2TGDA

Lack of the transition state stabilization site is a factor in the inactivity of trypsinogen, a serine protease zymogen. structure of dfp inhibited bovine trypsinogen at 2.1 angstroms resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
222
Chain Sequence
VGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Lack of the Transition State Stabilization Site is a Factor in the Inactivity of Trypsinogen, a Serine Protease Zymogen. Structure of Dfp Inhibited Bovine Trypsinogen at 2.1 Angstroms Resolution
rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 47
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1986-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tgdA02
2A4OA 2Y5FA 2CJIA 4MNYA 1V2OT 4K8YA 2A45B 2H9TH 2Z6BD 3LGIA 3UIRA 1BTXA 1C5YB 4Z0KA 2AEIH 3MNBA 3M5NA 3H7OA 2JETB 3SUGA 3DUXH 5A0CA 1C1NA 1TALA 2BD3A 1THPB 3GOVB 1TMUH 2FDAA 2JKHA 1YLDA 5E0JA 3A81A 3MNXA 3PMJA 3A88A 3VXEH 1SGNE 3NWUA 2R3UA 4WVPE 4FU7A 3E91A 3KQEA 3T28A 3VEQB 3GY5A 1DDJA 1TPAE 2FX6A 1ZMJA 2ASUB 2NU2E 2FX4A 1E37B 3D62A 2WYJA 3ZZ3A 4MDSA 3RXLA 2Y5GA 1ZRKA 3GCNA 1S82A 1NT1A 2OINA 1DM4B 4FUFA 1UVSH 3B8JA 4IGDA 2CXVA 2STBE 1A5IA 1EAWA 1GDQA 1GMHG 3BTTE 2P3FH 2VGCC 3SGAE 3MU8A 3FZZA 3RDZA 2EC9H 5GXPA 1LPZB 1O3JA 2Z7FE 2QAAA 3SU0A 4AFUA 1SGPE 2ZFRH 1A3EH 5HM9A 3UOPA 1A0HB 1C5LH 3S9CA 3DFJA 5EQQA 5L30H 1NU9A 1W8BH 3RXEA 1GI5A 2P59A 6CHAC 1YPHC 2QIQA 3O8CA 1QHRB 1YPHE 1JMOH 1LVBA 1ZPBA 2HNTE 5DP3A 4KP0A 3RMMH 1SLWB 1UCYK 2FP7B 1A46H 3A82A 3E0NB 1RS0A 2EA3A 1T7CA 4WWYA 1HIAB 1ZPZA 1Y3XA 2PKAB 2ZU4A 2K1QA 1LQEA 1NS3A 2GMTC 1C1OA 4B2CA 1ANCA 3SUDA 1GHWH 3A7YA 4CRGA 4JCNA 3SI4H 1NC6A 4BAOB 1PPGE 3RXJA 3CS0A 1BRAA 3AW0A 2XC5A 3SJKA 2FIRH 4NFEA 5EODA 4AN7A 1YLCA 2ZFFH 1P05A 2ZHEH 2BMGB 3ZVGA 3ATIA 4A1TA 4ABDA 1AMHA 1TQ7B 5F8TA 1WTHD 3G01A 4CRFA 4INHA 4OS5A 1Y3YA 5GDSH 4Y8ZA 1L1JA 3SU4A 4ZKRU 1KTSB 2GZ8A 3LKWA 2BXUH 1EZQA 1MAXA 3PMAB 2BZ6H 1JIMA 3A8DA 4K60A 4ISLA 3IWMA 1MCTA 1ZSJA 3TGKE 2FODA 2GT8A 1O3NA 1P2JA 1AI8H 1Y5AT 3F6UH 3KL6A 2UUYA 8KME2 3ZZAA 1HAVB 1Y8TA 3SNDA 4K5ZA 1V2WT 4YT6H 1RIWC 1DITH 1VJ9U 1GL1A 3MTYA 1C1SA 1H4WA 2BY6X 3P70B 5K7RA 1W0YH 5A8XA 2RDLA 1QA0A 4AORA 4X8SH 2O9QA 1BTWA 3M5OA 3BN9A 2FTMA 4DIIH 3QTOH 1O2NA 5EQRA 1FI8A 3DD2H 3UR9A 2F9PA 1TFXA 1DXWA 5A09A 4WH6A 3M61U 2GCTB 1O5EH 1XX9A 3O8RA 4ASHA 1HAPH 5T3HA 4A1VA 1AB9B 1ZOMA 3F9GA 1IQNA 1L4ZA 2ANMH 3QZRA 1AVXA 3LDXH 3Q3YA 4UE7H 4NA8A 2ZDNA 3MH7A 4FUEA 1UTLM 2OXSA 2SNVA 2RG3A 5J4QA 2UWLA 3GCTF 4Y79A 1PPFE 3FZDA 1XUKA 1O2OA 1AUTC 1MU6B 1S84A 2O8LA 1K2I1 2XBXA 3A83A 3ZZ4A 3RC6A 3AVZA 3BTQE 1P10A 1V2QT 5A0AE 3SU3A 1TNLA 1HAYB 1KLIH 2C4FH 2Q6GA 1HAGE 3K6ZA 2OP9A 1P03A 3MU5A 1EUFA 3RXVA 1SGFA 2A32A 2BD5A 4X1RU 1KLTA 1Y3VA 2AGEX 3P95A 2AS9A 1C5TA 2Y80A 3HKIB 2SGQE 1N6XA 3A87A 2H6MA 1QBVH 3ODFA 3RU4E 4CRCA 1C5ZB 1HJ9A 3BG8A 5TCAA 1RJXB 3Q00A 2BY8X 1AUJA 5G4BA 2QY0B 2LPRA 3SU2A 2TGPZ 1H8IH 4NWKA 1QNJA 3EE0B 1GJ6A 2C8ZB 5FPYA 3RLYH 2FI5E 1A0JA 3TK5A 1G2LA 2B5TB 2F3CE 1QL8A 2IJOB 3BG4B 4CREA 2O8UA 3GISB 1O2VA 1WBGB 3SU1A 1AVGH 1F5KU 3SU5A 1O5BB 1YPMH 4GAWA 2BY7X 1GI1A 1P0SH 1EJMA 1ELGA 1RTKA 2UWOA 3M3TA 3FP8E 2OQUA 1N8OB 1UVPA 1Q31A 2XXLA 4FXGH 1TX8A 2G55A 1VCPA 2R0LA 5AHGH 3VFEA 1WV7H 4TYDA 4LOYH 4VGCB 2BX3A 4ABIA 1TGSZ 1ZSLA 4SGAE 1IQFA 2Q1JA 1CSOE 5F03A 2CF9H 1O3OA 3LGYA 1IHSH 2OCVB 2ZEBA 2C8WB 2AMPA 2ZPRA 1NRPH 1H9HE 1YPEH 2BD9A 3MWIU 5HMAA 5LGOA 3MMGA 1T8NA 4OS2A 2VIPA 1GHXH 1C4U2 1GDUA 2ZTYA 4ZKSU 2ZFPH 1F2SE 1L0ZA 1TAWA 2A2XH 1GBAA 3IITA 1T4UH 2BLWA 5HXFA 4DW2U 1C2FA 1AWHB 5EGMA 2HOBA 4Y7BA 2ODYB 5LPRA 2D8WA 2HPPH 4GHTA 2Z94A 3DHKH 2G81E 5GPIB 1IHTH 1IQEA 3LJOA 5GIBA 3MYWA 4IMZA 1SFIA 1F5RA 3SJ8A 4DY7B 2GGVB 1ZSKA 1QL9A 3LU9B 4BNRA 1BRUP 1MKWH 2D26C 2ZGHA 5DGJA 4NZLA 3LIWA 3RXBA 3W95A 4E05H 1O34A 2BDAA 3RXHA 2IN2A 2Y6TA 4MVNA 1UVUH 2KAIB 1QBNA 3BEUA 1FONA 1E38B 2PKSC 2ODQA 1ZGIA 2AYWA 4Y0ZE 5AF9H 2TGDA 3UR6A 2H9HA 5HM2A 3A7WA 4AB9A 2W26A 1SMFE 1OSSA 3SV9A 2H5CA 1UTNA 4HFPB 2WV4A 1O2HA 4FUIA 1BMLA 1UTPA 4X2XA 4OS1A 1IQLA 1JIRA 1O2JA 3LONA 3ZVCA 3DFLA 4XBBA 1JXPA 2P3TB 2FO9A 1G3EA 1ID5H 4ABJA 1SOZA 3F1SB 2A1DB 1HYLA 4AFSA 2BLOA 3U9AH 4CHAB 4UFFH 2FOAA 4BANB 4KTCA 2PTCE 3CP7A 1OKXA 1EP6A 5EU8A 1O3PB 1Z6JH 5JB8S 1J16A 1Z8RA 4PROA 2DE8A 1EJAA 4AB8A 3F9FA 1VGCC 4Q2KA 2ZECA 3TVJB 1ETSH 5ESTE 4HGCA 3RXRA 2VH0A 4UFDH 1BRBE 3W94A 4BAHB 1S6FA 4D9RA 3U69H 1UVTH 1SPJA 3NCLA 4FUHA 2ZZUH 1GBDA 1SHHB 1FMGA 1UVOA 2VNTA 5EQSA 1AKSB 3F9EA 1G3CA 4NZQA 1O3LA 3HPTB 5E0GA 5DP9A 5CMXH 4D8NA 1TYNA 1GMCG 1O2TA 3SGQE 3GY2A 2BZAA 1EAIA 1SGCA 1W7XH 1Z8IB 4F4OC 1AY6H 5E2OA 5C5NA 4TWYA 1TNJA 1O2MA 3BF6H 3TIUA 2BLVA 2OC8A 5EPNA 3GY4A 1OWJA 4R0IA 3QDZB 3SJIA 4X6NA 2V3HH 5TJXA 4H6TA 2WPJS 2VVUA 5A2MH 1K22H 1YYY1 2ANKH 2M5TA 1W12U 2Z9KA 1RTFB 4J1YA 4NIYA 4ZUHA 4K8BA 3UTUH 3MO9A 1CQQA 3GDSA 1GHBG 3RC5A 1D4PB 4DVAU 3L33A 1E36B 2R2WU 1FY8E 1CGJE 1SG8B 1AFQC 1IOEA 3E0PB 1TA2A 2PTNA 4XDEA 3I29A 3TPIZ 1LTOA 3BTEE 1C4V2 1WQSA 4JYTA 4RKOB 1GHBF 1PPEE 4XBDA 2FPZA 2FI4E 3QTVH 4DG4A 1CA8B 3BTDE 4U2WA 1DSTA 3PLPA 1CU1A 1NRRH 5DK1A 1O3CA 3U1IB 2Z9IA 