2TIOA

Low packing density form of bovine beta-trypsin in cyclohexane
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-TRYPSIN)
publication title X-ray studies on two forms of bovine beta-trypsin crystals in neat cyclohexane.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tioA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tioA02
1ELTA 1P9UA 2FPZA 1O3JA 2QXJA 3MHWU 1AD8H 2GMTB 1Z8GA 4GSOA 3SQHE 1O31A 1GJ9B 3ZZCA 4YM9A 3UR6A 5T6FA 3V3MA 1C5OH 4I8JA 2XW9A 1H8IH 3BTWE 4H4FA 4X6PA 1HFDA 5L30H 1Q2WA 2SGAA 1WV7H 4BTUB 5EOKA 1QBNA 1OOKB 1O2LA 2FOBA 1SL3A 4B74A 1UK2A 3BTEE 3KCGH 2ZDVH 2ZDMA 3GDSA 3EA7A 3GCTG 3U98H 4Y6DA 4MNYA 2BDHA 3GCTF 1IAUA 5A8ZA 4ISIH 5TCAA 1PPCE 4Q7YA 4CRBA 4XOJA 1GL0E 1K21H 2R2MB 4ABEA 3SBKA 4ZHMU 1D6RA 1HUTH 1FN6A 3RP2A 3ESTA 4I8KA 4Y0ZE 2VIDA 1F7ZA 3QWCH 2P59A 3TH2H 1UHBB 1HAOH 2KAIB 2PKSB 3PM3A 4YLUA 5HM2A 2YOLA 1NESE 4K1SA 3A81A 1PPGE 2ZCLP 4SGAE 3RLYH 2GZ7A 1C5XB 1V2NT 1JRTA 1QIXB 1O3MA 3LOXA 4NSVA 3RM2H 1SR5C 4HFPB 2AMDA 5FHTA 3BG4B 1MKWH 1TPSA 1Z8RA 2D8WA 1SLWB 1C5VA 2ZQ2A 1GI5A 1FV9A 4E7NA 3RXLA 1TGSZ 1BT7A 4DW2U 3PWBA 2WV4A 2Q6GA 2V0BA 2SGDE 1Z6EA 1N1LA 2ZP0H 4TY7A 1DWCH 1L4DA 1S0RA 2C90B 1GI2A 5B6OA 1OWIA 4ABBA 1TNLA 1ESTA 1VITG 3TPIZ 1C2MA 1WBGB 1VITF 1P8VC 2ZFFH 4Y8YA 3RXFA 2A31A 1C4U2 4O3UA 3P92A 3A7YA 1C1QA 1EJNA 4MVNA 1FDPA 5EQRA 4AG2A 1HAIH 3U1IB 1UCYH 1O33A 2A5AA 1GJDB 1T4UH 1HPGA 1FY4A 1HAGE 1SGFG 2PTCE 3E90B 4D8NA 3LGUA 1P03A 3RDZA 1UTMA 4O3TA 3BTKE 2ZEBA 1FXYA 4ISNA 2PKAB 3BF6H 2Y5FA 1T8NA 3BIVH 4VGCC 2TBSA 2ESTE 3B8JA 2HWLB 1QA0A 3EDXB 1W0ZU 4FUDA 4ZKNU 1SGQE 2FYQA 4R8TB 1ELBA 1ARBA 3RMOH 2TGDA 3UNRA 1PPFE 5EODA 1G3CA 1ZJDA 3KQEA 1UK3A 3KHVA 3UIRA 1W8BH 2Y5HA 3BV9B 1CGIE 1NFUA 1DWDH 1NFXA 1GHYH 3ZVFA 5DP3A 4AYYB 2A2XH 3GY5A 1A0JA 1GHXH 3BSQA 1GI9B 1DICA 1C5PA 2W7SA 4R0IA 1QRZA 2RA3A 3RUOA 3PYHA 3MU1A 4Q2KA 2O8TA 4UE7H 4A1XA 2PHBA 1A7SA 1O3BA 1BZXE 2BXTH 2WYJA 4YTAA 1QRXA 1EZSC 4NGAH 4MQAA 4AG1A 3NK8A 1J9CH 1J15A 1KXAA 2SGEE 3SUEA 1NFYA 3PWCA 4B71A 3RXBA 3A7ZA 3KQBA 1S0QA 3ZZ3A 2TGTA 1EAWA 2WPHS 2Z9LA 2WINI 4U2WA 3A8CA 1GJ4H 2XBYA 3RM0H 1KLJH 1QQ4A 1THPB 1NM6A 1QJ7B 4NA7A 1V2WT 2CN0H 1GWAA 2C8XB 1CVWH 1O5AB 3T26A 3T29A 1SVPA 5FPYA 1QY6A 4JMYA 3TGIE 3I77A 5F6MA 2H5CA 2Z94A 3P70B 1KY9A 1LPKB 4X8VH 2AH4X 3BEIB 1O2PA 4TPYA 1HJ8A 1W11U 1S84A 5FPTA 3DHKH 2FXRA 2OINA 2SGPE 3A80A 1IQHA 1MMJN 2PWXA 4NSYA 2CMYA 4NIWA 3MU5A 4Z0KA 1J17T 1GBEA 4BTTB 4NIVA 2ZCKP 1C1VH 4WMDA 5G4BA 4OGYA 3DT0H 4JCNA 5AFZH 1C2EA 2VINA 3UPEA 1ZSKA 2ZDLA 4ABGA 4A92A 2P3UB 3M5MA 2WUBA 4BXSA 1QR3E 3ZV8A 1ZTKA 5FPSA 1P3CA 3UOUA 4K8BA 3FAOA 1DFPA 1C1SA 4MDSA 1HYLA 1V2PT 2GDDA 3BTQE 2Z3DA 2QV1A 4O03A 4YOGA 3P8GA 4JK5A 5C20A 1WAYB 5C5OA 2GCTC 3SW2B 4VGCB 4MNWA 1EX3A 1FIZA 4UDWH 3A82A 5H4IB 5SGAE 1O2SA 4MG3A 2ZU4A 2BB4A 5C1UA 1E34B 2VNTA 4IMQA 3IITA 2ZNKH 1MQ5A 1ACBE 1GMCF 1TA6A 2EI6A 2BY5X 1C5RA 1GBAA 2KAIA 1O5BB 1MZDA 3M5LA 2ODYB 1MD7A 1GBCA 3BN9A 1QJ6B 1GI1A 1NT1A 1PPZA 2BOHB 1UMAH 3GY8A 2BD4A 1OWEA 1Y3YA 1HJAC 4X1RU 3F9HA 3EQ0H 1O2HA 5ETXA 4D7GA 1SSXA 1TYNA 3SUDA 1K2I1 1C1WH 2HOBA 1GHBF 2ZFTA 1HBTH 1GJBB 2GV7A 2GZ9A 2C8YB 4X2VA 4DGJA 2ANWA 8GCHG 1BTPA 1F0UA 2ZPSA 3TJVA 7GCHG 1AVGH 2C3SA 1NRSH 3H5CB 3MU8A 2W5EA 1H1BA 2FX6A 2VVVA 4MPUA 1GVKB 1PPBH 1U6QA 1A3BH 3RXTA 2F9VA 2FOMB 2ZU5A 1N6YA 1ZSJA 3MNBA 1EZQA 2P3TB 3UNSA 2D26C 4AX9H 2WYGA 4HGCA 2UUFB 1G2LA 3HKIB 3LT3A 1ZHMA 1Q31A 3LGWA 1O3KA 2FTLE 1BTUA 5HGGA 1W0YH 1AFEH 1GCTC 3A85A 1L4ZA 3MH4A 5DK1A 3ODDA 4FUGA 3V12A 3UY9A 5E0JA 2BYAX 2BVXH 3BTDE 6CHAC 4CBNA 4JZFH 2GP9B 2Y5GA 2PKAA 2BHGA 2FOFA 4TWWA 3ZYDA 3KNXA 1Y3XA 4YLQH 1P3EA 1J16A 1DS2E 1ELEE 2GZ8A 5E2PA 4DT7B 3SO3A 2Q6FA 1GDUA 5DP6A 9LPRA 1SB1H 2CXVA 3MU4A 1YM0A 4FUBA 3QZRA 4CHAC 1C1PA 3M37A 3SUFA 2FTMA 2P95A 1PFXC 4U01A 4FVBA 1EZXC 1RTKA 3K6ZA 4K5ZA 1ARCA 5E0GA 3GY6A 2A5KA 4HZHA 4ISLA 4BAKB 1ABJH 1C4V2 4FVDA 4BAMB 1GJ5H 1LHDH 1P05A 1O2MA 5DP9A 1SGNE 1D3QB 3KGPA 3TGJE 3PO1B 1SGRE 1V2KT 3DFJA 1LO6A 2UUKB 4AN7A 5FXLA 1C4Y2 1G3BA 1ZSLA 4B2CA 1HJ9A 1Z1JA 2XRCA 3MNCA 4B2BA 1CBWC 4IW4E 4ABDA 3LGVA 4IC6A 3BTGE 3PV4A 1MTUA 2O8UA 3CENA 3ZVAA 1GVZA 2R0KA 5E8EH 4YOJA 5EXMA 1EUFA 2W3IA 4NCYA 4YZUA 2ZPQA 3PLPA 4DJZB 3S9AA 4MNVA 1CHGA 6GCHF 1TMTH 1XKAC 3RU4T 1PQ7A 1GHZA 1HJAB 1UVPA 2EI8A 1PPEE 3O8BA 3R0FA 4FUCA 1FJSA 2PUXB 3VXFH 4UFDH 1PPHE 1C5MD 3PB1E 1IHTH 2Q6DA 3RMLH 1UCYE 1BTYA 1CHOG 3TJOA 4GAWA 2BX4A 3UUZA 1RFNA 4DCDA 1Z8JB 1CHOF 3B23B 5DPAA 1A4WH 2ZU1A 1Y5BT 3RXUA 3SNAA 1O38A 2C4FH 4B75A 4DY7B 1O5CB 4I8GA 4KELA 1RXPA 3E91A 1MZAA 1LHCH 2VWLA 1H4WA 1S82A 3SJKA 1KTTB 1TGBA 1TNJA 2A0QB 2A7JA 4IBLH 4E7RG 1P57B 1O35A 1ZMJA 3MO9A 1CA0B 5A09A 3TIUA 2GGVB 3RXEA 4AFUA 3RU4E 3OY5U 4BOHA 1QBOA 2PKSC 2XWBI 5DJ7A 2J2UA 3SV9A 1W13U 1EB1H 1GI7B 2ZCHP 4Y8ZA 3IG6B 1KXCA 1O2QA 1BHXB 1TX8A 2ZGXH 4H42U 2OQ5A 3K9XB 1B0EA 2AGIX 1AY6H 3NCLA 1TBQH 6CHAB 1K1IA 2J9NA 4CH8B 2VJ1A 2GX4A 6ESTA 4ZUHA 1D4PB 1DE7H 1ANCA 4UFEH 1EP5A 3PMJA 1C2HA 2BDIA 1V2QT 5FBEA 4CR9A 1XUIA 3UNQA 4D9RA 3UWJH 1AZ8A 1BHXF 1O2YA 2FOHA 5JBAS 4Y76A 2AIQA 1VJAU 