2TMPA

N-terminal domain of tissue inhibitor of metalloproteinase-2 (n-timp-2), nmr, 49 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
b'CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TISSUE INHIBITOR OF METALLOPROTEINASES-2
publication title High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease inhibitor
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 1998-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tmpA00
3L3OC 3MA2B 1UEAB 2I07B 1BR9A 2B39A 1JC7A 5FO7B 2XWBB 4ILWA 5JPMC 1XWEA 5JPNC 2A73B 3V96A 5FO9B 4FXKC 1GXDC 1JB3A 3FRPB 3HRZC 3OHXC 3T4AC 3CU7A 1D2BA 3G6JB 2E2DC 2QKIC 3CKIB 2J0TD 1BQQT 2ICEC 5FOBB 3I70A 4FXGC 1OO9B 1BUVT 2WIIB 2XWJB 3KLSA 3HS0C 2TMPA 1PXUA 1UAPA 2WINB 5FO8B 2A74C
chains in the Genus database with same CATH superfamily
2F0SA 1MKHA 2EYPA 5M3MH 2VQFL 3BVMA 3JAME 5DM73 5C4HA 4RKLA 4RH6A 4NPSA 4RMFA 5AJ3L 1KNAA 3QO2A 3DLLA 3NUCA 4DV1L 4ZRZA 2YU9H 3M4OH 4A4IA 3W1GA 4IJHA 3CXCA 1E2VA 3VYSA 4PQXA 3DWPA 1MJEA 2V1CC 5EAYA 2EJGC 3FKIH 3KOJA 3O13A 4X66L 2O5JC 5TSSA 1WFQA 2KBNA 3J7YW 2C5CA 4DAVA 2PPBC 4OGQC 1XMQQ 3H0GB 1X3FA 1EFWA 4JI5Q 1SEBD 4A3CG 4A3LH 5M9OA 5DEHA 4AIMA 2AUJD 1EYCA 4B3MQ 1HR0W 4FF2A 1RTNA 2MJ8A 1J6QA 4QY7A 2B8GA 4X62L 1PTOF 1N34Q 2B63G 3E0EA 4DR1L 1UE6A 1M4VA 2NVXB 1B3QA 4DR4Q 1N32Q 4YCWA 3BVGA 4X3KA 2NVTB 3VA5A 2PQAA 1O7ZA 3TREA 4QCLA 1IBKL 3RUZA 1RDPD 2K05A 5IYCG 1JMCA 5LHY1 1SMYD 1NAPA 3NP8A 4A3MB 2OTLA 2UU9Q 4RGOS 1PH5A 4DV4L 2ICEC 1MD2D 2B29A 2Q2IA 2Z6KA 4MTKA 1EY6A 2K03A 4LF4L 2H1EA 1K8GA 1G91A 4JI2Q 2BH8A 3MA2B 2VY3A 4LF7L 1E2WA 4KLKA 1DD2A 1TS4A 1ENFA 2JA9A 1PH8A 3RLNA 3KBGA 3MEHA 4CDFC 1IHZA 3QOLA 5EBDA 1CZGA 1PA6A 3UI2A 2F0EA 3WOEA 2E2DC 1ESFA 4LF5Q 2MPMA 3MFYA 4TQUS 1N33Q 4YWKA 2F4IA 3H0GG 4QB4A 5CV7A 1JB7A 1TWFH 3U58A 1XYIA 1HZBA 4NMZA 1G6ZA 3P1HA 1EIFA 4GLVB 1WD1A 1YHBA 1R4QB 1YNNC 2QDBA 1ESRA 3ICEA 2M00A 3RZDH 1XMQL 4JI5L 4DNTB 1JB3A 4YHHQ 3CRKC 3SDZA 3AMUA 4GNXC 3F8TA 3JAMc 1NCVA 3HOVB 5EPKA 4XXEA 4X65L 3JAMi 5JEAJ 3OMGA 2DNEA 4IPDA 1B4OA 4N8X1 2LSSA 3M85A 1U4RA 1SAPA 4DR4L 5A35A 4YCVA 1Y1VH 5FLXE 5BN5A 1NR4A 2RA4A 4Y7NB 2F52A 1TWAH 2YU9B 4FXKC 2EXZA 4IOAA 1EWIA 1JE5A 1HJPA 3I56A 3T53B 