA 2PGQB 1HGTH 4B2CA 1VGCC 2ZGCA 1OP8A 3STJA 1WXRA 1OS8A 3UQOA 1IQIA 1MTUA 4M9FA 4FUFA 1S0QA 1C1UH 1GJ7B 2V3HH 1K1PA 1WCZA 1ZGIA 4JZFH 1RFNA 3ZIAD 1EB2A 1EXFA 1SQRA 2V3MA 1YPJH 1EPTB 1QA0A 2HNTF 4OS5A 3SI4H 1H1BA 1A4WH 1T7CA 2FESH 2AHME 5J4QA 5T6DA 2Y5HA 5EODA 1FQ3A 1FAXA 1NFXA 2F9NA 3S7HB 1EPTC 2HPQH 2UWPA 1K1JA 1LO6A 1YLCA 2ZHFH 4MNWA 3RU4E 3I29A 4A7IB 1NBME 3I77A 2HLCA 2LPRA 5C1XA 2QV1A 3LPRA 4ZUHA 4F4OC 3UREA 1C1RA 2Y6TA 1ARCA 1LHCH 1ZSKA 3F3BA 1KIGH 1KXEA 3A87A 3H5CB 3OY6U 1ZHRA 4YOGA 2HNTE 3PTNA 5EXNA 1VCWA 4NIWA 5FXLA 4INHA 3EYDA 2R0KA 2GJGA 3GY8A 6LPRA 1AFQC 1CE5A 1MBQA 1GDQA 4Y7BA 4ZH8A 3PMJA 4E7RG 1BTUA 1EAIA 2G55A 3IITA 3VXFH 4Y0YE 1EJAA 2WUBA 5EG4A 2NU0E 3U8TH 3TJUA 1O38A 3SO3A 1BTYA 5DK1A 3BG8A 1SGIB 4Y6DA 1ZMNA 1XUJA 9ESTA 3LT3A 2ZU2A 1PFXC 2ZTYA 1MCVA 2EQNA 3GDSA 4NIVA 1YYY1 1NFYA 1E36B 3HPTB 4X8TH 4WJG2 3M3SA 1GBLA 2ZFSA 4WXIA 2H1UA 1G2LA 1O2PA 3LGIA 3SOSA 1SGFG 1O2ZA 1C5OH 3RXLA 3LGWA 3QDZB 5AFZH 1MH0A 1SGNE 1S85A 1BBRH 1YKTA 2ZU1A 1UK4A 2AMPA 1YCPH 1C1WH 1UW7A 5IYTA 1CHOF 1E1RD 3GCHB 2FPZA 3ODFA 5PTPA 3WWFA 2ASUB 2VIOA 1NRSH 2OTVA 2D1JA 3E91A 2VWOA 5EOKA 1G2MA 1K28D 1SLWB 3GCHC 4CHAB 3RC4A 3ATIA 3HKJB 3P92A 4RKOB 1SC8U 1CT2E 1IQGA 3ZZBA 2Z6BD 1OSSA 3HGNA 1BZXE 3KYFA 5CHBA 3TITA 1O2XA 2D8WA 5DSFA 3K6YA 3VGCC 3SZEA 1Z1JA 2BD5A 2ZF0H 2J95A 3TVJB 1TGTA 5F53A 2D2DA 3RXUA 5LPRA 1QCPA 4TT3D 3Q3XA 3A85A 1DM4B 1GI0A 1SMFE 4K1EA 4Y8YA 2FM2A 3BTFE 2QC2A 1TNJA 2WZQA 2WV9A 2VGCC 1IQFA 1BTPA 1KXFA 1MU6B 3BTKE 2AMDA 2OUAA 1FMGA 4D8NA 3M5LA 4ZXYH 3LH3A 3TGIE 3ZZ8A 2P3TB 2F9PA 3MMGA 4H42U 3EAJA 4X0WU 1F5LA 4NWKA 1C9PA 2GGVB 3A82A 4XBBA 5LPFA 2NU3E 4X8UH 1C4U2 3SU1A 1NZQH 1O3NA 5DP9A 1GDNA 2QY0B 1GBEA 2R2WU 3PLBA 1GI2A 1MKXK 2WPKS 3TK6A 2J98B 1A0HB 3NKKA 1EAUA 1ZLRA 2QXGA 1GJ9B 1VCPA 2TBSA 1BITA 1UTQA 1GI8B 5IDKA 1Y59T 1OWIA 1FIWA 2KX4A 1C2GA 3FOAA 1K2I1 1Y3WA 3ZZAA 3FZDA 1TGNA 1GBBA 1BTHH 1TNGA 1ZPZA 4AX9H 2SFAA 4R0IA 2IPQX 1QRZA 2OLGA 1BCUH 2XRCA 2CXVA 4GHTA 1QTFA 4LXBH 3ZZ3A 2ZP0H 1P3CA 2PUXB 4FUIA 2A2QH 1WSSH 4B6FA 1GMDF 2C8YB 1SFQB 4PROA 3LOXA 4UDWH 2CHAC 4YLUA 1TBZH 1EZUC 1GVZA 2OD3B 3SJ8A 1W3CA 2P16A 1DE7H 1HB0B 3A86A 2XWAA 1INCA 5ESTE 1GMCF 2H9HA 4Q2KA 1KXDA 2GT8A 2XC4A 4X1PU 3TK9A 4Q7XA 1KSNA 