2ANMH 1HXFH 1QRWA 5FCKA 1P10A 3P8NA 4RSPA 4K69A 5PTPA 3GDUA 4CREA 1GI6A 2OCVB 2FEQH 4I7YH 1K22H 1VJ9U 5EPYA 4CHAB 4IC5A 5AHGH 1Y5AT 1NU7B 2OC0A 2CGAA 3A84A 1FI8A 3C27B 1SFQB 2G52A 1AB9B 1GJ6A 1V2TT 1UTQA 2I6QA 4THNH 1L1JA 2CV3A 3O8DA 2QXHA 2UUJB 4OS6A 1HLTH 2J95A 1S81A 1C1TA 1V2LT 2AIPA 4E05H 1ZTJA 2B9LA 1L2EA 1OPHB 2BLVA 1W14U 2XC0A 4GHQA 4TWYA 2C8WB 1ZPCA 1HIAB 2A4QA 2ZECA 5DKMA 3MYWA 4Q7ZA 2STBE 4Q80A 1CBWB 2ZA5A 1V2JT 3AAVA 3SU1A 4LXBH 1GHAG 2BQWB 1OP2A 2G5NA 2NU1E 2ZGJA 4HI3A 1JIRA 1F5RA 2ZGBH 1YPLH 4BXWA 1DOJA 1FAXA 3RLWH 1ORFA 3OYPA 4FUIA 3LGYA 5HYOA 5T6GA 2W26A 4IN2A 4DVAU 1O2ZA 2P16A 1D3PB 2VB0A 2VU8E 1BJUA 2R3YA 5AFYH 2HRVA 2H9TH 4YO9A 3TK5A 1DLKB 1MBQA 1AQ7A 1PQAA 4FU8A 4GUXA 4ABHA 2WPLS 2PSYA 1BBRH 2F9NA 1EJAA 3LIWA 5C2ZA 2OP9A 3A8BA 2G81E 1KTSB 1TPOA 1T8LA 3A83A 1CGJE 2AYWA 1TQ0B 1O0DH 2FX4A 2R9PA 3VB3A 1KLTA 1H8DH 2ULLA 1BQYA 1GBFA 3LJJA 2UUYA 4INLA 3FFGA 1JWTA 4JZDH 2H1UA 2GT8A 3P8FA 3VB4A 1TPAE 1JMOH 2J4IA 4WMFA 1G2MA 3OU0A 5EQQA 1QA7A 3E6PH 1UCYK 2K1QA 1NPMA 4WH8A 1SFIA 1HDTH 2V3HH 1W12U 1VCQA 1DSTA 1LHGH 1J8AA 3SU6A 1ZHPA 3FVFB 1C5TA 4JZEH 4MLFB 1P11E 3E0PB 3KL6A 4I8HA 3E0NB 1ZLRA 5L2ZH 5JB9S 1P0SH 2FMJA 2V6NA 3QGNB 2C93B 2XC4A 4FUEA 4BAHB 1G37A 5CMXH 4ZXYH 1AKSB 4ISHH 2VWOA 5TCCA 2EI7A 3JZ2B 3SNEA 5FAHA 2JH6D 4GCHG 1NY22 1Z6JH 1F0SA 1TWXB 1P04A 2OXSA 1EATA 3GY7A 3JZ1B 4I32A 2FP7B 3LDXH 1GJAB 1NU9A 1KXBA 1TGNA 4IGDA 3NUMA 1HAPH 3LC5A 5CE1A 1S6FA 4NZLA 4A1VA 1VCPA 4INKA 4UD9H 3ZVDA 4UONA 2TGAA 5BPEA 1S83A 1VR1H 3HK3B 1UO6A 1DLEA 5A0CA 1TBZH 1MAYA 4FUJA 2XCNA 1C9TA 1QL9A 1Y3VA 4MTBA 3RU4D 3Q3KA 1HAHH 1GL1A 3BIUH 2Z9GA 1SBWA 3L3TA 3ZVCA 1EB2A 2BDAA 2H5DA 1IQEA 1GBDA 2OTVA 2HALA 3SN8A 2GCHG 1ANEA 2GCHF 3TH3H 3U9AH 3QTOH 3VPKA 1RTFB 4NG9H 1ZRKA 3SJIA 1HXEH 1D6WA 1EKBB 3LJOA 1A2CH 2VWNA 2CF9H 1YLDA 1AVWA 5A2MH 1QCPA 4CH2B 5IDKA 1GJCB 1G30B 1UTNA 1MUEB 5A8YA 3EYDA 4Q7XA 2PFEA 3V13A 1DY8A 1O2IA 4X0WU 1NFWA 1Y3WA 4J2YB 5EU8A 4FU9A 1OYTH 8KME2 2AGEX 1O2TA 1O3OA 4D9QA 1TPPA 1IQLA 2SGFE 3M7TA 2RG3A 2FDAA 1FY8E 4BNRA 6LPRA 1L0ZA 1W7GH 4CRCA 3QZQA 2P8OC 2FODA 3SOSA 1BTXA 5FCRA 3M61U 1PJPA 3K2UA 1K1LA 3SORA 1O3HA 3TU7H 1JXPA 3NZIA 5TJXA 3DFLA 4WMEA 2HVXA 5LPRA 2AGGX 2ZTYA 3FP8E 1QB6A 5EPNA 1YPHC 2OD3B 3M3SA 4QT8C 1GVLA 4SGBE 4I8LA 2BD8A 3T27A 2A7CA 4UEHH 5EGMA 1BIOA 4U32A 5JBTA 2OC7A 1XKBC 2LNCA 4CRGA 4GLYA 1K1PA 3GOVB 5C1YA 2R3UA 1P01A 1SPJA 3O8RA 2ZPRA 1IQFA 1KSNA 2F9PA 4AZ2B 3O8CA 3ZV9A 4BAOB 3VEQB 1LVYA 3RXKA 1GGDC 1MKXH 3NWUA 4YOIA 3F6UH 4H6SB 1BMLA 1WTGH 1HIAA 2RA0A 4AGJA 3SNDA 2G4TA 4Y8XA 2QF3A 3SHCH 3DD2H 1SGCA 1A61H 1BJVA 3FP7E 2VH0A 1BDAA 1NN6A 2BDBA 3MNSA 3K65B 5BRRE 2BLWA 1MTVA 2BY6X 2OUAA 3V0XA 1EAXA 1JRSA 2PUQH 1MTSA 1TGTA 1TABE 4J1YA 2HNTC 1Y5UT 2F3CE 2TGPZ 3TJNA 2A1DB 4OS7A 4B73A 1OKXA 2FWWA 4ABJA 1OSSA 1UVOA 3ITIA 3ODFA 1JOUB 2R0LA 3C1KA 5LPFA 2WPJS 1ELGA 2GTBA 4OS5A 5F03A 1O2RA 4IS5A 4X1PU 4AB8A 4ZHAA 3D65E 3PLBA 3PO1C 1YCPM 3TJUA 2YNBA 1E38B 3ATWA 2ZWLH 2BQ7B 4AFQA 4IN1A 2BD5A 4X1QU 3GYLB 2PR3A 2R2WU 1BTWA 1JBUH 2FOEA 1ELVA 1TBRH 1ZJKA 2VGCC 2ZHFH 3UR9A 1TGCA 4X8UH 3PMAB 1SQTA 1O3FA 3M35A 1DUAA 3BTFE 3ZZ4A 4ABFA 4UFGH 1H9IE 5A0AE 1TRNA 2VIQA 1O3NA 1O37A 2F83A 1HAZB 2P8OB 1XM1A 3EA8A 1L1GA 1AKSA 8GCHF 1DSUA 4BAQB 7GCHF 3ZVBA 2Y82A 3FP6E 1C1NA 3BG8A 2NWNA 1C1RA 1CA8B 1NS3A 2O9QA 3U69H 3P95A 1RIWC 2PSXA 1EASA 1FAKH 1O5DH 2BD2A 1O2NA 1QL8A 4KGAA 1CA0C 4GHTA 3HATH 3A8AA 2TPIZ 2I6SA 2ZZUH 2AMQA 1INCA 1N6XA 4XBBA 5J4QA 3RXCA 1AIXH 1P9SA 5F8ZA 5C1XA 1FUJA 2ZFPH 1PYTD 2H9EH 1CGHA 1CO7E 3E8LA 1FY5A 1P2IA 2F91A 3A86A 2V35A 3I78A 3RXQA 3ATIA 1GGDB 1O5EH 4X1NU 2NU2E 1O3EA 2TIOA 1LHEH 1AO5A 4K60A 1O2JA 3TGKE 1LVOA 1YCPH 1SLVB 1ZGIA 2GKVE 1DANH 3A7VA 1P02A 3BEUA 1AE8H 4CRAA 1FZZA 1QQUA 4Y7BA 1TX7A 2CHAC 3SHAH 3RC4A 1TE0A 2QYIA 3I29A 3MO3A 3F9EA 5GDSH 4Y11E 1TQ7B 2OBQA 3UQVA 4KTUA 1NTPA 1AB9C 2SNWA 5LGOA 3SGBE 3GCHC 2G00A 3LH1A 1XXFA 2FYRA 2W7UA 5F8TA 2HNTF 5LPEA 2HLCA 3S9BA 2ZHEH 1B0FA 3HGPA 1DX5M 1GPZA 1OWKA 4LZ4B 3F68H 3AVZA 2Y80A 1BRAA 1F2SE 4BTIB 3SQEE 1EP6A 3A8DA 1UTKA 2UWPA 2DE8A 1LHFH 5ESTE 3V7TA 3SGQE 4NIXA 5GCHG 1ANBA 2IPHA 3QTVH 1UTOA 1GBTA 1SGTA 5GCHF 4JYUH 1GCDA 3R3GB 4K1EA 3QDZB 5K0HA 1TONA 1TRMA 4JZIA 1DWEH 5F8XA 2VGCB 3ATLA 7LPRA 3MI4A 3ZVEA 3GISB 1GHVH 3MOCA 2ZHDA 1O3IA 4A1TA 4WY3A 5E0HA 1A5HA 3QLPH 2D1JA 1CU1A 5I46H 1Z8IB 4AB9A 2RDLA 1GMHG 4XDEA 3T25A 1O5FH 1NRRH 1O34A 1GMHF 1QB9A 3FZZA 4ZKRU 2EA3A 3T5FH 8LPRA 4X2WA 1FONA 2XYAA 1DDJA 2XBXA 1UTJA 3RXRA 3M5NA 1G9IE 1P2KA 3EAJA 3TNSA 1LQEA 2HGTH 4RKOB 1SQAA 1K9OE 1RIWB 4H6TA 1DWBH 2G51A 1OYQA 1B7XB 1UVTH 3CS7A 2J34A 4WVPE 5DO4H 1ZYOA 2BD3A 2PGQB 5FX6A 2BY9X 3RXVA 1A0LA 1HAVB 3HPTB 1TAWA 4DIHH 2BD9A 3A7TA 3MTYA 3K6YA 1ETTH 2PTNA 1AUTC 3MMGA 2Z9IA 3PTNA 1ZTLA 3T2NA 5LH8A 4AYVB 2Q1JA 1EOJA 2QA9E 1BCUH 2G8TA 1GI0A 2F9OA 4O97A 2GVFA 2B7DH 3WY8A 2OC8A 4MPVA 2AMPA 1GBJA 1FPCH 3RMNH 1WYKA 3D62A 1EJMA 1RD3B 1G3DA 3MH7A 5JYIA 2EC9H 5DG6A 1YLCA 1IQIA 1QJ1B 2FI3E 2G5VA 4KTCA 1C5SA 3ZZ7A 3STIA 1EPTC 2CHAB 1LKBA 2GT7A 4LOYH 2FS8A 5A8XA 1AUJA 5HXFA 1UK4A 