2TIOA

Low packing density form of bovine beta-trypsin in cyclohexane
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-TRYPSIN)
publication title X-ray studies on two forms of bovine beta-trypsin crystals in neat cyclohexane.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tioA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tioA02
2TIOA 3A8CA 3A88A 3QGJA 2FP7B 2A5IA 2EEKA 1ID5H 2A4RA 1NRNH 2A4QA 5E0GA 5K0HA 1K1JA 1SFIA 1QA7A 2ZQ1A 4Y8ZA 2BLVA 1Q31A 5GCHG 5K7RA 4IMQA 2QXGA 3A87A 4OS7A 4D7FA 4H6TA 3SORA 1LHGH 1YC0A 3OY6U 5DP6A 1MKXK 2ZTZA 3VXFH 2J9NA 1ZRBA 2FODA 5GIBA 2I6QA 1ZMLA 1ELFA 2BXTH 1XX9A 1D9IA 4YT6H 1SC8U 1PYTD 2P16A 3QDZB 1K21H 3RMMH 3UIRA 4CRAA 3QUMP 2ZWLH 2ZEBA 3GYMA 3QTVH 1BJUA 1VJAU 1C5MD 1JXPA 1SL3A 2VNTA 3LC3A 3TK9A 5JYIA 3M5NA 1ETTH 3SQHE 1ZTJA 4WJG2 2QGRA 1LQDB 2P93A 4Q7YA 5E0HA 3MH6A 4K5ZA 1TNGA 1TRMA 1TGNA 4I31A 2ZF0H 4K69A 1XXFA 2R2MB 3EYDA 1GPZA 1Z7KA 3LU9B 1RXPA 2Y80A 3TJNA 2YNAA 5JBBS 1FY4A 1AFQC 1XVMA 3S9BA 3LGYA 3SUGA 1O32A 2XW9A 2OTVA 4ISIH 1EZQA 1GCDA 1WUNH 2DUCA 3A83A 1C9TA 1O2QA 4UONA 3FAOA 3RXSA 4H42U 2VH6A 1HAGE 5EXLA 5LPEA 3ZZ9A 1O3LA 5PTPA 4CR5A 1J17T 3RMLH 1C5LH 2OD3B 4OS6A 1MAXA 2ZFRH 5LPRA 3VPKA 1TNHA 3LGIA 2GT7A 1N8OC 4TPIZ 3T27A 2CXVA 1C9PA 2HRVA 5GCHF 1DANH 1PYTC 1GHYH 1UCYE 2OC8A 1CE5A 4CH8B 2ZDKA 3ZVEA 2PUQH 1N1LA 1TA2A 3B9FH 3OSYA 1HCGA 1EP6A 5JBTA 3K6ZA 1SB1H 4GCHF 1T4UH 2QN5T 2PKAA 1FI8A 1EAIA 3FP8E 4YO9A 1V2WT 1O3MA 1YPMH 3Q3XA 1B5GH 1AN1E 2DE8A 3GICB 2B8OH 1PPZA 1PPBH 1WYKA 2A7CA 4XBDA 3A81A 4H4FA 2ULLA 2R3YA 4BXSA 4DOQA 3EA8A 1O31A 2SFAA 4XFQA 4ZHLU 3JZ2B 4A1VA 1C2DA 2HNTE 4NIVA 1PPEE 4RKOB 1O2VA 5C1UA 5TJXA 2Z3EA 2ZFPH 2NU0E 1TNLA 1T31A 1GHVH 1GI6A 2GX4A 1P01A 2VWNA 1P2IA 1EXFA 3BIVH 4FUEA 1P09A 2XC0A 1A0LA 1QL9A 3SU3A 4E05H 1F5LA 1C5PA 2Q1JA 2OLGA 2HNTC 1DFPA 4TYDA 2UUFB 2CHAB 5DKMA 4ZKRU 3H7TA 1MZDA 2XYAA 4QT8C 2C93B 1F2SE 1O2RA 4WH6A 4RKJB 1CQQA 3QK1A 2KAIB 3QWCH 4CRGA 1XUHA 1AI8H 5LGOA 1TX6A 1ANEA 1DS2E 1SFQB 2QYIA 3TJUA 1TGSZ 4I8LA 1RJXB 3RXDA 5C67A 2O8WA 2R0KA 3ZVGA 1T8LA 3SU1A 4BTUB 5EQRA 1ZPBA 1WSSH 1XXDA 1GMCG 2R2WU 4NZQA 1YKTA 2GT8A 1E38B 1IQJA 2XTTB 1DUAA 1QL7A 3K9XB 1AU8A 1O2XA 1Y8TA 3UR9A 4NWKA 1MZAA 5FPTA 1F5RA 1AY6H 3LOXA 3R3GB 3ZZ5A 4ABAA 2ZG0H 2WPMS 1P3EA 1Z1IA 2VJ1A 2IPHA 3RXLA 3O8RA 3U8OH 1BMLA 1J8AA 4MPWA 2VGCC 2PLXA 5I46H 1HAHH 1KXBA 2AERH 1C5WB 1TONA 3RXRA 5L2ZH 2GZ9A 1O3AA 2CGAA 4WXVA 3TK5A 4AFUA 5DGJA 4Y11E 5DP4A 1UTKA 3LIWA 1BHXF 1W0YH 4A92A 2C4FH 1K1OA 4Y8XA 5IYTA 5EXMA 3GCHB 1C2GA 2PHBA 4Z6AH 3ZYEA 1NN6A 1BOQA 4MNVA 4YOIA 2IN2A 1AUJA 1THRH 2VWLA 2HLCA 3ZVBA 1JIMA 2Z9GA 2VIQA 5GXPA 3BN9A 1A46H 1FAXA 2ESTE 4Y0YE 2Y81A 4AORA 1OWEA 1N6XA 1F5KU 3FP6E 5A8YA 4B76A 1C1TA 3LKWA 1GHAG 2RG3A 2FX6A 1IQFA 1LHDH 2WUCA 3UREA 1LPKB 4O3UA 2VIVA 2ZHFH 1ELVA 1GCTC 4ZKOU 1CGJE 2BLQA 1GVKB 1C5YB 5JPMH 3E1XB 2A7JA 4GUXA 1AVWA 1QJ7B 1QJ6B 3ZV9A 3P70B 4INLA 1FY5A 3T28A 2BDBA 1GJ4H 1Y5AT 1HAXB 1TLDA 2JETB 1S83A 5E2PA 4HTCH 1TRYA 3MHWU 1NZQH 1KSNA 1RFNA 4UE7H 3MH5A 1ELEE 4X8TH 3SNDA 2D1JA 1DXWA 4O97A 4YOJA 2H5DA 3ENSB 1FUJA 3TITA 1GI2A 1C1WH 1K2I1 1QB6A 1O2TA 1IQHA 1NU9A 1DE7H 3LGTA 1V2QT 2GZ8A 3BTDE 3MNXA 3ZZCA 1INCA 1HAOH 1B7XB 1C1OA 1NM6A 2ZHQH 1THSH 5E2OA 3TNTA 2BDHA 3UQOA 1MAYA 3FP7E 4AG2A 5JB9S 4UFDH 1DXPA 3E90B 5GPIB 4X1RU 1S84A 2FMJA 3UOPA 1NFYA 5AVDA 2Y6TA 6ESTA 4UD9H 2Z94A 1TIOA 2BDAA 1O2WA 2FXRA 1ZGVA 3GCTG 2OBQA 4UFGH 3S9AA 5A0BA 4IN2A 4DY7B 1EAXA 2EA3A 1PQAA 1BMMH 3SGBE 1ELGA 2O8TA 3HK3B 3RXCA 3ATKA 3LDXH 3ZZDA 5GJ4B 3RP2A 1E36B 1QHRB 1UVPA 4NFEA 2ASUB 2G51A 1SR5C 2AIPA 2OQUA 1A3EH 3BV9B 1BTHH 4X6OA 2BM2A 2ALVA 4X0WU 4R0IA 2BY5X 1BB0B 1WOFA 1YPJH 1C1VH 1GGDC 1CGHA 4VGCB 3RXVA 1UTMA 1GDQA 3SJKA 1OYTH 3ZYDA 3W94A 4KTCA 2Q6GA 1C5SA 3T62A 4ASHA 1KXAA 3L33A 2A7HA 1H4WA 1ZSKA 5TCAA 1FAKH 1H9HE 4GAWA 1O2ZA 3P8FA 2AIQA 4I8GA 2FOAA 3P95A 3PO1B 3V13A 5FAHA 2H2ZA 1J15A 3V12A 3PWCA 1LO6A 1YYY1 2OUAA 1QA0A 1Z8JB 1V2TT 3TJOA 4E7RG 1HNEE 1Y3WA 3MU4A 1IQLA 4SGAE 1YCPM 2FDAA 3SNCA 1O3IA 3URDA 1BCUH 3TU7H 1RTLA 1O0DH 2GCHF 1RGQA 3M61U 4E7NA 1TAWA 1OPHB 2F9NA 2GV7A 1FPHH 1OWJA 3VXEH 2ALPA 3SI3H 1O3DA 2K1QA 1FQ3A 4I32A 3SUDA 2SNVA 3UUZA 1HBTH 1F0RA 4NCYA 2XRCA 3M3SA 1AMHA 3UR6A 2GMTB 1CHGA 1CHOF 1P57B 1FJSA 3UWJH 4JK5A 3NK8A 1LKAA 4JCNA 1AZ8A 2PUXB 2ZU5A 3TK6A 1HAYB 1EPTC 3F9HA 1MCVA 2FIRH 1UO6A 1Z1JA 4K3JA 1BMAA 2F9PA 2NU1E 3T2NA 2OQ5A 2OC1A 2Y5GA 1G32B 1BQYA 4J2YB 1GL1A 3HGNA 4K1SA 1SGTA 2SGEE 3BEFB 5CMXH 3MNBA 1KXEA 2CF8H 1BBRE 1XUGA 1SOZA 5ABWA 3VB3A 2J38A 3TGIE 1TX7A 2Y5FA 4AN7A 2ZPSA 4MPVA 1MD7A 5DPAA 4FU7A 1UHBA 1VR1H 1AB9C 1U6QA 2HNTF 3M3TA 5DP7A 5EU8A 1GJ7B 1D4PB 4B2AA 4MQAA 3DA9B 2C8XB 1G2LA 5DO4H 4UEHH 3ATWA 3PV4A 4YM9A 1C1UH 1AVGH 1E34B 1C4Y2 4I33A 4IC6A 7ESTE 7GCHG 1XUKA 1Q3XA 2G00A 1TRNA 1RTFB 1XUIA 2EI7A 4KTSA 5CHAC 4MG3A 1FV9A 3D65E 2QF3A 2V35A 2Z3CA 1HAVA 1QQUA 3KF2A 4NIXA 3QTOH 3T29A 2W3KA 2PR3A 5FCRA 3RMNH 2NU4E 2V0BA 1UVTH 1ARCA 1A4WH 3GY7A 1O2MA 1P03A 4NZLA 3RXKA 4AZ2B 5FX5A 3TH4H 1DWDH 2F9BH 3VB4A 2AYWA 1P05A 3SV8A 2B5TB 1G3CA 1C5NH 