3G01A 5B6LA 1HAXB 4KP0A 4R8TB 3E6PH 1O3HA 3QLPH 2ZFTA 1C1QA 1LVMA 2P8OB 1LVBA 2CGAA 1ELTA 4ZKNU 1CHGA 1V2OT 1ACBE 2J2UA 3T29A 3MO3A 2G4TA 5C0UA 2P8OC 1MQ6A 2GCHF 1NC6A 1OWJA 3S9BA 1F0UA 2QE7D 1B7XB 1ZPCA 2ZIQH 1ZHPA 2THFB 2SGPE 2AIPA 1C5PA 2PSYA 3RXFA 1YC0A 1TMUH 2BDBA 1BHXB 1FY8E 4B6EA 1H4WA 1C5SA 2WV5A 1QB6A 2QF4A 3P8GA 1BMLA 3EA7A 4FUEA 3UFAA 5H4IB 4DT4A 4X8VH 5A09A 5HM9A 3GY4A 5GWZA 2XTTB 1IQMA 2J34A 3ITIA 1VITH 1Z7KA 3RXBA 2YOLA 1SQTA 1MZDA 1WBGB 1K1IA 1WYKA 2PFEA 2Y81A 3MH6A 3VEQB 1C2IA 3SJOA 4Q80A 1RD3B 1BRCE 2ZDMA 3DA9B 1MTVA 3O8CA 2SGAA 1CT0E 4O97A 5T6FA 2A32A 2A7CA 4LZ1H 4A5TS 2KM0A 3U98H 1GGDB 2W5EA 4GSOA 1GMDG 2PV9B 3PTBA 1EUFA 1LMWB 2VIQA 3M5OA 3MH4A 3SGBE 2ZQ1A 1E1QD 1Y8TA 2BXUH 1TPSA 2BLOA 4AYVB 2ODQA 4A1TA 1NM6A 1AUJA 5DN6D 1O5AB 1GMCG 4UE7H 2F9BH 3LJOA 1C1OA 1Z8RA 1TA2A 1KXBA 1NESE 4Y79A 5F6MA 4IN2A 4Y7AA 2KCPA 1F0SA 3GDUA 3WY8A 1GBDA 1UTLM 3M36A 1F7ZA 5HYOA 3JZ1B 1XUKA 4MLFB 1OYTH 3SUFA 1CA0B 2QF5A 3TJVA 1EB1H 3RXMA 4ABAA 4DOQA 3ZZ6A 2BM2A 2GCHG 2UUKB 1D6WA 4O03A 3PMBB 1O32A 4FXGH 5K0HA 3F2GA 1CA0C 1ZMJA 2DE8A 2FZZA 1BBRK 1MKWH 2PSXA 1YCPK 2ULLA 1GJ8B 2JJ1D 1ABJH 1P10A 2B5TB 1QQ4A 3ATMA 3GCNA 1D3DB 1EP6A 1AU8A 1TGSZ 3DCLA 1GHBF 3ZZ9A 2XCFA 2AS9A 3BTME 3GICB 5FBIA 3RXVA 2P95A 2TPIZ 2VJ1A 4DT7B 4ZKSU 1ZJDA 3VG8A 4CH2B 5SGAE 1UK3A 5L2ZH 1XUIA 1C1SA 3EE7A 1AWFH 2M2AA 2XC0A 2OINA 3BG4B 2UWOA 1C2HA 2BDHA 4K8BA 4ABFA 1TX7A 4AOQA 4K8YA 4BTTB 1HAVB 3LGUA 3MI4A 4AGJA 1CGHA 2IJD1 2FWWA 1QFKH 3SU4A 3BG4C 2FI3E 3KN2A 2OP9A 2BZAA 1FPCH 3SN8A 3E90B 5ETXA 3AW1A 4D9QA 1HNEE 2FODA 3GYLB 2NU4E 2ANYA 1SFIA 2ZECA 3A7TA 5EGMA 4E06H 1TGCA 2G5NA 1B0FA 2ZQ2A 1DLKB 1SPJA 2Z9GA 1C4Y2 3OSYA 2AH4X 2I6QA 2TRMA 4NGAH 7ESTE 1F0RA 3W94A 1RRKA 2HALA 3A7XA 3ZZCA 1HPGA 4YT7H 1SG8B 1MQ5A 3RXEA 1GBJA 3I78A 3GDVA 4A92A 1YGCH 1YLDA 5FPTA 1V2QT 1MTNC 1MZAA 4XDEA 5JYIA 2NWNA 3WW7A 1ZZZA 1A0JA 3S9CA 7GCHF 2PR3A 1SGQE 3H09A 1T8MA 4JZEH 1H9HE 1BMMH 1QB1A 4JYVH 4UFGH 2GT7A 2XCNA 2RCEA 2XNDD 1ZTKA 4Y8ZA 3B23B 3PLPA 5BRRE 3MWIU 3SNAA 1VJ9U 1L4ZA 3GOVB 3C1KA 4Q4LA 2V0BA 4MQAA 1JIMA 3BEUA 1IQKA 1V2MT 1SOTA 1O3LA 4NCYA 3LDXH 3UR6A 1N1LA 3DUXH 4NA9H 1V6DA 1O2KA 1JOUB 2OBOA 4DVAU 2JKHA 3MO9A 1HRTH 2ZFPH 4FUDA 1ZPBA 4DCDA 3NPSA 4FUGA 1O3AA 