2NU0E 2B5TB 2J94A 3QN7A 1ZOMA 5IYTA 3RXGA 2FOGA 3SV8A 1NROH 3F9FA 3LGTA 4KKDA 2IJOB 1GBHA 3GCHB 4FUFA 3RXOA 1V2RT 1C2KA 1YC0A 2H2ZA 3QX5H 2WV5A 4WF8A 4ISOA 4X6OA 4X2XA 2VH6A 1O32A 3TNTA 1OWDA 3BTTE 1BB0B 3B9FH 3D23A 4ZHLU 2FM2A 3RXSA 1C1OA 4IMZA 3ENSB 3W94A 4FXGH 4Z6AH 4ZXXH 1RJXB 2ODQA 2P94A 2AERH 1MTNC 2XBWA 3LU9B 1C1UH 1MAXA 1G32B 1C1MA 2B8OH 4WJG2 2VIVA 1SHYA 1AU8A 1GHAF 1O2OA 2Y7ZA 2BMGB 2BY7X 2P3FH 1SGPE 1C5ZB 1LVMA 4JYTA 1IOEA 1O2WA 3GCOA 1WCZA 3A88A 1KDQB 5HM9A 1FN8A 4NWLA 1V3XA 2VVCA 5EQSA 1C5WB 2F9BH 2ZQ1A 1V2ST 3U8TH 1S6HA 3SU5A 3QUMP 3SV7A 1CT4E 2ZFQH 3VB5A 4A5TS 2YNAA 3M7UA 1GBBA 2ILNA 3S0NA 5JDUB 4OS1A 1TOMH 1E37B 2ZTZA 1AE5A 3SI3H 3VB6A 4X8TH 1OWHA 1SGEE 2Z6BD 3RXAA 1QGFA 1DM4B 1DT2A 1MKWK 2BX3A 2SFAA 4E06H 2THFB 5EXNA 2ZDNA 4D76A 3SGAE 5EXLA 7KMEH 5GPIB 2H9HA 1EOLA 1G3EA 1OP0A 4LZ1H 1QBVH 2B0FA 2OC1A 5AVDA 2JETC 1ANDA 1NRNH 1ZPBA 3PMHB 1XUFA 3Q76A 2QY0B 2AS9A 2FOCA 3NKKA 1O3LA 1RS0A 2ZIQH 1E0FD 1TNHA 2ZC9H 5DP5A 1A3EH 1WU1A 1YPMH 1O2UA 2ZI2H 3T28A 1V2VT 1DITH 1C5YB 1GDNA 3SJ9A 1OWJA 3EA9A 1Z71A 3ZZBA 2WUCA 4X1SU 2ZTXA 3OTJE 3TK9A 1P12E 1ELAA 2ZO3H 3SUGA 4A6LA 2UWOA 4CRFA 1OP8A 1YP9A 2Z9KA 1ZMNA 3UQOA 2ZHWH 1O2KA 2ODPA 3VXEH 1CSOE 1FY1A 1H9HE 1LMWB 3SV6A 1BRUP 2GV6A 4Y10E 4ASHA 4GCHF 2G55A 2XBVA 4XSKU 1C9PA 3U8OH 2Z7FE 3SNBA 4YT7H 1EPTB 5C3NA 4YT6H 5AF9H 2M5TA 1O3GA 1T31A 4K8YA 1TNGA 2ALVA 3LONA 1FIWA 4GPGA 4JZ1A 1NZQH 3SI4H 1UVUH 2QC2A 1E35B 4ESTE 3RC5A 5C5NA 1B5GH 1ETSH 3Q77A 2ZHQH 1UJ1A 1ETRH 2CF8H 1W2KH 3GY2A 1DVAH 1GBKA 1VGCC 3U8RH 1V6DA 1HAXB 4Y7AA 3UREA 5K7RA 1O3DA 2FZZA 1TALA 2FOAA 3D49H 1GBLA 1OX1A 1P2QA 1TRYA 1MTNB 1NO9H 3KQDA 4X8SH 2QAAA 2AEIH 3VB7A 1THRH 4NWKA 3UTUH 1O3CA 5I25A 1HB0B 1BRBE 4M7GA 3BEFB 1J14A 2JKHA 1HAVA 5DP7A 1D3DB 3RXHA 2BLOA 2A32A 1C2FA 3SJOA 1THSH 4AOQA 2OLGA 3RXPA 3UOPA 1P2NA 2GD4B 2PW8H 3G01A 2A4GA 5EG4A 1BMNH 1OXGA 1TX6A 2J38A 1FPHH 5GWZA 5L2YH 1LCYA 2NU3E 3KF2A 1FLEE 1BMAA 5JBCS 2FO9A 1KYNA 2WPMS 1ID5H 1MKXK 2FI4E 3ATMA 2FIRH 2ALPA 2IOTA 2WPKS 1P2OA 1AI8H 2A5IA 5CHAC 3QK1A 1SG8B 3CS0A 2C8ZB 1T4VH 4Y0YE 3PMBB 1X7AC 2G4UA 5EW2H 2JETB 1GDQA 2XWAA 1KXEA 1QTFA 2VIOA 4INHA 4YESB 4WXIA 3RMMH 1SGYE 3S7HB 1DXPA 1IQNA 1V2MT 4XBCA 1G36A 2PGBB 1YF4A 5HMAA 2P93A 3S69A 2BZAA 3GDVA 2LPRA 3Q00A 4XBDA 2WPIS 2BTCE 1LQDB 2NU4E 1L1NA 2TRMA 1WQVH 1Y8TA 3UFAA 3VFEA 5J4SA 1DUEA 4NA9H 4ABIA 3RXDA 4ZMAH 2O8LA 5L6NH 5JBBS 1GHWH 1PQ8A 1MBMA 2EEKA 3Q3XA 3E16B 3LKWA 2D2DA 2ZFSA 2ZU3A 1A5IA 1TB6H 1CE5A 3TH4H 1TFXA 2FLBH 1Y59T 2QXIA 1BRCE 1QNJA 3PLKA 1KDQA 3AAUA 1IQMA 4WXVA 1O3AA 3URCA 4NIYA 1BMMH 2O8WA 1Z1IA 1UTPA 1ESAA 3P17H 3M7QA 4NFFA 1ZR0A 3MH5A 1C5NH 2VIWA 3M5OA 4RN6A 3DA9B 4CBOA 1EXFA 1AWFH 1VZQH 1T8MA 3STJA 1TIOA 1UVSH 7ESTE 2XCFA 1ELFA 1MD8A 3SU3A 1PQ5A 4Y79A 1TNIA 3MO6A 1YYY1 2PLXA 1VGCB 3NXPA 1Q3XA 3ZZ8A 1HV7A 1K28D 1P09A 3ZZ9A 2BVRH 1MCVA 2SNVA 1NC6A 5ESBA 1F92A 1QURH 1ZGVA 4X2YA 1WTHD 3RC6A 3QGJA 5ABWA 1Y3UA 2ZDAH 4ZKOU 4DIIH 3QO6A 4I31A 4XFQA 1MH0A 2FI5E 3UWIA 2BVSH 1LVBA 4CRDA 2XXLA 3SNCA 1ZMLA 1MCTA 1BITA 3URDA 5EW1H 3M3VA 1TA2A 3NPSA 1P06A 4K1TA 1SOZA 1GMCG 3A7WA 4FUHA 4TYDA 2A4RA 1FQ3A 1SGIB 1BTZA 1AFQC 2JH5D 2BY8X 1C2GA 1ELDE 2ZKSA 1GG6C 1M9UA 3Q3YA 1D3TB 1NRPH 1O2GH 1SI5H 1UHBA 1QB1A 2VIPA 5T6DA 4ABAA 1ZRBA 4K2YA 1BTHH 1XUGA 2A4OA 2BD7A 2QCYA 1HNEE 1FMGA 2BXUH 5CHAB 1YCPK 2QXGA 3E3TA 1GMDG 1GHBG 1ZHRA 1T7CA 1EPTA 1ZZZA 2F9UA 1YPKH 1GMDF 1KIGH 2FESH 1A46H 3FANA 3W95A 1CT0E 1KXDA 1C5LH 4NA8A 4B2AA 2ZU2A 2XTTB 4TPIZ 1A0HB 1GI8B 3F9GA 3HK6B 3SU2A 3H7TA 1YPGH 4NFEA 4AGKA 1K1JA 2ASUB 2CJIA 1DY9A 3LGIA 1AVXA 1TOCB 2GDEH 2QGRA 1SGFA 1C2JA 1GBIA 5FBIA 2Y7XA 2ZG0H 3VGCC 2IN2A 1GBMA 1JIMA 4MNXA 2BQ6B 5DP8A 1YPEH 3SZNA 3LH3A 1AGJA 3PTBA 2STAE 1HRTH 1FY3A 1QFKH 3GY4A 1E36B 3SV2H 3A7XA 1O5GH 1K1NA 2J92A 4DG4A 1O36A 4OS2A 1S85A 4XE4A 1GJ7B 4F4OC 1AN1E 1O2XA 9ESTA 1BBRE 1YGCH 1F5KU 2AFQB 2Y6TA 3ELAH 2SGQE 3OX7U 1SOTA 1N8OC 1C2DA 2A45B 1SC8U 3A87A 2BDGA 2BZ6H 3RXJA 1TNKA 3L33A 1VCWA 4GVUA 3ZZ6A 4OGXA 1XXDA 1V2UT 3E1XB 3OSYA 5JB8S 1K1MA 3IWMA 5GIBA 1HAYB 4ZROA 3S9CA 5DGJA 4JK6A 1O3PB 1P2MA 3SJ8A 3MWIU 5FX5A 2BM2A 5JPMH 1XUKA 4FU7A 1V2OT 2ANKH 1LPGB 4DOQA 1LDTT 1PYTC 1SLUB 4D7FA 3ZYEA 4KTSA 4RKJB 1NRQH 4OS4A 1SQOA 4AFSA 5DP4A 2DE9A 4X6NA 1F0RA 1ELCA 2ZGCA 3EGKH 3TVJB 2V3OH 1IQGA 3MH6A 1P2JA 1CQQA 2ZFRH 2VVUA 1FNIA 1HGTH 1IQKA 1EQ9A 2GCTB 4KP0A 5T3HA 1TMBH 1DPOA 1MTWA 3AW1A 2FS9A 4Y71A 2BOKA 1OS8A 1T8OA 2XNIA 1W10U 3BTME 1XUJA 1O30A 1AFQB 2GMTC 4LK4A 1BOQA 1GG6B 2A2QH 3MFJA 4MPXA 3ZZ5A 3RXMA 3ZVGA 4O9VA 6GCHG 1XVMA 1KXFA 4TY6A 1ESBA 1MU6B 1TLDA 3TITA 1LTOA 3AASA 2BDCA 4WWYA 8ESTE 1SHHB 2H6MA 4F49A 2Z3CA 2ZGHA 3KIDU 3PROA 3GCNA 4K3JA 2QN5T 5GXPA 2OQUA 1IHSH 2DUCA 1WUNH 1XMNB 4MPWA 3T62A 2VWMA 4CR5A 2Y81A 1C5UA 1D9IA 1SGDE 2QIQA 4NZQA 4I33A 3ATKA 1W7XH 1F0TA 3L6PA 1WOFA 1MU8B 2Z9JA 3DUXH 3ZZDA 3OY6U 4B1TA 3VGCB 1VITH 3MNXA 1AMHA 1A5GH 4AORA 2A7HA 3SU0A 3GYMA 1O2VA 1WSSH 2XC5A 2W3KA 1EAIA 4ZH8A 1QHRB 1ABIH 1GCTB 1YPHE 4A7IB 3KN2A 3GY3A 4WH6A 1H9LB 2QF0A 3CP7A 1ZPZA 1C2IA 1RGQA 1TMUH 3M3TA 1S5SA 1HCGA 1RTLA 2BDYA 3ZZAA 4BANB 1GI3A 1SMFE 1W3CA 2PV9B 1LPZB 4DURA 1XX9A 3BG4C 1N8OB 1YPJH 2ZF0H 1IQJA 3KQCA 3EE0B 1BUIA 4U30A 1C5QA 3HGNA 3N7OA 3TK6A 1EAUA 3RXIA 4UFFH 1XVOA 1WQSA 3BTHE 3P8OA 1F5LA 1UTLM 2UWLA 1CT2E 1SLXB 1T32A 2ANYA 3SU4A 1BA8B 1GJ8B 1K1OA 2HPPH 3GICB 1Z7KA 3U1JB 4X6MA 1YKTA 2OBOA 4B76A 3LC3A 3M36A 3S7KB 1LKAA 1C2LA 1BBRK 1AHTH 1YBWA 1O39A 2RCEA 3A89A 3F1SB 4ZKSU 2Z3EA 4AFZA 5A0BA 1EZUC 2HNTE 3LPRA 4HTCH 1A1RA 1GI4A 4JYVH 1KLIH 5E2OA 2ZDKA 1AWHB 3H7OA 4ZAEA 3FZDA 2JH0D 2BLQA 1XUHA 3TLOA 1RRKA 2O8MA 3P6ZB 1DXWA 1QL7A 1MQ6A 2HPQH 3KEEA 1AZZA 5C67A 3MU0A 4PROA 3HKJB 5GJ4B 3AW0A 2FLRH