4WY3A 1DWCH 1LMWB 1K1PA 2ZFQH 1XM1A 3T29A 2VGCB 1ZTKA 1KDQA 1O3KA 2W5EA 3RXOA 1RTLA 3K2UA 3RXCA 5EW2H 1BUIA 3TNSA 1DOJA 1TQ0B 3LC3A 2AGIX 2XCFA 1JBUH 2D2DA 3ATMA 3MI4A 1O3AA 2WPLS 1BBRH 1BZXE 1OS8A 2PR3A 2YOLA 6CHAB 1D3PB 7GCHG 3EAJA 4ZROA 1C5WB 4ISHH 1IQKA 2BVRH 3S69A 5FCKA 1DWBH 2ZDMA 2ZDKA 4WXIA 5B6OA 3BSQA 2GX4A 4JMYA 7GCHF 1TNIA 3SUEA 2BOHB 1UHBA 1ZMLA 4TPYA 1Z7KA 1TX7A 1L1GA 1SFQB 3QGNB 3RXIA 2GMTB 4TPIZ 2BXTH 3E3TA 1QL7A 1TGNA 3M7QA 2XTTB 1Z6EA 3NZIA 2OBOA 2H2ZA 4AG2A 5L2ZH 3A7VA 4Y8XA 2BX4A 4H6SB 4XSKU 1ZLRA 1UJ1A 3RUOA 2THFB 4JZIA 2RA3A 4DIHH 1GHZA 1C2DA 3SI3H 1AO5A 5PTPA 1TOCB 1TNGA 3QK1A 2ZQ1A 1GMDF 1C5SA 3SUFA 4GPGA 2V0BA 2VIQA 1V2ST 1HBTH 1OOKB 3GY6A 1UK3A 3BTME 1GVKB 3SNCA 1QJ7B 3A89A 2ZHQH 1DWDH 3M36A 1XUGA 1SGDE 1OX1A 1O30A 4CH2B 1NFYA 1GG6C 1Z71A 1BTYA 3E1XB 1Y59T 1V3XA 3EGKH 3GCOA 3RMOH 1FY4A 1K28D 5C20A 5JYIA 5LH8A 1CGIE 5JBCS 2P16A 2ZU5A 4WMFA 4X6OA 1HXFH 1MD7A 3IG6B 3HGPA 3SU6A 5DP7A 3HK6B 1VCWA 1NO9H 1O39A 1RIWB 1EPTA 3F68H 3LGUA 1W7GH 1V2LT 4K3JA 4MNXA 5SGAE 5JBTA 1HNEE 4Q7YA 1XXDA 3U8RH 3H7TA 4I8HA 2F9NA 3P17H 4IN1A 1HAXB 4RKJB 2FLBH 2J95A 3RMLH 1AN1E 4I8LA 3GDUA 1D9IA 2G00A 4K69A 1A1RA 2Y5HA 2O8WA 3GYMA 2Z3EA 1TWXB 3UY9A 3PB1E 2EI7A 1DXPA 1HIAA 1QCPA 4LXBH 2PKAA 1A61H 1F7ZA 4DJZB 1NFUA 1SLXB 1MCVA 2XW9A 3EA8A 4F49A 2BTCE 1FAKH 4KTSA 5F6MA 1FUJA 3KQBA 1GGDC 1P8VC 2XWBI 2RCEA 4B71A 1ARBA 1ZHPA 3SQHE 1X7AC 1Y5UT 2PUXB 3ODDA 1MZAA 2SGFE 4Y76A 2FMJA 3TH3H 4MPXA 3QX5H 1SQTA 3A85A 3SBKA 4BXSA 1IQJA 1BRCE 1GCDA 4ISNA 5AVDA 3Q76A 2HNTC 1YC0A 3TJUA 3SHCH 1CGHA 1G2MA 2A5IA 3A86A 5DKMA 1D3QB 1O3FA 1PQ8A 2BDIA 1NFXA 3ZZ6A 1SB1H 4ZHLU 2F83A 1AQ7A 4OS6A 1F5LA 2QGRA 1ABIH 1QA7A 1C2HA 2V35A 1GBCA 2AIQA 3STIA 1AHTH 2HGTH 2ZPSA 2BDHA 4ABHA 1ETTH 1HCGA 1VR1H 2BDGA 1EX3A 1IAUA 4MG3A 2ZNKH 1SGQE 5TCCA 1T8LA 5FAHA 1P06A 1QGFA 2SGEE 2ZCLP 2GV7A 1K1JA 2JH5D 1A5GH 1OPHB 1K1MA 2D1JA 2ZCHP 3ZYEA 4NIWA 1UTJA 1AVWA 1C1MA 1E35B 1HGTH 3QO6A 2FESH 4NIVA 3PO1C 1QB9A 3MO3A 1ETRH 1UCYE 1LPKB 2VVVA 4ZKNU 1KXFA 3T25A 1C1PA 2UUFB 3VPKA 1YM0A 1FN6A 3MU4A 4ABFA 4YESB 2A4GA 3UOUA 1D3TB 2FZZA 5FBEA 5FX6A 3F9HA 3KEEA 2FOBA 2VINA 4AZ2B 4GUXA 1Z8JB 3M5MA 4IN2A 3PM3A 2VWNA 1BMAA 4OGXA 1S81A 1K9OE 2JH0D 1QRWA 1NPMA 3LPRA 1P2MA 1ACBE 1MTSA 9LPRA 2WUCA 5C1XA 3R0FA 2XBVA 1MTUA 2OC1A 2ILNA 3P92A 1KSNA 1O35A 2ZU2A 4ABEA 3FANA 1O3HA 2BD8A 1W11U 1O2YA 3RXMA 5FXLA 1GI9B 1P02A 3GY7A 2A5AA 1TX6A 2BQWB 1FXYA 3M3VA 1ZZZA 1TBZH 3B23B 2G4TA 4GSOA 3LGWA 4WF8A 4UFEH 1K1IA 1C2EA 1PFXC 2H1UA 3SJOA 4X8UH 1FDPA 2ZC9H 1WQVH 3GCTG 1AIXH 1HAZB 2BYAX 2XBYA 1Q2WA 2R0KA 1YPKH 4CRBA 4X1SU 3KIDU 1WU1A 1TPOA 1LHGH 1C1UH 2J34A 1QY6A 4ZXXH 4ABAA 2Z3CA 5C67A 1TIOA 1TGBA 3S0NA 1YP9A 1LVYA 2AERH 1NRQH 1DUAA 3E16B 4ZHAA 2XRCA 3OX7U 1L2EA 3OTJE 4Q7ZA 1P2QA 3URCA 5ETXA 1GJAB 2HWLB 1EPTC 7KMEH 2CF8H 3TLOA 2VIWA 1GBFA 3M37A 4X6MA 4YM9A 2PKSB 2BD2A 4B74A 5FBIA 4BXWA 2Y82A 1ZJKA 1ARCA 3BTWE 3K6YA 3PROA 5I46H 1A4WH 3MH4A 2BQ6B 1W14U 2R2MB 3QWCH 2PW8H 1P11E 1GPZA 1JRTA 3NXPA 1ELBA 1B5GH 1ZMNA 3UNRA 5EW1H 4FUDA 2ZDLA 2ZF0H 4FVBA 3RXTA 3RU4D 3ELAH 3SV2H 3TJVA 1LKAA 1P09A 3C1KA 1EB1H 1PQ7A 1W3CA 1O3IA 3VGCC 1ELDE 1NRSH 4RN6A 3S7KB 2HNTF 1GHVH 5A0BA 2P93A 2WYGA 2AGGX 4K1EA 3FAOA 1RRKA 4YTAA 1V2KT 1YPGH 2BVSH 1HAOH 1O37A 2FYRA 1VGCB 2B0FA 1QFKH 1BTUA 3PTNA 1F0TA 5FPSA 4YOJA 1TMBH 3RM0H 3MU0A 4THNH 2F9UA 4I7YH 4B75A 2Y81A 2A7JA 5I25A 2H9EH 1QJ6B 3BIVH 4OS7A 4I33A 1G30B 2J2UA 3A80A 3GCHC 4ABBA 2C90B 5DO4H 4MNWA 1BB0B 2ZGJA 1C2GA 2ZIQH 2KAIA 1C1TA 4FU9A 5DPAA 1OYTH 1DS2E 5JBBS 1NRNH 1TOMH 3BEFB 1TABE 4Y71A 1MTNC 1O5DH 3TJNA 2G4UA 3VB6A 4H42U 1Y3WA 1QQUA 3EDXB 1TRMA 1O2XA 1KXCA 3L3TA 2FEQH 4CBNA 1BIOA 1W10U 2CN0H 3RXPA 1G37A 3ZZ8A 1E0FD 1GI7B 5T6DA 1S0RA 2SGPE 1GCTC 3SV6A 2NU0E 2Q6DA 3AASA 1NROH 1AFQB 4ZH8A 1TGTA 3PWCA 4TY7A 1T4VH 1L1NA 1AE8H 1GJCB 4CRAA 3P8FA 5CHAC 1F0SA 2FM2A 1GI3A 4BTTB 3RC4A 2NU4E 2GVFA 4A92A 1P12E 1AE5A 2TGTA 2ANYA 3RXSA 3RMNH 1J9CH 1CBWC 1C2MA 1J14A 2ZDAH 1TRNA 1WCZA 3TK6A 3V0XA 3FP7E 1GBMA 3ZYDA 4NGAH 3ATWA 3P6ZB 3RXKA 2ANWA 2ZHWH 1N6YA 3DT0H 1C5UA 2B8OH 1SBWA 1HV7A 4BOHA 1MKWK 1FQ3A 2PV9B 4NCYA 5IDKA 2W3IA 5DJ7A 3STJA 3S9AA 3ENSB 1FV9A 2VWOA 3QUMP 5LPFA 3UUZA 2OQ5A 2ZQ2A 2F91A 1D6RA 3DA9B 2CMYA 1EXFA 4INLA 1VITH 3VB7A 1O3EA 1GHYH 4X1QU 3K9XB 1HRTH 1DVAH 4NSVA 2PHBA 3KF2A 4Y11E 2WPHS 5H4IB 1G3BA 1THRH 1WYKA 4FUCA 4KTUA 2DE9A 1F0UA 2Z9LA 3EQ0H 1P2KA 1SGIB 1NU7B 1J15A 1BTZA 1NN6A 3GY3A 1HAHH 4BTUB 1BMMH 1GL0E 3MH6A 1H9IE 4OS4A 2ZTXA 2ZG0H 1PJPA 1BHXF 4XE4A 1B7XB 2QXHA 5LPEA 2WPKS 2QV1A 2ZFTA 1QRXA 6GCHF 1O5GH 1KYNA 1P9SA 3HK3B 5C2ZA 2QXGA 5E8EH 2GZ7A 1S85A 4DT7B 1O2GH 4AGJA 2ZHDA 4DCDA 1DLKB 2XC0A 4IC5A 5EG4A 2P94A 1SSXA 3A84A 2B7DH 1O2RA 3TK9A 1GG6B 3A8BA 4MPUA 1MU8B 2I6QA 3LC5A 5AFZH 1O2WA 3T5FH 1C2KA 1VCQA 2BDYA 1B0EA 2GP9B 5L6NH 1DPOA 5JPMH 1D3DB 4IMQA 3UWJH 3WY8A 2QC2A 1SQAA 2QXJA 1OWHA 4GVUA 2FS8A 4BTIB 2F9BH 2NU3E 1THSH 5C5OA 1GBBA 1U6QA 1A5HA 5DP8A 6LPRA 1OP0A 3O8BA 1KXEA 1QIXB 2ZGXH 1ELTA 1CA0C 1KIGH 1OWEA 2BDBA 2VU8E 3RP2A 1E34B 3PYHA 1EZUC 1ABJH 3LJJA 2DUCA 3SQEE 1EOJA 1O2LA 2A2QH 3PMBB 1EAXA 