2ANWA 3KIDU 1MBMA 3URCA 3UWIA 1Q3XA 1BIOA 1D3TB 2PTNA 3PV4A 2LNCA 1W7XH 3PV5A 3LH1A 3CP7A 1TQ0B 2FOEA 4H6SB 3VB7A 2VWLA 1KY9A 2ANMH 5DJ7A 1QURH 3TH3H 3P95A 3MH5A 3VB4A 1EZQA 1JIRA 1TABE 4Y71A 1M9UA 1J8AA 2OC7A 3GY7A 3RXQA 1NY22 2B9LA 1N6YA 1DWBH 3LC5A 4JZIA 4YOJA 2QAAA 3O8DA 2H5CA 1P8VC 4JZDH 3M7QA 1P11E 1P2MA 1O39A 1TBQH 3B8JA 2QF3A 2ANKH 1DPOA 4ABDA 1GI7B 2QA9E 2YMSB 3TLOA 1P9UA 1ARBA 1W2KH 1OWDA 1AVGH 4O3UA 4BAOB 3N7DA 4ISIH 2HLDD 3FVFB 3DFJA 1LHDH 2YMSC 1W7GH 1LPZB 3QGJA 1SOZA 4X6NA 2ZHEH 4A1VA 2BY9X 2GV7A 1C5TA 4KKDA 1FXYA 4GCHF 1DXPA 1ELDE 1EOJA 3ENSB 3V3MA 3RU4D 1BJVA 1NBMD 3OYPA 4O3TA 3AAUA 3SV8A 4ISNA 3RXDA 3ZV8A 4YOIA 3QN7A 7GCHG 1O3IA 2C93B 2BY7X 4Q7ZA 2O8MA 3RMMH 2ZCHP 1G36A 3RXCA 4AFUA 1A0LA 2HRVA 2WUCA 4B1TA 5C5OA 1A5HA 5EQRA 2KFWA 1GHVH 2A7HA 1O2JA 1C4V2 1HLTH 1ANBA 1AUTC 4OS7A 5A8XA 1G37A 1AD8H 1VGCB 1ELVA 1ANCA 2NU2E 2ZDNA 3ZVEA 1GCDA 1KDQB 3SORA 4UFFH 3SZNA 1FY3A 2BD9A 1EQ9A 3A84A 1LTOA 2FOGA 4K1SA 1P2IA 1A7SA 1SGRE 1TX8A 1OPHB 1DSTA 2DUCA 1O33A 4WVPE 4IC6A 4BAHB 2ZU5A 4YM9A 1HAIH 4XSKU 2W7SA 1D9IA 1H8ED 2A4OA 3S69A 4BXWA 1KLJH 2UUJB 4AB8A 5EJ1A 1C2JA 1TPAE 2HOBA 1UTMA 1W13U 1P2JA 1J17T 2B7DH 1SLVB 1AQ7A 2RFKC 1HJAC 1OHHD 2Z7FE 1AO5A 2FP7B 3Q77A 3PLKA 5GXPA 2G8TA 3WWBA 1A3EH 4RT1A 4TYDA 4X2VA 4IGDA 2XYAA 2FDAA 3N99A 2V7QD 3GY2A 2Y5GA 2LELA 1TWXB 5DG6A 1TE0A 2VIVA 4QT8C 4U32A 2JETB 4ACAA 1AFQB 1WU1A 2VVUA 2A31A 5TCAA 1K1OA 1SGPE 4K3JA 1BRAA 2JH5D 1T4UH 4ZKRU 1SGTA 1HAVA 2JETC 1ESBA 2TGTA 1UCYH 3HK6B 1MKWK 1THRH 3MNXA 4GCHG 4ISHH 3ZZ4A 1FZZA 3S9AA 3MNBA 3UNQA 3P17H 2YNAA 3LJJA 1WQVH 4X1QU 1S6HA 5A0BA 2H9TH 3NUMA 2GDEH 1Z8JB 4KTSA 3TH2H 3OTJE 3SYJA 4B76A 1AE5A 1EKBB 4TPYA 7LPRA 1ZSJA 1B5GH 1O3GA 2QF0A 3MFJA 1BT7A 2OK5A 3MH7A 5DO4H 3F1SB 3TPIZ 1Z8IB 2CV3A 1V2PT 4ZCNA 2K0QA 1N8OB 2YNBA 3LIWA 1A5GH 1O2GH 3M5NA 4GUXA 5T6GA 1K9OE 4OGXA 4I7YH 2RA3A 2PLXA 1MTWA 1UVSH 3FZZA 4WY3A 1N8OC 1QNJA 1Z1IA 4ABEA 4LK4A 4FETA 2BDGA 4GAWA 3NCLA 4NZLA 5E0GA 1GJ4H 3RXSA 4AFSA 1XUFA 1S5SA 1UHBB 1SGEE 3O8BA 3VGCB 5BPEA 3SUEA 3MTYA 3DHKH 1GL0E 1OWHA 3IWMA 3TIUA 1ELFA 2FOCA 2YMSD 4AFQA 2B0FA 4WMFA 1PPEE 3TGJE 4NIXA 1FLEE 1THPB 1C2DA 1ABIH 3BV9B 1P2QA 5LH8A 1VKYA 1WOFA 1Z71A 1C5MD 2Z3EA 4B75A 1EASA 4MNXA 4NSYA 1VJAU 