4K5XA 1VQ4A 1W2BA 1YBYA 4KN7C 5EGTA 5IGFA 4FF1A 4FF4A 2UXCQ 1EYGA 2UU9L 5IYDH 3W1BA 2H5XA 1U4PA 3NK9A 4IFDI 4LF6Q 2NVYH 1EQQA 5E4WC 1PXUA 1CQVA 3FKIB 4DK0A 4JI2L 4LJZC 3R93A 4JW0A 1K83B 4IURA 2NTSA 1AP0A 3C46A 1NR2A 3EBEA 3KYHC 5E4XA 1VQFA 2CWPA 1X3PA 1LT6D 1TU2B 3RLOA 1D1KA 2K01A 3KK7A 3M7NA 3CKIB 1Y1WH 4LF5L 3TP5A 2JA8H 3IRBA 1OTCA 1IXRA 3H6MA 4L5RC 2XSCA 2EYOA 4PMWA 1N33L 3D4WA 2BDOA 4HSPA 3MAQA 2ZJRA 1U4LA 1B44D 2O2LD 1QILA 3I90A 3AB9A 3PUYA 1GJXA 5IGDA 1L0XB 3HOVG 4JBJA 2HQEA 3I7FA 4GN4B 1PTOH 4A93B 1XJVA 1PFNA 1CHQD 3MWYW 4DR6Q 3SK6A 3M4OB 1FD7D 5CORA 4YHHL 2V4DA 1V1OA 4C3IH 2C9OA 3I70A 1S5CD 4EQOA 2RHSB 3V05A 4GOPA 3NELA 4TKOB 1DJRD 4JBMA 1VQJA 3J80E 5C4JH 4K14A 1O7IA 2NTTA 3R2TA 3X3MA 3GTOB 2EYMA 4XYQA 3R8BA 1SJHD 1WVLA 4BXXG 1CUKA 3FKIG 5DNFA 1HNWL 4OIKA 5IP7G 2Z4HA 3GTMH 3DXJC 4UAIA 2MHVA 5KGUA 2QEXA 3HGBA 4N9PA 1VQPA 2UXCL 1M1KC 3OIPA 1OXSC 4LF6L 3UE1A 4Z9CB 5IIFA 3C2PA 1FJGQ 5K5PA 1TWFB 2UXDL 2MQHA 4RKBA 5H1SE 4DK6C 1VF5C 4ABNA 2CCZA 2LXKA 3CC7A 1GHJA 2WB1E 1F9SA 4P74A 2L4NA 1LM0A 2LS01 4JVZA 4OXPA 2KA7A 1QNKA 5LL6S 3I4OA 2KCMA 5NUCA 3S1QH 4KY5A 4DV6Q 1YHQA 4LW1A 1ICFB 1ZEQX 3CHBD 1MBYA 4A76A 3TBIB 4A93G 2FXQA 2Z6KC 1Z9FA 1Y1VB 3J81i 1WCMH 4YY3Q 3F1ZA 5D14A 1TWAB 2B2TA 2QEJC 4K5VA 2F0QA 4DR6L 1VQGA 5JJIA 2NVYB 5CMDA 3QG1A 3ZJYC 4MN3A 4S3SA 3HOXB 2K5HA 4O0AA 3S1RH 1CZWA 3WDNA 3PUZA 3U4ZA 2F0JA 4RAUC 1AZPA 2OQKA 1AEXA 2YTXA 1WYDA 3EROA 5IODA 5JJZA 1LYLA 5IT9E 4RA8A 5I6WA 1G51A 3MXPA 1PH2A 2UUAQ 3G48A 2GVBA 4JC0A 2Z0SA 3UDXA 1EEFD 4FVMA 1ICWA 4DUYQ 4DAPA 1QJOA 1V1QA 2ES2A 2J4XA 3Q24A 4K0KQ 1X32A 5IGBA 1Z47A 3VR4A 2JA7H 1DXMA 3D3RA 1I6VC 3VR5A 1KNEA 2K28A 5K36H 3I73A 4NKLA 1PZKD 2IY5B 4RCNA 4DU9A 2R92H 1PTOB 1TWGB 4EQPA 4A3BH 2AQ1B 2GA4B 4FDBA 4FNFA 4X64L 1YJ9A 3Q6SA 2ATWA 2WB1B 4XT3B 1D2BA 2F0TA 3L0OA 1Y1VG 2E5LQ 2NBFA 1NE3A 2R93H 4K2LA 1G6PA 3J80i 2IW3A 1PRTD 5C6AA 3MXGA 2Q8TA 1L2FA 1IW7D 1EY5A 1K0SA 2LXJA 1YIJA 3CPFA 2K1BA 2O5IC 1QUQA 3HOXG 4MHEA 3OIQA 4RFBA 2QKIC 1HA5A 5JAVA 3K5LA 2DUDA 3RMHA 1J8IA 1IYVA 1MSGA 2N49A 3HS0C 4ZKCB 5J1ZA 5A2QL 3HZXA 3NXWA 2SOBA 3GDEA 4CGYB 2ZM6Q 3TDQA 3MXNB 1F9PA 1ONLA 1W6JA 5CYUA 1G2SA 1EIGA 3NTKA 1NSNS 4XQJA 3VR2A 