1O2KA 1GGDB 2AIPA 2WPMS 2G5NA 3FVFB 3A8AA 1GI6A 3TU7H 4IC6A 1RGQA 3ZZCA 2HVXA 1GJ4H 4XOJA 4B2BA 1FY5A 4NA7A 1BTHH 2UWPA 2C3SA 3A7ZA 1LHCH 3LH3A 2ESTE 1M9UA 1O5AB 3SNBA 5DG6A 4D7FA 1XMNB 4A7IB 1ELFA 4ABGA 1CT0E 3S7HB 1XUJA 1GJ7B 1Y5BT 1O31A 1V2NT 1PQAA 1BBRK 1H8DH 4LK4A 1C5QA 2Z3DA 1UK4A 1MKXH 1FY1A 2ZP0H 3FFGA 4WH8A 2NU1E 5T6GA 1KXDA 1JOUB 1KTTB 3KGPA 2AMDA 1GMDG 1C5MD 4ZHMU 3PWBA 2A7CA 1SGEE 2W7UA 5HGGA 4XFQA 5F8XA 1HXEH 1LCYA 3PO1B 1KLJH 3KHVA 1O2SA 1P2NA 1C5VA 1FPCH 1PQ5A 1G36A 2FOGA 4FUBA 1GDNA 5DP6A 5BRRE 1C1WH 1KDQB 1C5XB 1DLEA 1DY9A 3O8DA 1INCA 1EQ9A 1EAUA 1FIZA 3ZVBA 1ZPCA 2P95A 3UQOA 2VIVA 3TGJE 2VWMA 1EKBB 1OYQA 4WJG2 3NKKA 4CBOA 1J8AA 1FJSA 1C1RA 4CR9A 5AFYH 1UTOA 1BOQA 3RXQA 4JK5A 4GHQA 1IQMA 4O3UA 3BTHE 1MH0A 2GCHG 2J94A 4XBCA 4B1TA 4Y6DA 4D76A 1VITG 2V6NA 2ZU3A 1OWDA 2GDEH 4O3TA 1SHYA 2P8OC 1XVOA 5F8ZA 1DY8A 1CO7E 1YCPH 2EEKA 5EPYA 1UHBB 2GCHF 3A7XA 4IBLH 2CGAA 3TNTA 1VITF 2R9PA 2ZWLH 2OTVA 2UUKB 1EATA 1RXPA 1H1BA 1O2IA 3MH5A 1EB2A 1SGFG 4OGYA 2EI6A 1EP5A 4YT7H 4INKA 4D7GA 1L4DA 1DE7H 1CE5A 4ZKOU 1P3EA 1LVMA 3KCGH 1A3BH 1HJAC 2OC7A 2QYIA 4CR5A 5E0HA 1TPSA 1MBQA 2STAE 2ZFSA 3ZVAA 1YCPK 3M7UA 3ZZ9A 1UMAH 4R8TB 1HJ8A 2Y7XA 1AWFH 1ZHMA 4DOQA 4NA9H 4MPVA 3TH2H 4ZMAH 2NWNA 1G32B 2TBSA 1T8OA 4I8KA 3AAVA 4B76A 2QXIA 1WAYB 1NM6A 3M5LA 3N7OA 1H9LB 2G52A 3M3SA 5FPTA 4U01A 4JYUH 2SGAA 7LPRA 2FXRA 1VJAU 4FVDA 1V2JT 3P8GA 1MBMA 1DX5M 2F9VA 4JK6A 3MFJA 3V12A 4IS5A 1GBJA 1QR3E 3UWIA 1C2JA 1WUNH 2A31A 2G8TA 2F9OA 5C1YA 1UCYH 1GMHF 4UFGH 3SOSA 1EPTB 3SORA 4AG1A 1BHXB 2XC4A 2O8TA 1YCPM 4AFZA 1GBTA 2CHAC 3SN8A 2XBWA 1DICA 1IQHA 4ZAEA 2SFAA 1NFWA 4X2VA 2FYQA 2A4QA 1ELVA 8LPRA 1YBWA 1HAVA 1O5CB 2WINI 4I31A 2QN5T 2SNWA 1MQ5A 4NIXA 3PMHB 1O2ZA 2ZTZA 2FOMB 1ANBA 3BTGE 3TGIE 3LT3A 2BOKA 3GDVA 1KXAA 4FUJA 4B2AA 4AYYB 3BTFE 3PTBA 1LPGB 4E7NA 3ZV9A 2Z9GA 1XKAC 2XWAA 3M7TA 9ESTA 3RXFA 3QN7A 1ZHRA 2J9NA 3ZZ5A 1HUTH 1V2PT 1CVWH 3VGCB 4YO9A 3URDA 4MNVA 1EZSC 2OC0A 4RSPA 3ZVDA 3LGVA 1KXBA 1PPBH 1O3GA 3B9FH 3SV7A 1GI2A 1QQ4A 1TONA 4U30A 1EJNA 4WXVA 1BA8B 2PFEA 2PLXA 1V2UT 1ZRBA 4GLYA 2ZCKP 4CRDA 3D65E 1YGCH 8ESTE 1RD3B 3NK8A 3S9BA 1BCUH 3V3MA 5JB9S 2TIOA 1O32A 1PYTC 4HTCH 1P57B 4QT8C 2JETC 1K1OA 4Q7XA 3T2NA 1FPHH 3MNSA 1BQYA 1C5PA 3GCHB 2AFQB 1K1NA 1SI5H 1T31A 4NFFA 3U8TH 1KY9A 2JH6D 3EA7A 2HALA 5FHTA 1XVMA 1PYTD 1ZGVA 4KGAA 1MZDA 1MTNB 3FP6E 3PLKA 5FCRA 1XUHA 3ZVFA 1O2UA 1JRSA 1BITA 2FOEA 1C9TA 1D6WA 3I77A 1QJ1B 1O3BA 2I6SA 2UUJB 1OP2A 1TRYA 3MNCA 2FS9A 1QB1A 1GCTB 1A7SA 2A4RA 2BM2A 2VJ1A 3MHWU 1BJUA 1MTVA 2TGAA 4O97A 4MQAA 4UDWH 8GCHG 1GI8B 2VVCA 2IOTA 1IQIA 1TE0A 5CHAB 4D9QA 1GBEA 3E6PH 1GBIA 3EYDA 3RXAA 2V3OH 1NESE 1ZJDA 4HI3A 2C8YB 1PPHE 3MOCA 4AFQA 4YOIA 4E06H 1TMTH 2VIDA 2ZGBH 1FN8A 8GCHF 1P04A 1CBWB 2GZ9A 3QGJA 2FTLE 1LHEH 4AYVB 6ESTA 2BD7A 3UREA 1ELAA 3V13A 3SV8A 1O36A 1F92A 2PGQB 3R3GB 4O03A 1ZYOA 4X2YA 1MD8A 1MMJN 1ESTA 1GBHA 1MQ6A 3BTKE 3I78A 3K65B 1C5NH 1HPGA 2FI3E 1LO6A 2WUBA 5A8ZA 1BMNH 2XNIA 2GD4B 1TBRH 4Q80A 2H5DA 1T32A 1QBOA 1RFNA 4K2YA 3ITIA 4A5TS 4KELA 2A7HA 1XUFA 3E90B 3E8LA 1G3DA 3L6PA 3OYPA 3ZZ7A 5CE1A 1LVOA 4X8TH 1F0RA 2J92A 1V2MT 1Z1IA 1ZR0A 2PSXA 1NZQH 2ZI2H 4AGKA 3LH1A 4Y7AA 3GICB 3T26A 2XCNA 3OY5U 3RXUA 3U8OH 5DP5A 4MPWA 2OD3B 5ABWA 2Z9JA 2BHGA 4X6PA 3VXFH 5EOKA 3TJOA 5T6FA 3ESTA 2ALPA 1TBQH 2C8XB 4UONA 1HDTH 1AU8A 1C4Y2 2O8MA 3VB3A 1IQGA 2Q6FA 2AH4X 1S6HA 3Q3XA 3KN2A 1O38A 3ZZBA 1SGYE 2IPHA 1GJ5H 1V6DA 4SGBE 1LQDB 5HYOA 4JZ1A 1YPLH 4J2YB 1QTFA 5IYTA 4O9VA 1S83A 5C3NA 4JZEH 3D23A 3HGNA 3MU1A 4A1XA 3OU0A 5DP4A 1C1QA 2QF3A 3SW2B 2BY9X 1A0LA 4X1NU 1O3MA 2ALVA 5GJ4B 1ANDA 1WSSH 4BAQB 3HATH 3ZV8A 3CENA 2PUQH 4K1TA 4CH8B 3MO6A 1QURH 2ZPQA 4FUGA 3KNXA 3V7TA 1BJVA 3ATLA 3SZNA 1MUEB 3Q3KA 2GT7A 2GCTC 3D49H 1OXGA 1C9PA 1AGJA 1ELCA 3OSYA 4IW4E 3QZQA 1EZXC 1FY3A 3RXGA 4AOQA 5JBAS 2ZGCA 2A0QB 1HFDA 1P01A 3SNEA 1AB9C 4DGJA 4JZFH 3RLWH 5E2PA 3SGBE 7ESTE 2QF0A 2P3UB 1K21H 1ESBA 1Z8GA 1HB0B 1CA0B 3ATKA 1UTKA 2VH6A 1SOTA 1WOFA 1ESAA 2LNCA 1GJBB 5JDUB 1P2OA 1TLDA 1ORFA 1J17T 2VWLA 1FIWA 1EASA 1DANH 1GHAG 2A5KA 1SC8U 3UNQA 1O2PA 2ULLA 4I8JA 2VB0A 3H5CB 3JZ1B 3GY8A 1B0FA 1N1LA 1SR5C 1LHDH 5ESBA 5BPEA 1LKBA 2OUAA 1GHAF 2ZKSA 2FWWA 2PGBB 2TRMA 1AKSA 4BAKB 4ISOA 4X2WA 4NSYA 4Y8YA 2RA0A 1TB6H 3CS7A 1MAYA 2BY5X 2QA9E 1C5OH 2FOFA 3AAUA 1AZZA 3P8OA 4MTBA 1OWIA 4ESTE 3U1JB 4X1PU 1G9IE 3EA9A 1QRZA 1FAXA 2Y7ZA 4UD9H 1DT2A 2J4IA 4GCHG 4WMDA 2AMQA 3KQCA 5GWZA 1UK2A 1ANEA 6GCHG 4E7RG 3GYLB 1K1LA 1ZTLA 2R3YA 2C93B 4GCHF 3OY6U 4K1SA 2ZDVH 2HRVA 1QB6A 4Z6AH 1FZZA 1O0DH 1NY22 4WMEA 1S0QA 3BG4C 2YNBA 1S5SA 2FOHA 2PSYA 2QCYA 1SVPA 3QLPH 1AZ8A 1P9UA 2FOCA 1GI0A 4M7GA 3A8CA 1VZQH 2GKVE 2HPQH 1HAIH 1N8OC 1W13U 4LZ1H 1OP8A 1O33A 1MTWA 4I32A 1Z1JA 1LDTT 3BV9B 4A6LA 3UPEA 1WTGH 3NPSA 2W3KA 4I8GA 4VGCC 1T8MA 3RU4T 4BAMB 1XUIA 5A8YA 2YNAA 1UTQA 2PWXA 3VB5A 1BT7A 4B73A 1CT4E 2P8OB 3SNAA 4HZHA 1O5FH 2GV6A 3RM2H 2OBQA 3UFAA 2CV3A 2BQ7B 2EI8A 1NTPA 2ODPA 1GMCF 2J38A 2SGDE 2ZA5A 1YKTA 4YZUA 5J4SA 1GJDB 3SJ9A 2ZHFH 5FX5A 1GBLA 4KKDA 4Y0YE 1DSUA 1TNKA 1TPPA 3HKJB 1HJAB 3M35A 3TH4H 1BTPA 5C1UA 1FNIA 