1BRUP 1H9IE 2V6NA 2VGCB 2V35A 1SR5C 3HGPA 5C5NA 2J92A 1O2LA 2O8TA 1HXFH 4K69A 1A46H 3QGNB 3KGPA 3SHCH 3M3TA 1A5IA 3DD2H 2Z94A 4RT0A 4X6OA 1GJDB 2ZG0H 1GHAF 2WHXA 3VB5A 3RMLH 3A7ZA 5L2YH 1W14U 2WPIS 1XVMA 2VH6A 5DGJA 2H9EH 1BTWA 4O9VA 1TFXA 3EE0B 3ESTA 3URDA 4CR9A 2TGDA 2VNTA 2XWBI 1WTHD 3RUOA 3L6PA 2C8XB 4B74A 1O3PB 1O3EA 3U9AH 5DP7A 2BDCA 1C1VH 1GCTB 1WDIA 3RMOH 3TNSA 1W12U 4MNVA 3AASA 5EU8A 4ISOA 1O36A 1UVOA 3V0XA 1GCTC 2P3FH 2XBXA 3M3VA 2VWMA 1C2KA 1C2LA 5GCHF 5A8ZA 1O3BA 2RG3A 2PHBA 4I31A 1UVPA 1K0HA 1G3EA 1O2YA 1CHOG 1DWEH 4MPVA 2FS8A 1BB0B 1EZSC 2ZWLH 2CHAB 2BDYA 1QL8A 1C2EA 1EJNA 2JJ2D 3PMAB 3CS7A 1CT4E 2C8ZB 2BQWB 4FUJA 3K65B 2K8IA 5FPSA 1TX6A 4IMZA 1KDQA 3U8RH 1BUIA 2XXLA 3SUGA 3K2UA 4XD7D 1O3CA 1A2CH 3CNRA 2WPMS 4KTUA 8ESTE 1CQQA 4NZQA 1Z6JH 3SU6A 1HIAB 1O2UA 1IAUA 1G3DA 2J4IA 1HXEH 1GMHF 3P8FA 1GI3A 1H8HD 1T32A 1FJSA 4M7GA 2ZU4A 2QXIA 3A8BA 1HCGA 1EPTA 2QYIA 1LVOA 3D65E 1TQ7B 1GHAG 1O2WA 2GDDA 5DKMA 1G30B 9LPRA 4INLA 1E79D 4ABHA 2FIRH 1YPHE 1FY4A 1A1RA 2FI5E 2J97A 4XBDA 1AE8H 1EATA 5DP6A 1HBTH 3T28A 1TOMH 1JWTA 1AB9B 1O3KA 1ETTH 2R3UA 2ZPRA 3DFLA 1Y3XA 2FOHA 3LGVA 1S0RA 3RDZA 1NS3A 2NU1E 1BMFD 3SJ9A 3SUDA 3BN9A 3E3TA 2K1QA 3L3TA 4AC9A 1AB9C 3A7WA 4BOHA 2GVFA 2CJIA 1O5DH 2BD3A 1C5QA 5C3NA 3DSPA 2SGDE 4X8SH 1EP5A 1GJBB 2D26C 1G32B 1FONA 5GNDA 3LONA 1ELEE 1GJ6A 5L30H 3UAIC 1PJPA 1V2RT 3OAAD 3F0PA 3MNSA 3RXGA 2ZGHA 1ORFA 2GZ9A 1JMOH 2BLVA 3OU0A 3UQVA 1C1TA 5ABWA 2VINA 1QQUA 2SGFE 3PB1E 1T31A 3E16B 5TCCA 2UWLA 2WPDD 1C5UA 1TMTH 4MPUA 2ALVA 1UCYK 1TOCB 4D7FA 3UWJH 3S7KB 3STIA 4OS4A 2G5VA 3MU8A 3SJIA 4NIYA 1YF4A 3T25A 2XOKD 2EI6A 2Z9LA 1BDAA 3MQKC 5KEDA 4BANB 5C1YA 4BTIB 1Y3YA 2ODPA 3ZVCA 2VWNA 4RI0A 3JZ2B 1MTSA 1OP2A 3EA9A 4IN1A 2ESTE 2FTLE 3BTWE 1YLNA 3PWCA 3KQBA 4F49A 1L1NA 3P70B 4WH8A 1DICA 1IQJA 3AAVA 1LQDB 4FOUC 4XBCA 1NRNH 1IQEA 1C5NH 3UOPA 4K5ZA 4MG3A 1RTKA 3K9XB 2KCAA 4YLQH 1OOKB 3M5MA 5F03A 3U1JB 3MU1A 5HGGA 1KTSB 3VB3A 4B71A 5CDFE 1PYTC 1T8OA 5LGOA 1V2ST 2I6SA 3BTGE 1O2OA 1Y3VA 2M5TA 3A80A 5EPNA 5I25A 4NG9H 5C94A 1SGCA 1L1GA 1O31A 2Q6GA 1K1NA 4U2WA 1DWCH 3EGKH 1P03A 4AG2A 2QN5T 1SVPA 2HNTC 1W11U 4NFEA 1FPHH 4I8HA 4I8GA 1W0YH 4TSFD 2G81E 2AGGX 5A8YA 1YPKH 2J38A 2P93A 2ZEBA 1ETSH 5LPEA 2J98A 