chains in the Genus database with same CATH superfamily
1ELTA 1P9UA 2FPZA 1O3JA 2QXJA 3MHWU 1AD8H 2GMTB 1Z8GA 4GSOA 3SQHE 1O31A 1GJ9B 3ZZCA 4YM9A 3UR6A 5T6FA 3V3MA 1C5OH 2PP6A 1VKYA 4I8JA 2XW9A 1H8IH 3BTWE 4H4FA 4X6PA 1HFDA 5L30H 1Q2WA 2SGAA 1WV7H 4BTUB 5EOKA 1QBNA 1OOKB 1O2LA 2FOBA 1SL3A 4B74A 1UK2A 3BTEE 3KCGH 2ZDVH 2ZDMA 3GDSA 3EA7A 3GCTG 3U98H 2KZ4A 4Y6DA 4MNYA 2BDHA 3GCTF 1IAUA 5A8ZA 4ISIH 5TCAA 1PPCE 4Q7YA 4CRBA 4XOJA 1GL0E 1K21H 2R2MB 4ABEA 3SBKA 4ZHMU 1D6RA 1HUTH 1FN6A 3WW7A 3RP2A 3ESTA 4I8KA 4Y0ZE 2VIDA 1F7ZA 3QWCH 2P59A 3TH2H 1UHBB 1HAOH 3ZIAD 2KAIB 2PKSB 3PM3A 4YLUA 5HM2A 2JJ1D 2YOLA 1NESE 4K1SA 5T1VA 3A81A 1PPGE 2ZCLP 4SGAE 3RLYH 2GZ7A 1C5XB 1V2NT 1JRTA 1QIXB 1O3MA 2WPDD 3LOXA 4NSVA 3RM2H 1SR5C 4HFPB 2AMDA 5FHTA 3BG4B 1MKWH 1TPSA 4FETA 1Z8RA 2D8WA 1SLWB 1C5VA 2ZQ2A 1GI5A 1FV9A 4E7NA 3RXLA 1TGSZ 1BT7A 4DW2U 3PWBA 2WV4A 2Q6GA 2V0BA 2SGDE 1Z6EA 1N1LA 2ZP0H 4TY7A 1DWCH 1L4DA 1S0RA 2C90B 1GI2A 5B6OA 1OWIA 4ABBA 1TNLA 5EJZA 1ESTA 1VITG 3TPIZ 1C2MA 1WBGB 1VITF 1P8VC 2ZFFH 4Y8YA 3RXFA 2A31A 1C4U2 4O3UA 3P92A 3A7YA 1C1QA 1EJNA 4MVNA 3VG8A 1FDPA 5EQRA 4AG2A 1HAIH 3U1IB 1UCYH 1O33A 2A5AA 1GJDB 1T4UH 1HPGA 1FY4A 1HAGE 1SGFG 2PTCE 3E90B 4D8NA 3LGUA 1P03A 3RDZA 1UTMA 4O3TA 3BTKE 2ZEBA 1FXYA 4ISNA 2PKAB 3BF6H 2Y5FA 1T8NA 3BIVH 4VGCC 2TBSA 2ESTE 3B8JA 2HWLB 1QA0A 3EDXB 1W0ZU 4FUDA 4ZKNU 1SGQE 2FYQA 4R8TB 1ELBA 1ARBA 3RMOH 2TGDA 1W0KD 3UNRA 1PPFE 5EODA 1G3CA 1ZJDA 3KQEA 1UK3A 3KHVA 3UIRA 1W8BH 2Y5HA 3BV9B 1CGIE 1NFUA 1DWDH 1NFXA 1GHYH 3ZVFA 5DP3A 4AYYB 2A2XH 3GY5A 1A0JA 1GHXH 3BSQA 1GI9B 1DICA 1C5PA 2KCAA 2W7SA 4R0IA 5DSFA 1QRZA 2RA3A 3RUOA 3PYHA 3MU1A 4Q2KA 2O8TA 4UE7H 4A1XA 2PHBA 1A7SA 1O3BA 1BZXE 2BXTH 2WYJA 4YTAA 1QRXA 1EZSC 4NGAH 4MQAA 4AG1A 3NK8A 1J9CH 1J15A 1KXAA 4DT4A 2SGEE 3SUEA 1NFYA 3PWCA 4B71A 3RXBA 3A7ZA 3KQBA 1S0QA 3ZZ3A 2TGTA 1EAWA 2WPHS 2Z9LA 2WINI 1SQRA 4U2WA 3A8CA 1GJ4H 2XBYA 3RM0H 1KLJH 1QQ4A 1THPB 1NM6A 1QJ7B 4NA7A 1V2WT 2CN0H 1GWAA 2C8XB 1CVWH 1O5AB 3PRDA 3T26A 3T29A 1SVPA 5FPYA 1QY6A 4JMYA 3TGIE 3I77A 5F6MA 2H5CA 2Z94A 3P70B 1KY9A 2J98B 1LPKB 4X8VH 2AH4X 3BEIB 1O2PA 4TPYA 1HJ8A 1W11U 1S84A 2W6ID 3DHKH 5FPTA 2FXRA 2OINA 2SGPE 3PRBA 3A80A 1IQHA 1MMJN 1H8ED 2PWXA 4NSYA 2CMYA 4NIWA 3MU5A 4Z0KA 1J17T 1GBEA 4BTTB 4NIVA 2ZCKP 1C1VH 3N99A 4WMDA 5G4BA 4OGYA 3DT0H 4JCNA 5AFZH 1C2EA 2VINA 3UPEA 1ZSKA 2ZDLA 4ABGA 4A92A 2P3UB 3M5MA 2WUBA 4BXSA 1QR3E 3ZV8A 1ZTKA 2EQNA 3OTPA 5FPSA 1P3CA 3FO8D 3UOUA 4K8BA 3FAOA 1DFPA 1C1SA 4MDSA 1HYLA 1V2PT 2GDDA 3BTQE 2Z3DA 2QV1A 4O03A 4YOGA 3P8GA 4JK5A 5C20A 2LP6A 2J5UA 1WAYB 5C5OA 3EE7A 3N7EA 2GCTC 3SW2B 4VGCB 4MNWA 1EX3A 1FIZA 4UDWH 3A82A 5H4IB 5SGAE 1E79D 1O2SA 4MG3A 2ZU4A 2BB4A 5C1UA 1E34B 2VNTA 4IMQA 3IITA 2ZNKH 1UW7A 1MQ5A 1ACBE 1GMCF 1TA6A 2EI6A 2BY5X 1C5RA 1GBAA 2KAIA 1O5BB 1MZDA 3M5LA 2ODYB 1MD7A 1GBCA 3BN9A 1QJ6B 1GI1A 1NT1A 1PPZA 2BOHB 3OEHD 5KGOA 1UMAH 3GY8A 4B6EA 2BD4A 1OWEA 1Y3YA 1HJAC 4X1RU 3F9HA 3EQ0H 1O2HA 5ETXA 4D7GA 1SSXA 1TYNA 3SUDA 1K2I1 1C1WH 2HOBA 2LELA 1GHBF 2ZFTA 1HBTH 1GJBB 2GV7A 2GZ9A 2C8YB 4X2VA 4DGJA 2ANWA 8GCHG 1BTPA 1F0UA 2ZPSA 3TJVA 4AC9A 7GCHG 1AVGH 2C3SA 1NRSH 3H5CB 3MU8A 2W5EA 1H1BA 2FX6A 2VVVA 4MPUA 1GVKB 1PPBH 2HVYB 1U6QA 1A3BH 3RXTA 2F9VA 2FOMB 2ZU5A 5C0UA 1N6YA 1ZSJA 3MNBA 1EZQA 2P3TB 3UNSA 2D26C 4AX9H 2WYGA 4HGCA 2UUFB 1G2LA 3HKIB 3LT3A 1ZHMA 1Q31A 3LGWA 1O3KA 3OE7D 2FTLE 1BTUA 5HGGA 1W0YH 1AFEH 1GCTC 3A85A 1L4ZA 3MH4A 5DK1A 3ODDA 4FUGA 2YMSC 3V12A 3UY9A 5E0JA 2BYAX 2BVXH 3BTDE 6CHAC 4CBNA 4JZFH 2GP9B 3F2HA 2Y5GA 2PKAA 2BHGA 2FOFA 4TWWA 3ZYDA 3KNXA 1Y3XA 4YLQH 1P3EA 1J16A 2JIZD 1QZ8A 1DS2E 1ELEE 2GZ8A 5E2PA 4DT7B 3SO3A 2Q6FA 1GDUA 5DP6A 9LPRA 1SB1H 2CXVA 3MU4A 1YM0A 4FUBA 3QZRA 4CHAC 1C1PA 3M37A 3SUFA 2FTMA 2P95A 1PFXC 4U01A 4FVBA 1EZXC 1RTKA 3K6ZA 4K5ZA 1ARCA 5E0GA 3GY6A 2A5KA 4HZHA 4ISLA 4BAKB 1ABJH 1C4V2 3SZEA 4FVDA 4BAMB 1GJ5H 3F0PA 1LHDH 1P05A 1O2MA 5DP9A 1SGNE 1D3QB 4TT3D 3KGPA 3TGJE 3PO1B 1SGRE 1V2KT 3DFJA 1LO6A 2UUKB 4AN7A 5FXLA 1C4Y2 1G3BA 1ZSLA 4B2CA 1HJ9A 1Z1JA 2XRCA 3MNCA 2RFKC 4B2BA 1CBWC 4IW4E 4ABDA 3LGVA 4IC6A 3BTGE 3PV4A 1MTUA 2O8UA 3CENA 3ZVAA 1GVZA 2R0KA 5E8EH 4YOJA 5EXMA 1EUFA 2W3IA 4NCYA 4YZUA 2ZPQA 3PLPA 4DJZB 3S9AA 4MNVA 1CHGA 6GCHF 1TMTH 1XKAC 3RU4T 1PQ7A 1GHZA 1HJAB 1UVPA 2EI8A 1PPEE 3O8BA 3R0FA 4FUCA 1FJSA 2J98A 2PUXB 3VXFH 4UFDH 1PPHE 1C5MD 3PB1E 1IHTH 2Q6DA 3RMLH 1UCYE 1BTYA 1CHOG 3TJOA 4GAWA 2BX4A 3UUZA 1RFNA 