3BEIB 2VIOA 1AD8H 3PV4A 2FLRH 1Q3XA 4YLUA 1PPCE 2ZO3H 1CHOG 3SO3A 1GVZA 1C1VH 5EXNA 3RXDA 2XYAA 5GCHG 3SHAH 1SQOA 4YLQH 1W0ZU 4MLFB 1BDAA 2G5VA 3LGTA 1GBKA 1SGTA 4JYVH 1SLUB 1CHOF 3VB4A 1V2VT 3LOXA 5GCHF 1CT2E 2HLCA 3P8NA 3NUMA 1ELEE 1CHGA 1DFPA 4YOGA 1YF4A 4LZ4B 3ZZDA 1A2CH 1GWAA 1P2IA 2G51A 3A7TA 1OWKA 1XXFA 5L2YH 1HLTH 2GTBA 4X8VH 2CHAB 2OLGA 3TITA 1P3CA 3UQVA 2WPIS 1DWEH 1UTMA 1SL3A 1EOLA 4TWWA 2BB4A 1FLEE 1TNHA 3C27B 2BVXH 4JZDH 4NWLA 2GDDA 4U32A 1JWTA 4CHAC 5K0HA 4H4FA 1GJ9B 3T62A 1DUEA 4DURA 2BDCA 2W7SA 1GI4A 4Y10E 3BIUH 1C2IA 1V2TT 4NG9H 1PPZA 3U98H 4TY6A 1MKXK 1ZTJA 4FU8A 1W2KH 1SLVB 1Y3UA 1GVLA 2ZU1A 4X0WU 5EXMA 1BBRE 1YPJH 2BLQA 2BD4A 4ZXYH 2B9LA 1SGRE 3Q77A 4AX9H 1TA6A 1GJ8B 3UNSA 1C2LA 1TGCA 1LHFH 5EXLA 1AFEH 1XKBC 1O2QA 1O3DA 2TPIZ 2WV5A 4ISIH 3JZ2B 3AW1A 3T27A 3KQDA 4UEHH 1V2RT 3PLBA 1C5RA 3ZVEA 1UO6A
chains in the Genus database with same CATH superfamily
2A4OA 2Y5FA 4ACAA 2CJIA 4MNYA 1V2OT 4K8YA 2A45B 2H9TH 2Z6BD 3LGIA 3UIRA 1BTXA 1C5YB 4Z0KA 2AEIH 3MNBA 4FETA 3M5NA 3H7OA 2JETB 3SUGA 2KCAA 3DUXH 5A0CA 1C1NA 1TALA 2J98A 2BD3A 1THPB 3GOVB 1TMUH 2FDAA 2JKHA 1YLDA 5E0JA 3A81A 3MNXA 3PMJA 3A88A 3VXEH 1SGNE 3NWUA 2R3UA 4WVPE 4FU7A 3E91A 3KQEA 3T28A 3VEQB 3GY5A 1DDJA 1TPAE 2JJ2D 2FX6A 1ZMJA 2ASUB 2NU2E 2JJ1D 2FX4A 3N99A 1E37B 3D62A 2WYJA 3ZZ3A 4MDSA 3U28C 3RXLA 2KCPA 2CK3D 2Y5GA 1ZRKA 3GCNA 1S82A 1NT1A 2OINA 1DM4B 4FUFA 4I86A 1UVSH 3B8JA 4IGDA 2CXVA 2STBE 1A5IA 1EAWA 1GDQA 1GMHG 3BTTE 2P3FH 2VGCC 5EJLA 3SGAE 3MU8A 3FZZA 3RDZA 2EC9H 5GXPA 1LPZB 1O3JA 2Z7FE 2QAAA 3SU0A 4AFUA 1SGPE 2ZFRH 1A3EH 1E79D 5HM9A 3UOPA 1A0HB 1C5LH 3S9CA 3DFJA 3SYJA 5IK2D 5EQQA 5L30H 1NU9A 1W8BH 3RXEA 1GI5A 1H8ED 2P59A 6CHAC 1YPHC 2YMSB 2QIQA 3O8CA 1QHRB 1YPHE 1JMOH 1LVBA 1ZPBA 2HNTE 5DP3A 4KP0A 3RMMH 1SLWB 1UCYK 2FP7B 1A46H 3A82A 3E0NB 1RS0A 2EA3A 1T7CA 4WWYA 1HIAB 1ZPZA 1Y3XA 2PKAB 2ZU4A 2K1QA 1LQEA 1NS3A 2GMTC 1E1QD 1NBMD 1C1OA 4B2CA 1ANCA 3SUDA 2KM0A 4YXWD 1GHWH 3A7YA 4CRGA 4JCNA 3SI4H 1NC6A 4BAOB 1PPGE 3RXJA 3CS0A 1BRAA 3AW0A 2XC5A 3SJKA 2FIRH 4NFEA 5EODA 4AN7A 1YLCA 2ZFFH 1P05A 2ZHEH 2BMGB 3ZVGA 3ATIA 4A1TA 4ABDA 1AMHA 1TQ7B 5F8TA 1WTHD 3G01A 4CRFA 4INHA 4OS5A 1Y3YA 5GDSH 4Y8ZA 3NRLA 1L1JA 3SU4A 4ZKRU 1KTSB 2GZ8A 3LKWA 2BXUH 1EZQA 1MAXA 3F2HA 3PMAB 2BZ6H 1JIMA 3A8DA 4K60A 4ISLA 3IWMA 1MCTA 1ZSJA 3TGKE 2FODA 2GT8A 2JDID 1O3NA 1YY3A 1P2JA 1AI8H 1Y5AT 3F6UH 3KL6A 2UUYA 8KME2 3ZZAA 1HAVB 1Y8TA 3SNDA 4K5ZA 1V2WT 4YT6H 1RIWC 5B6LA 2RDEA 1DITH 1VJ9U 1GL1A 3MTYA 1C1SA 5KECA 1H4WA 2BY6X 3P70B 5K7RA 1W0YH 5A8XA 1QZ8A 2RDLA 1QA0A 4AORA 4X8SH 2O9QA 1BTWA 3M5OA 3BN9A 2FTMA 4DIIH 3QTOH 1O2NA 5EQRA 1FI8A 3DD2H 3UR9A 2F9PA 1TFXA 1DXWA 5A09A 4WH6A 3M61U 2GCTB 1O5EH 1XX9A 3O8RA 4ASHA 1HAPH 5T3HA 4A1VA 1AB9B 1ZOMA 3F9GA 1IQNA 1L4ZA 2ANMH 3QZRA 1AVXA 3LDXH 3Q3YA 4UE7H 4NA8A 2ZDNA 3MH7A 4FUEA 2KX4A 1UTLM 2OXSA 2SNVA 2RG3A 2L6OA 5J4QA 2UWLA 3GCTF 4Y79A 1PPFE 3FZDA 1XUKA 1O2OA 1AUTC 1MU6B 1S84A 2O8LA 1K2I1 2XBXA 5FL7D 3A83A 3ZZ4A 3RC6A 3AVZA 3BTQE 1P10A 1V2QT 3OE7D 5A0AE 3SU3A 1TNLA 1HAYB 1KLIH 2C4FH 2Q6GA 1HAGE 3K6ZA 2OP9A 5DSFA 1P03A 3MU5A 1EUFA 3RXVA 1SGFA 2A32A 2BD5A 4X1RU 1KLTA 1Y3VA 2AGEX 3P95A 2AS9A 1C5TA 2Y80A 3HKIB 2SGQE 1N6XA 3A87A 2H6MA 1QBVH 3ODFA 3RU4E 4CRCA 1C5ZB 1HJ9A 3BG8A 5TCAA 1RJXB 3Q00A 2BY8X 3KYGA 1AUJA 5G4BA 2QY0B 4ACBA 5CDFE 2LPRA 3SU2A 2TGPZ 1H8IH 4NWKA 1QNJA 3EE0B 1GJ6A 2C8ZB 5FPYA 3RLYH 2FI5E 1A0JA 3TK5A 1G2LA 2B5TB 2F3CE 1QL8A 2IJOB 3BG4B 4CREA 2O8UA 3GISB 1O2VA 1WBGB 3SU1A 1AVGH 1F5KU 3SU5A 1O5BB 1YPMH 3DSOA 4GAWA 2BY7X 1GI1A 1P0SH 1EJMA 1ELGA 1RTKA 2UWOA 3M3TA 3FP8E 2OQUA 1N8OB 2AHME 1UVPA 1Q31A 2XXLA 4FXGH 1TX8A 2G55A 1VCPA 2R0LA 5AHGH 3VFEA 1WV7H 4TYDA 4LOYH 4VGCB 2BX3A 4ABIA 1TGSZ 1ZSLA 4SGAE 1IQFA 2Q1JA 1CSOE 5F03A 2CF9H 1O3OA 3LGYA 1IHSH 2OCVB 2ZEBA 2C8WB 2AMPA 2EY4C 2ZPRA 1NRPH 1H9HE 1YPEH 2BD9A 3MWIU 5HMAA 5LGOA 3MMGA 1T8NA 4OS2A 2VIPA 1GHXH 1C4U2 1GDUA 2ZTYA 4ZKSU 2ZFPH 1F2SE 1L0ZA 1TAWA 2A2XH 1GBAA 3IITA 1T4UH 2BLWA 5HXFA 4DW2U 1C2FA 1AWHB 2KCOA 2HOBA 5EGMA 4Y7BA 2ODYB 5LPRA 2D8WA 2HPPH 4GHTA 2Z94A 3DHKH 2G81E 5GPIB 3PRDA 1IHTH 1IQEA 3LJOA 5GIBA 3MYWA 4IMZA 1SFIA 1F5RA 3SJ8A 4DY7B 2GGVB 1ZSKA 1QL9A 3LU9B 3WW7A 1BRUP 4BNRA 1MKWH 2D26C 2ZGHA 2EQNA 5DGJA 4NZLA 2K0QA 2F4LA 3LIWA 3RXBA 3W95A 4E05H 1O34A 2BDAA 3RXHA 2IN2A 2Y6TA 4MVNA 1UVUH 2KAIB 3PV5A 3AK5A 1QBNA 3BEUA 1FONA 4TSFD 1E38B 2PKSC 2ODQA 1ZGIA 2AYWA 4Y0ZE 5AF9H 2TGDA 3UR6A 2H9HA 5HM2A 3A7WA 4AB9A 2W26A 1SMFE 5HKKD 1OSSA 3SV9A 2H5CA 3OFND 1UTNA 4HFPB 2WV4A 1O2HA 4FUIA 1BMLA 1UTPA 4X2XA 4OS1A 1IQLA 1JIRA 1O2JA 3LONA 3ZVCA 3DFLA 4XBBA 1JXPA 2P3TB 2FO9A 1G3EA 1ID5H 4ABJA 1SOZA 3F1SB 1KMHB 2A1DB 1HYLA 4AFSA 2BLOA 3U9AH 4CHAB 4UFFH 2WPDD 2FOAA 4BANB 4KTCA 2PTCE 3CP7A 1OKXA 1EP6A 5EU8A 1O3PB 1Z6JH 5JB8S 1J16A 3VG8A 1Z8RA 4PROA 2DE8A 1EJAA 4AB8A 3F9FA 1VGCC 4Q2KA 2ZECA 3TVJB 1ETSH 5ESTE 4HGCA 3RXRA 2VH0A 4UFDH 1BRBE 3W94A 4BAHB 1S6FA 4D9RA 3U69H 1UVTH 1SPJA 3NCLA 4FUHA 2ZZUH 5HIZA 1GBDA 1SHHB 1FMGA 1UVOA 2VNTA 5EQSA 1AKSB 3F9EA 1G3CA 1K0HA 4NZQA 1O3LA 3HPTB 5E0GA 5DP9A 5CMXH 4D8NA 1TYNA 1GMCG 1O2TA 3SGQE 