1JXPA 2R0LA 2IOTA 1Q31A 2F9UA 3TJOA 2OC1A 2FOAA 4AORA 1UO6A 3RC5A 1SB1H 1V2LT 1FUJA 2FLRH 1JRTA 2A5IA 3TU7H 1EAWA 4BAKB 3A7VA 4MPWA 1W0KD 3SU3A 1VITF 3FP6E 2SNVA 1F0TA 4WMDA 1K1MA 3KCGH 1BMNH 1O5FH 1CVWH 3SU0A 3Q3YA 4H4FA 5JPMH 3NRLA 3SV9A 1AVWA 1GHXH 4TY7A 2KZ4A 5EW1H 3RLYH 1MTNB 2QGRA 1V2KT 3ZVGA 1SQAA 1TONA 5A0AE 1TRNA 1Y3UA 3SGAE 8KME2 1TLDA 2C8WB 2G00A 1SSXA 2IPHA 4CH8B 1KLIH 4I86A 3HKIB 2Y7ZA 1Y5AT 4GPGA 3V7TA 5TJXA 3P8OA 1SQOA 5IK2D 3SNEA 1HIAA 2A7JA 3PRBA 2GX4A 2F4LA 2FS9A 3FAOA 1MCTA 3BTHE 3F2FA 2ZHWH 3NXPA 1MAXA 4NWLA 3RM2H 1QR3E 1TB6H 1SKYE 1DUAA 2P3UB 1UTJA 1QBVH 2CN0H 2F3CE 3KL6A 2ZHQH 3SU5A 1GBFA 1DDJA 4OS6A 1GHBG 1QL9A 1C5RA 2XNIA 1LHEH 4D9RA 4RSPA 2FX6A 2Z9IA 2FLBH 2Z9JA 1ZGVA 4Q7YA 4GHQA 3UY9A 1BOQA 1RJXB 4IMQA 2F43B 2WINI 3RXRA 1XXDA 1QRXA 4I8LA 2GZ8A 2W6ID 3PV2A 4KGAA 1YP9A 1AY6H 2AERH 3BIVH 2VIPA 1O2SA 5F8XA 1K1LA 2W3IA 3QK1A 2Y80A 1ZR0A 4JMYA 3OE7D 3ZVFA 1HV7A 1YWUA 1YPEH 1QB9A 4Q63A 1YBWA 2ZPSA 1PPFE 1BHXF 5JDUB 5FPYA 2XW9A 1YM0A 2FXRA 5DP5A 1O3OA 1VITG 1H8IH 1QIXB 6GCHF
chains in the Genus database with same CATH topology
5FCRA 1ELGA 4ZHLU 2ZI2H 1AI8H 2AGEX 3RC6A 1OP0A 2ZCLP 5JBBS 2VB0A 1P05A 5ESBA 1B0EA 1OWKA 3ZZ5A 4AG1A 2ZDLA 3T62A 5E0JA 1NTPA 1UTOA 3BTQE 4BXSA 1PYTD 3Q3KA 1O3JA 3E0PB 4TWWA 1V3XA 5GDSH 2RDLA 1DSUA 2FEQH 2H6MA 4JYTA 2AEIH 1DY9A 1P04A 2UUFB 3SV7A 1ESAA 3F68H 2ZHDA 1T8NA 1W10U 4AN7A 4KTCA 1AMHA 4TY6A 1UTNA 3BEFB 5CMXH 1C9TA 2C90B 1IQHA 1O5BB 2A45B 4JK5A 2IJOB 3QZRA 2OC0A 2ZDVH 3BEIB 2GMTB 1DXWA 3KNXA 3U69H 1PPZA 2FOFA 2VVVA 4I8JA 5C67A 1E34B 1MMJN 2Z9KA 5E2PA 1HJAB 1NO9H 2GMTC 3RP2A 8GCHF 2FO9A 4GVUA 1SGFA 1AZZA 1HDTH 1ZMLA 5I46H 4UEHH 1DS2E 1GBTA 4UFEH 2BMGB 1F2SE 1DT2A 1FV9A 4Z6AH 2A4QA 1GJCB 1BTZA 2A5AA 1DWDH 3CENA 3LC3A 3SI3H 4CBNA 4ESTE 3PROA 4AFZA 4AGKA 3P8NA 3F9EA 4DG4A 1NPMA 2Z3CA 2ZA5A 3T26A 3QO6A 2G52A 5F8ZA 1AZ8A 3KF2A 1RIWB 1XXFA 1OKXA 1EAXA 6GCHG 2F83A 3GYMA 1O3FA 1SI5H 2HGTH 1V2VT 1YPMH 2ZPQA 1TRYA 3GCTF 2Q6FA 4RKJB 1GI4A 1PPHE 4MPXA 1RIWC 3T27A 3SBKA 2Y5FA 3FP7E 2CF9H 1DVAH 1QL7A 2BY6X 4X6PA 3K6ZA 2BD7A 2BVRH 1CGJE 3SW2B 1NRPH 1LVYA 1Y5UT 1RS0A 4CRCA 4JYUH 5DPAA 3ZYEA 3RXAA 3PYHA 1O2TA 1QBNA 4IBLH 1BTXA 1QJ7B 3GY6A 1C1PA 1C5XB 1YPLH 1OYQA 1L4DA 5JB8S 