1GMDF 1O3OA 1RS0A 1XM1A 2HPPH 1MBMA 2BHGA 1FY8E 4ISOA 4TWYA 4FUBA 1OOKB 3SJ9A 5JDUB 2AGEX 1MTSA 2VIDA 3QZRA 6GCHF 5ESBA 2ZGJA 1O2YA 2BD2A 2A32A 1TALA 2QV1A 1ELDE 1OSSA 1C5RA 2XC5A 4D9QA 1SSXA 2EI6A 3FFGA 2C8ZB 1A61H 1KXCA 1HUTH 5EOKA 1BUIA 4K60A 2NWNA 3O8DA 1W0ZU 4HFPB 3EDXB 3LJOA 1OXGA 3SV2H 1B0FA 3PLPA 5JB8S 5LPFA 4Q7XA 2C90B 4ZXXH 3GYLB 1ESBA 5C5OA 1VGCC 3A7TA 1JMOH 3STIA 1PQ7A 4X1QU 5HGGA 2G81E 1DDJA 2EI8A 5F8XA 1QBNA 3LH1A 1KY9A 1NFWA 4XSKU 5HXFA 1JIRA 1O5EH 1N6YA 3RXFA 2PKSC 1NRSH 3E0NB 4LOYH 3V3MA 1MTUA 2BQ7B 1OWDA 2VIPA 3UFAA 4AFZA 3A82A 2FI4E 2A4OA 3QO6A 5F03A 1F7ZA 1A5GH 3AW0A 3F6UH 3NZIA 3VGCB 3LT3A 1L2EA 3TVJB 5FHTA 1EB1H 1TA6A 1V2VT 1PPHE 2PGQB 4Q80A 1E35B 2W7UA 4DIIH 3SNEA 3BSQA 1ABIH 3HKIB 3BTFE 1EQ9A 1XVOA 4K1EA 2VH0A 1GBDA 1GHXH 4XBBA 4GVUA 4F49A 4FUFA 2UUJB 4UDWH 1PPGE 1RIWB 1MTNC 2Z9LA 1AVXA 1GI0A 3BTWE 3KCGH 1JBUH 2F91A 2R3UA 2D8WA 5AFYH 1SVPA 3U1IB 1MKWH 1PJPA 2ZP0H 2ANYA 1P2MA 5CE1A 4BXWA 1UK4A 2QY0B 1ZHPA 2Z6BD 3ZZ4A 3G01A 2WPLS 1O2HA 1QBVH 4JZIA 3E3TA 4O3TA 3SBKA 2UWOA 1GI5A 4X2VA 3B8JA 2PV9B 1TMBH 1G3DA 2OCVB 3BIUH 4FVDA 4ABGA 2SNWA 3RXBA 1TPPA 1NESE 2D26C 4JZFH 4IS5A 1WAYB 1YPLH 4FUIA 2FPZA 1FY1A 2HOBA 2WYJA 1Z6EA 1EJMA 1LVYA 1AHTH 1YLCA 2VINA 1G3EA 2H9EH 3RXHA 3BTTE 1ZPZA 2PTCE 4MNWA 1FIZA 1O3FA 1MD8A 1GL0E 2V3HH 5HMAA 1O38A 4MNYA 1C2KA 2AGIX 3M35A 1EJNA 1O3JA 1D3DB 3LPRA 3CENA 2IOTA 4WVPE 3E8LA 2ZFFH 1DLKB 1IQKA 4XOJA 1EZXC 4ZHMU 1O5FH 1FZZA 1QRWA 1YM0A 3D23A 4FU9A 1DX5M 1Y59T 2BYAX 4CHAC 3L3TA 3ZZ7A 1YPHE 1SHYA 3ODFA 4WMEA 5F8TA 1GJ8B 3MH4A 1G30B 1YPHC 2TRMA 1MKWK 2STBE 1DM4B 1CGIE 3M37A 4YOGA 3RXGA 4X2YA 4LXBH 1HFDA 1ZHRA 1LVOA 2GGVB 3ITIA 2SGQE 1FY3A 3BTME 1TNKA 3SU5A 1BRAA 1EPTA 1ZHMA 2QXJA 2ZPQA 3A8BA 3JZ1B 1EX3A 4D9RA 1SGNE 1SGEE 3GY3A 1L0ZA 1QQ4A 1GHWH 3CS7A 1G9IE 6LPRA 2NU3E 3SHAH 2J92A 3KL6A 1AD8H 2FWWA 4OS2A 1SMFE 1GGDB 4ZUHA 3O8BA 4D76A 1GMHG 1SQTA 2ZHDA 3TGJE 1UK2A 4OS5A 3S69A 1V2JT 1EAWA 1Y3XA 5JBAS 1X7AC 1V2LT 2Y7ZA 3Q76A 2GKVE 1QBOA 2RCEA 1ZPCA 3EQ0H 1ZZZA 1KYNA 4B74A 1WBGB 5GDSH 8LPRA 1ZRKA 4AYVB 1O3EA 5DP8A 3PWBA 2TGTA 1GG6B 3C1KA 3SU2A 1BTUA 5BPEA 2A1DB 4NFFA 1CBWB 2C8YB 1ZMJA 5F6MA 1D6RA 2G52A 2V6NA 1A2CH 3RC5A 2BXUH 1BMNH 1SLVB 2VWMA 2PKAB 5TCCA 1MU6B 2QXIA 1YCPH 2P59A 1IHTH 1SI5H 2BTCE 3K65B 1HLTH 2OXSA 4MNXA 3MU1A 3SV7A 4O9VA 1O2LA 2A0QB 2TGDA 2BZAA 3BEUA 1L4DA 2D2DA 1GBEA 4K8YA 5H4IB 3F9GA 2BY8X 4YESB 2G55A 3UWIA 1QR3E 1VJ9U 2ANKH 1D6WA 1SG8B 2OINA 4X6NA 1ABJH 1C2IA 1WQVH 4ZHAA 1GJDB 3M5OA 2O8LA 2Z9IA 1VITH 1TQ7B 3MO3A 2BQ6B 1MCTA 3MMGA 1GJAB 1KLIH 1VCQA 3VFEA 6CHAB 2Z7FE 3P17H 1AB9B 1GBCA 1G3BA 2ZA5A 1UTLM 3BG4B 1C5OH 2JKHA 3FZZA 1UVSH 2ZU1A 4OGYA 1O3CA 1SGFG 1A5IA 1C5TA 1K1LA 1GHZA 2A31A 1BTZA 3T25A 1LQEA 3ZVAA 1C1SA 2BVRH 1SGQE 3HK6B 4FUHA 4INKA 2F3CE 5L2YH 2WPIS 1GMCF 1UJ1A 3BG8A 3DFLA 1DUEA 2GTBA 3RXQA 1A1RA 2ZHEH 2Q6FA 7LPRA 2FX4A 4XDEA 4TY6A 5ETXA 2ILNA 2Q6DA 1H1BA 1H9IE 1YCPK 1BTPA 4Q2KA 2ZGBH 3ZVDA 2P8OC 1O3GA 1MBQA 4D7GA 1ZYOA 2G4TA 3Q3YA 3O8CA 1GHBG 2GCTC 4Y8YA 1YLDA 4BAMB 3P6ZB 3V0XA 5F8ZA 1BHXB 1O3KA 1O2SA 3FZDA 1W13U 1LHFH 2SGPE 1QFKH 2BVSH 1ACBE 3U8RH 2XWAA 2H6MA 1ARBA 1BDAA 3E6PH 2BD4A 1THPB 3UPEA 4CREA 2IJOB 3Q3KA 4CRDA 3PMHB 1QL8A 1UMAH 2QIQA 4ZMAH 3F68H 2ZDMA 1DOJA 3KQDA 2SGDE 2THFB 2XC4A 3A7YA 1L1GA 1Q2WA 1SOTA 3F9EA 1ELTA 3SJOA 3U98H 1PPCE 5A2MH 4FUGA 2W7SA 1H9LB 2VWOA 2HALA 3RXTA 2BOKA 4DURA 2ZHWH 1ELBA 3TH2H 1IQEA 4BANB 3UY9A 1DITH 5HM2A 3B23B 2FS9A 1HIAA 1E0FD 1GHAF 3AAUA 2PW8H 1NS3A 1YP9A 4H6SB 3RXIA 3KEEA 3NWUA 1Z8RA 2XXLA 5DP5A 1C5XB 1VGCB 2VU8E 4AG1A 1Z8GA 3HPTB 1LDTT 3MNCA 1DY9A 5LH8A 1AWFH 3RLWH 4I7YH 2ZC9H 2P3TB 2H9TH 4IGDA 2BD9A 3NUMA 4THNH 1HJAB 1SHHB 3TNSA 1TBZH 3LGWA 1DICA 1NO9H 2ODYB 3SV6A 1AKSA 3E91A 4NIYA 1O2PA 3VB7A 5A8ZA 4JZ1A 4NIWA 4B2BA 3BEIB 2HPQH 4X8SH 3SUEA 4ZAEA 5FXLA 1ZMNA 1P06A 3RXEA 1GI4A 1NROH 1IQNA 3P8OA 3K6YA 4ABEA 5EW2H 1NRQH 3H7OA 1VCWA 2FLBH 2QAAA 1HPGA 2CHAC 1F92A 3PM3A 1T8MA 4KKDA 4MTBA 2AS9A 5L6NH 3PMBB 4X8VH 2ODPA 7KMEH 4YLUA 2R0LA 4Y7AA 3N7OA 2OBOA 4BOHA 4PROA 2ZCLP 1EATA 3A80A 1FNIA 1Y5BT 1PPFE 1V2UT 4U01A 1P10A 5BRRE 1ZSJA 3MU0A 1QB9A 3GCTF 5FBIA 3E0PB 4U2WA 2FI3E 2BD5A 1EKBB 4TPYA 1TGCA 1BJVA 3STJA 1H8IH 3U69H 4BAOB 1GI1A 1HJ9A 1HYLA 1D3QB 3RXJA 1AFEH 3T26A 4WMFA 3PLKA 2ZDNA 1AFQB 1MH0A 3SNAA 2C8WB 1TWXB 1MMJN 4Y76A 3RUOA 1Z8IB 8GCHG 1W2KH 5T3HA 2JH5D 4GPGA 1O2IA 3GISB 2ZTYA 4E06H 1QRXA 2G4UA 1A5HA 3DUXH 5SGAE 3NXPA 1FDPA 1W14U 4FVBA 3KIDU 2VVUA 2PSYA 3DHKH 3OTJE 4X6MA 4MPXA 1WQSA 4ABDA 3KHVA 2WPKS 3C27B 4X1NU 3HKJB 1OP0A 3GCHC 1WU1A 5DP9A 1O34A 1IQMA 1N8OB 1O3HA 1O2KA 2M5TA 4ISHH 1S0QA 3UNSA 1KDQA 1UTQA 3TIUA 2FTLE 1TGTA 2AGGX 1IHSH 2QA9E 5T6GA 1E37B 2F9OA 3A7WA 3QZQA 5EW1H 2Z3DA 3MI4A 4NA7A 2GV6A 4X6PA 2J2UA 2A4GA 4NSVA 1VITG 2JH0D 4JYTA 4GSOA 4DW2U 3HGPA 1W3CA 4WF8A 1SGCA 2BY7X 2EC9H 2A2XH 1DWCH 3EE0B 4I8KA 1TYNA 1S85A 1BRCE 4AB9A 2B7DH 1UTNA 2I6SA 1XMNB 2FS8A 2VB0A 1LHEH 2ZCKP 2BD8A 3A7XA 3RXMA 3ATLA 4IBLH 4RSPA 2JETC 1C1MA 1K22H 3LH3A 3SO3A 3A7VA 5HYOA 4BAHB 4ZXYH 4NA8A 2BVXH 1V3XA 1YF4A 1C5VA 