3GY2A 2BZAA 1EAIA 1SGCA 1W7XH 1Z8IB 2V3MA 4F4OC 4DT4A 1AY6H 5E2OA 5C5NA 4TWYA 1TNJA 1O2MA 3BF6H 3TIUA 2BLVA 2OC8A 5EPNA 3GY4A 1OWJA 4R0IA 3QDZB 3SJIA 4X6NA 2V3HH 5TJXA 4H6TA 2WPJS 2VVUA 5A2MH 1K22H 1YYY1 2ANKH 2M5TA 1W12U 2Z9KA 1RTFB 4J1YA 4NIYA 4ZUHA 4K8BA 3UTUH 3MO9A 1CQQA 3GDSA 1GHBG 3RC5A 1D4PB 4DVAU 3L33A 1E36B 2R2WU 1FY8E 1CGJE 1SG8B 1AFQC 1IOEA 3E0PB 1TA2A 2PTNA 4XDEA 3I29A 3TPIZ 1LTOA 3BTEE 1C4V2 1WQSA 4JYTA 4RKOB 1GHBF 1PPEE 4XBDA 2FPZA 2FI4E 3QTVH 4DG4A 2LELA 1CA8B 3BTDE 4U2WA 1DSTA 3PLPA 1CU1A 1NRRH 5DK1A 1O3CA 3U1IB 2Z9IA 4WY3A 1DWCH 1LMWB 1K1PA 2ZFQH 1XM1A 3T29A 2VGCB 1ZTKA 1KDQA 1O3KA 2W5EA 3RXOA 1RTLA 3K2UA 3RXCA 5EW2H 2XNDD 1BUIA 3TNSA 1DOJA 1SKYE 1TQ0B 3LC3A 2AGIX 2XCFA 1JBUH 2D2DA 3ATMA 3MI4A 1O3AA 2WPLS 1BBRH 1BZXE 1OS8A 2PR3A 2YOLA 6CHAB 1D3PB 7GCHG 3EAJA 4ZROA 1C5WB 4ISHH 1IQKA 4B6FA 2BVRH 3S69A 5FCKA 1DWBH 2ZDMA 2ZDKA 4WXIA 5B6OA 3BSQA 2GX4A 4JMYA 7GCHF 1TNIA 3SUEA 2BOHB 1UHBA 1ZMLA 4TPYA 1Z7KA 1TX7A 1L1GA 1SFQB 3QGNB 3UAIC 3RXIA 2GMTB 4TPIZ 4TT3D 2BXTH 3E3TA 1QL7A 1TGNA 3M7QA 2XTTB 1Z6EA 3NZIA 2OBOA 2H2ZA 4AG2A 5L2ZH 3A7VA 4Y8XA 2BX4A 4H6SB 4XSKU 1ZLRA 1UJ1A 3RUOA 2THFB 4JZIA 2RA3A 4DIHH 1GHZA 1C2DA 4RT1A 3SI3H 1E1RD 1AO5A 5PTPA 1TOCB 1TNGA 3QK1A 2ZQ1A 1GMDF 1C5SA 3SUFA 4GPGA 2V0BA 2VIQA 1V2ST 1HBTH 1OOKB 3GY6A 1UK3A 3BTME 1GVKB 3SNCA 1QJ7B 3A89A 2ZHQH 1DWDH 3M36A 1XUGA 1SGDE 1OX1A 3PRBA 1O30A 4CH2B 1NFYA 1GG6C 1Z71A 1BTYA 3E1XB 1Y59T 1V3XA 3EGKH 3GCOA 3RMOH 1FY4A 1K28D 5C20A 2HVYB 5JYIA 5LH8A 1CGIE 5JBCS 2P16A 2ZU5A 3KYFA 3FN8A 4WMFA 4X6OA 1HXFH 1MD7A 3IG6B 3HGPA 3SU6A 5DP7A 3HK6B 1VCWA 1NO9H 1O39A 1RIWB 1EPTA 3F68H 3OEED 3LGUA 1W7GH 1V2LT 4K3JA 4MNXA 5SGAE 5JBTA 1HNEE 4Q7YA 1XXDA 3U8RH 3H7TA 4I8HA 2F9NA 3P17H 4IN1A 1HAXB 4RKJB 2FLBH 2J95A 3RMLH 1AN1E 4I8LA 3GDUA 1D9IA 2G00A 4K69A 1A1RA 2Y5HA 2O8WA 3GYMA 2Z3EA 1TWXB 3UY9A 3PB1E 2EI7A 1DXPA 1HIAA 1QCPA 3DCLA 2PKAA 4LXBH 1A61H 1F7ZA 4DJZB 1NFUA 1SLXB 5C17A 1MCVA 2KR7A 2XW9A 3EA8A 4F49A 2BTCE 1FAKH 4KTSA 5F6MA 1FUJA 3KQBA 1GGDC 1P8VC 2XWBI 2RCEA 4B71A 1ARBA 1ZHPA 3SQHE 1X7AC 3MQKC 1Y5UT 2PUXB 3ODDA 1MZAA 2SGFE 4Y76A 2FMJA 3TH3H 4MPXA 3QX5H 1SQTA 3A85A 3SBKA 4BXSA 1IQJA 1BRCE 1GCDA 4ISNA 5AVDA 3Q76A 2HNTC 3WWBA 1YC0A 3TJUA 3SHCH 1CGHA 1G2MA 2A5IA 3A86A 5DKMA 1D3QB 1O3FA 1PQ8A 2BDIA 1NFXA 3ZZ6A 1SB1H 4ZHLU 2F83A 1AQ7A 4OS6A 1F5LA 3EE7A 2QGRA 3UB0A 1ABIH 1QA7A 1C2HA 2V35A 1GBCA 2AIQA 3STIA 1AHTH 4B6EA 2HGTH 2ZPSA 2BDHA 4ABHA 1ETTH 1HCGA 1VR1H 2BDGA 1EX3A 1IAUA 4MG3A 2ZNKH 1SGQE 5TCCA 1T8LA 5FAHA 1P06A 1QGFA 2SGEE 2ZCLP 2GV7A 1K1JA 2JH5D 1NBME 1A5GH 1OPHB 1K1MA 2D1JA 2ZCHP 3ZYEA 4NIWA 1UTJA 1AVWA 1C1MA 1E35B 1HGTH 3QO6A 2FESH 4NIVA 3PO1C 3OEHD 1QB9A 3MO3A 1ETRH 1UCYE 1LPKB 2VVVA 4ZKNU 1KXFA 3T25A 1C1PA 4XRNA 2UUFB 3VPKA 1YM0A 1FN6A 3MU4A 4ABFA 4YESB 2A4GA 3UOUA 1D3TB 2FZZA 5FBEA 5FX6A 3F9HA 3KEEA 2FOBA 2VINA 4AZ2B 4GUXA 1Z8JB 3M5MA 4IN2A 3PM3A 2VWNA 1BMAA 4OGXA 1S81A 1K9OE 2JH0D 1QRWA 1NPMA 3LPRA 1P2MA 1ACBE 1MTSA 9LPRA 3F0PA 2WV9A 2WUCA 5C1XA 3R0FA 2XBVA 1MTUA 2OC1A 2ILNA 3P92A 1KSNA 1O35A 2ZU2A 4ABEA 3FANA 1O3HA 2BD8A 1W11U 1O2YA 3RXMA 5FXLA 1GI9B 1P02A 3GY7A 2A5AA 1TX6A 2BQWB 1FXYA 3M3VA 1ZZZA 1TBZH 3B23B 3F0OA 2G4TA 4GSOA 3LGWA 4WF8A 5GNDA 4UFEH 1K1IA 1C2EA 1PFXC 2H1UA 3SJOA 4X8UH 1FDPA 2ZC9H 1WQVH 3GCTG 5EIYA 1AIXH 1HAZB 2BYAX 2XBYA 1Q2WA 2R0KA 1YPKH 4CRBA 4X1SU 3KIDU 1WU1A 1TPOA 1LHGH 4F55A 1C1UH 2J34A 1QY6A 4ZXXH 4ABAA 2Z3CA 5C67A 1TIOA 1TGBA 3S0NA 1YP9A 1LVYA 2AERH 1NRQH 1DUAA 3E16B 4ZHAA 2XRCA 3OX7U 1L2EA 3OTJE 4Q7ZA 1P2QA 3URCA 5ETXA 1GJAB 2HWLB 2L74A 1EPTC 7KMEH 2CF8H 3TLOA 2VIWA 1GBFA 3M37A 4X6MA 4YM9A 2PKSB 2BD2A 2W6ID 4B74A 5FBIA 4BXWA 2Y82A 1ZJKA 1ARCA 3BTWE 3K6YA 3OTPA 4P02A 3PROA 4AC9A 5I46H 1A4WH 3MH4A 2BQ6B 1W14U 2R2MB 3QWCH 1WDIA 2PW8H 1P11E 1GPZA 1JRTA 3NXPA 1ELBA 1B5GH 1ZMNA 3UNRA 5EW1H 4FUDA 2ZDLA 2ZF0H 4FVBA 3RXTA 3RU4D 3ELAH 3SV2H 3TJVA 1LKAA 1P09A 3C1KA 1EB1H 1PQ7A 1W3CA 1O3IA 3VGCC 1ELDE 1NRSH 4RN6A 3S7KB 2HNTF 1GHVH 5A0BA 2P93A 2WYGA 2AGGX 4K1EA 3FAOA 1RRKA 4YTAA 1V2KT 1YPGH 2BVSH 1HAOH 1O37A 2FYRA 3WWFA 1VGCB 2B0FA 1QFKH 2QF5A 1BTUA 3PTNA 1F0TA 5FPSA 4YOJA 1TMBH 3RM0H 3MU0A 4THNH 2F9UA 4I7YH 4B75A 2Y81A 2A7JA 1BMFD 5I25A 2H9EH 1QJ6B 3BIVH 4OS7A 4I33A 2QF4A 1G30B 2J2UA 3A80A 3GCHC 4ABBA 2C90B 5DO4H 4MNWA 1BB0B 2ZGJA 1C2GA 2ZIQH 2KAIA 1C1TA 4FU9A 5DPAA 1OYTH 1DS2E 5JBBS 1NRNH 1TOMH 3BEFB 1TABE 4Y71A 1MTNC 1O5DH 3TJNA 2G4UA 3VB6A 4H42U 1Y3WA 1QQUA 3EDXB 1TRMA 1O2XA 2M2AA 1KXCA 3L3TA 2FEQH 4CBNA 1BIOA 3KQ5A 4Q4LA 1W10U 2CN0H 3RXPA 1G37A 3ZZ8A 1E0FD 1GI7B 5T6DA 1S0RA 2SGPE 1GCTC 3SV6A 2NU0E 2Q6DA 3AASA 1NROH 1AFQB 4ZH8A 1TGTA 3PWCA 4TY7A 1T4VH 1L1NA 1AE8H 1GJCB 4CRAA 3P8FA 5CHAC 1F0SA 2FM2A 1GI3A 4BTTB 3RC4A 2NU4E 2GVFA 4A92A 1P12E 1AE5A 2TGTA 2ANYA 3RXSA 3RMNH 5C0TA 1J9CH 1CBWC 1C2MA 1J14A 2ZDAH 1TRNA 1WCZA 3TK6A 3V0XA 3FP7E 1GBMA 3W1EA 1YLNA 4NGAH 3ZYDA 3ATWA 3P6ZB 3RXKA 2ANWA 2ZHWH 4RT0A 1N6YA 3DT0H 2W6JD 1C5UA 2B8OH 1SBWA 1HV7A 4BOHA 1MKWK 1FQ3A 5T1VA 2PV9B 4NCYA 5IDKA 2W3IA 5DJ7A 3STJA 3S9AA 3ENSB 2J5UA 1FV9A 2VWOA 3QUMP 5LPFA 3UUZA 2OQ5A 2ZQ2A 2F91A 1D6RA 