4DCDA 1Z8JB 1CHOF 2QF4A 3B23B 5DPAA 1A4WH 2ZU1A 1Y5BT 3RXUA 3SNAA 1O38A 2C4FH 4B75A 4DY7B 1O5CB 4I8GA 4KELA 1RXPA 3E91A 1MZAA 1LHCH 2VWLA 1H4WA 1S82A 3SJKA 1KTTB 1TGBA 1TNJA 2A0QB 2A7JA 4IBLH 4E7RG 1EFRD 1P57B 1O35A 1ZMJA 3MO9A 1CA0B 5A09A 3TIUA 2GGVB 3RXEA 4AFUA 3RU4E 3OY5U 5KEDA 4BOHA 1QBOA 2PKSC 2XWBI 5DJ7A 2J2UA 3SV9A 1W13U 1EB1H 1GI7B 2ZCHP 4Y8ZA 3IG6B 1KXCA 1O2QA 1BHXB 1TX8A 2ZGXH 2YMSB 4H42U 2OQ5A 3K9XB 1B0EA 2AGIX 1AY6H 3NCLA 1TBQH 2XOKD 6CHAB 1K1IA 2J9NA 4CH8B 2VJ1A 2GX4A 6ESTA 4ZUHA 1D4PB 1DE7H 1ANCA 4UFEH 1EP5A 3PMJA 1C2HA 2BDIA 1V2QT 5FBEA 4CR9A 1XUIA 3UNQA 4D9RA 3UWJH 1AZ8A 1BHXF 1O2YA 2FOHA 5JBAS 4Y76A 2AIQA 1VJAU 2ANMH 1HXFH 1QRWA 5FCKA 1P10A 3P8NA 4RSPA 4K69A 5PTPA 3GDUA 4CREA 1GI6A 2OCVB 2FEQH 4I7YH 1K22H 1VJ9U 5EPYA 4CHAB 4IC5A 5AHGH 1Y5AT 1NU7B 2OC0A 2CGAA 3A84A 1FI8A 4ACBA 3C27B 1SFQB 2G52A 1AB9B 1GJ6A 1V2TT 1UTQA 2I6QA 4THNH 1L1JA 2CV3A 3O8DA 2QXHA 2UUJB 4OS6A 1HLTH 2JDID 2J95A 1S81A 1C1TA 1V2LT 2AIPA 4E05H 1ZTJA 2B9LA 1L2EA 1OPHB 2BLVA 1W14U 2XC0A 4GHQA 4ASUD 4TWYA 2C8WB 1ZPCA 1HIAB 2A4QA 2ZECA 5CHBA 5DKMA 3MYWA 4Q7ZA 4P00A 2STBE 4Q80A 1CBWB 2ZA5A 1V2JT 3AAVA 3SU1A 2HLDD 4LXBH 2VBCA 1GHAG 2BQWB 1OP2A 2G5NA 2NU1E 2ZGJA 4HI3A 3F0OA 1JIRA 1YLNA 1F5RA 2ZGBH 1YPLH 4BXWA 1DOJA 1FAXA 3RLWH 1ORFA 3OYPA 2KCOA 4FUIA 2V3MA 3LGYA 5HYOA 5T6GA 2W26A 4IN2A 4DVAU 1O2ZA 2P16A 1D3PB 2VB0A 2VU8E 1BJUA 2R3YA 5AFYH 2HRVA 2H9TH 4YO9A 4HG6A 3TK5A 1DLKB 1MBQA 1AQ7A 3OAAD 1PQAA 4FU8A 4GUXA 4ABHA 2WPLS 2PSYA 1BBRH 2F9NA 1EJAA 3LIWA 5C2ZA 2OP9A 3A8BA 2G81E 1KTSB 1TPOA 1T8LA 3A83A 1CGJE 2AYWA 1TQ0B 1O0DH 2FX4A 2R9PA 3VB3A 1KLTA 1OHHD 1H8DH 2ULLA 1BQYA 1GBFA 3LJJA 2UUYA 3NRLA 4INLA 3FFGA 1JWTA 4JZDH 2H1UA 2GT8A 3P8FA 3VB4A 1TPAE 1JMOH 2J4IA 4WMFA 1G2MA 3OU0A 5EQQA 1QA7A 2JJ2D 3E6PH 1UCYK 2K1QA 1NPMA 4WH8A 1SFIA 1HDTH 2V3HH 1W12U 2K8IA 1VCQA 1DSTA 1LHGH 1J8AA 3W1EA 3SU6A 1ZHPA 3FVFB 1C5TA 4JZEH 4MLFB 1P11E 3E0PB 3KL6A 4I8HA 3E0NB 1ZLRA 5L2ZH 5JB9S 1P0SH 2FMJA 2V6NA 2V7QD 2C93B 2XC4A 3QGNB 4FUEA 4BAHB 1E1QD 1G37A 5CMXH 4ZXYH 1AKSB 4ISHH 2VWOA 5TCCA 2EI7A 3JZ2B 3SNEA 5FAHA 2JH6D 4GCHG 1NY22 1Z6JH 1F0SA 1TWXB 1P04A 2OXSA 1EATA 3GY7A 3JZ1B 4FOUC 2FP7B 4I32A 3LDXH 1GJAB 1NU9A 1KXBA 1TGNA 4IGDA 3NUMA 1HAPH 3LC5A 5CE1A 1S6FA 4NZLA 4A1VA 1VCPA 4INKA 4UD9H 3ZVDA 4UONA 2TGAA 4ACAA 5BPEA 1S83A 1VR1H 3DCLA 3HK3B 1UO6A 1DLEA 5A0CA 1TBZH 1MAYA 4FUJA 2XCNA 1C9TA 1QL9A 1Y3VA 4MTBA 3RU4D 3Q3KA 1HAHH 1GL1A 3BIUH 2Z9GA 1SBWA 3L3TA 3ZVCA 1EB2A 2BDAA 2H5DA 1IQEA 1GBDA 2OTVA 2HALA 3SN8A 2GCHG 1ANEA 2M2AA 2GCHF 3TH3H 2KM0A 3U9AH 3QTOH 3VPKA 1RTFB 4NG9H 1ZRKA 3SJIA 1HXEH 1D6WA 1EKBB 3LJOA 1A2CH 2VWNA 2CF9H 1YLDA 1AVWA 5A2MH 1QCPA 4CH2B 5IDKA 1GJCB 1G30B 1UTNA 3WWFA 1MUEB 5A8YA 3EYDA 4Q7XA 2PFEA 3V13A 2L6OA 1DY8A 1O2IA 4X0WU 1NFWA 1Y3WA 4J2YB 5EU8A 4FU9A 1OYTH 8KME2 2AGEX 1O2TA 1O3OA 4D9QA 1TPPA 1IQLA 2SGFE 3M7TA 2RG3A 2FDAA 1FY8E 4BNRA 6LPRA 1L0ZA 1W7GH 4CRCA 3QZQA 2P8OC 2FODA 3SOSA 1BTXA 5FCRA 3M61U 1PJPA 3K2UA 1K1LA 3SORA 1O3HA 3TU7H 1JXPA 3NZIA 5TJXA 3DFLA 4WMEA 2HVXA 5LPRA 2AGGX 2ZTYA 3FP8E 1QB6A 5EPNA 1YPHC 2OD3B 3M3SA 4QT8C 1GVLA 4SGBE 4I8LA 2BD8A 3T27A 2A7CA 4UEHH 5EGMA 1BIOA 2W6JD 4U32A 5JBTA 2OC7A 1XKBC 2LNCA 4CRGA 4GLYA 1K1PA 3GOVB 5C1YA 2R3UA 1P01A 1SPJA 3O8RA 2ZPRA 1IQFA 2IPQX 1KSNA 3PV2A 2F9PA 4AZ2B 3O8CA 3ZV9A 4BAOB 3VEQB 1NBME 1LVYA 3RXKA 1GGDC 1MKXH 3NWUA 4YOIA 3F6UH 2WSSD 4H6SB 1BMLA 1WTGH 1HIAA 2RA0A 4AGJA 3SNDA 2G4TA 4Y8XA 2QF3A 3SHCH 3DD2H 1SGCA 1A61H 1BJVA 3FP7E 2VH0A 1BDAA 1NN6A 2BDBA 3MNSA 3K65B 5BRRE 2BLWA 1MTVA 3N7DA 2BY6X 2OUAA 3V0XA 1EAXA 1JRSA 2PUQH 1MTSA 1TGTA 1TABE 4J1YA 2HNTC 1Y5UT 2F3CE 2TGPZ 3TJNA 2A1DB 4OS7A 4B73A 1OKXA 2FWWA 4ABJA 1OSSA 1UVOA 3ITIA 3ODFA 1JOUB 2R0LA 3C1KA 5LPFA 2WPJS 1ELGA 2GTBA 4F48B 4OS5A 5F03A 1O2RA 4IS5A 4X1PU 4AB8A 4ZHAA 3D65E 3PLBA 4RT1A 3PO1C 1YCPM 3TJUA 2YNBA 1E38B 3ATWA 2ZWLH 2BQ7B 4AFQA 4IN1A 5KECA 2BD5A 4X1QU 3GYLB 2PR3A 2R2WU 1BTWA 1JBUH 2FOEA 1ELVA 1TBRH 2KFWA 1ZJKA 2VGCC 2ZHFH 3UR9A 1TGCA 4X8UH 3PMAB 1SQTA 1O3FA 3M35A 2KCPA 1DUAA 3DSPA 3BTFE 3ZZ4A 4ABFA 4OM9A 4UFGH 1H9IE 5A0AE 1TRNA 2VIQA 1O3NA 1O37A 2F83A 1HAZB 2P8OB 1XM1A 3EA8A 1L1GA 1AKSA 8GCHF 1DSUA 4BAQB 7GCHF 3ZVBA 2Y82A 3FP6E 1C1NA 3BG8A 2NWNA 1C1RA 1CA8B 1NS3A 2O9QA 2QE7D 3U69H 3P95A 1RIWC 2PSXA 1EASA 1FAKH 1O5DH 2BD2A 1O2NA 1QL8A 4KGAA 1CA0C 4GHTA 3HATH 3A8AA 2TPIZ 2I6SA 2ZZUH 2AMQA 1INCA 1N6XA 4XBBA 5J4QA 3RXCA 1AIXH 1P9SA 5F8ZA 5C1XA 1FUJA 2ZFPH 1PYTD 2H9EH 1CGHA 1CO7E 3E8LA 1FY5A 1P2IA 5B6LA 2F91A 3A86A 2V35A 3I78A 3RXQA 3ATIA 1GGDB 1O5EH 4X1NU 2NU2E 1O3EA 2TIOA 1LHEH 1AO5A 4K60A 1O2JA 3FOAA 3TGKE 1LVOA 1YCPH 1SKYE 1SLVB 5HIYA 1ZGIA 2GKVE 1DANH 3A7VA 1P02A 3BEUA 1AE8H 4CRAA 1FZZA 1QQUA 3F3BA 4XRNA 4Y7BA 1TX7A 2CHAC 3KQ5A 3SHAH 3RC4A 1TE0A 2QYIA 4TSFD 3I29A 3MO3A 2OK5A 3F9EA 5GDSH 4Y11E 1TQ7B 2OBQA 3UQVA 4KTUA 1NTPA 1AB9C 2SNWA 3WWBA 5LGOA 3SGBE 3GCHC 2G00A 3LH1A 1XXFA 2FYRA 2W7UA 2WHXA 5F8TA 2HNTF 5LPEA 2HLCA 3S9BA 2ZHEH 1B0FA 3HGPA 1DX5M 1GPZA 1OWKA 1K0HA 4LZ4B 3F68H 3AVZA 2K0QA 2Y80A 1BRAA 1F2SE 4BTIB 3SQEE 1EP6A 