1O30A 2XNIA 1MQ6A 1JRTA 3U8TH 2GP9B 3TGKE 2FOGA 1CO7E 2XBXA 1UHBB 5AHGH 1S82A 5DP3A 2V3OH 4B71A 1OWIA 4U32A 3EAJA 4YLQH 4IMZA 4MVNA 4NWLA 1YPKH 5EG4A 3A89A 3SZNA 4Y71A 3BTKE 1EJAA 1CT4E 4X1SU 5FBEA 1F0TA 3GY2A 3SU6A 1F0SA 1GDNA 3SN8A 1T8OA 4MLFB 2P3FH 1QURH 4Y10E 1JRSA 1TB6H 2OP9A 1TNIA 2FM2A 7GCHF 3UOUA 5IDKA 5B6OA 5DJ7A 2CV3A 3NPSA 2BLOA 3I29A 1HAVB 3D49H 5GWZA 1TPOA 2J95A 1TPAE 4FU8A 4J1YA 1IOEA 3A7ZA 1C2HA 4A7IB 2WV4A 2FOFA 2VGCB 3ZZ8A 5FPSA 1G2MA 4OGXA 3VEQB 4JMYA 4DIHH 3MU8A 1OP2A 2YNBA 1C1QA 3M7QA 1A3BH 4JYVH 3ESTA 2LNCA 4VGCC 4LZ4B 1G36A 1DWEH 1NY22 1BTWA 1QB1A 4HI3A 4TWWA 3RXPA 1GI3A 1ELAA 5J4SA 4D8NA 1AE5A 3MNSA 4ABFA 1O3PB 3DFJA 3M7TA 3Q77A 2PWXA 3ZZ3A 1HAIH 1EP5A 1EOLA 3CS0A 3SU0A 3M5MA 1B0EA 3GY8A 3ZV8A 4Q7ZA 2QC2A 1GBHA 2UUYA 4BTIB 3PO1C 2XCNA 2ZQ2A 3KGPA 1WTHD 1H8DH 1P2KA 1SQAA 1HRTH 1P12E 1RD3B 2ZU3A 4B75A 1BRBE 5JBCS 2ANWA 9ESTA 3PYHA 3QX5H 2FESH 2W3IA 2CMYA 2FOBA 4BAQB 1V2OT 2BMGB 1V2RT 1BITA 1GJBB 3VB6A 1PQ5A 4HZHA 2A5AA 5I25A 1EASA 3A85A 4OS4A 2XBWA 2ZKSA 2FOHA 2WYGA 4GCHG 1BT7A 1D3PB 1GCTB 4AGJA 1GBTA 3MTYA 2ZCHP 4AFSA 1WV7H 4XBCA 3MU5A 1LVMA 1DT2A 1UK3A 3KQEA 1NC6A 3TPIZ 2GMTC 1J9CH 2P3UB 1OP8A 5C1YA 1C2FA 1YGCH 3M3VA 3AAVA 3MFJA 1AO5A 2P8OB 1IQIA 1SLWB 2GCTB 2AMPA 1FONA 1W10U 3I77A 2WPHS 2UUKB 1QCPA 5EQQA 2CN0H 4ZKNU 3ATMA 2WUBA 2YOLA 1KXFA 3SJ8A 1GBFA 3RC6A 1KTSB 5C2ZA 3KNXA 3V7TA 2A2QH 2FYQA 2KAIA 4LZ1H 1EOJA 3GCOA 3OY5U 1TOMH 3BTEE 1S5SA 3GY4A 1OX1A 1UCYH 1UVOA 4K2YA 1TPSA 1YPGH 3LC5A 4O03A 4RN6A 1S81A 3PTNA 1RRKA 3PTBA 1O39A 1HGTH 4IC5A 4B1TA 5FCKA 2XBVA 1Z71A 3A86A 1ZR0A 4BNRA 1LHCH 3Q00A 5EXNA 1WTGH 1DY8A 1O36A 3IWMA 4I8JA 4ABHA 5J4QA 1GWAA 2FO9A 2ZIQH 4JK6A 3M36A 4AYYB 1C2JA 5T6FA 3LGUA 3WY8A 2FLRH 1CU1A 3UNQA 3KN2A 3D62A 1OWKA 2QCYA 2VVVA 4JYUH 2CJIA 2TGPZ 5A09A 2SGAA 2ZECA 5FPYA 3F9FA 1TX8A 4XE4A 3RMOH 1CA0C 1QNJA 3ODDA 3U9AH 2ZDAH 4Z0KA 1C2LA 3SU4A 1TMTH 1QTFA 1K1PA 2AFQB 1P04A 2O8UA 1ZOMA 2FZZA 1O37A 1GI8B 1GI7B 1MTWA 1LVBA 4NG9H 1P2QA 1P2NA 4B73A 3U1JB 1HXFH 1GBMA 4FUDA 3CP7A 4NSYA 2ZDVH 2ZGXH 4K1TA 5E0JA 1W7XH 1L1NA 1KIGH 3TH3H 4CRCA 3GCNA 1KLJH 1CSOE 3ZVFA 1K28D 1XUJA 1O3NA 1P0SH 3M5LA 3RXUA 1TBRH 2O8MA 5DG6A 3A84A 3AASA 1UCYK 1K1IA 1O3BA 4DGJA 1CA8B 3GDVA 3GY6A 1W12U 1J14A 1TBQH 3P8GA 4WH8A 1V2ST 2ZNKH 3SV9A 1FLEE 5A8XA 1SGIB 3S7HB 3RXOA 4DT7B 4CH2B 2H9HA 3QN7A 3LGVA 1S6HA 1TOCB 4I8HA 1SLXB 1WCZA 5E8EH 1EPTB 2J4IA 2B9LA 4MDSA 1GJ9B 1JOUB 2BDCA 1KTTB 2ANMH 2Y5HA 3OU0A 1V2PT 4ABJA 1GJ5H 1EZUC 1S6FA 3FVFB 4YT7H 3PLBA 2G5NA 8ESTE 1D3TB 3ZVCA 2ZGCA 4CBNA 1OWHA 1AE8H 1SPJA 4Y79A 1DPOA 3DT0H 9LPRA 1CVWH 1GMHF 4YTAA 1NFXA 1HXEH 3VGCC 3RU4D 1DLEA 1ESAA 2Y82A 1NRPH 4GLYA 3QLPH 3S0NA 1J16A 2FEQH 4NGAH 3RU4T 2STAE 2P94A 1IAUA 3SGAE 1BRUP 3M7UA 2HGTH 3A8AA 3ATIA 2QXHA 4MPUA 3P92A 1SLUB 3LONA 4JZEH 2J94A 4IW4E 2R9PA 5C1XA 2FYRA 1RIWC 2ZFQH 3SOSA 4AB8A 1YPEH 4U30A 1OKXA 2BLWA 3P8NA 1FN6A 3RXAA 1AUTC 2AMDA 1GBLA 1LKBA 1UTOA 1G37A 4K8BA 1GBAA 5CHAB 1ZSLA 3SJIA 1C1PA 3NKKA 5AFZH 2VIWA 3BTQE 2SGFE 4A1TA 4ESTE 4CBOA 1C2EA 1AGJA 1LPZB 3UQVA 4SGBE 4YZUA 1FPCH 4ZH8A 1DSUA 2ODQA 1ETRH 2WPJS 4CRBA 1FN8A 1SGDE 5DK1A 3RU4E 2PSXA 1ETSH 2BB4A 2QF0A 3FANA 3TLOA 1TABE 4B2CA 2GD4B 3NCLA 2BX4A 2ZU2A 4BTTB 2AH4X 1XKBC 1ZGIA 3L6PA 4IN1A 2GDDA 1BTYA 1BZXE 2TGAA 1NU7B 3ELAH 1O5DH 1TMUH 1C1RA 1EB2A 1GBJA 1TNJA 1O2JA 2H5CA 1W11U 4UFFH 8KME2 1O2NA 1DVAH 1LPGB 2ZDLA 2F9VA 1GDUA 1NFUA 3ZZBA 2ZGHA 3KQCA 4Y6DA 3MO9A 2F9UA 2TPIZ 3PMJA 4ABIA 1MU8B 2ZFTA 4ZROA 2CF9H 3ZZ6A 1HDTH 2GVFA 1BIOA 5AF9H 5FX6A 5C20A 1SBWA 1TQ0B 1V2KT 2FOEA 1SGFA 1ZTKA 3MO6A 2GCHG 1O2GH 1A0HB 1SGYE 5A0CA 4AFQA 4CR9A 3BTGE 4UFEH 1PQ8A 2UWPA 4A1XA 4A5TS 3IITA 1NPMA 1ZJKA 2UWLA 1O5CB 1ORFA 1FMGA 1CHOG 1LMWB 1TGBA 1XKAC 3IG6B 1O2OA 1W7GH 5ESTE 2A45B 2P95A 3T5FH 3RDZA 1GBBA 3VB5A 1IQGA 4DG4A 3TJVA 3EA7A 2W5EA 4GHQA 3GDUA 3MOCA 2FOMB 2FOCA 1BTXA 3HATH 4NA9H 2FTMA 2F83A 4WY3A 1HJ8A 1TE0A 3AW1A 1MTVA 1GHBF 4WWYA 2PKSB 1O5GH 2ZPRA 1S0RA 2W26A 1ANBA 1AWHB 1HAZB 3SQEE 1AQ7A 1V2NT 3E16B 1O33A 2Y7XA 2HVXA 5T6DA 1SGRE 3S7KB 1T7CA 4M7GA 2J34A 1PFXC 4KP0A 1QIXB 1C2MA 1A0JA 4TY7A 3A8DA 5A0AE 1MUEB 1P9SA 1QRZA 1QJ1B 1ESTA 2AMQA 1KXDA 1A7SA 2ZTXA 1P02A 2RA3A 1K1MA 4LK4A 1UVUH 2BX3A 1Z6JH 1XUFA 1MTNB 1EZSC 1GG6C 3EA9A 2RDLA 1FIWA 4HGCA 4OS1A 1CBWC 4FUCA 2Z9JA 2JH6D 1HIAB 1V6DA 1C4U2 4DJZB 2C3SA 5EODA 1ZJDA 1ZTLA 4FXGH 1ANCA 1VCPA 1C5QA 3EGKH 1AIXH 3OX7U 4X8UH 4BAKB 1K1NA 2OC0A 1AZZA 1Y3YA 3GY5A 1GBIA 1NT1A 1GMDG 4GHTA 1AKSB 1BBRH 1M9UA 1L4ZA 1TFXA 3H5CB 2TBSA 1C1NA 2A5KA 2FI5E 2BD3A 2PFEA 2GDEH 6GCHG 2G8TA 3DD2H 5G4BA 4AOQA 1NTPA 2GZ7A 4KELA 2G5VA 3MH7A 1W8BH 3LJJA 3SGQE 2BDIA 1GBKA 2VIOA 3PB1E 1KLTA 1GJ6A 1Y5UT 3BF6H 4WXIA 3UTUH 2H1UA 1HV7A 1MQ5A 1P11E 1DWBH 2ZO3H 1NRRH 5L30H 6CHAC 1UTJA 2WINI 5EPYA 4ISLA 2BDYA 2XCFA 5C3NA 3BG4C 5EPNA 1GVZA 1CT0E 2B0FA 4CHAB 1T8NA 2NU2E 1SGPE 1T4VH 1K9OE 1QGFA 3AVZA 1GVLA 4X2WA 3URCA 3SW2B 3W95A 4A6LA 3MYWA 3OYPA 4ABBA 2PTNA 2BY9X 1HAPH 1Y3VA 2ZU4A 3RM2H 3K2UA 4CRFA 4JZDH 1SQOA 3R0FA 1P9UA 1RTKA 1YBWA 1FXYA 2DE9A 2ZZUH 1UTPA 2BY6X 1OS8A 4X1PU 2BD7A 1LTOA 1EAUA 2OC7A 3UNRA 3BTHE 2BOHB 1ZLRA 3RLYH 1CA0B 1HB0B 3SUFA 1BBRK 3RC4A 4DVAU 1O2UA 3I78A 8GCHF 3SI4H 4WMDA 1F0UA 1P2OA 4FUJA 5EQSA 2BZ6H 1P8VC 2RA0A 4AGKA 1P3CA 4ZKSU 3KQBA 4INHA 2Z9KA 2XBYA 1O5BB 3SNBA 1MKXH 4KTUA 1ANDA 1GI9B 1LCYA 2O9QA 2BDGA 2ZFSA 4KGAA 1VZQH 1KDQB 3ZZAA 1JWTA 1Y3UA 1DSTA 1T32A 2LPRA 2VVCA 1BA8B 2WV5A 4DCDA 3SHCH 4R8TB 1EUFA 3F1SB 1O35A 2PGBB 3RM0H 4Y7BA 1C5UA 3PMAB 1CT2E 3MWIU 3PROA 3QGNB 4ISNA 1C4V2 1VITF 5HM9A 2BQWB 2XWBI 2ZI2H 4X2XA 3S9CA 2AEIH 1QY6A 2HWLB 4AX9H 3GDSA 1HJAC 1V2MT 3GOVB 5C5NA 1GJCB 1P2JA 5EGMA 4Y0ZE 1C5ZB 4F4OC 1L1JA 1ELCA 1OYQA 1O5AB