3DA9B 2CMYA 1EXFA 4INLA 1VITH 3VB7A 1O3EA 1GHYH 4X1QU 3K9XB 1HRTH 1DVAH 2QE7D 4NSVA 2PHBA 3KF2A 4Y11E 2WPHS 5H4IB 1G3BA 1THRH 1WYKA 4FUCA 4KTUA 2DE9A 1F0UA 2Z9LA 3EQ0H 1P2KA 2V7QD 3H09A 1SGIB 1NU7B 1J15A 1BTZA 1NN6A 3GY3A 1HAHH 4BTUB 1BMMH 1GL0E 3MH6A 1H9IE 4OS4A 2ZTXA 2ZG0H 1PJPA 1BHXF 4XE4A 1B7XB 2QXHA 3N7EA 5LPEA 1WXRA 2WPKS 2QV1A 2ZFTA 1QRXA 6GCHF 1O5GH 1KYNA 1P9SA 3HK3B 5C2ZA 2QXGA 5E8EH 2K8IA 2GZ7A 1S85A 4DT7B 1O2GH 4AGJA 2ZHDA 4DCDA 1DLKB 2XC0A 2VBCA 4IC5A 5EG4A 2P94A 1SSXA 3A84A 2B7DH 1O2RA 3TK9A 1GG6B 3A8BA 4MPUA 1MU8B 5C0UA 2I6QA 3FOAA 3LC5A 5AFZH 1O2WA 3T5FH 1C2KA 1VCQA 2BDYA 1B0EA 2GP9B 5KEDA 4XD7D 5L6NH 1DPOA 5JPMH 1D3DB 4IMQA 3UWJH 3WY8A 2QC2A 1SQAA 2QXJA 1OWHA 4GVUA 2FS8A 4BTIB 2F9BH 2NU3E 3SZEA 1THSH 5C5OA 1GBBA 1U6QA 1A5HA 5DP8A 6LPRA 1OP0A 3O8BA 3F3BA 1KXEA 1QIXB 2ZGXH 1ELTA 1CA0C 1KIGH 1OWEA 2BDBA 2VU8E 3RP2A 1E34B 3PYHA 1EZUC 1ABJH 3LJJA 2DUCA 3SQEE 1EOJA 1O2LA 2A2QH 3PMBB 1EAXA 1O2KA 1GGDB 2AIPA 2WPMS 2G5NA 3FVFB 3A8AA 1GI6A 4OM9A 3TU7H 2HLDD 4FOUC 4IC6A 1RGQA 3ZZCA 1SQRA 2HVXA 1GJ4H 4XOJA 4B2BA 1FY5A 4NA7A 1BTHH 2UWPA 2C3SA 3A7ZA 1LHCH 1UW7A 3LH3A 2ESTE 1M9UA 1O5AB 3SNBA 5DG6A 4D7FA 1XMNB 4A7IB 1ELFA 4ABGA 1CT0E 3S7HB 1XUJA 1GJ7B 1Y5BT 1O31A 1V2NT 1PQAA 3GS9A 1BBRK 1H8DH 3FO8D 4LK4A 1C5QA 2Z3DA 1UK4A 1MKXH 1FY1A 2ZP0H 3FFGA 4WH8A 2NU1E 5T6GA 1KXDA 1JOUB 1KTTB 3KGPA 2AMDA 1GMDG 1C5MD 4ZHMU 3PWBA 2A7CA 1SGEE 2W7UA 5HGGA 4XFQA 5F8XA 2GJGA 1HXEH 1LCYA 3PO1B 1KLJH 3KHVA 1O2SA 1P2NA 1C5VA 1FPCH 1PQ5A 1G36A 2FOGA 2KCYA 4FUBA 1GDNA 5DP6A 5BRRE 1C1WH 1KDQB 1C5XB 1DLEA 1DY9A 3O8DA 1INCA 1EQ9A 1EAUA 1FIZA 3ZVBA 1ZPCA 2P95A 3UQOA 2VIVA 3TGJE 2VWMA 1EKBB 1OYQA 4WJG2 3NKKA 4CBOA 1J8AA 1FJSA 1C1RA 4CR9A 5AFYH 1UTOA 1BOQA 3RXQA 4JK5A 4GHQA 1IQMA 4O3UA 3BTHE 1MH0A 2GCHG 2J94A 4XBCA 4B1TA 4Y6DA 4D76A 1VITG 2V6NA 2ZU3A 1OWDA 2GDEH 4O3TA 1SHYA 2P8OC 1XVOA 5F8ZA 1DY8A 1CO7E 1YCPH 2EEKA 5EPYA 1UHBB 2GCHF 3A7XA 4IBLH 2CGAA 3TNTA 1VITF 2R9PA 2ZWLH 2OTVA 2UUKB 1EATA 1RXPA 1H1BA 1O2IA 3MH5A 1EB2A 1SGFG 4OGYA 2EI6A 1EP5A 4YT7H 4INKA 4D7GA 1L4DA 1DE7H 1CE5A 4ZKOU 1P3EA 1LVMA 3KCGH 1A3BH 1HJAC 2OC7A 2QYIA 4CR5A 5E0HA 1TPSA 1MBQA 2STAE 2ZFSA 3ZVAA 1YCPK 1VKYA 3DSGA 3M7UA 3ZZ9A 1UMAH 4R8TB 1HJ8A 2Y7XA 1AWFH 1ZHMA 4DOQA 4NA9H 4MPVA 3TH2H 4ZMAH 2NWNA 1G32B 2TBSA 1T8OA 4I8KA 3AAVA 4B76A 2QXIA 1WAYB 1NM6A 3M5LA 3N7OA 4P00A 1H9LB 2G52A 3M3SA 5FPTA 4U01A 4JYUH 2SGAA 7LPRA 2FXRA 1VJAU 4FVDA 1V2JT 3P8GA 1MBMA 4F48B 1DX5M 2F9VA 4JK6A 3MFJA 3V12A 4IS5A 1GBJA 1QR3E 3UWIA 2J98B 1C2JA 1WUNH 2A31A 2G8TA 2F9OA 5C1YA 1UCYH 1GMHF 4UFGH 3SOSA 1EPTB 3SORA 4AG1A 1BHXB 2XC4A 2O8TA 1YCPM 4AFZA 1GBTA 2CHAC 3SN8A 2XBWA 1DICA 1IQHA 2WHXA 4ZAEA 2SFAA 1NFWA 4X2VA 2FYQA 2A4QA 1ELVA 8LPRA 1YBWA 1HAVA 1O5CB 2WINI 4I31A 2QN5T 2SNWA 3PV2A 1MQ5A 4NIXA 3PMHB 1O2ZA 2ZTZA 2FOMB 1ANBA 3BTGE 3TGIE 3LT3A 2BOKA 3GDVA 1KXAA 4FUJA 4B2AA 4AYYB 3BTFE 3PTBA 1LPGB 4E7NA 3ZV9A 2Z9GA 1XKAC 2XWAA 3M7TA 5C94A 9ESTA 3RXFA 3QN7A 1ZHRA 2J9NA 3ZZ5A 1HUTH 1V2PT 1CVWH 5EJZA 3VGCB 4YO9A 3URDA 4MNVA 1EZSC 2OC0A 4RSPA 3ZVDA 3LGVA 1KXBA 1PPBH 1O3GA 3B9FH 3SV7A 1GI2A 1QQ4A 1TONA 4U30A 1EJNA 4WXVA 3F2FA 1BA8B 2PFEA 2PLXA 1V2UT 4RI0A 1ZRBA 1COWD 4GLYA 2ZCKP 4CRDA 3D65E 1YGCH 8ESTE 1RD3B 1W0KD 3NK8A 3S9BA 1BCUH 3V3MA 5JB9S 2TIOA 1O32A 1PYTC 4HTCH 1P57B 4QT8C 2JETC 1K1OA 4Q7XA 3T2NA 3DSPA 1FPHH 3MNSA 1BQYA 1C5PA 3GCHB 2AFQB 1K1NA 1SI5H 1T31A 4NFFA 3U8TH 1KY9A 2JH6D 3EA7A 2HALA 5FHTA 1XVMA 3FKSD 1PYTD 1ZGVA 4KGAA 1MZDA 1MTNB 3FP6E 3PLKA 5FCRA 1XUHA 3ZVFA 1O2UA 1JRSA 1BITA 2FOEA 2J97A 1C9TA 1D6WA 3I77A 1QJ1B 1O3BA 5CHBA 2I6SA 2UUJB 1OP2A 1TRYA 3MNCA 2FS9A 4ZCNA 1QB1A 1GCTB 1A7SA 2A4RA 2BM2A 2VJ1A 3MHWU 1BJUA 1MTVA 2TGAA 4O97A 4MQAA 4UDWH 8GCHG 1GI8B 2VVCA 2IOTA 1IQIA 1TE0A 5CHAB 2PP6A 4D9QA 1GBEA 3E6PH 1GBIA 3EYDA 3RXAA 2V3OH 1NESE 1ZJDA 4HI3A 2C8YB 1PPHE 3MOCA 4AFQA 4YOIA 4E06H 1TMTH 2VIDA 2ZGBH 1FN8A 8GCHF 1P04A 1CBWB 2GZ9A 3QGJA 2FTLE 1LHEH 4AYVB 6ESTA 2BD7A 3UREA 1ELAA 3V13A 3SV8A 1O36A 1F92A 2PGQB 3R3GB 4O03A 1ZYOA 4X2YA 1MD8A 1MMJN 1ESTA 1GBHA 2IJD1 2KZ4A 4Z1MD 1MQ6A 3BTKE 3I78A 3K65B 1C5NH 1HPGA 2FI3E 2YMSC 4Q63A 1LO6A 2WUBA 5A8ZA 1BMNH 2XNIA 2GD4B 1TBRH 4Q80A 1W0JD 2H5DA 1T32A 1QBOA 1RFNA 4K2YA 2RFKC 3ITIA 4A5TS 4KELA 2A7HA 1XUFA 3E90B 3E8LA 4HG6A 1G3DA 2YMSD 3L6PA 3OYPA 3ZZ7A 5CE1A 1LVOA 5F53A 4X8TH 1F0RA 2J92A 1V2MT 1Z1IA 1ZR0A 2PSXA 1NZQH 2ZI2H 4AGKA 3LH1A 4Y7AA 3GICB 3T26A 2XCNA 3OY5U 3RXUA 3U8OH 5DP5A 4MPWA 2OD3B 5ABWA 2Z9JA 2BHGA 4X6PA 3VXFH 5EOKA 3TJOA 5T6FA 3ESTA 2ALPA 1TBQH 2C8XB 4UONA 1HDTH 1AU8A 1C4Y2 2O8MA 3VB3A 5DN6D 1IQGA 2Q6FA 2AH4X 1S6HA 3Q3XA 3KN2A 1O38A 3ZZBA 1SGYE 2IPHA 1GJ5H 1V6DA 4SGBE 1LQDB 5HYOA 4JZ1A 2WZQA 5EJ1A 1YPLH 4J2YB 1QTFA 5IYTA 4O9VA 1OHHD 1S83A 5C3NA 4JZEH 3D23A 3HGNA 3MU1A 4A1XA 3OU0A 5DP4A 1C1QA 2QF3A 3SW2B 2BY9X 1A0LA 4X1NU 3ZIAD 1O3MA 2ALVA 5GJ4B 1ANDA 1WSSH 4BAQB 3HATH 3ZV8A 3CENA 2PUQH 4K1TA 4CH8B 3MO6A 1QURH 2ZPQA 4FUGA 3KNXA 3V7TA 1BJVA 3ATLA 3SZNA 1MUEB 3Q3KA 3F2GA 2GT7A 2GCTC 3D49H 1OXGA 1C9PA 1AGJA 1ELCA 3OSYA 4IW4E 3QZQA 1EZXC 1FY3A 3RXGA 4AOQA 4ASUD 2ZGCA 5JBAS 2A0QB 1HFDA 