1XMNB 1EJMA 4DJZB 2EC9H 1P9SA 1T4VH 1UMAH 5HM2A 5CE1A 3S0NA 5G4BA 1EX3A 2PKSB 2TIOA 1ZSLA 1O34A 2AGIX 1HAGE 3V12A 3PM3A 2ZDAH 1C1NA 2XBYA 4UONA 6CHAB 5GPIB 2HWLB 4Y8XA 1HAHH 2FOBA 2PKSC 4X6MA 4CRGA 5AF9H 1J9CH 1D3PB 1ZRBA 4D76A 5GJ4B 3ZZDA 1C5VA 5FCKA 1GBIA 6CHAC 1TNLA 3RXIA 4YTAA 8GCHG 1XKBC 5AFYH 1Z8GA 3SNCA 3UR9A 5FAHA 3ZVBA 4HFPB 4Y76A 5C1UA 1UTKA 4D7GA 4ZXXH 4ZAEA 4FUHA 3B9FH 4YT6H 1O0DH 3A8DA 1K21H 3DT0H 3EDXB 3SU2A 2ZO3H 1N6XA 3MO6A 1ZTLA 4WF8A 4XOJA 1IHSH 1DLEA 1RTLA 1P2KA 1KTTB 1GBHA 1PPGE 1JBUH 1THSH 2OBQA 3KQDA 2STBE 4E7NA 4J2YB 2B8OH 4HTCH 4ISLA 2BZ6H 4OS2A 3MOCA 4MDSA 1O2RA 1G3BA 1MU8B 1P01A 3NZIA 1KYNA 4DIIH 2ILNA 1AKSB 1XX9A 3ODDA 1SHHB 3GCTG 2Q6DA 1H9LB 3UPEA 1GWAA 2OCVB 2VIWA 4CHAC 4A6LA 2BY8X 1GI9B 1Z6EA 3R3GB 3MU0A 1V2JT 4OS1A 3RXTA 1NFUA 2CMYA 3KQCA 2J9NA 3D49H 3F6UH 3VPKA 1SHYA 1NROH 1XVOA 2BX3A 5JBCS 4DGJA 4FU7A 1E37B 4FU8A 1CO7E 2WPJS 1PQ8A 2A1DB 2QXJA 1W8BH 5EXLA 1NRQH 1A61H 4U30A 1ESTA 4X2YA 2ZTXA 3UTUH 2PKAB 1C2FA 2XC5A 2WPHS 1IQLA 3TK5A 3ZV9A 3H7TA 7KMEH 1SBWA 1EZXC 2SGEE 1ID5H 3RXKA 3A88A 1FNIA 2TGPZ 1LKAA 5JBTA 2ZNKH 5DP3A 5JBAS 1L1JA 2HVXA 2W3KA 5FBEA 4AZ2B 4WWYA 2ALPA 1NN6A 3RMNH 4DIHH 1QRWA 2WPLS 2GZ7A 3RXJA 1XUGA 1CA8B 4HGCA 1IQNA 2VVCA 2Y82A 3CS0A 1UCYE 1TALA 3QWCH 1IHTH 4BNRA 3RXPA 2F9VA 1DUEA 3F9FA 1OWEA 1YCPM 2H2ZA 2A2XH 1ANDA 1QJ6B 1FAKH 1OXGA 1TAWA 3A8AA 4X1RU 1SGYE 1MUEB 3F9GA 4IC5A 1G3CA 1PPCE 2DE9A 4ABIA 1TMBH 1P3EA 1TGBA 3H7OA 2STAE 4FVBA 2EI8A 1DITH 3W95A 1U6QA 1XUHA 3SQEE 1C2MA 1GJAB 2SNWA 4SGAE 4DW2U 3QTVH 2AYWA 1UVTH 4JCNA 3NK8A 1NRRH 3C27B 1O3MA 4ZROA 5EQQA 2FOMB 3SJKA 1WQSA 4DY7B 2J94A 4CRFA 1E38B 1C5LH 1EOLA 2O9QA 2BB4A 1ETRH 5DP8A 4NFFA 1BBRE 4NA7A 2Z3DA 2VU8E 1A3BH 4A1XA 4ASHA 3ZYDA 2ODYB 3PO1B 5EXMA 1RTFB 1NU9A 4KELA 1ELAA 3MNCA 1O35A 4BTUB 2FYRA 1RXPA 2R9PA 1BMAA 1UTPA 3T5FH 1ZYOA 5FX6A 2GP9B 3A89A 3PO1C 5L6NH 2BOHB 4X2WA 3U8OH 3EQ0H 3UOUA 1WV7H 3ATLA 2BQ6B 2WYGA 1FY5A 1AIXH 1YPGH 1SLXB 3Q00A 1V2UT 1T8LA 1ANEA 1GVKB 1P2NA 3RM0H 2O8LA 2H5DA 3GY5A 3R0FA 1PQ7A 4DURA 2QXHA 4YESB 2ZKSA 4FU9A 1GL1A 5GCHG 2BTCE 1J14A 4JZ1A 1LPKB 1F5KU 2F91A 2ZFFH 4OGYA 4MTBA 4FUBA 2A5KA 1ELCA 3SGQE 1VCQA 2BVXH 1O2VA 3D62A 1O5CB 3O8RA 1O2NA 3ZZ7A 3LGYA 2Y7XA 3RXHA 1CGIE 