3A8DA 1UTKA 1NBMD 2DE8A 2UWPA 1LHFH 5ESTE 3V7TA 3SGQE 4NIXA 5GCHG 1ANBA 2IPHA 3QTVH 1UTOA 1GBTA 1SGTA 5GCHF 4JYUH 5CDFE 1GCDA 3R3GB 4K1EA 3QDZB 5K0HA 1TONA 1TRMA 4JZIA 1DWEH 5F8XA 2KR7A 2VGCB 3ATLA 7LPRA 3MI4A 3ZVEA 3GISB 1GHVH 3MOCA 2ZHDA 1O3IA 4A1TA 4WY3A 5E0HA 1A5HA 3QLPH 2D1JA 1CU1A 5I46H 1Z8IB 4AB9A 2RDLA 1GMHG 4XDEA 3T25A 3DSOA 1O5FH 1NRRH 1O34A 1GMHF 1QB9A 3FZZA 4ZKRU 2EA3A 3T5FH 8LPRA 4X2WA 1FONA 2XYAA 1WXRA 1DDJA 2XBXA 1UTJA 3RXRA 3M5NA 1G9IE 1P2KA 3EAJA 3TNSA 3MQKC 1LQEA 2HGTH 4RKOB 1SQAA 1K9OE 1RIWB 4H6TA 1DWBH 2G51A 1OYQA 1B7XB 1UVTH 3CS7A 2J34A 4WVPE 5DO4H 1ZYOA 2BD3A 2PGQB 5FX6A 2BY9X 3RXVA 1A0LA 1HAVB 3HPTB 1TAWA 4DIHH 2BD9A 3A7TA 3MTYA 5HIZA 3K6YA 2CK3D 3OEED 1ETTH 2PTNA 1AUTC 3MMGA 1WDIA 2Z9IA 2KX4A 3PTNA 1ZTLA 3T2NA 5LH8A 4AYVB 2Q1JA 1EOJA 2QA9E 1BCUH 2G8TA 1GI0A 2F9OA 4O97A 2GVFA 2B7DH 3WY8A 2OC8A 4MPVA 2AMPA 1GBJA 1FPCH 3RMNH 1WYKA 3D62A 1EJMA 1RD3B 1G3DA 3MH7A 5JYIA 2EC9H 5DG6A 1YLCA 1IQIA 1QJ1B 2FI3E 2G5VA 4KTCA 1C5SA 3ZZ7A 3STIA 1EPTC 2CHAB 1LKBA 2GT7A 4LOYH 2FS8A 5A8XA 1AUJA 5HXFA 1UK4A 2NU0E 2EY4C 2B5TB 2J94A 1COWD 3QN7A 1ZOMA 5IYTA 3RXGA 1YWUA 2FOGA 3SV8A 1NROH 3F9FA 3LGTA 4KKDA 2IJOB 1GBHA 3GCHB 4FUFA 3RXOA 1V2RT 1C2KA 1YC0A 2H2ZA 3QX5H 2WV5A 4WF8A 4ISOA 4X6OA 4X2XA 2VH6A 1O32A 3TNTA 1OWDA 3F2GA 3BTTE 1BB0B 3B9FH 3D23A 4ZHLU 2FM2A 3RXSA 1C1OA 4IMZA 3ENSB 3W94A 4FXGH 4Z6AH 4ZXXH 1RJXB 2ODQA 2P94A 2AERH 5C17A 1MTNC 2XBWA 5HKKD 3LU9B 1C1UH 1MAXA 1G32B 1C1MA 2B8OH 4WJG2 2VIVA 1SHYA 1AU8A 1BMFD 1GHAF 1O2OA 2Y7ZA 2BMGB 2BY7X 2P3FH 1SGPE 1C5ZB 1LVMA 4JYTA 1IOEA 1O2WA 3GCOA 1WCZA 3A88A 1KDQB 5FL7D 1FN8A 4NWLA 5HM9A 1V3XA 2VVCA 5EQSA 1C5WB 2F9BH 2ZQ1A 1V2ST 3U8TH 1S6HA 3SU5A 3QUMP 3SV7A 1CT4E 2ZFQH 3VB5A 4A5TS 2YNAA 3M7UA 1GBBA 2ILNA 3S0NA 5JDUB 4OS1A 1TOMH 1E37B 2ZTZA 1AE5A 3SI3H 3VB6A 4X8TH 1OWHA 1SGEE 2Z6BD 3RXAA 1QGFA 1DM4B 1DT2A 4XD7D 1MKWK 5EJLA 2BX3A 2SFAA 4E06H 2THFB 5EXNA 2ZDNA 4D76A 3SGAE 5EXLA 7KMEH 5GPIB 2H9HA 1EOLA 1G3EA 1OP0A 4LZ1H 1QBVH 2B0FA 2OC1A 5AVDA 2JETC 1ANDA 1NRNH 2QF5A 1ZPBA 3PMHB 1XUFA 3Q76A 2QY0B 2XNDD 2AS9A 2FOCA 3NKKA 1O3LA 1RS0A 2ZIQH 1E0FD 1TNHA 2ZC9H 5DP5A 1A3EH 1WU1A 1YPMH 1O2UA 2ZI2H 3T28A 1V2VT 2J97A 2L74A 1DITH 1C5YB 1GDNA 3SJ9A 1OWJA 3EA9A 1Z71A 2AHME 3ZZBA 2WUCA 4X1SU 4Z1MD 2ZTXA 3OTJE 3TK9A 1P12E 1ELAA 2ZO3H 3SUGA 4A6LA 2UWOA 4F55A 4CRFA 1OP8A 1YP9A 2Z9KA 1ZMNA 3UQOA 2ZHWH 1O2KA 2ODPA 3VXEH 1CSOE 1FY1A 1H9HE 1LMWB 3SV6A 1BRUP 2GV6A 4Y10E 4ASHA 4GCHF 2G55A 2XBVA 4XSKU 1C9PA 3U8OH 2Z7FE 3SNBA 4YT7H 1EPTB 5C3NA 4YT6H 5AF9H 2M5TA 1O3GA 1T31A 4K8YA 1TNGA 2ALVA 3LONA 1FIWA 4GPGA 4JZ1A 1NZQH 3SI4H 1UVUH 2QC2A 1E35B 4ESTE 3RC5A 5C5NA 1B5GH 1ETSH 3Q77A 2ZHQH 1UJ1A 1ETRH 2CF8H 1W2KH 3GY2A 1DVAH 1GBKA 1VGCC 3U8RH 1V6DA 1HAXB 4Y7AA 3UREA 3H09A 5K7RA 1O3DA 2FZZA 1TALA 2FOAA 3D49H 1GBLA 1OX1A 1P2QA 1TRYA 1MTNB 1NO9H 3KQDA 4X8SH 2QAAA 2AEIH 3VB7A 1THRH 4NWKA 3UTUH 2RDEA 1O3CA 5I25A 1HB0B 4RI0A 1BRBE 4M7GA 3BEFB 1J14A 2JKHA 1HAVA 5DP7A 1D3DB 3RXHA 2BLOA 2A32A 1C2FA 3SJOA 1THSH 4AOQA 2OLGA 3RXPA 3UOPA 1P2NA 2GD4B 2PW8H 3G01A 2A4GA 5EG4A 1BMNH 1OXGA 1KMHB 1TX6A 2J38A 1FPHH 5GWZA 5L2YH 1LCYA 2NU3E 4Q4LA 3KF2A 1FLEE 1BMAA 5JBCS 2FO9A 1KYNA 2WPMS 4P02A 1ID5H 1MKXK 2FI4E 3ATMA 2FIRH 2ALPA 2IOTA 2WPKS 1P2OA 1AI8H 2A5IA 3CNRA 5CHAC 3QK1A 1SG8B 3CS0A 2C8ZB 1T4VH 4Y0YE 3PMBB 1X7AC 2G4UA 5EW2H 2JETB 1GDQA 2XWAA 5GNDA 1KXEA 1QTFA 2VIOA 4INHA 4YESB 4WXIA 3RMMH 1SGYE 3S7HB 1DXPA 1IQNA 1V2MT 4XBCA 1G36A 2PGBB 1YF4A 5HMAA 4B6FA 2P93A 3S69A 2BZAA 3GDVA 2LPRA 3Q00A 4XBDA 2WPIS 2BTCE 1LQDB 2NU4E 1L1NA 2TRMA 1WQVH 1Y8TA 3UFAA 3AK5A 3VFEA 5J4SA 1DUEA 4NA9H 4ABIA 3RXDA 4ZMAH 2O8LA 5L6NH 5JBBS 1GHWH 1PQ8A 1MBMA 2EEKA 3Q3XA 3E16B 3LKWA 2D2DA 2ZFSA 2ZU3A 1A5IA 1TB6H 1CE5A 3TH4H 1TFXA 2FLBH 1Y59T 3KYFA 2QXIA 1BRCE 1QNJA 3PLKA 1KDQA 3AAUA 1IQMA 4WXVA 1O3AA 3URCA 4NIYA 5F53A 1BMMH 1E1RD 1Z1IA 1UTPA 1ESAA 2O8WA 3M7QA 3P17H 4NFFA 1ZR0A 3MH5A 3UAIC 1C5NH 2VIWA 4YXWD 3M5OA 4RN6A 3DA9B 4CBOA 1EXFA 1AWFH 1VZQH 1T8MA 3STJA 1TIOA 1UVSH 7ESTE 2XCFA 1ELFA 1MD8A 3SU3A 1PQ5A 4Y79A 5EJ1A 1TNIA 2GJGA 3MO6A 1YYY1 2PLXA 1VGCB 3NXPA 4RT0A 1Q3XA 3ZZ8A 1HV7A 1K28D 1P09A 3ZZ9A 5C0TA 2BVRH 1MCVA 2SNVA 1NC6A 5ESBA 1F92A 1QURH 1ZGVA 4X2YA 1WTHD 3RC6A 4Q63A 3QGJA 5ABWA 1Y3UA 2ZDAH 4ZKOU 4DIIH 3QO6A 4I31A 4XFQA 1MH0A 2FI5E 3UWIA 2BVSH 1LVBA 4CRDA 2XXLA 3SNCA 1ZMLA 1H8HD 1MCTA 1BITA 3URDA 5EW1H 3M3VA 1TA2A 3NPSA 1P06A 4K1TA 5IK2D 1SOZA 1GMCG 3A7WA 4FUHA 1S6LA 4TYDA 2A4RA 1FQ3A 1SGIB 1BTZA 1AFQC 2JH5D 2BY8X 1C2GA 2YMSD 1ELDE 2ZKSA 1GG6C 1M9UA 3Q3YA 1D3TB 1NRPH 1O2GH 1SI5H 1UHBA 2IJD1 1QB1A 2VIPA 5T6DA 4ABAA 1ZRBA 5EIYA 4K2YA 1BTHH 1XUGA 2A4OA 2BD7A 2QCYA 1HNEE 2WV9A 1FMGA 2BXUH 5CHAB 1YCPK 3F2FA 2QXGA 3E3TA 1GMDG 1GHBG 1ZHRA 1T7CA 1EPTA 1ZZZA 2F9UA 1YPKH 1GMDF 1KIGH 2FESH 1A46H 3FANA 3W95A 1CT0E 1KXDA 1C5LH 4NA8A 4B2AA 2ZU2A 2XTTB 4TPIZ 1A0HB 1GI8B 3F9GA 4M9FA 3HK6B 3SU2A 3H7TA 1YPGH 4NFEA 4AGKA 1K1JA 2ASUB 2CJIA 1DY9A 3LGIA 1AVXA 3U28C 1TOCB 2GDEH 2QGRA 1SGFA 1C2JA 1GBIA 4I86A 2Y7XA 2ZG0H 5FBIA 3VGCC 2IN2A 1GBMA 1JIMA 4MNXA 