1P01A 3SNEA 1AB9C 4DGJA 4JZFH 3RLWH 5E2PA 3SGBE 7ESTE 2QF0A 2P3UB 1K21H 1ESBA 1Z8GA 1HB0B 1CA0B 3ATKA 1UTKA 2VH6A 1SOTA 1WOFA 1ESAA 2LNCA 1GJBB 2KFWA 5JDUB 1P2OA 1TLDA 1ORFA 1J17T 2VWLA 1FIWA 1EASA 1DANH 1MABB 4M9FA 1GHAG 2A5KA 1SC8U 3UNQA 1O2PA 2ULLA 4I8JA 2VB0A 3H5CB 3JZ1B 2OK5A 3GY8A 1B0FA 1N1LA 1SR5C 1LHDH 5ESBA 5BPEA 1LKBA 2OUAA 5KGOA 1GHAF 2ZKSA 2FWWA 2PGBB 2TRMA 1AKSA 4BAKB 4ISOA 4X2WA 4NSYA 4Y8YA 2RA0A 1TB6H 3CS7A 1MAYA 2BY5X 2QA9E 5HIYA 1C5OH 2FOFA 3AAUA 1AZZA 3P8OA 4MTBA 1OWIA 4ESTE 3U1JB 4X1PU 1G9IE 3EA9A 1QRZA 1FAXA 2Y7ZA 4UD9H 1H8HD 1DT2A 2J4IA 2F43B 4GCHG 4WMDA 2AMQA 3KQCA 5GWZA 1UK2A 1ANEA 6GCHG 4E7RG 3GYLB 1K1LA 1ZTLA 2R3YA 2C93B 4GCHF 3OY6U 4K1SA 2ZDVH 1EFRD 2HRVA 1QB6A 4Z6AH 1FZZA 1O0DH 1NY22 4WMEA 1S0QA 3BG4C 2YNBA 1S5SA 2FOHA 2PSYA 2QCYA 1SVPA 3QLPH 1AZ8A 1P9UA 2FOCA 1GI0A 4M7GA 3A8CA 1VZQH 2GKVE 2HPQH 1HAIH 1N8OC 1W13U 4LZ1H 1OP8A 1O33A 1MTWA 4I32A 1Z1JA 1LDTT 3BV9B 4A6LA 3UPEA 1WTGH 3NPSA 2W3KA 4I8GA 4VGCC 1T8MA 3RU4T 1FX0B 4BAMB 1XUIA 5A8YA 2YNAA 1UTQA 2PWXA 3VB5A 1BT7A 4B73A 1CT4E 2P8OB 3SNAA 4HZHA 1O5FH 2GV6A 2WSSD 2OBQA 3RM2H 3UFAA 2CV3A 2BQ7B 2EI8A 1NTPA 3N7DA 2ODPA 1GMCF 2J38A 2SGDE 2ZA5A 1YKTA 4YZUA 5J4SA 1GJDB 3SJ9A 2ZHFH 5FX5A 1GBLA 4KKDA 4Y0YE 1DSUA 1TNKA 1TPPA 3HKJB 1HJAB 3M35A 3TH4H 1BTPA 5C1UA 1FNIA 3BEIB 2VIOA 1AD8H 3PV4A 2IPQX 2FLRH 1Q3XA 4YLUA 1PPCE 1S6LA 2ZO3H 1CHOG 3SO3A 1GVZA 1C1VH 5EXNA 3RXDA 2XYAA 5GCHG 3SHAH 1SQOA 4YLQH 1W0ZU 4MLFB 1BDAA 2G5VA 3LGTA 1GBKA 1SGTA 4JYVH 1SLUB 1CHOF 3VB4A 1V2VT 3LOXA 5GCHF 1CT2E 2HLCA 3P8NA 3NUMA 1ELEE 1CHGA 1DFPA 4YOGA 1YF4A 4LZ4B 3ZZDA 1A2CH 1GWAA 1P2IA 2G51A 3A7TA 1OWKA 1XXFA 5L2YH 1HLTH 2GTBA 4X8VH 2CHAB 2OLGA 3TITA 1P3CA 3UQVA 2WPIS 1DWEH 1UTMA 1SL3A 1EOLA 4TWWA 2XOKD 2BB4A 1FLEE 1TNHA 3C27B 2BVXH 4JZDH 4NWLA 2GDDA 4U32A 1JWTA 2JIZD 4CHAC 5K0HA 4H4FA 1GJ9B 3T62A 1DUEA 4DURA 2BDCA 2W7SA 1GI4A 3CNRA 4Y10E 3BIUH 1YWUA 1C2IA 1V2TT 4NG9H 1PPZA 3U98H 4TY6A 1MKXK 1ZTJA 4FU8A 1W2KH 2LP6A 1SLVB 1Y3UA 1GVLA 2ZU1A 4X0WU 5EXMA 1BBRE 1YPJH 2BLQA 2BD4A 4ZXYH 2B9LA 1SGRE 3Q77A 4AX9H 1TA6A 1GJ8B 3UNSA 1C2LA 1TGCA 1LHFH 5EXLA 1AFEH 1XKBC 3OAAD 1O2QA 1O3DA 2TPIZ 2WV5A 4ISIH 3JZ2B 3AW1A 3T27A 3KQDA 4UEHH 1V2RT 3PLBA 1C5RA 3ZVEA 1UO6A
chains in the Genus database with same CATH topology
2A4OA 2Y5FA 2CJIA 4MNYA 1V2OT 4K8YA 2A45B 2H9TH 2Z6BD 3LGIA 3UIRA 1BTXA 1C5YB 4Z0KA 2AEIH 3MNBA 3M5NA 3H7OA 2JETB 3SUGA 3DUXH 5A0CA 1C1NA 1TALA 2BD3A 1THPB 3GOVB 1TMUH 2FDAA 2JKHA 1YLDA 5E0JA 3A81A 3MNXA 3PMJA 3A88A 3VXEH 1SGNE 3NWUA 2R3UA 4WVPE 4FU7A 3E91A 3KQEA 3T28A 3VEQB 3GY5A 1DDJA 1TPAE 2FX6A 1ZMJA 2ASUB 2NU2E 2FX4A 1E37B 3D62A 2WYJA 3ZZ3A 4MDSA 3RXLA 2Y5GA 1ZRKA 3GCNA 1S82A 1NT1A 2OINA 1DM4B 4FUFA 1UVSH 3B8JA 4IGDA 2CXVA 2STBE 1A5IA 1EAWA 1GDQA 1GMHG 3BTTE 2P3FH 2VGCC 3SGAE 3MU8A 3FZZA 3RDZA 2EC9H 5GXPA 1LPZB 1O3JA 2Z7FE 2QAAA 3SU0A 4AFUA 1SGPE 2ZFRH 1A3EH 5HM9A 3UOPA 1A0HB 1C5LH 3S9CA 3DFJA 5EQQA 5L30H 1NU9A 1W8BH 3RXEA 1GI5A 2P59A 6CHAC 1YPHC 2QIQA 3O8CA 1QHRB 1YPHE 1JMOH 1LVBA 1ZPBA 2HNTE 5DP3A 4KP0A 3RMMH 1SLWB 1UCYK 2FP7B 1A46H 3A82A 3E0NB 1RS0A 2EA3A 1T7CA 4WWYA 1HIAB 1ZPZA 1Y3XA 2PKAB 2ZU4A 2K1QA 1LQEA 1NS3A 2GMTC 1C1OA 4B2CA 1ANCA 3SUDA 1GHWH 3A7YA 4CRGA 4JCNA 3SI4H 1NC6A 4BAOB 1PPGE 3RXJA 3CS0A 1BRAA 3AW0A 2XC5A 3SJKA 2FIRH 4NFEA 5EODA 4AN7A 1YLCA 2ZFFH 1P05A 2ZHEH 2BMGB 3ZVGA 3ATIA 4A1TA 4ABDA 1AMHA 1TQ7B 5F8TA 1WTHD 3G01A 4CRFA 4INHA 4OS5A 1Y3YA 5GDSH 4Y8ZA 1L1JA 3SU4A 4ZKRU 1KTSB 2GZ8A 3LKWA 2BXUH 1EZQA 1MAXA 3PMAB 2BZ6H 1JIMA 3A8DA 4K60A 4ISLA 3IWMA 1MCTA 1ZSJA 3TGKE 2FODA 2GT8A 1O3NA 1P2JA 1AI8H 1Y5AT 3F6UH 3KL6A 2UUYA 8KME2 3ZZAA 1HAVB 1Y8TA 3SNDA 4K5ZA 1V2WT 4YT6H 1RIWC 1DITH 1VJ9U 1GL1A 3MTYA 1C1SA 1H4WA 2BY6X 3P70B 5K7RA 1W0YH 5A8XA 2RDLA 1QA0A 4AORA 4X8SH 2O9QA 1BTWA 3M5OA 3BN9A 2FTMA 4DIIH 3QTOH 1O2NA 5EQRA 1FI8A 3DD2H 3UR9A 2F9PA 1TFXA 1DXWA 5A09A 4WH6A 3M61U 2GCTB 1O5EH 1XX9A 3O8RA 4ASHA 1HAPH 5T3HA 4A1VA 1AB9B 1ZOMA 3F9GA 1IQNA 1L4ZA 2ANMH 3QZRA 1AVXA 3LDXH 3Q3YA 4UE7H 4NA8A 2ZDNA 3MH7A 4FUEA 1UTLM 2OXSA 2SNVA 2RG3A 5J4QA 2UWLA 3GCTF 4Y79A 1PPFE 3FZDA 1XUKA 1O2OA 1AUTC 1MU6B 1S84A 2O8LA 1K2I1 2XBXA 3A83A 3ZZ4A 3RC6A 3AVZA 3BTQE 1P10A 1V2QT 5A0AE 3SU3A 1TNLA 1HAYB 1KLIH 2C4FH 2Q6GA 1HAGE 3K6ZA 2OP9A 1P03A 3MU5A 1EUFA 3RXVA 1SGFA 2A32A 2BD5A 4X1RU 1KLTA 1Y3VA 2AGEX 3P95A 2AS9A 1C5TA 2Y80A 3HKIB 2SGQE 1N6XA 3A87A 2H6MA 1QBVH 3ODFA 3RU4E 4CRCA 1C5ZB 1HJ9A 3BG8A 5TCAA 1RJXB 3Q00A 2BY8X 1AUJA 5G4BA 2QY0B 2LPRA 3SU2A 2TGPZ 1H8IH 4NWKA 1QNJA 3EE0B 1GJ6A 2C8ZB 5FPYA 3RLYH 2FI5E 1A0JA 3TK5A 1G2LA 2B5TB 2F3CE 1QL8A 2IJOB 3BG4B 4CREA 2O8UA 3GISB 1O2VA 1WBGB 3SU1A 1AVGH 1F5KU 3SU5A 1O5BB 1YPMH 4GAWA 2BY7X 1GI1A 1P0SH 1EJMA 1ELGA 1RTKA 2UWOA 3M3TA 3FP8E 2OQUA 1N8OB 1UVPA 1Q31A 2XXLA 4FXGH 1TX8A 2G55A 1VCPA 2R0LA 5AHGH 3VFEA 1WV7H 4TYDA 4LOYH 4VGCB 2BX3A 4ABIA 1TGSZ 1ZSLA 4SGAE 1IQFA 2Q1JA 1CSOE 5F03A 2CF9H 1O3OA 3LGYA 1IHSH 2OCVB 2ZEBA 2C8WB 2AMPA 2ZPRA 1NRPH 1H9HE 1YPEH 2BD9A 3MWIU 5HMAA 5LGOA 3MMGA 1T8NA 4OS2A 2VIPA 1GHXH 1C4U2 1GDUA 2ZTYA 4ZKSU 2ZFPH 1F2SE 1L0ZA 1TAWA 2A2XH 1GBAA 3IITA 1T4UH 