3A8CA 2FTMA 1LCYA 1P12E 2ZTZA 3RXOA 4CRAA 2BDIA 3TGKE 1DX5M 1UVUH 3P6ZB 4YO9A 1GBKA 1P09A 1C5YB 1ELBA 4J1YA 1GG6B 2OC8A 1O2HA 2OXSA 4WH6A 1HUTH 2BYAX 1LKBA 4WMEA 4LZ4B 1F92A 1GMHG 2BLQA 2ZU3A 5AVDA 3BTDE 3M35A 4B2BA 1GG6C 1LDTT 3GY3A 1QHRB 1J15A 1GHZA 3QZQA 1UHBA 4ABGA 6ESTA 1GI5A 5T3HA 3UUZA 2R3YA 1DY8A 4CBOA 4E05H 1CSOE 3MHWU 4MVNA 2VIDA 2C4FH 2KAIB 3AW0A 3KHVA 1C5WB 2GV6A 3ATKA 4GLYA 1GGDC 2A4RA 2W26A 2BXTH 4XFQA 5HXFA 3A83A 1TPOA 1DANH 4H6TA 4X1SU 2SGQE 3NWUA 5E0HA 5EQSA 2ZZUH 5E8EH 3SV6A 3QX5H 3M7TA 1XM1A 2ZFQH 2O8WA 4UD9H 4NSVA 4I32A 5DP4A 1Y5BT 1KLTA 3LKWA 4X2XA 1HJ9A 2P94A 3QUMP 3UNSA 1AKSA 1TNIA 2BD4A 4Y10E 2G51A 1UK2A 3KQEA 5AHGH 1GBCA 5GIBA 3SV2H 1PQ5A 4ZHMU 3D23A 3RLWH 1AHTH 5EW2H 4NA8A 3SNDA 1MD7A 2UUYA 1P0SH 2BOKA 4INKA 1AVXA 5F8TA 1JRSA 2WV4A 3PMHB 2FMJA 4CR5A 2ZC9H 1DOJA 1AGJA 2HPPH 2WYJA 2OQUA 1TNHA 4X1NU 3GISB 2FYQA 2PTCE 3MU5A 1HAYB 3FP8E 3SNBA 3LGTA 1ZRKA 1TA6A 2BDAA 4I33A 1S82A 2R2MB 1W0ZU 2PKAA 3VXEH 1HJ8A 2JH6D 2BY5X 1WUNH 2EA3A 1UJ1A 3VFEA 5C20A 3QTOH 4ABJA 1FN6A 3BIUH 2AIQA 2O8UA 2ZGXH 3SHAH 5E2OA 3N7OA 3F9HA 1V2NT 4ZMAH 1GBMA 1LPGB 4IS5A 1VR1H 2GCTB 2BX4A 3IG6B 5EPYA 2XBVA 3MU4A 1V2TT 2PUQH 1AWHB 1TIOA 1O37A 2EEKA 4B2AA 2G4UA 2GCTC 1TNKA 2QIQA 1D6RA 3A81A 1P57B 1S6FA 3RU4T 3HK3B 3UNRA 1BRBE 1O2IA 1O2QA 3L33A 3Q76A 1P06A 4CREA 1NT1A 1S81A 1HFDA 2BD2A 2ZGBH 4AB9A 3E8LA 3TNTA 1XKAC 1O30A 3ATWA 4Y11E 4ZKOU 1MD8A 4FVDA 5FHTA 2VH0A 1PPBH 5HMAA 1GVLA 5J4SA 3GCOA 4U01A 3V13A 5A2MH 1SLUB 2A4GA 1OX1A 1MAYA 1LHGH 3U1IB 1SGDE 3BF6H 5JB9S 2PWXA 1CU1A 1WTGH 1FDPA 4ABBA 1IOEA 3KEEA 2JH0D 3M61U 5A0CA 4Y0ZE 3TJNA 1QJ1B 2PGBB 2Q1JA 1CBWB 1HAZB 2PW8H 4TPIZ 4FUCA 4VGCB 2W7UA 1D4PB 2GKVE 3BTTE 1J16A 1X7AC 2RA0A 1ZTJA 5C2ZA 1GDUA 1LHFH 1P2OA 1CBWC 1QY6A 1AN1E 3M7UA 2A0QB 1QGFA 1O3DA 4VGCC 4CRBA 2OQ5A 1GHYH 1NU7B 2XBWA 2BQ7B 1GHWH 1MKXH 2ZGJA 4THNH 1H8DH 1GPZA 3E1XB 2TGAA 1BA8B 1S83A 4K1TA 1TPPA 4CRDA 1FI8A 1QBOA 1G9IE 3PWBA 2BLWA 2P59A 1C5ZB 3FANA 1HAPH 4IW4E 4RN6A 2CF8H 4HZHA 3BSQA 1O5EH 1BQYA 2BHGA 1ZHMA 1Q2WA 3SQHE 8LPRA 5CHAB 3T2NA 1KXCA 3HATH 4I8KA 4XE4A 4JK6A 5B6OA 1O2MA 3VB6A 1DFPA 1QA7A 2EI7A 5CHAC 3TH4H 2FX4A 1AFEH 4AYYB 3BTEE 1F5RA 1BJUA 1D3QB 4YZUA 3E0NB 1TBRH 2V3OH 1FN8A 1GBAA 3MYWA 3UIRA 