chains in the Genus database with same CATH superfamily
2TIOA 3A8CA 3A88A 3QGJA 2FP7B 2A5IA 2EEKA 1ID5H 2A4RA 1NRNH 4F48B 2A4QA 5E0GA 5K0HA 1K1JA 1SFIA 1QA7A 2ZQ1A 4Y8ZA 2BLVA 1Q31A 5GCHG 5K7RA 4IMQA 2QXGA 3A87A 4OS7A 4D7FA 4H6TA 3SORA 1LHGH 1YC0A 3OY6U 5DP6A 1MKXK 2ZTZA 3VXFH 2J9NA 1ZRBA 2FODA 5GIBA 2I6QA 1ZMLA 1ELFA 2BXTH 1XX9A 2QF4A 1D9IA 4YT6H 1SC8U 1PYTD 2P16A 3QDZB 1K21H 3RMMH 3UIRA 4CRAA 3QUMP 4Z1MD 2ZWLH 2ZEBA 3GYMA 3QTVH 1BJUA 1VJAU 1C5MD 1JXPA 1SL3A 3OAAD 2VNTA 3LC3A 3TK9A 5JYIA 3M5NA 1ETTH 3SQHE 1ZTJA 4WJG2 2QGRA 1YLNA 1LQDB 2P93A 4Q7YA 5E0HA 3MH6A 4K5ZA 1TNGA 1TRMA 1QZ8A 1TGNA 4I31A 2ZF0H 4K69A 1XXFA 2R2MB 3EYDA 1GPZA 1Z7KA 3LU9B 1RXPA 2Y80A 3TJNA 2YNAA 5JBBS 1FY4A 1AFQC 1XVMA 3S9BA 3LGYA 3SUGA 1O32A 2XW9A 2OTVA 4ISIH 1EZQA 1GCDA 1WUNH 2DUCA 3A83A 5HIYA 1C9TA 1O2QA 4UONA 3FAOA 1E1QD 3RXSA 4H42U 2VH6A 1HAGE 5EXLA 5LPEA 3ZZ9A 1O3LA 5PTPA 4CR5A 1J17T 3RMLH 1C5LH 2OD3B 4OS6A 1MAXA 2ZFRH 5LPRA 3VPKA 1TNHA 3LGIA 2GT7A 1N8OC 4TPIZ 3T27A 2CXVA 1C9PA 2HRVA 5GCHF 1DANH 1PYTC 1GHYH 1UCYE 2OC8A 1CE5A 4CH8B 2ZDKA 1UW7A 3ZVEA 2PUQH 1N1LA 1TA2A 3B9FH 5C0TA 3OSYA 1HCGA 1EP6A 5JBTA 3K6ZA 1SB1H 4P00A 4GCHF 1T4UH 2QN5T 2PKAA 1FI8A 2XNDD 1EAIA 3FP8E 4YO9A 1V2WT 1O3MA 1YPMH 3Q3XA 1B5GH 1AN1E 2DE8A 1WDIA 3GICB 2B8OH 1PPZA 1PPBH 1WYKA 2A7CA 4XBDA 3A81A 4H4FA 2ULLA 2R3YA 4BXSA 4DOQA 3EA8A 1O31A 2SFAA 4XFQA 4ZHLU 3JZ2B 4A1VA 1C2DA 2HNTE 4NIVA 1PPEE 1S6LA 1O2VA 4RKOB 5C1UA 5TJXA 2Z3EA 2ZFPH 2NU0E 1TNLA 1T31A 1GHVH 1GI6A 2GX4A 1P01A 2VWNA 1P2IA 1EXFA 3BIVH 4FUEA 1P09A 2XC0A 1A0LA 1FX0B 1QL9A 3SU3A 1F5LA 1C5PA 4E05H 2Q1JA 2OLGA 2HNTC 1DFPA 4TYDA 2RFKC 2UUFB 2CHAB 5DKMA 4ZKRU 3H7TA 1MZDA 2XYAA 4QT8C 2C93B 1F2SE 1O2RA 4WH6A 4RKJB 1CQQA 3QK1A 2KAIB 3QWCH 4CRGA 1XUHA 1AI8H 5LGOA 1TX6A 1ANEA 1DS2E 1SFQB 2QYIA 3TJUA 1TGSZ 4I8LA 1RJXB 3RXDA 5C67A 2O8WA 3FN8A 2R0KA 3ZVGA 1T8LA 3SU1A 4BTUB 5EQRA 1E79D 1ZPBA 1WSSH 1H8HD 1XXDA 1GMCG 2R2WU 4RT1A 4NZQA 1YKTA 2GT8A 1E38B 4M9FA 1IQJA 2XTTB 1DUAA 1QL7A 3K9XB 3DCLA 1AU8A 1O2XA 1Y8TA 3UR9A 4NWKA 1MZAA 5FPTA 1F5RA 3DSPA 1AY6H 3LOXA 3R3GB 3ZZ5A 4ABAA 2ZG0H 2WPMS 1P3EA 1Z1IA 2VJ1A 4I86A 2IPHA 3RXLA 3O8RA 3U8OH 4P02A 3OTPA 1BMLA 1J8AA 4MPWA 2VGCC 2PLXA 5I46H 1HAHH 1KXBA 2AERH 1C5WB 1TONA 3RXRA 5L2ZH 2GZ9A 1O3AA 2CGAA 4WXVA 3TK5A 4AFUA 5DGJA 4Y11E 5DP4A 1UTKA 3LIWA 1BHXF 1W0YH 4A92A 2C4FH 1K1OA 4Y8XA 5IYTA 5EXMA 3GCHB 1C2GA 2PHBA 4Z6AH 3ZYEA 1NN6A 1BOQA 4MNVA 4YOIA 2IN2A 1AUJA 1THRH 5DSFA 2VWLA 2HLCA 3ZVBA 1JIMA 3F2FA 2Z9GA 2VIQA 5GXPA 3BN9A 1A46H 1FAXA 2ESTE 4Y0YE 2Y81A 4AORA 1OWEA 1N6XA 1F5KU 3FP6E 1COWD 5A8YA 4B76A 1C1TA 2QF5A 3LKWA 1GHAG 2RG3A 2FX6A 1IQFA 1LHDH 2WUCA 3F0PA 3UREA 1LPKB 4O3UA 2VIVA 2ZHFH 1ELVA 1GCTC 4ZKOU 1CGJE 2BLQA 1GVKB 1C5YB 5JPMH 3E1XB 2A7JA 4GUXA 1AVWA 1QJ7B 1QJ6B 3ZV9A 3P70B 4INLA 1FY5A 3T28A 2BDBA 1GJ4H 1Y5AT 1HAXB 2L74A 1TLDA 2JETB 1S83A 5E2PA 4HTCH 1TRYA 3MHWU 1NZQH 1KSNA 1RFNA 4UE7H 3MH5A 1ELEE 4X8TH 3SNDA 2D1JA 1DXWA 4O97A 4YOJA 2H5DA 3ENSB 1FUJA 3TITA 1GI2A 1C1WH 1K2I1 1QB6A 1O2TA 1IQHA 1NU9A 4RI0A 1DE7H 3LGTA 1V2QT 1W0KD 2GZ8A 3BTDE 3MNXA 3ZZCA 1INCA 1HAOH 1B7XB 1C1OA 1NM6A 2ZHQH 1THSH 5E2OA 3TNTA 2BDHA 3UQOA 1MAYA 3FP7E 4AG2A 5JB9S 4UFDH 1DXPA 3E90B 5GPIB 2WV9A 4X1RU 1S84A 2FMJA 3UOPA 1NFYA 5AVDA 2Y6TA 6ESTA 4UD9H 2Z94A 1TIOA 2BDAA 1O2WA 2FXRA 1ZGVA 3GCTG 2OBQA 4UFGH 3S9AA 5A0BA 2V3MA 4IN2A 4DY7B 1EAXA 2EA3A 1PQAA 1BMMH 3SGBE 1ELGA 2O8TA 3HK3B 3RXCA 3ATKA 3LDXH 3ZZDA 2J98A 5GJ4B 3RP2A 1E36B 1QHRB 1UVPA 4NFEA 2ASUB 4DT4A 2G51A 1SR5C 2AIPA 2OQUA 1A3EH 3BV9B 1BTHH 4X6OA 5KECA 2BM2A 2ALVA 4X0WU 4R0IA 2BY5X 1BB0B 2OK5A 1WOFA 1EFRD 1YPJH 2F4LA 1C1VH 1GGDC 1CGHA 4VGCB 3RXVA 1UTMA 1GDQA 3SJKA 1OYTH 3ZYDA 3W94A 4KTCA 2Q6GA 1C5SA 3T62A 4ASHA 1KXAA 3L33A 2A7HA 1H4WA 1ZSKA 5TCAA 1FAKH 1H9HE 4GAWA 1O2ZA 3P8FA 2AIQA 4I8GA 2FOAA 3P95A 2LELA 3PO1B 3V13A 2WHXA 5FAHA 2H2ZA 1J15A 3H09A 3V12A 3PWCA 1LO6A 1YYY1 2OUAA 1QA0A 1Z8JB 1V2TT 3TJOA 4E7RG 1HNEE 1Y3WA 3MU4A 1IQLA 4SGAE 1YCPM 3SYJA 2FDAA 3SNCA 1O3IA 3URDA 1BCUH 3TU7H 1RTLA 1O0DH 2GCHF 1RGQA 3M61U 4E7NA 1TAWA 1OPHB 2KCYA 1BMFD 3F2HA 2F9NA 2GV7A 1FPHH 1OWJA 3VXEH 2ALPA 3SI3H 1O3DA 2K1QA 1FQ3A 4I32A 3SUDA 2SNVA 3UUZA 1HBTH 3FO8D 1F0RA 4NCYA 2XRCA 3M3SA 1AMHA 3UR6A 2GMTB 1CHGA 1CHOF 1P57B 1FJSA 3UWJH 4JK5A 3NK8A 1LKAA 4JCNA 1AZ8A 2PUXB 2ZU5A 4TT3D 3TK6A 1HAYB 1EPTC 3F9HA 1MCVA 2FIRH 4Q4LA 1UO6A 1Z1JA 4K3JA 1BMAA 2F9PA 2NU1E 3T2NA 2OQ5A 