2BLWA 5HXFA 4DW2U 1C2FA 1AWHB 5EGMA 2HOBA 4Y7BA 2ODYB 5LPRA 2D8WA 2HPPH 4GHTA 2Z94A 3DHKH 2G81E 5GPIB 1IHTH 1IQEA 3LJOA 5GIBA 3MYWA 4IMZA 1SFIA 1F5RA 3SJ8A 4DY7B 2GGVB 1ZSKA 1QL9A 3LU9B 4BNRA 1BRUP 1MKWH 2D26C 2ZGHA 5DGJA 4NZLA 3LIWA 3RXBA 3W95A 4E05H 1O34A 2BDAA 3RXHA 2IN2A 2Y6TA 4MVNA 1UVUH 2KAIB 1QBNA 3BEUA 1FONA 1E38B 2PKSC 2ODQA 1ZGIA 2AYWA 4Y0ZE 5AF9H 2TGDA 3UR6A 2H9HA 5HM2A 3A7WA 4AB9A 2W26A 1SMFE 1OSSA 3SV9A 2H5CA 1UTNA 4HFPB 2WV4A 1O2HA 4FUIA 1BMLA 1UTPA 4X2XA 4OS1A 1IQLA 1JIRA 1O2JA 3LONA 3ZVCA 3DFLA 4XBBA 1JXPA 2P3TB 2FO9A 1G3EA 1ID5H 4ABJA 1SOZA 3F1SB 2A1DB 1HYLA 4AFSA 2BLOA 3U9AH 4CHAB 4UFFH 2FOAA 4BANB 4KTCA 2PTCE 3CP7A 1OKXA 1EP6A 5EU8A 1O3PB 1Z6JH 5JB8S 1J16A 1Z8RA 4PROA 2DE8A 1EJAA 4AB8A 3F9FA 1VGCC 4Q2KA 2ZECA 3TVJB 1ETSH 5ESTE 4HGCA 3RXRA 2VH0A 4UFDH 1BRBE 3W94A 4BAHB 1S6FA 4D9RA 3U69H 1UVTH 1SPJA 3NCLA 4FUHA 2ZZUH 1GBDA 1SHHB 1FMGA 1UVOA 2VNTA 5EQSA 1AKSB 3F9EA 1G3CA 4NZQA 1O3LA 3HPTB 5E0GA 5DP9A 5CMXH 4D8NA 1TYNA 1GMCG 1O2TA 3SGQE 3GY2A 2BZAA 1EAIA 1SGCA 1W7XH 1Z8IB 4F4OC 1AY6H 5E2OA 5C5NA 4TWYA 1TNJA 1O2MA 3BF6H 3TIUA 2BLVA 2OC8A 5EPNA 3GY4A 1OWJA 4R0IA 3QDZB 3SJIA 4X6NA 2V3HH 5TJXA 4H6TA 2WPJS 2VVUA 5A2MH 1K22H 1YYY1 2ANKH 2M5TA 1W12U 2Z9KA 1RTFB 4J1YA 4NIYA 4ZUHA 4K8BA 3UTUH 3MO9A 1CQQA 3GDSA 1GHBG 3RC5A 1D4PB 4DVAU 3L33A 1E36B 2R2WU 1FY8E 1CGJE 1SG8B 1AFQC 1IOEA 3E0PB 1TA2A 2PTNA 4XDEA 3I29A 3TPIZ 1LTOA 3BTEE 1C4V2 1WQSA 4JYTA 4RKOB 1GHBF 1PPEE 4XBDA 2FPZA 2FI4E 3QTVH 4DG4A 1CA8B 3BTDE 4U2WA 1DSTA 3PLPA 1CU1A 1NRRH 5DK1A 1O3CA 3U1IB 2Z9IA 4WY3A 1DWCH 1LMWB 1K1PA 2ZFQH 1XM1A 3T29A 2VGCB 1ZTKA 1KDQA 1O3KA 2W5EA 3RXOA 1RTLA 3K2UA 3RXCA 5EW2H 1BUIA 3TNSA 1DOJA 1TQ0B 3LC3A 2AGIX 2XCFA 1JBUH 2D2DA 3ATMA 3MI4A 1O3AA 2WPLS 1BBRH 1BZXE 1OS8A 2PR3A 2YOLA 6CHAB 1D3PB 7GCHG 3EAJA 4ZROA 1C5WB 4ISHH 1IQKA 2BVRH 3S69A 5FCKA 1DWBH 2ZDMA 2ZDKA 4WXIA 5B6OA 3BSQA 2GX4A 4JMYA 7GCHF 1TNIA 3SUEA 2BOHB 1UHBA 1ZMLA 4TPYA 1Z7KA 1TX7A 1L1GA 1SFQB 3QGNB 3RXIA 2GMTB 4TPIZ 2BXTH 3E3TA 1QL7A 1TGNA 3M7QA 2XTTB 1Z6EA 3NZIA 2OBOA 2H2ZA 4AG2A 5L2ZH 3A7VA 4Y8XA 2BX4A 4H6SB 4XSKU 1ZLRA 1UJ1A 3RUOA 2THFB 4JZIA 2RA3A 4DIHH 1GHZA 1C2DA 3SI3H 1AO5A 5PTPA 1TOCB 1TNGA 3QK1A 2ZQ1A 1GMDF 1C5SA 3SUFA 4GPGA 2V0BA 2VIQA 1V2ST 1HBTH 1OOKB 3GY6A 1UK3A 3BTME 1GVKB 3SNCA 1QJ7B 3A89A 2ZHQH 1DWDH 3M36A 1XUGA 1SGDE 1OX1A 1O30A 4CH2B 1NFYA 1GG6C 1Z71A 1BTYA 3E1XB 1Y59T 1V3XA 3EGKH 3GCOA 3RMOH 1FY4A 1K28D 5C20A 5JYIA 5LH8A 1CGIE 5JBCS 2P16A 2ZU5A 4WMFA 4X6OA 1HXFH 1MD7A 3IG6B 3HGPA 3SU6A 5DP7A 3HK6B 1VCWA 1NO9H 1O39A 1RIWB 1EPTA 3F68H 3LGUA 1W7GH 1V2LT 4K3JA 4MNXA 5SGAE 5JBTA 1HNEE 4Q7YA 1XXDA 3U8RH 3H7TA 4I8HA 2F9NA 3P17H 4IN1A 1HAXB 4RKJB 2FLBH 2J95A 3RMLH 1AN1E 4I8LA 3GDUA 1D9IA 2G00A 4K69A 1A1RA 2Y5HA 2O8WA 3GYMA 2Z3EA 1TWXB 3UY9A 3PB1E 2EI7A 1DXPA 1HIAA 1QCPA 4LXBH 2PKAA 1A61H 1F7ZA 4DJZB 1NFUA 1SLXB 1MCVA 2XW9A 3EA8A 4F49A 2BTCE 1FAKH 4KTSA 5F6MA 1FUJA 3KQBA 1GGDC 1P8VC 2XWBI 2RCEA 4B71A 1ARBA 1ZHPA 3SQHE 1X7AC 1Y5UT 2PUXB 3ODDA 1MZAA 2SGFE 4Y76A 2FMJA 3TH3H 4MPXA 3QX5H 1SQTA 3A85A 3SBKA 4BXSA 1IQJA 1BRCE 1GCDA 4ISNA 5AVDA 3Q76A 2HNTC 1YC0A 3TJUA 3SHCH 1CGHA 1G2MA 2A5IA 3A86A 5DKMA 1D3QB 1O3FA 1PQ8A 2BDIA 1NFXA 3ZZ6A 1SB1H 4ZHLU 2F83A 1AQ7A 4OS6A 1F5LA 2QGRA 1ABIH 1QA7A 1C2HA 2V35A 1GBCA 2AIQA 3STIA 1AHTH 2HGTH 2ZPSA 2BDHA 4ABHA 1ETTH 1HCGA 1VR1H 2BDGA 1EX3A 1IAUA 4MG3A 2ZNKH 1SGQE 5TCCA 1T8LA 5FAHA 1P06A 1QGFA 2SGEE 2ZCLP 2GV7A 1K1JA 2JH5D 1A5GH 1OPHB 1K1MA 2D1JA 2ZCHP 3ZYEA 4NIWA 1UTJA 1AVWA 1C1MA 1E35B 1HGTH 3QO6A 2FESH 4NIVA 3PO1C 1QB9A 3MO3A 1ETRH 1UCYE 1LPKB 2VVVA 4ZKNU 1KXFA 3T25A 1C1PA 2UUFB 3VPKA 1YM0A 1FN6A 3MU4A 4ABFA 4YESB 2A4GA 3UOUA 1D3TB 2FZZA 5FBEA 5FX6A 3F9HA 3KEEA 2FOBA 2VINA 4AZ2B 4GUXA 1Z8JB 3M5MA 4IN2A 3PM3A 2VWNA 1BMAA 4OGXA 1S81A 1K9OE 2JH0D 1QRWA 1NPMA 3LPRA 1P2MA 1ACBE 1MTSA 9LPRA 2WUCA 5C1XA 3R0FA 2XBVA 1MTUA 2OC1A 2ILNA 3P92A 1KSNA 1O35A 2ZU2A 4ABEA 3FANA 1O3HA 2BD8A 1W11U 1O2YA 3RXMA 5FXLA 1GI9B 1P02A 3GY7A 2A5AA 1TX6A 2BQWB 1FXYA 3M3VA 1ZZZA 1TBZH 3B23B 2G4TA 4GSOA 3LGWA 4WF8A 4UFEH 1K1IA 1C2EA 1PFXC 2H1UA 3SJOA 4X8UH 1FDPA 2ZC9H 1WQVH 3GCTG 1AIXH 1HAZB 2BYAX 2XBYA 1Q2WA 2R0KA 1YPKH 4CRBA 4X1SU 3KIDU 1WU1A 1TPOA 1LHGH 1C1UH 2J34A 1QY6A 4ZXXH 4ABAA 2Z3CA 5C67A 1TIOA 1TGBA 3S0NA 1YP9A 1LVYA 2AERH 1NRQH 1DUAA 3E16B 4ZHAA 2XRCA 3OX7U 1L2EA 3OTJE 4Q7ZA 1P2QA 3URCA 5ETXA 1GJAB 2HWLB 1EPTC 7KMEH 2CF8H 3TLOA 2VIWA 1GBFA 3M37A 4X6MA 4YM9A 2PKSB 2BD2A 4B74A 5FBIA 4BXWA 2Y82A 1ZJKA 1ARCA 3BTWE 3K6YA 3PROA 5I46H 1A4WH 3MH4A 2BQ6B 1W14U 2R2MB 3QWCH 2PW8H 1P11E 1GPZA 1JRTA 3NXPA 1ELBA 1B5GH 1ZMNA 3UNRA 5EW1H 4FUDA 2ZDLA 2ZF0H 4FVBA 3RXTA 3RU4D 3ELAH 3SV2H 3TJVA 1LKAA 1P09A 3C1KA 1EB1H 1PQ7A 1W3CA 1O3IA 3VGCC 1ELDE 1NRSH 4RN6A 3S7KB 2HNTF 1GHVH 5A0BA 2P93A 2WYGA 2AGGX 4K1EA 3FAOA 1RRKA 4YTAA 1V2KT 1YPGH 2BVSH 1HAOH 1O37A 2FYRA 1VGCB 2B0FA 1QFKH 1BTUA 3PTNA 1F0TA 5FPSA 4YOJA 1TMBH 3RM0H 3MU0A 4THNH 2F9UA 4I7YH 4B75A 2Y81A 2A7JA 5I25A 2H9EH 1QJ6B 3BIVH 4OS7A 4I33A 1G30B 2J2UA 3A80A 3GCHC 4ABBA 2C90B 5DO4H 4MNWA 1BB0B 2ZGJA 1C2GA 2ZIQH 2KAIA 1C1TA 4FU9A 5DPAA 1OYTH