2BQ6B 5DP8A 1YPEH 3SZNA 3LH3A 1AGJA 3PTBA 2STAE 1HRTH 1FY3A 1QFKH 3GY4A 1E36B 3SV2H 3A7XA 1O5GH 1K1NA 2J92A 4DG4A 1O36A 4OS2A 1S85A 4XE4A 1GJ7B 4F4OC 1AN1E 1O2XA 1FX0B 9ESTA 1BBRE 1YGCH 1F5KU 2AFQB 2Y6TA 3ELAH 2SGQE 3OX7U 1SOTA 1N8OC 1C2DA 2A45B 1SC8U 3A87A 2BDGA 2BZ6H 3RXJA 3OFND 1TNKA 3L33A 1VCWA 4GVUA 3ZZ6A 4OGXA 1XXDA 1V2UT 3E1XB 3OSYA 5JB8S 1K1MA 3IWMA 5GIBA 1HAYB 4ZROA 3S9CA 5DGJA 4JK6A 1O3PB 3UB0A 1P2MA 3SJ8A 3MWIU 5FX5A 2BM2A 5JPMH 1XUKA 4FU7A 1V2OT 2ANKH 1LPGB 4DOQA 1LDTT 1PYTC 1SLUB 4D7FA 3ZYEA 4KTSA 4RKJB 1NRQH 4OS4A 1SQOA 4AFSA 5DP4A 2DE9A 3FN8A 4X6NA 3PV5A 1F0RA 1ELCA 2ZGCA 3EGKH 3TVJB 2V3OH 1IQGA 2WZQA 3MH6A 1P2JA 1CQQA 2ZFRH 2VVUA 1FNIA 1HGTH 1IQKA 1EQ9A 2GCTB 4KP0A 5T3HA 1TMBH 1DPOA 1MTWA 3AW1A 2FS9A 4Y71A 2BOKA 1OS8A 1T8OA 2XNIA 1W10U 3BTME 1XUJA 1O30A 1AFQB 2GMTC 4LK4A 1BOQA 1GG6B 2A2QH 2KCYA 3MFJA 4MPXA 3ZZ5A 3RXMA 3ZVGA 3GS9A 4O9VA 5DN6D 6GCHG 1XVMA 1KXFA 4TY6A 1ESBA 1MU6B 1TLDA 3TITA 1LTOA 3AASA 2BDCA 4WWYA 8ESTE 1SHHB 2H6MA 4F49A 2Z3CA 2ZGHA 3KIDU 3PROA 3GCNA 4K3JA 2QN5T 5GXPA 1IHSH 2DUCA 2F4LA 2OQUA 1W0JD 1WUNH 1XMNB 4MPWA 3T62A 2VWMA 4CR5A 2Y81A 1C5UA 1D9IA 1SGDE 2QIQA 4NZQA 4I33A 3ATKA 1W7XH 1F0TA 3L6PA 1WOFA 1MU8B 2Z9JA 3DUXH 3ZZDA 3OY6U 4B1TA 3VGCB 1VITH 3MNXA 1AMHA 1A5GH 2F43B 4AORA 2A7HA 3SU0A 3GYMA 1O2VA 1WSSH 2XC5A 2W3KA 1EAIA 4ZH8A 1QHRB 1ABIH 1GCTB 1YPHE 4A7IB 3KN2A 3GY3A 4WH6A 1H9LB 3KYGA 2QF0A 3CP7A 1ZPZA 1C2IA 1RGQA 1TMUH 3M3TA 1S5SA 1HCGA 1RTLA 2BDYA 3ZZAA 4BANB 1GI3A 1SMFE 1W3CA 2PV9B 1LPZB 4DURA 1XX9A 3BG4C 1YY3A 1N8OB 1YPJH 2ZF0H 1IQJA 3KQCA 3EE0B 1BUIA 4U30A 1C5QA 3HGNA 3N7OA 3TK6A 1EAUA 3RXIA 4UFFH 1XVOA 1WQSA 1MABB 3SYJA 3BTHE 3P8OA 1F5LA 1UTLM 2UWLA 1CT2E 1SLXB 1T32A 2ANYA 3SU4A 1BA8B 3DSGA 1GJ8B 1K1OA 2HPPH 3GICB 1Z7KA 3U1JB 4X6MA 1YKTA 2OBOA 4B76A 3LC3A 3M36A 3S7KB 1LKAA 1C2LA 1BBRK 1AHTH 1YBWA 1O39A 2RCEA 3A89A 3F1SB 4ZKSU 2Z3EA 4AFZA 5A0BA 1EZUC 2HNTE 3LPRA 4ZCNA 4HTCH 3FKSD 1A1RA 1GI4A 4JYVH 1KLIH 5E2OA 2ZDKA 1AWHB 3H7OA 4ZAEA 3FZDA 2JH0D 2BLQA 1XUHA 3TLOA 1RRKA 2O8MA 3P6ZB 1DXWA 1QL7A 1MQ6A 2HPQH 3KEEA 1AZZA 5C94A 5C67A 3MU0A 4PROA 3HKJB 5GJ4B 3AW0A 2FLRH
chains in the Genus database with same CATH topology
1ELTA 1P9UA 2FPZA 1O3JA 2QXJA 3MHWU 1AD8H 2GMTB 1Z8GA 4GSOA 3SQHE 1O31A 1GJ9B 3ZZCA 4YM9A 3UR6A 5T6FA 3V3MA 1C5OH 4I8JA 2XW9A 1H8IH 3BTWE 4H4FA 4X6PA 1HFDA 5L30H 1Q2WA 2SGAA 1WV7H 4BTUB 5EOKA 1QBNA 1OOKB 1O2LA 2FOBA 1SL3A 4B74A 1UK2A 3BTEE 3KCGH 2ZDVH 2ZDMA 3GDSA 3EA7A 3GCTG 3U98H 4Y6DA 4MNYA 2BDHA 3GCTF 1IAUA 5A8ZA 4ISIH 5TCAA 1PPCE 4Q7YA 4CRBA 4XOJA 1GL0E 1K21H 2R2MB 4ABEA 3SBKA 4ZHMU 1D6RA 1HUTH 1FN6A 3RP2A 3ESTA 4I8KA 4Y0ZE 2VIDA 1F7ZA 3QWCH 2P59A 3TH2H 1UHBB 1HAOH 2KAIB 2PKSB 3PM3A 4YLUA 5HM2A 2YOLA 1NESE 4K1SA 3A81A 1PPGE 2ZCLP 4SGAE 3RLYH 2GZ7A 1C5XB 1V2NT 1JRTA 1QIXB 1O3MA 3LOXA 4NSVA 3RM2H 1SR5C 4HFPB 2AMDA 5FHTA 3BG4B 1MKWH 1TPSA 1Z8RA 2D8WA 1SLWB 1C5VA 2ZQ2A 1GI5A 1FV9A 4E7NA 3RXLA 1TGSZ 1BT7A 4DW2U 3PWBA 2WV4A 2Q6GA 2V0BA 2SGDE 1Z6EA 1N1LA 2ZP0H 4TY7A 1DWCH 1L4DA 1S0RA 2C90B 1GI2A 5B6OA 1OWIA 4ABBA 1TNLA 1ESTA 1VITG 3TPIZ 1C2MA 1WBGB 1VITF 1P8VC 2ZFFH 4Y8YA 3RXFA 2A31A 1C4U2 4O3UA 3P92A 3A7YA 1C1QA 1EJNA 4MVNA 1FDPA 5EQRA 4AG2A 1HAIH 3U1IB 1UCYH 1O33A 2A5AA 1GJDB 1T4UH 1HPGA 1FY4A 1HAGE 1SGFG 2PTCE 3E90B 4D8NA 3LGUA 1P03A 3RDZA 1UTMA 4O3TA 3BTKE 2ZEBA 1FXYA 4ISNA 2PKAB 3BF6H 2Y5FA 1T8NA 3BIVH 4VGCC 2TBSA 2ESTE 3B8JA 2HWLB 1QA0A 3EDXB 1W0ZU 4FUDA 4ZKNU 1SGQE 2FYQA 4R8TB 1ELBA 1ARBA 3RMOH 2TGDA 3UNRA 1PPFE 5EODA 1G3CA 1ZJDA 3KQEA 1UK3A 3KHVA 3UIRA 1W8BH 2Y5HA 3BV9B 1CGIE 1NFUA 1DWDH 1NFXA 1GHYH 3ZVFA 5DP3A 4AYYB 2A2XH 3GY5A 1A0JA 1GHXH 3BSQA 1GI9B 1DICA 1C5PA 2W7SA 4R0IA 1QRZA 2RA3A 3RUOA 3PYHA 3MU1A 4Q2KA 2O8TA 4UE7H 4A1XA 2PHBA 1A7SA 1O3BA 1BZXE 2BXTH 2WYJA 4YTAA 1QRXA 1EZSC 4NGAH 4MQAA 4AG1A 3NK8A 1J9CH 1J15A 1KXAA 2SGEE 3SUEA 1NFYA 3PWCA 4B71A 3RXBA 3A7ZA 3KQBA 1S0QA 3ZZ3A 2TGTA 1EAWA 2WPHS 2Z9LA 2WINI 4U2WA 3A8CA 1GJ4H 2XBYA 3RM0H 1KLJH 1QQ4A 1THPB 1NM6A 1QJ7B 4NA7A 1V2WT 2CN0H 1GWAA 2C8XB 1CVWH 1O5AB 3T26A 3T29A 1SVPA 5FPYA 1QY6A 4JMYA 3TGIE 3I77A 5F6MA 2H5CA 2Z94A 3P70B 1KY9A 1LPKB 4X8VH 2AH4X 3BEIB 1O2PA 4TPYA 1HJ8A 1W11U 1S84A 5FPTA 3DHKH 2FXRA 2OINA 2SGPE 3A80A 1IQHA 1MMJN 2PWXA 4NSYA 2CMYA 4NIWA 3MU5A 4Z0KA 1J17T 1GBEA 4BTTB 4NIVA 2ZCKP 1C1VH 4WMDA 5G4BA 4OGYA 3DT0H 4JCNA 5AFZH 1C2EA 2VINA 3UPEA 1ZSKA 2ZDLA 4ABGA 4A92A 2P3UB 3M5MA 2WUBA 4BXSA 1QR3E 3ZV8A 1ZTKA 5FPSA 1P3CA 3UOUA 4K8BA 3FAOA 1DFPA 1C1SA 4MDSA 1HYLA 1V2PT 2GDDA 3BTQE 2Z3DA 2QV1A 4O03A 4YOGA 3P8GA 4JK5A 5C20A 1WAYB 5C5OA 2GCTC 3SW2B 4VGCB 4MNWA 1EX3A 1FIZA 4UDWH 3A82A 5H4IB 5SGAE 1O2SA 4MG3A 2ZU4A 2BB4A 5C1UA 1E34B 2VNTA 4IMQA 3IITA 2ZNKH 1MQ5A 1ACBE 1GMCF 1TA6A 2EI6A 2BY5X 1C5RA 1GBAA 2KAIA 1O5BB 1MZDA 3M5LA 2ODYB 1MD7A 1GBCA 3BN9A 1QJ6B 1GI1A 1NT1A 1PPZA 2BOHB 1UMAH 3GY8A 2BD4A 1OWEA 1Y3YA 1HJAC 4X1RU 3F9HA 3EQ0H 1O2HA 5ETXA 4D7GA 1SSXA 1TYNA 3SUDA 1K2I1 1C1WH 2HOBA 1GHBF 2ZFTA 1HBTH 1GJBB 2GV7A 2GZ9A 2C8YB 4X2VA 4DGJA 2ANWA 8GCHG 1BTPA 1F0UA 2ZPSA 3TJVA 7GCHG 1AVGH 2C3SA 