2OC1A 2Y5GA 1G32B 1BQYA 4J2YB 1GL1A 3HGNA 4K1SA 1SGTA 2SGEE 3BEFB 5CMXH 3MNBA 1KXEA 2CF8H 1BBRE 1XUGA 1SOZA 5ABWA 3VB3A 2J38A 3TGIE 1TX7A 2Y5FA 4AN7A 2ZPSA 4MPVA 1MD7A 5DPAA 4FU7A 1UHBA 1VR1H 1AB9C 1U6QA 2HNTF 3M3TA 5DP7A 5EU8A 1GJ7B 1D4PB 4B2AA 4MQAA 3DA9B 2C8XB 1G2LA 5DO4H 4UEHH 3ATWA 3PV4A 4YM9A 1C1UH 1AVGH 1E34B 1C4Y2 4I33A 4IC6A 7ESTE 7GCHG 1XUKA 2KM0A 1Q3XA 2G00A 1TRNA 1RTFB 1XUIA 2EI7A 4KTSA 5CHAC 4MG3A 1FV9A 3D65E 2QF3A 2V35A 2Z3CA 1HAVA 1QQUA 3KF2A 4NIXA 2J97A 3QTOH 3T29A 2W3KA 2PR3A 5FCRA 3RMNH 2NU4E 2V0BA 1UVTH 1ARCA 1A4WH 3GY7A 1O2MA 1P03A 4NZLA 3RXKA 4AZ2B 5FX5A 3TH4H 1DWDH 2F9BH 3VB4A 2AYWA 1P05A 3SV8A 2B5TB 4B6EA 1G3CA 1C5NH 1GMDF 1O3OA 1RS0A 1XM1A 2HPPH 1MBMA 2BHGA 1FY8E 4ISOA 4TWYA 4FUBA 1OOKB 1NBMD 3SJ9A 5JDUB 2AGEX 1MTSA 2VIDA 3QZRA 6GCHF 5ESBA 2ZGJA 1O2YA 2BD2A 2A32A 1TALA 2QV1A 1ELDE 1OSSA 1C5RA 2XC5A 4D9QA 1SSXA 4RT0A 2EI6A 3FFGA 2C8ZB 1A61H 1KXCA 1HUTH 5EOKA 1BUIA 4K60A 2NWNA 3O8DA 1W0ZU 4HFPB 3EDXB 3LJOA 1OXGA 3SV2H 1B0FA 3PLPA 5JB8S 5LPFA 4Q7XA 2C90B 4ZXXH 3GYLB 1ESBA 5C5OA 1VGCC 3A7TA 1JMOH 3STIA 1PQ7A 4X1QU 5HGGA 2G81E 1DDJA 2EI8A 1NBME 5F8XA 1QBNA 2JJ2D 3LH1A 1KY9A 2WPDD 1NFWA 4XSKU 5HXFA 1JIRA 1O5EH 1N6YA 2QE7D 3RXFA 2PKSC 1NRSH 3E0NB 3NRLA 4LOYH 3W1EA 3V3MA 1MTUA 2BQ7B 1OWDA 2VIPA 3UFAA 4AFZA 2HVYB 3A82A 2FI4E 2A4OA 3QO6A 5F03A 1F7ZA 1A5GH 3AW0A 3F6UH 3NZIA 3VGCB 3LT3A 1L2EA 3TVJB 5FHTA 1EB1H 1TA6A 1V2VT 1PPHE 2PGQB 4Q80A 1E35B 2W7UA 4DIIH 3SNEA 3BSQA 1ABIH 3HKIB 3BTFE 1EQ9A 1XVOA 4K1EA 2VH0A 1GBDA 1GHXH 5EJ1A 4XBBA 4GVUA 4F49A 4FUFA 2UUJB 4UDWH 1PPGE 3KYFA 1RIWB 1MTNC 2Z9LA 1AVXA 4ACAA 1GI0A 3BTWE 3KCGH 3MQKC 1JBUH 2F91A 2R3UA 2D8WA 3PRDA 5AFYH 1SVPA 3U1IB 1MKWH 1PJPA 2ZP0H 2ANYA 3WWBA 1P2MA 5CE1A 4BXWA 1UK4A 2QY0B 1ZHPA 2Z6BD 3ZZ4A 3G01A 2WPLS 1O2HA 1QBVH 4JZIA 3E3TA 4O3TA 3SBKA 2UWOA 1GI5A 4X2VA 3B8JA 2PV9B 1TMBH 1G3DA 2OCVB 3BIUH 4FVDA 4ABGA 2SNWA 3RXBA 1TPPA 1NESE 2D26C 4JZFH 4IS5A 1WAYB 1YPLH 4FUIA 4XD7D 2FPZA 2IPQX 1FY1A 2HOBA 2WYJA 1Z6EA 1EJMA 1LVYA 1AHTH 1YLCA 2VINA 1G3EA 2H9EH 3RXHA 1SKYE 3BTTE 1ZPZA 2PTCE 4MNWA 1FIZA 1O3FA 1MD8A 1GL0E 2V3HH 5HMAA 1O38A 4MNYA 1C2KA 2AGIX 3M35A 1EJNA 2KX4A 1O3JA 1D3DB 3UAIC 3LPRA 3CENA 2IOTA 4WVPE 3E8LA 2ZFFH 1DLKB 1IQKA 4XOJA 1EZXC 4ZHMU 1O5FH 1FZZA 1QRWA 1YM0A 3D23A 4FU9A 1DX5M 1Y59T 2BYAX 4CHAC 3L3TA 3ZZ7A 1YPHE 3N99A 1SHYA 3ODFA 4WMEA 5F8TA 1GJ8B 2YMSB 3MH4A 5GNDA 5FL7D 1G30B 1YPHC 2TRMA 1MKWK 2STBE 1DM4B 1CGIE 3M37A 4YOGA 3RXGA 4X2YA 4LXBH 1HFDA 1ZHRA 1LVOA 2GGVB 3ITIA 2SGQE 1FY3A 3BTME 2KR7A 1TNKA 3SU5A 1BRAA 1EPTA 1ZHMA 2QXJA 2ZPQA 5C17A 3A8BA 3JZ1B 1EX3A 4D9RA 1SGNE 1SGEE 3GY3A 1L0ZA 1QQ4A 1GHWH 3CS7A 1G9IE 6LPRA 2NU3E 3SHAH 2J92A 3KL6A 1AD8H 2FWWA 4OS2A 1SMFE 5HIZA 1GGDB 4ZUHA 3O8BA 4D76A 1GMHG 1SQTA 2V7QD 2ZHDA 3TGJE 1UK2A 4OS5A 3S69A 1V2JT 1EAWA 1Y3XA 5JBAS 1X7AC 1V2LT 2Y7ZA 3Q76A 2GKVE 1QBOA 2RCEA 1ZPCA 3EQ0H 1MABB 1ZZZA 1KYNA 4B74A 1WBGB 5GDSH 8LPRA 1ZRKA 4AYVB 1O3EA 5DP8A 3PWBA 2TGTA 1GG6B 2L6OA 3C1KA 3SU2A 1BTUA 5BPEA 2KCAA 2A1DB 4NFFA 1CBWB 2C8YB 1ZMJA 5F6MA 1D6RA 2G52A 2V6NA 1A2CH 3RC5A 2BXUH 1BMNH 3PV5A 1SLVB 2VWMA 2PKAB 5TCCA 1MU6B 2QXIA 1YCPH 1IHTH 1SI5H 2BTCE 2P59A 3K65B 1HLTH 2OXSA 4MNXA 3MU1A 3SV7A 4O9VA 1O2LA 2A0QB 2TGDA 2BZAA 3BEUA 1L4DA 2D2DA 2LP6A 1GBEA 4K8YA 5H4IB 3F9GA 2BY8X 4YESB 2G55A 3UWIA 1QR3E 1VJ9U 2ANKH 1D6WA 3F0OA 3KYGA 1SG8B 2OINA 4X6NA 1ABJH 1C2IA 1WQVH 4ZHAA 1GJDB 3M5OA 2O8LA 2Z9IA 1VITH 1TQ7B 3MO3A 2BQ6B 1MCTA 3MMGA 1GJAB 1KLIH 1VCQA 3VFEA 6CHAB 2Z7FE 3P17H 1AB9B 1GBCA 1G3BA 2ZA5A 1UTLM 3BG4B 1C5OH 2JKHA 3FZZA 1UVSH 2ZU1A 4OGYA 1O3CA 1SGFG 1A5IA 1C5TA 1K1LA 1GHZA 3OEHD 2A31A 1BTZA 3T25A 2J5UA 1LQEA 3ZVAA 1C1SA 2BVRH 1SGQE 3HK6B 4FUHA 4INKA 2F3CE 5L2YH 2WPIS 1GMCF 1UJ1A 3BG8A 3DFLA 1DUEA 2GTBA 3RXQA 1A1RA 2ZHEH 2Q6FA 7LPRA 2FX4A 4XDEA 4TY6A 5ETXA 2ILNA 2Q6DA 5B6LA 1H1BA 2EQNA 1H9IE 1YCPK 1BTPA 4Q2KA 2ZGBH 3ZVDA 2P8OC 1O3GA 1MBQA 4D7GA 2KCOA 1ZYOA 2G4TA 3Q3YA 3O8CA 1GHBG 2GCTC 4Y8YA 1YLDA 2GJGA 4BAMB 5CHBA 3P6ZB 3V0XA 5F8ZA 1BHXB 1O3KA 1O2SA 3FZDA 1W13U 1LHFH 2SGPE 1QFKH 2BVSH 1ACBE 3U8RH 2XWAA 2H6MA 1ARBA 1BDAA 3E6PH 2BD4A 1THPB 3UPEA 4CREA 2IJOB 3Q3KA 4CRDA 3PMHB 1QL8A 1UMAH 2QIQA 2WSSD 4ZMAH 3F68H 2ZDMA 3F2GA 1DOJA 3KQDA 2SGDE 2THFB 3DSGA 2XC4A 3A7YA 1L1GA 1Q2WA 1SOTA 3F9EA 1ELTA 3SJOA 3U98H 1PPCE 5A2MH 4FUGA 2W7SA 1H9LB 2VWOA 2HALA 3RXTA 2BOKA 4DURA 2ZHWH 1ELBA 3TH2H 1IQEA 4BANB 3UY9A 1DITH 5HM2A 3B23B 2FS9A 1HIAA 1E0FD 1GHAF 3AAUA 2PW8H 1NS3A 1YP9A 4H6SB 3RXIA 3KEEA 3NWUA 1Z8RA 2XXLA 5DP5A 1C5XB 1VGCB 2VU8E 4AG1A 1W0JD 1Z8GA 3HPTB 1LDTT 3MNCA 1DY9A 5LH8A 1AWFH 3RLWH 4I7YH 2ZC9H 2P3TB 2H9TH 4IGDA 2BD9A 3NUMA 2RDEA 1HJAB 1SHHB 4THNH 3TNSA 1TBZH 1H8ED 3LGWA 1YY3A 1DICA 1NO9H 2ODYB 3SV6A 1AKSA 3E91A 3N7DA 4NIYA 1O2PA 3VB7A 3EE7A 5A8ZA 4JZ1A 4NIWA 4B2BA 3BEIB 2HPQH 4X8SH 3SUEA 4ZAEA 5FXLA 1ZMNA 1P06A 3RXEA 1GI4A 1NROH 1IQNA 3P8OA 3K6YA 3ZIAD 4ABEA 5EW2H 1NRQH 3H7OA 1VCWA 2FLBH 2QAAA 1HPGA 2CHAC 1F92A 3PM3A 1T8MA 4KKDA 4MTBA 2AS9A 5L6NH 3PMBB 4X8VH 2ODPA 7KMEH 4YLUA 2R0LA 4FETA 4Y7AA 3N7OA 2OBOA 4BOHA 