4LOYH 3OX7U 3ELAH 1SL3A 5FX5A 3AVZA 2GD4B 4SGBE 3ZVDA 3ZVAA 2ZDKA 1PQAA 1L0ZA 1L2EA 4Z0KA 4WXVA 1HYLA 2AMQA 2F9OA 2BVSH 1S84A 1GI6A 2KAIA 4ZHAA 1NFWA 4MNYA 4B73A 1GJ5H 2QCYA 4HI3A 1TRMA 1O5GH 1E35B 3OY5U 1VZQH 1GI1A 1WAYB 1ZJKA 4BAQB 1C1MA 3EA8A 1LQEA 4K2YA 1HAOH 2BD8A 3M37A 1P02A 1RGQA 2C3SA 4BAMB 2IN2A 2ZCKP 1K22H 1TYNA 1KXAA 2FI4E 1E0FD 2ZFRH 4UFDH 1ZOMA 2AFQB 3LU9B 1FY1A 2GTBA 5K7RA 3FFGA 1V2WT 4TWYA 4K60A 1FIZA 1YPHC 3A7YA 2PGQB 1HGTH 4B2CA 1VGCC 2ZGCA 1OP8A 3STJA 1OS8A 3UQOA 1IQIA 1MTUA 4FUFA 1S0QA 1C1UH 1GJ7B 2V3HH 1K1PA 1WCZA 1ZGIA 4JZFH 1RFNA 1EB2A 1EXFA 1YPJH 1EPTB 1QA0A 2HNTF 4OS5A 3SI4H 1H1BA 1A4WH 1T7CA 2FESH 5J4QA 5T6DA 2Y5HA 5EODA 1FQ3A 1FAXA 1NFXA 2F9NA 3S7HB 1EPTC 2HPQH 2UWPA 1K1JA 1LO6A 1YLCA 2ZHFH 4MNWA 3RU4E 3I29A 4A7IB 3I77A 2HLCA 2LPRA 5C1XA 2QV1A 3LPRA 4ZUHA 4F4OC 3UREA 1C1RA 2Y6TA 1ARCA 1LHCH 1ZSKA 1KIGH 1KXEA 3A87A 3H5CB 3OY6U 1ZHRA 4YOGA 2HNTE 3PTNA 5EXNA 1VCWA 4NIWA 5FXLA 4INHA 3EYDA 2R0KA 3GY8A 6LPRA 1AFQC 1CE5A 1MBQA 1GDQA 4Y7BA 4ZH8A 3PMJA 4E7RG 1BTUA 1EAIA 2G55A 3IITA 3VXFH 4Y0YE 1EJAA 2WUBA 5EG4A 2NU0E 3U8TH 3TJUA 1O38A 3SO3A 1BTYA 5DK1A 3BG8A 1SGIB 4Y6DA 1ZMNA 1XUJA 9ESTA 3LT3A 2ZU2A 1PFXC 2ZTYA 1MCVA 3GDSA 4NIVA 1YYY1 1NFYA 1E36B 3HPTB 4X8TH 4WJG2 3M3SA 1GBLA 2ZFSA 4WXIA 2H1UA 1G2LA 1O2PA 3LGIA 3SOSA 1SGFG 1O2ZA 1C5OH 3RXLA 3LGWA 3QDZB 5AFZH 1MH0A 1SGNE 1S85A 1BBRH 1YKTA 2ZU1A 1UK4A 2AMPA 1YCPH 1C1WH 5IYTA 1CHOF 3GCHB 2FPZA 3ODFA 5PTPA 2ASUB 2VIOA 1NRSH 2OTVA 2D1JA 3E91A 2VWOA 5EOKA 1G2MA 1K28D 1SLWB 3GCHC 4CHAB 3RC4A 3ATIA 3HKJB 3P92A 4RKOB 1SC8U 1CT2E 1IQGA 3ZZBA 2Z6BD 1OSSA 3HGNA 1BZXE 3TITA 1O2XA 2D8WA 3K6YA 3VGCC 1Z1JA 2BD5A 2ZF0H 2J95A 3TVJB 1TGTA 2D2DA 3RXUA 5LPRA 1QCPA 3Q3XA 3A85A 1DM4B 1GI0A 1SMFE 4K1EA 4Y8YA 2FM2A 3BTFE 2QC2A 1TNJA 2VGCC 1IQFA 1BTPA 1KXFA 1MU6B 3BTKE 2AMDA 2OUAA 1FMGA 4D8NA 3M5LA 4ZXYH 3LH3A 3TGIE 3ZZ8A 2P3TB 2F9PA 3MMGA 4H42U 3EAJA 4X0WU 1F5LA 4NWKA 1C9PA 2GGVB 3A82A 4XBBA 5LPFA 2NU3E 4X8UH 1C4U2 3SU1A 1NZQH 1O3NA 5DP9A 1GDNA 2QY0B 1GBEA 2R2WU 3PLBA 1GI2A 1MKXK 2WPKS 3TK6A 3NKKA 1A0HB 1EAUA 1ZLRA 2QXGA 1GJ9B 1VCPA 2TBSA 1BITA 1UTQA 1GI8B 5IDKA 1Y59T 1OWIA 1FIWA 1C2GA 1K2I1 1Y3WA 3ZZAA 3FZDA 1TGNA 1GBBA 1BTHH 1TNGA 1ZPZA 4AX9H 2SFAA 4R0IA 1QRZA