1NRSH 3H5CB 3MU8A 2W5EA 1H1BA 2FX6A 2VVVA 4MPUA 1GVKB 1PPBH 1U6QA 1A3BH 3RXTA 2F9VA 2FOMB 2ZU5A 1N6YA 1ZSJA 3MNBA 1EZQA 2P3TB 3UNSA 2D26C 4AX9H 2WYGA 4HGCA 2UUFB 1G2LA 3HKIB 3LT3A 1ZHMA 1Q31A 3LGWA 1O3KA 2FTLE 1BTUA 5HGGA 1W0YH 1AFEH 1GCTC 3A85A 1L4ZA 3MH4A 5DK1A 3ODDA 4FUGA 3V12A 3UY9A 5E0JA 2BYAX 2BVXH 3BTDE 6CHAC 4CBNA 4JZFH 2GP9B 2Y5GA 2PKAA 2BHGA 2FOFA 4TWWA 3ZYDA 3KNXA 1Y3XA 4YLQH 1P3EA 1J16A 1DS2E 1ELEE 2GZ8A 5E2PA 4DT7B 3SO3A 2Q6FA 1GDUA 5DP6A 9LPRA 1SB1H 2CXVA 3MU4A 1YM0A 4FUBA 3QZRA 4CHAC 1C1PA 3M37A 3SUFA 2FTMA 2P95A 1PFXC 4U01A 4FVBA 1EZXC 1RTKA 3K6ZA 4K5ZA 1ARCA 5E0GA 3GY6A 2A5KA 4HZHA 4ISLA 4BAKB 1ABJH 1C4V2 4FVDA 4BAMB 1GJ5H 1LHDH 1P05A 1O2MA 5DP9A 1SGNE 1D3QB 3KGPA 3TGJE 3PO1B 1SGRE 1V2KT 3DFJA 1LO6A 2UUKB 4AN7A 5FXLA 1C4Y2 1G3BA 1ZSLA 4B2CA 1HJ9A 1Z1JA 2XRCA 3MNCA 4B2BA 1CBWC 4IW4E 4ABDA 3LGVA 4IC6A 3BTGE 3PV4A 1MTUA 2O8UA 3CENA 3ZVAA 1GVZA 2R0KA 5E8EH 4YOJA 5EXMA 1EUFA 2W3IA 4NCYA 4YZUA 2ZPQA 3PLPA 4DJZB 3S9AA 4MNVA 1CHGA 6GCHF 1TMTH 1XKAC 3RU4T 1PQ7A 1GHZA 1HJAB 1UVPA 2EI8A 1PPEE 3O8BA 3R0FA 4FUCA 1FJSA 2PUXB 3VXFH 4UFDH 1PPHE 1C5MD 3PB1E 1IHTH 2Q6DA 3RMLH 1UCYE 1BTYA 1CHOG 3TJOA 4GAWA 2BX4A 3UUZA 1RFNA 4DCDA 1Z8JB 1CHOF 3B23B 5DPAA 1A4WH 2ZU1A 1Y5BT 3RXUA 3SNAA 1O38A 2C4FH 4B75A 4DY7B 1O5CB 4I8GA 4KELA 1RXPA 3E91A 1MZAA 1LHCH 2VWLA 1H4WA 1S82A 3SJKA 1KTTB 1TGBA 1TNJA 2A0QB 2A7JA 4IBLH 4E7RG 1P57B 1O35A 1ZMJA 3MO9A 1CA0B 5A09A 3TIUA 2GGVB 3RXEA 4AFUA 3RU4E 3OY5U 4BOHA 1QBOA 2PKSC 2XWBI 5DJ7A 2J2UA 3SV9A 1W13U 1EB1H 1GI7B 2ZCHP 4Y8ZA 3IG6B 1KXCA 1O2QA 1BHXB 1TX8A 2ZGXH 4H42U 2OQ5A 3K9XB 1B0EA 2AGIX 1AY6H 3NCLA 1TBQH 6CHAB 1K1IA 2J9NA 4CH8B 2VJ1A 2GX4A 6ESTA 4ZUHA 1D4PB 1DE7H 1ANCA 4UFEH 1EP5A 3PMJA 1C2HA 2BDIA 1V2QT 5FBEA 4CR9A 1XUIA 3UNQA 4D9RA 3UWJH 1AZ8A 1BHXF 1O2YA 2FOHA 5JBAS 4Y76A 2AIQA 1VJAU 2ANMH 1HXFH 1QRWA 5FCKA 1P10A 3P8NA 4RSPA 4K69A 5PTPA 3GDUA 4CREA 1GI6A 2OCVB 2FEQH 4I7YH 1K22H 1VJ9U 5EPYA 4CHAB 4IC5A 5AHGH 1Y5AT 1NU7B 2OC0A 2CGAA 3A84A 1FI8A 3C27B 1SFQB 2G52A 1AB9B 1GJ6A 1V2TT 1UTQA 2I6QA 4THNH 1L1JA 2CV3A 3O8DA 2QXHA 2UUJB 4OS6A 1HLTH 2J95A 1S81A 1C1TA 1V2LT 2AIPA 4E05H 1ZTJA 2B9LA 1L2EA 1OPHB 2BLVA 1W14U 2XC0A 4GHQA 4TWYA 2C8WB 1ZPCA 1HIAB 2A4QA 2ZECA 5DKMA 3MYWA 4Q7ZA 2STBE 4Q80A 1CBWB 2ZA5A 1V2JT 3AAVA 3SU1A 4LXBH 1GHAG 2BQWB 1OP2A 2G5NA 2NU1E 2ZGJA 4HI3A 1JIRA 1F5RA 2ZGBH 1YPLH 4BXWA 1DOJA 1FAXA 3RLWH 1ORFA 3OYPA 4FUIA 3LGYA 5HYOA 5T6GA 2W26A 4IN2A 4DVAU 1O2ZA 2P16A 1D3PB 2VB0A 2VU8E 1BJUA 2R3YA 5AFYH 2HRVA 2H9TH 4YO9A 3TK5A 1DLKB 1MBQA 1AQ7A 1PQAA 4FU8A 4GUXA 4ABHA 2WPLS 2PSYA 1BBRH 2F9NA 1EJAA 3LIWA 5C2ZA 2OP9A 3A8BA 2G81E 1KTSB 1TPOA 1T8LA 3A83A 1CGJE 2AYWA 1TQ0B 1O0DH 2FX4A 2R9PA 3VB3A 1KLTA 1H8DH 2ULLA 1BQYA 1GBFA 3LJJA 2UUYA 4INLA 3FFGA 1JWTA 4JZDH 2H1UA 2GT8A 3P8FA 3VB4A 1TPAE 1JMOH 2J4IA 4WMFA 1G2MA 3OU0A 5EQQA 1QA7A 3E6PH 1UCYK 2K1QA 1NPMA 4WH8A 1SFIA 1HDTH 2V3HH 1W12U 1VCQA 1DSTA 1LHGH 1J8AA 3SU6A 1ZHPA 3FVFB 1C5TA 4JZEH 4MLFB 1P11E 3E0PB 3KL6A 4I8HA 3E0NB 1ZLRA 5L2ZH 5JB9S 1P0SH 2FMJA 2V6NA 3QGNB 2C93B 2XC4A 4FUEA 4BAHB 1G37A 5CMXH 4ZXYH 1AKSB 4ISHH 2VWOA 5TCCA 2EI7A 3JZ2B 3SNEA 5FAHA 2JH6D 4GCHG 1NY22 1Z6JH 1F0SA 1TWXB 1P04A 2OXSA 1EATA 3GY7A 3JZ1B 4I32A 2FP7B 3LDXH 1GJAB 1NU9A 1KXBA 1TGNA 4IGDA 3NUMA 1HAPH 3LC5A 5CE1A 1S6FA 4NZLA 4A1VA 1VCPA 4INKA 4UD9H 3ZVDA 4UONA 2TGAA 5BPEA 1S83A 1VR1H 3HK3B 1UO6A 1DLEA 5A0CA 1TBZH 1MAYA 4FUJA 2XCNA 1C9TA 1QL9A 1Y3VA 4MTBA 3RU4D 3Q3KA 1HAHH 1GL1A 3BIUH 2Z9GA 1SBWA 3L3TA 3ZVCA 1EB2A 2BDAA 2H5DA 1IQEA 1GBDA 2OTVA 2HALA 3SN8A 2GCHG 1ANEA 2GCHF 3TH3H 3U9AH 3QTOH 3VPKA 1RTFB 4NG9H 1ZRKA 3SJIA 1HXEH 1D6WA 1EKBB 3LJOA 1A2CH 2VWNA 2CF9H 1YLDA 1AVWA 5A2MH 1QCPA 4CH2B 5IDKA 1GJCB 1G30B 1UTNA 1MUEB 5A8YA 3EYDA 4Q7XA 2PFEA 3V13A 1DY8A 1O2IA 4X0WU 1NFWA 1Y3WA 4J2YB 5EU8A 4FU9A 1OYTH 8KME2 2AGEX 1O2TA 1O3OA 4D9QA 1TPPA 1IQLA 2SGFE 3M7TA 2RG3A 2FDAA 1FY8E 4BNRA 6LPRA 1L0ZA 1W7GH 4CRCA 3QZQA 2P8OC 2FODA 3SOSA 1BTXA 5FCRA 3M61U 1PJPA 3K2UA 1K1LA 3SORA 1O3HA 3TU7H 1JXPA 3NZIA 5TJXA 3DFLA 4WMEA 2HVXA 5LPRA 2AGGX 2ZTYA 3FP8E 1QB6A 5EPNA 1YPHC 2OD3B 3M3SA 4QT8C 1GVLA 4SGBE 4I8LA 2BD8A 3T27A 2A7CA 4UEHH 5EGMA 1BIOA 4U32A 5JBTA 2OC7A 1XKBC 2LNCA 4CRGA 4GLYA 1K1PA 3GOVB 5C1YA 2R3UA 1P01A 1SPJA 3O8RA 2ZPRA 1IQFA 1KSNA 2F9PA 4AZ2B 3O8CA 3ZV9A 4BAOB 3VEQB 1LVYA 3RXKA 1GGDC 1MKXH 3NWUA 4YOIA 3F6UH 4H6SB 1BMLA 1WTGH 1HIAA 2RA0A 4AGJA 3SNDA 2G4TA 4Y8XA 2QF3A 3SHCH 3DD2H 1SGCA 1A61H 1BJVA 3FP7E 2VH0A 1BDAA 1NN6A 2BDBA 3MNSA 3K65B 5BRRE 2BLWA 1MTVA 2BY6X 2OUAA 3V0XA 1EAXA 1JRSA 2PUQH 1MTSA 1TGTA 1TABE 4J1YA 2HNTC 1Y5UT 2F3CE 2TGPZ 3TJNA 2A1DB 4OS7A 4B73A 1OKXA 2FWWA 4ABJA 1OSSA 1UVOA 3ITIA 3ODFA 1JOUB 2R0LA 3C1KA 5LPFA 2WPJS 1ELGA 2GTBA 4OS5A 5F03A 1O2RA 4IS5A 4X1PU 4AB8A 4ZHAA 3D65E 3PLBA 3PO1C 1YCPM 3TJUA 2YNBA 1E38B 3ATWA 2ZWLH 2BQ7B 4AFQA 4IN1A 2BD5A 4X1QU 3GYLB 2PR3A 2R2WU 1BTWA 1JBUH 2FOEA 1ELVA 1TBRH 1ZJKA 2VGCC 2ZHFH 3UR9A 1TGCA 4X8UH 3PMAB 1SQTA 1O3FA 3M35A 1DUAA 3BTFE 3ZZ4A 4ABFA 4UFGH 1H9IE 5A0AE 1TRNA 2VIQA 1O3NA 1O37A 2F83A 1HAZB 2P8OB 1XM1A