4PROA 2ZCLP 1EATA 2K0QA 3A80A 1FNIA 1Y5BT 1PPFE 1V2UT 4U01A 1P10A 5BRRE 1ZSJA 3MU0A 1QB9A 3GCTF 5FBIA 3CNRA 3E0PB 4U2WA 2FI3E 2BD5A 1EKBB 4YXWD 4TPYA 1TGCA 1BJVA 2J98B 3STJA 1H8IH 3U69H 4AC9A 2CK3D 4BAOB 1GI1A 1HJ9A 1HYLA 1D3QB 3RXJA 1AFEH 3T26A 4WMFA 3PLKA 2ZDNA 1AFQB 1MH0A 3SNAA 2C8WB 2KFWA 1TWXB 1MMJN 4HG6A 4Y76A 3RUOA 1Z8IB 8GCHG 1W2KH 5T3HA 2JH5D 4GPGA 1O2IA 3WWFA 3GISB 2ZTYA 4E06H 1QRXA 2G4UA 1A5HA 3DUXH 5SGAE 3NXPA 1FDPA 1W14U 4FVBA 3KIDU 2IJD1 2VVUA 2PSYA 3DHKH 3OTJE 4X6MA 4MPXA 1WQSA 4ABDA 3KHVA 2WPKS 3C27B 4X1NU 3HKJB 1OP0A 3GCHC 1WU1A 5DP9A 1O34A 4OM9A 1IQMA 1N8OB 1O3HA 1O2KA 2M5TA 4ISHH 1S0QA 3UNSA 1KDQA 1UTQA 3PV2A 3TIUA 2FTLE 1TGTA 2AGGX 1IHSH 2QA9E 5T6GA 1E37B 2F9OA 3A7WA 3F3BA 3QZQA 5EW1H 2Z3DA 3MI4A 4NA7A 2GV6A 4X6PA 2J2UA 3U28C 2A4GA 4NSVA 1VITG 2KZ4A 2JH0D 4JYTA 4GSOA 4DW2U 3HGPA 1W3CA 4WF8A 1SGCA 2BY7X 2EC9H 3GS9A 2A2XH 1DWCH 3EE0B 4I8KA 1TYNA 1S85A 1BRCE 4AB9A 2B7DH 1UTNA 2I6SA 1XMNB 4B6FA 2FS8A 2VB0A 1LHEH 2ZCKP 2BD8A 3A7XA 3RXMA 3ATLA 4IBLH 4RSPA 2JETC 1C1MA 1K22H 3LH3A 3SO3A 3A7VA 5HYOA 4BAHB 4ZXYH 4NA8A 2BVXH 1V3XA 1YF4A 1C5VA 1O30A 2XNIA 1MQ6A 1JRTA 3U8TH 2GP9B 3TGKE 2FOGA 1CO7E 2XBXA 1UHBB 5AHGH 1S82A 5DP3A 2V3OH 4B71A 1OWIA 4U32A 3EAJA 4YLQH 4IMZA 4MVNA 4NWLA 4TSFD 1YPKH 5EG4A 3A89A 3SZNA 3AK5A 4Y71A 3BTKE 1EJAA 1CT4E 4X1SU 5FBEA 1F0TA 3GY2A 3SU6A 1F0SA 1GDNA 3SN8A 1T8OA 4MLFB 2P3FH 1QURH 4Y10E 1JRSA 1TB6H 2OP9A 1TNIA 2FM2A 7GCHF 3UOUA 5IDKA 5B6OA 5DJ7A 2CV3A 3NPSA 2BLOA 3I29A 1HAVB 3D49H 5GWZA 1TPOA 2J95A 1TPAE 4FU8A 5DN6D 4J1YA 1IOEA 3A7ZA 1C2HA 4A7IB 2WV4A 2FOFA 2VGCB 3ZZ8A 5FPSA 1G2MA 4OGXA 3VEQB 2XOKD 4JMYA 4DIHH 3MU8A 1OP2A 2YNBA 1C1QA 3M7QA 1A3BH 4JYVH 3ESTA 2LNCA 4VGCC 4LZ4B 1G36A 1DWEH 1NY22 1BTWA 1QB1A 4HI3A 4TWWA 3RXPA 1GI3A 1ELAA 5J4SA 4D8NA 1AE5A 3MNSA 4ABFA 1O3PB 3DFJA 3M7TA 3Q77A 2PWXA 3ZZ3A 1HAIH 1EP5A 2JDID 1EOLA 3CS0A 3SU0A 3M5MA 1B0EA 3GY8A 3UB0A 3ZV8A 4Q7ZA 2QC2A 1GBHA 2UUYA 4BTIB 3PO1C 2XCNA 2ZQ2A 3KGPA 1WTHD 3PRBA 1H8DH 1P2KA 1SQAA 1HRTH 1P12E 1RD3B 2ZU3A 4B75A 1BRBE 5JBCS 2ANWA 9ESTA 3PYHA 3QX5H 2FESH 2W3IA 2CMYA 2FOBA 4BAQB 1V2OT 5F53A 2BMGB 2PP6A 4XRNA 1V2RT 1BITA 1GJBB 3VB6A 1PQ5A 4HZHA 2A5AA 5I25A 5T1VA 1EASA 3A85A 4OS4A 2XBWA 2ZKSA 2FOHA 2WYGA 4GCHG 1BT7A 1D3PB 1GCTB 4AGJA 1GBTA 3MTYA 2ZCHP 4AFSA 1WV7H 4XBCA 3MU5A 1LVMA 1DT2A 1UK3A 3KQEA 1NC6A 3TPIZ 2GMTC 1J9CH 2P3UB 1OP8A 5C1YA 1C2FA 1YGCH 3M3VA 3AAVA 3MFJA 3WW7A 1AO5A 2P8OB 1IQIA 1SLWB 2GCTB 2AMPA 1FONA 2M2AA 1W10U 3I77A 2WPHS 2UUKB 1QCPA 5EQQA 2CN0H 4ZKNU 3ATMA 2WUBA 2YOLA 1KXFA 3SJ8A 1GBFA 3RC6A 1KTSB 5C2ZA 3KNXA 3V7TA 2A2QH 2FYQA 2KAIA 4LZ1H 1EOJA 3GCOA 3OY5U 1TOMH 3BTEE 1S5SA 3GY4A 1OX1A 1UCYH 1UVOA 4K2YA 1TPSA 1YPGH 3LC5A 4O03A 4RN6A 1S81A 3PTNA 1RRKA 3PTBA 1O39A 1HGTH 4IC5A 4B1TA 5FCKA 2XBVA 1Z71A 3A86A 1ZR0A 4FOUC 4BNRA 1LHCH 3Q00A 5EXNA 1WTGH 1DY8A 1O36A 3IWMA 4I8JA 5CDFE 4ABHA 5J4QA 1GWAA 2FO9A 2ZIQH 4JK6A 3M36A 4AYYB 1C2JA 5T6FA 3LGUA 3WY8A 2FLRH 1CU1A 3UNQA 3KN2A 3D62A 1OWKA 2QCYA 2VVVA 4JYUH 2CJIA 2TGPZ 5A09A 2SGAA 2ZECA 5FPYA 3F9FA 1TX8A 4XE4A 3RMOH 1CA0C 1QNJA 3ODDA 3U9AH 2ZDAH 4Z0KA 1C2LA 3SU4A 4ASUD 1TMTH 1QTFA 1K1PA 1KMHB 2AFQB 1P04A 2O8UA 1ZOMA 2FZZA 1O37A 1GI8B 1GI7B 1MTWA 1LVBA 4NG9H 1P2QA 1P2NA 4B73A 3U1JB 1HXFH 1GBMA 4FUDA 3CP7A 4NSYA 2ZDVH 2ZGXH 4K1TA 2KCPA 5E0JA 1W7XH 1L1NA 1KIGH 3TH3H 4CRCA 3GCNA 1KLJH 1CSOE 3ZVFA 1K28D 1XUJA 1O3NA 1P0SH 3M5LA 3RXUA 1TBRH 2O8MA 5DG6A 3A84A 3AASA 1UCYK 1K1IA 1O3BA 4DGJA 1CA8B 3GDVA 3GY6A 1W12U 1J14A 1TBQH 3P8GA 4WH8A 1V2ST 2ZNKH 3SV9A 1FLEE 5A8XA 1SGIB 3S7HB 3RXOA 4DT7B 4CH2B 2H9HA 3QN7A 2HLDD 3LGVA 1S6HA 1TOCB 4I8HA 1SLXB 1WCZA 5E8EH 1EPTB 2J4IA 5KEDA 2B9LA 4MDSA 1GJ9B 1JOUB 2BDCA 1KTTB 2ANMH 2Y5HA 3OU0A 1V2PT 4ABJA 1GJ5H 1EZUC 1S6FA 3FVFB 4YT7H 3PLBA 2G5NA 8ESTE 1D3TB 3ZVCA 2ZGCA 4CBNA 1OWHA 1AE8H 1SPJA 4Y79A 1DPOA 3DT0H 9LPRA 1CVWH 1GMHF 4YTAA 1NFXA 1HXEH 3VGCC 3RU4D 1DLEA 1ESAA 2Y82A 1NRPH 4GLYA 3QLPH 3S0NA 1J16A 2FEQH 4NGAH 3RU4T 2STAE 2P94A 1IAUA 3SGAE 4F55A 1BRUP 3M7UA 2HGTH 2JIZD 3A8AA 3ATIA 2QXHA 4MPUA 3P92A 1SLUB 3LONA 4JZEH 2J94A 4IW4E 2R9PA 3KQ5A 2FYRA 1RIWC 2ZFQH 3SOSA 5C1XA 4AB8A 1YPEH 4U30A 1OKXA 2BLWA 3P8NA 1FN6A 3RXAA 1AUTC 2AMDA 1GBLA 1LKBA 1UTOA 1G37A 4K8BA 1GBAA 5CHAB 1ZSLA 3SJIA 1C1PA 2W6ID 3NKKA 5AFZH 2VIWA 3BTQE 2YMSD 2SGFE 4A1TA 4ESTE 4CBOA 3FKSD 1C2EA 1AGJA 1LPZB 3UQVA 4SGBE 4YZUA 1FPCH 4ZH8A 1DSUA 2ODQA 3DSOA 1ETRH 2WPJS 4CRBA 1SQRA 1FN8A 1SGDE 5DK1A 3RU4E 2PSXA 1ETSH 2AHME 2BB4A 2QF0A 3FANA 3TLOA 1TABE 4B2CA 5C94A 2GD4B 3NCLA 2BX4A 2ZU2A 4BTTB 2AH4X 1XKBC 1ZGIA 3L6PA 4IN1A 2GDDA 1BTYA 1BZXE 2TGAA 1NU7B 3ELAH 1O5DH 1TMUH 1C1RA 1EB2A 1GBJA 1TNJA 1O2JA 2H5CA 1W11U 4UFFH 8KME2 1O2NA 1DVAH 1LPGB 2ZDLA 2F9VA 1GDUA 1NFUA 3ZZBA 2ZGHA 3KQCA 3OEED 3MO9A 2F9UA 2TPIZ 3PMJA 4Y6DA 1MU8B 4ABIA 2ZFTA 4ZROA 2CF9H 3ZZ6A 1HDTH 2GVFA 1BIOA 5AF9H 5FX6A 5C20A 1SBWA 1TQ0B 1V2KT 2FOEA 1SGFA 1ZTKA 1OHHD 3MO6A 2GCHG 1O2GH 1A0HB 1SGYE 5A0CA 4AFQA 4CR9A 4Q63A 3BTGE 4UFEH 1PQ8A 2UWPA 4A1XA 4A5TS 3IITA 1NPMA 2YMSC 1ZJKA 2UWLA 5EIYA 1VKYA 1O5CB 1ORFA 1FMGA 1CHOG 1LMWB 1TGBA 1XKAC 3IG6B 1O2OA 1W7GH 5ESTE 2A45B 2P95A 3T5FH 3RDZA 1GBBA 3VB5A 1IQGA 4DG4A 3TJVA 3EA7A 2W5EA 4GHQA 3GDUA 3MOCA 2FOMB 2FOCA 1BTXA 3HATH 1K0HA 4NA9H 2FTMA 2F83A 4WY3A 1HJ8A 1TE0A 5HKKD 3AW1A 1MTVA 1GHBF 4WWYA 2PKSB 1O5GH 2ZPRA 1S0RA 2W26A 1ANBA 1AWHB 1HAZB 3SQEE 1AQ7A 1V2NT 3E16B 1O33A 2Y7XA 2HVXA 5T6DA 1SGRE 3S7KB 1T7CA 4M7GA 2J34A 1PFXC 4KP0A 1QIXB 1C2MA 1A0JA 4TY7A 5KGOA 1WXRA 3A8DA 5A0AE 1MUEB 1P9SA 2F43B 1QRZA 1QJ1B 1ESTA 2AMQA 1KXDA 1A7SA 2ZTXA 1P02A 2RA3A 1K1MA 4LK4A 1UVUH 2BX3A 1Z6JH 1XUFA 3N7EA 1MTNB 1EZSC 1GG6C 3EA9A 2RDLA 1FIWA 3OE7D 4HGCA 4OS1A 1CBWC 5EJZA 5IK2D 4FUCA 2Z9JA 2JH6D 1HIAB 1V6DA 1C4U2 4DJZB 2C3SA 3OFND 5EODA 1ZJDA 1ZTLA 4FXGH 5C0UA 1YWUA 1ANCA 1VCPA 1C5QA 3EGKH 1AIXH 3OX7U 4X8UH 4BAKB 1K1NA 2OC0A 1AZZA 1Y3YA 3GY5A 1GBIA 3VG8A 1NT1A 1GMDG 4GHTA 1AKSB 1BBRH 1M9UA 1L4ZA 1TFXA 3H5CB 2TBSA 1C1NA 2W6JD 2A5KA 3SZEA 2FI5E 2BD3A 5EJLA 2PFEA 2GDEH 6GCHG 2G8TA 3DD2H 5G4BA 4AOQA 1NTPA 2GZ7A 4KELA 2G5VA 3MH7A 1W8BH 3LJJA 3SGQE 2BDIA 1GBKA 2VIOA 3PB1E 1KLTA 1GJ6A 1Y5UT 3BF6H 4WXIA 3UTUH 2H1UA 1HV7A 1MQ5A 1P11E 1DWBH 2ZO3H 1NRRH 5L30H 6CHAC 4ZCNA 1UTJA 2JJ1D 2WINI 1E1RD 5EPYA 4ISLA 2BDYA 2XCFA 5C3NA 3BG4C 5EPNA 1GVZA 1CT0E 2B0FA 4CHAB 3FOAA 1T8NA 2NU2E 1SGPE 1T4VH 1K9OE 1QGFA 3AVZA 1GVLA 4X2WA 3URCA 3SW2B 2EY4C 3W95A 4A6LA 2VBCA 3MYWA 3OYPA 4ABBA 2PTNA 2BY9X 1HAPH 1Y3VA 2ZU4A 3RM2H 3K2UA 4CRFA 4JZDH 1SQOA 3R0FA 1P9UA 1RTKA 1YBWA 1FXYA 2DE9A 2ZZUH 1UTPA 2BY6X 1OS8A 4X1PU 2BD7A 1LTOA 1EAUA 2OC7A 3UNRA 3BTHE 2BOHB 1ZLRA 3RLYH 1CA0B 1HB0B 3SUFA 1BBRK 3RC4A 4DVAU 1O2UA 3I78A 8GCHF 3SI4H 4WMDA 1F0UA 1P2OA 4FUJA 2WZQA 5EQSA 2BZ6H 1P8VC 2RA0A 4AGKA 1P3CA 4ZKSU 3KQBA 4INHA 2Z9KA 2XBYA 1O5BB 3SNBA 1MKXH 4KTUA 1ANDA 1GI9B 1LCYA 2O9QA 2BDGA 2ZFSA 4KGAA 1VZQH 1KDQB 4ACBA 3ZZAA 1JWTA 1Y3UA 1DSTA 1T32A 2LPRA 2VVCA 1BA8B 2WV5A 4DCDA 3SHCH 4R8TB 1EUFA 3F1SB 1O35A 2PGBB 3RM0H 4Y7BA 1C5UA 3PMAB 1CT2E 3MWIU 3PROA 3QGNB 4ISNA 1C4V2 1VITF 5HM9A 2BQWB 2XWBI 2ZI2H 4X2XA 3S9CA 2K8IA 2AEIH 1QY6A 2HWLB 4AX9H 3GDSA 1HJAC 1V2MT 3GOVB 5C5NA 1GJCB 1P2JA 5EGMA 4Y0ZE 1C5ZB 4F4OC 1L1JA 1ELCA 1OYQA 1O5AB
chains in the Genus database with same CATH topology
2TIOA 3A8CA 3A88A 3QGJA 2FP7B 2A5IA 2EEKA 1ID5H 2A4RA 1NRNH 2A4QA 5E0GA 5K0HA 1K1JA 1SFIA 1QA7A 2ZQ1A 4Y8ZA 2BLVA 1Q31A 5GCHG 5K7RA 4IMQA 2QXGA 3A87A 4OS7A 4D7FA 4H6TA 3SORA 1LHGH 1YC0A 3OY6U 5DP6A 1MKXK 2ZTZA 3VXFH 2J9NA 1ZRBA 2FODA 5GIBA 2I6QA 1ZMLA 1ELFA 2BXTH 1XX9A 1D9IA 4YT6H 1SC8U 1PYTD 2P16A 3QDZB 1K21H 3RMMH 3UIRA 4CRAA 3QUMP 2ZWLH 2ZEBA 3GYMA 3QTVH 1BJUA 1VJAU 1C5MD 1JXPA 1SL3A 2VNTA 3LC3A 3TK9A 5JYIA 3M5NA 1ETTH 3SQHE 1ZTJA 4WJG2 2QGRA 1LQDB 2P93A 4Q7YA 5E0HA 3MH6A 4K5ZA 1TNGA 1TRMA 1TGNA 4I31A 2ZF0H 4K69A 1XXFA 2R2MB 3EYDA 1GPZA 1Z7KA 3LU9B 1RXPA 2Y80A 3TJNA 2YNAA 5JBBS 1FY4A 1AFQC 1XVMA 3S9BA 3LGYA 3SUGA 1O32A 2XW9A 2OTVA 4ISIH 1EZQA 1GCDA 1WUNH 2DUCA 3A83A 1C9TA 1O2QA 4UONA 3FAOA 3RXSA 4H42U 2VH6A 1HAGE 5EXLA 5LPEA 3ZZ9A 1O3LA 5PTPA 4CR5A 1J17T 3RMLH 1C5LH 2OD3B 4OS6A 1MAXA 2ZFRH 5LPRA 3VPKA 1TNHA 3LGIA 2GT7A 1N8OC 4TPIZ 3T27A 2CXVA 1C9PA 2HRVA 5GCHF 1DANH 1PYTC 1GHYH 1UCYE 2OC8A 1CE5A 4CH8B 2ZDKA 3ZVEA 2PUQH 1N1LA 1TA2A 3B9FH 3OSYA 1HCGA 1EP6A 5JBTA 3K6ZA 1SB1H 4GCHF 1T4UH 2QN5T 2PKAA 1FI8A 1EAIA 3FP8E 4YO9A 1V2WT 1O3MA 1YPMH 3Q3XA 1B5GH 1AN1E 2DE8A 3GICB 2B8OH 1PPZA 1PPBH 1WYKA 2A7CA 4XBDA 3A81A 4H4FA 2ULLA 2R3YA 4BXSA 4DOQA 3EA8A 1O31A 2SFAA 4XFQA 4ZHLU 3JZ2B 4A1VA 1C2DA 2HNTE 4NIVA 1PPEE 4RKOB 1O2VA 5C1UA 5TJXA 2Z3EA 2ZFPH 2NU0E 1TNLA 1T31A 1GHVH 1GI6A 2GX4A 1P01A 2VWNA 1P2IA 1EXFA 3BIVH 4FUEA 1P09A 2XC0A 1A0LA 1QL9A 3SU3A 4E05H 1F5LA 1C5PA 2Q1JA 2OLGA 2HNTC 1DFPA 4TYDA 2UUFB 2CHAB 5DKMA 4ZKRU 3H7TA 1MZDA 2XYAA 4QT8C 2C93B 1F2SE 1O2RA 4WH6A 4RKJB 1CQQA 3QK1A 2KAIB 3QWCH 4CRGA 1XUHA 1AI8H 5LGOA 1TX6A 1ANEA 1DS2E 1SFQB 2QYIA 3TJUA 1TGSZ 4I8LA 1RJXB 3RXDA 5C67A 2O8WA 2R0KA 3ZVGA 1T8LA 3SU1A 4BTUB 5EQRA 1ZPBA 1WSSH 1XXDA 1GMCG 2R2WU 4NZQA 1YKTA 2GT8A 1E38B 1IQJA 2XTTB 1DUAA 1QL7A 3K9XB 1AU8A 1O2XA 1Y8TA 3UR9A 4NWKA 1MZAA 5FPTA 1F5RA 1AY6H 3LOXA 3R3GB 3ZZ5A 4ABAA 2ZG0H 2WPMS 1P3EA 1Z1IA 2VJ1A 2IPHA 3RXLA 3O8RA 3U8OH 1BMLA 1J8AA 4MPWA 2VGCC 2PLXA 5I46H 1HAHH 1KXBA 2AERH 1C5WB 1TONA 3RXRA 5L2ZH 2GZ9A 1O3AA 2CGAA 4WXVA 3TK5A 4AFUA 5DGJA 4Y11E 5DP4A 1UTKA 3LIWA 1BHXF 1W0YH 4A92A 2C4FH 1K1OA 4Y8XA 5IYTA 5EXMA 3GCHB 1C2GA 2PHBA 4Z6AH 3ZYEA 1NN6A 1BOQA 4MNVA 4YOIA 2IN2A 1AUJA 1THRH 2VWLA 2HLCA 3ZVBA 1JIMA 2Z9GA 2VIQA 5GXPA 3BN9A 1A46H 1FAXA 2ESTE 4Y0YE 2Y81A 4AORA 1OWEA 1N6XA 1F5KU 3FP6E 5A8YA 4B76A 1C1TA 3LKWA 1GHAG 2RG3A 2FX6A 1IQFA 1LHDH 2WUCA 3UREA 1LPKB 4O3UA 2VIVA 2ZHFH 1ELVA 1GCTC 4ZKOU 1CGJE 2BLQA 1GVKB 1C5YB 5JPMH 3E1XB 2A7JA 4GUXA 1AVWA 1QJ7B 1QJ6B 3ZV9A 3P70B 4INLA 1FY5A 3T28A 2BDBA 1GJ4H 1Y5AT 1HAXB 1TLDA 2JETB 1S83A 5E2PA 4HTCH 1TRYA 3MHWU 1NZQH 1KSNA 1RFNA 4UE7H 3MH5A 1ELEE 4X8TH 3SNDA 2D1JA 1DXWA 4O97A 4YOJA 2H5DA 3ENSB 1FUJA 3TITA 1GI2A 1C1WH 1K2I1 1QB6A 1O2TA 1IQHA 1NU9A 1DE7H 3LGTA 1V2QT 2GZ8A 3BTDE 3MNXA 3ZZCA 1INCA 1HAOH 1B7XB 1C1OA 1NM6A 2ZHQH 1THSH 5E2OA 3TNTA 2BDHA 3UQOA 1MAYA 3FP7E 4AG2A 5JB9S 4UFDH 1DXPA 3E90B 5GPIB 4X1RU 1S84A 2FMJA 3UOPA 1NFYA 5AVDA 2Y6TA 6ESTA 4UD9H 2Z94A 1TIOA 2BDAA 1O2WA 2FXRA 1ZGVA 3GCTG 2OBQA 4UFGH 3S9AA 5A0BA 4IN2A 4DY7B 1EAXA 2EA3A 1PQAA 1BMMH 3SGBE 1ELGA 2O8TA 3HK3B 3RXCA 3ATKA 3LDXH 3ZZDA 5GJ4B 3RP2A 1E36B 1QHRB 1UVPA 4NFEA 2ASUB 2G51A 1SR5C 2AIPA 2OQUA 1A3EH 3BV9B 1BTHH 4X6OA 2BM2A 2ALVA 4X0WU 4R0IA 2BY5X 1BB0B 1WOFA 1YPJH 1C1VH 1GGDC 1CGHA 4VGCB 3RXVA 1UTMA 1GDQA 3SJKA 1OYTH 3ZYDA 3W94A 4KTCA 2Q6GA 1C5SA 3T62A 4ASHA 1KXAA 3L33A 2A7HA 1H4WA 1ZSKA 5TCAA 1FAKH 1H9HE 4GAWA 1O2ZA 3P8FA 2AIQA 4I8GA 2FOAA 3P95A 3PO1B 3V13A 5FAHA 2H2ZA 1J15A 3V12A 3PWCA 1LO6A 1YYY1 2OUAA 1QA0A 1Z8JB 1V2TT 3TJOA 4E7RG 1HNEE 1Y3WA 3MU4A 1IQLA 4SGAE 1YCPM 2FDAA 3SNCA 1O3IA 3URDA 1BCUH 3TU7H 1RTLA 1O0DH 2GCHF 1RGQA 3M61U 4E7NA 1TAWA 1OPHB 2F9NA 2GV7A 1FPHH 1OWJA 3VXEH 2ALPA 3SI3H 1O3DA 2K1QA 1FQ3A 4I32A 3SUDA 2SNVA 3UUZA 1HBTH 1F0RA 4NCYA 2XRCA 3M3SA 1AMHA 3UR6A 2GMTB 1CHGA 1CHOF 1P57B 1FJSA 3UWJH 4JK5A 3NK8A 1LKAA 4JCNA 1AZ8A 2PUXB 2ZU5A 3TK6A 1HAYB 1EPTC 3F9HA 1MCVA 2FIRH 1UO6A 1Z1JA 4K3JA 1BMAA 2F9PA 2NU1E 3T2NA 2OQ5A 2OC1A 2Y5GA 1G32B 1BQYA 4J2YB 1GL1A 3HGNA 4K1SA 1SGTA 2SGEE 3BEFB 5CMXH 3MNBA 1KXEA 2CF8H 1BBRE 1XUGA 1SOZA 5ABWA 3VB3A 2J38A 3TGIE 1TX7A 2Y5FA 4AN7A 2ZPSA 4MPVA 1MD7A 5DPAA 4FU7A 1UHBA 1VR1H 1AB9C 1U6QA 2HNTF 3M3TA 5DP7A 5EU8A 1GJ7B 1D4PB 4B2AA 4MQAA 3DA9B 2C8XB 1G2LA 5DO4H 4UEHH 3ATWA 3PV4A 4YM9A 1C1UH 1AVGH 1E34B 1C4Y2 4I33A 4IC6A 7ESTE 7GCHG 1XUKA 1Q3XA 2G00A 1TRNA 1RTFB 1XUIA 2EI7A 4KTSA 5CHAC 4MG3A 1FV9A 3D65E 2QF3A 2V35A 2Z3CA 1HAVA 1QQUA 3KF2A 4NIXA 3QTOH 3T29A 2W3KA 2PR3A 5FCRA 3RMNH 2NU4E 2V0BA 1UVTH 1ARCA 1A4WH 3GY7A 1O2MA 1P03A 4NZLA 3RXKA 4AZ2B 5FX5A 3TH4H 1DWDH 2F9BH 3VB4A 2AYWA 1P05A 3SV8A 2B5TB 1G3CA 1C5NH 1GMDF 1O3OA 1RS0A 1XM1A 2HPPH 1MBMA 2BHGA 1FY8E 4ISOA 4TWYA 4FUBA 1OOKB 3SJ9A 5JDUB 2AGEX 1MTSA 2VIDA 3QZRA 6GCHF 5ESBA 2ZGJA 1O2YA 2BD2A 2A32A 1TALA 2QV1A 1ELDE 1OSSA 1C5RA 2XC5A 4D9QA 1SSXA 2EI6A 3FFGA 2C8ZB 1A61H 1KXCA 1HUTH 5EOKA 1BUIA 4K60A 2NWNA 3O8DA 1W0ZU 4HFPB 3EDXB 3LJOA 1OXGA 3SV2H 1B0FA 3PLPA 5JB8S 5LPFA 4Q7XA 2C90B 4ZXXH 3GYLB 1ESBA 5C5OA 1VGCC 3A7TA 1JMOH 3STIA 1PQ7A 4X1QU 5HGGA 2G81E 1DDJA 2EI8A 5F8XA 1QBNA 3LH1A 1KY9A 1NFWA 4XSKU 5HXFA 1JIRA 1O5EH 1N6YA 3RXFA 2PKSC 1NRSH 3E0NB 4LOYH 3V3MA 1MTUA 2BQ7B 1OWDA 2VIPA 3UFAA 4AFZA 3A82A 2FI4E 2A4OA 3QO6A 5F03A 1F7ZA 1A5GH 3AW0A 3F6UH 3NZIA 3VGCB 3LT3A 1L2EA 3TVJB 5FHTA 1EB1H 1TA6A 1V2VT 1PPHE 2PGQB 4Q80A 1E35B 2W7UA 4DIIH 3SNEA 3BSQA 1ABIH 3HKIB 3BTFE 1EQ9A 1XVOA 4K1EA 2VH0A 1GBDA 1GHXH 4XBBA 4GVUA 4F49A 4FUFA 2UUJB 4UDWH 1PPGE 1RIWB 1MTNC 2Z9LA 1AVXA 1GI0A 3BTWE 3KCGH 1JBUH 2F91A 2R3UA 2D8WA 5AFYH 1SVPA 3U1IB 1MKWH 1PJPA 2ZP0H 2ANYA 1P2MA 5CE1A 4BXWA 1UK4A 2QY0B 1ZHPA 2Z6BD 3ZZ4A 3G01A 2WPLS 1O2HA 1QBVH 4JZIA 3E3TA 4O3TA 3SBKA 2UWOA 1GI5A 4X2VA 3B8JA 2PV9B 1TMBH 1G3DA 2OCVB 3BIUH 4FVDA 4ABGA 2SNWA 3RXBA 1TPPA 1NESE 2D26C 4JZFH 4IS5A 1WAYB 1YPLH 4FUIA 2FPZA 1FY1A 2HOBA 2WYJA 1Z6EA 1EJMA 1LVYA 1AHTH 1YLCA 2VINA 1G3EA 2H9EH 3RXHA 3BTTE 1ZPZA 2PTCE 4MNWA 1FIZA 1O3FA 1MD8A 1GL0E 2V3HH 5HMAA 1O38A 4MNYA 1C2KA 2AGIX 3M35A 1EJNA 1O3JA 1D3DB 3LPRA 3CENA 2IOTA 4WVPE 3E8LA 2ZFFH 1DLKB 1IQKA 4XOJA 1EZXC 4ZHMU 1O5FH 1FZZA 1QRWA 1YM0A 3D23A 4FU9A 1DX5M 1Y59T 2BYAX 4CHAC 3L3TA 3ZZ7A 1YPHE 1SHYA 3ODFA 4WMEA 5F8TA 1GJ8B 3MH4A 1G30B 1YPHC 2TRMA 1MKWK 2STBE 1DM4B 1CGIE 3M37A 4YOGA 3RXGA 4X2YA 4LXBH 1HFDA 1ZHRA 1LVOA 2GGVB 3ITIA 2SGQE 1FY3A 3BTME 1TNKA 3SU5A 1BRAA 1EPTA 1ZHMA 2QXJA 2ZPQA 3A8BA 3JZ1B 1EX3A 4D9RA 1SGNE 1SGEE 3GY3A 1L0ZA 1QQ4A 1GHWH 3CS7A 1G9IE 6LPRA 2NU3E 3SHAH 2J92A 3KL6A 1AD8H 2FWWA 4OS2A 1SMFE 1GGDB 4ZUHA 3O8BA 4D76A 1GMHG 1SQTA 2ZHDA 3TGJE 1UK2A 4OS5A 3S69A 1V2JT 1EAWA 1Y3XA 5JBAS 1X7AC 1V2LT 2Y7ZA 3Q76A 2GKVE 1QBOA 2RCEA 1ZPCA 3EQ0H 1ZZZA 1KYNA 4B74A 1WBGB 5GDSH 8LPRA 1ZRKA 4AYVB 1O3EA 5DP8A 3PWBA 2TGTA 1GG6B 3C1KA 3SU2A 1BTUA 5BPEA 2A1DB 4NFFA 1CBWB 2C8YB 1ZMJA 5F6MA 1D6RA 2G52A 2V6NA 1A2CH 3RC5A 2BXUH 1BMNH 1SLVB 2VWMA 2PKAB 5TCCA 1MU6B 2QXIA 1YCPH 2P59A 1IHTH 1SI5H 2BTCE 3K65B 1HLTH 2OXSA 4MNXA 3MU1A 3SV7A 4O9VA 1O2LA 2A0QB 2TGDA 2BZAA 3BEUA 1L4DA 2D2DA 1GBEA 4K8YA 5H4IB 3F9GA 2BY8X 4YESB 2G55A 3UWIA 1QR3E 1VJ9U 2ANKH 1D6WA 1SG8B 2OINA 4X6NA 1ABJH 1C2IA 1WQVH 4ZHAA 1GJDB 3M5OA 2O8LA 2Z9IA 1VITH 1TQ7B 3MO3A 2BQ6B 1MCTA 3MMGA 1GJAB 1KLIH 1VCQA 3VFEA 6CHAB 2Z7FE 3P17H 1AB9B 1GBCA 1G3BA 2ZA5A 1UTLM 3BG4B 1C5OH 2JKHA 3FZZA 1UVSH 2ZU1A 4OGYA 1O3CA 1SGFG 1A5IA 1C5TA 1K1LA 1GHZA 2A31A 1BTZA 3T25A 1LQEA 3ZVAA 1C1SA 2BVRH 1SGQE 3HK6B 4FUHA 4INKA 2F3CE 5L2YH 2WPIS 1GMCF 1UJ1A 3BG8A 3DFLA 1DUEA 2GTBA 3RXQA 1A1RA 2ZHEH 2Q6FA 7LPRA 2FX4A 4XDEA 4TY6A 5ETXA 2ILNA 2Q6DA 1H1BA 1H9IE 1YCPK 1BTPA 4Q2KA 2ZGBH 3ZVDA 2P8OC 1O3GA 1MBQA 4D7GA 1ZYOA 2G4TA 3Q3YA 3O8CA 1GHBG 2GCTC 4Y8YA 1YLDA 4BAMB 3P6ZB 3V0XA 5F8ZA 1BHXB 1O3KA 1O2SA 3FZDA 1W13U 1LHFH 2SGPE 1QFKH 2BVSH 1ACBE 3U8RH 2XWAA 2H6MA 1ARBA 1BDAA 3E6PH 2BD4A 1THPB 3UPEA 4CREA 2IJOB 3Q3KA 4CRDA 3PMHB 1QL8A