1HTLD 1BBUA 1X56A 4IO9A 1AN8A 3FRPB 4DUYL 2A6HC 2JK8A 2K32A 1SE4A 4K0KL 4QIWE 4POFA 5KNCA 1IKMA 3Q8DA 2KOLA 3HEJA 4RCOA 2F0UA 2E76C 4K5WA 1I94Q 3VR6A 4F7XA 1XPOA 1FGUA 1MSHA 2PI2E 2I0QA 2VNUD 3ULLA 2WB1G 2E74C 1BR9A 1K3BC 3A8IE 2RF4A 1LTTD 3U9OA 5CV4A 5I2XA 4OWXB 4YIJA 4B3TL 5ELEA 3PCOB 4R8NA 1O7LA 1F9RA 2F0WA 5M3FH 1HQMC 4MIUA 1ENCA 5IT9c 2E5LL 3CP0A 1C8CA 1YNND 4TSSA 4EQNA 2RHQB 3TP6A 1WTHA 5CBEE 3LX0A 4DPGA 2ASBA 3G4SA 5IYBH 1KL9A 4CKEA 1PH4A 2E2IB 2NN6I 4CJ2C 1CKNB 4CBVA 4UP7A 5C0XI 5CBAE 1STAA 4DAYA 1NMFA 2B8FA 1DOLA 3D6CA 2JA7B 1EQRA 5COYA 1Y69U 1PZID 2ZM6L 1SYCA 4LF8Q 1WTVA 2HHHQ 4KHVA 1XWEA 2CVRA 1EWHA 4YWLA 2EZVA 1ET6A 4BY1H 1DOKA 2BA1A 3CCEA 4F8MA 5IGGA 3PUVA 4A3DB 1QVGA 1IL8A 5IY0A 2NUCA 2B2TC 4ALPA 1KRTA 5JVH3 4PZ8A 1PYSB 1II3A 4J15A 1I94L 1LO5D 1WOCA 1BCPC 4QIWB 3FP9A 1VQNA 1STHA 5EKLA 4K2KA 2PQEA 4P2CB 5C44H 2K5QA 3RLFA 1HR0Q 2K50A 1P16A 5LMNW 2NN6H 1L1OB 4JCVE 4IPHA 2JA5H 1VQKA 3W5OA 3S17H 1NJIC 3PGZA 1N36Q 1HZCA 2NVQH 4XQQA 4EQ5A 1LTBD 1S5ED 4K6DA 3KJPA 1HH2P 1VDZA 3SVMA 4JI7L 3E9HA 1WTPA 2RDHA 1VQHA 5EBCA 2EY2A 1BCPF 1FR3A 2JA7G 4IFDJ 1U5KA 3SK5A 1H9JA 4GKJQ 5K36G 2XRQD 4DV5Q 4RGTA 1RHPA 2R7ZB 1HNXQ 1EZ6A 1K28A 2RQXA 4JBWA 3D0FA 3HOWH 3CU7A 4HCSA 4H7BA 5EKIA 2KEEA 3FPPA 2JA6H 5GADC 3OTOQ 2OF1A 2XGTA 4LF9L 5IGEA 2KCCA 5I2YA 1XPUA 1STNA 1K3RA 1B8AA 1ML0D 2Q8IB 4LF8L 4A3DG 2DN8A 3TSSA 2HHHL 4A3JH 1TWCH 2A6ED 1EQTA 1EOVA 2F0LA 4C2MH 3BZCA 5C5LA 1ILQA 5M3FB 3N52A 3HRZC 1YJWA 2VUMB 3QB3A 4X3TA 1BO0A 2IL8A 2UUCL 4A3FH 5IWAL 4JI8Q 4DV4Q 1I6HH 1TQOA 1V1PA 3C3LA 2RDGA 2EVBA 1Z7TA 4LF7Q 3TN2A 2AHOB 2PQAB 1HR0L 3BDCA 4LFBQ 5JPMC 2LMCB 2YV5A 3PIO3 3STBC 4MZ9A 5T1GA 4FF3A 3S2HB 5HGTA 2RCNA 3D4DA 1N36L 3EQLC 1PTOC 3K0YA 4FXGC 3UDIA 1XNQQ 3NEMA 1E22A 4HCEA 2L1BA 5JEAG 2A68C 1PH6A 2R7ZG 3TP8A 4C3JH 2IJ0A 2KJXA 2E8GA 3NQIA 3TMEA 1UE5A 4LUZA 3M4QA 3SGIA 1S3OA 1A3TA 5CV5A 4GKJL 4HJ7A 2K33A 4DV5L 3OHXC 1HNXL 1VQAA 1EU3A 2PMZB 3NBHA 3D4RA 4ODGA 4IUVA 5G3LD 1EY0A 1BBWA 2EYLA 3OTOL 3Q23A 2Z6BA 2EY6A 1RTOA 1XPRA 4X65Q 5AFWA 2EOTA 1TS3A 5M3FG 1CHPD 2VUMG 2QW7A 5J22A 3M3YB 4GKKQ 1I50H 3I55A 2OTJA 1BOSA 1E7ZA 1S40A 2YTVA 3U9SA 1SN8A 2JA5B 3J7A5 3S17B 1HXYD 2K5NA 2HD3A 5IYBG 1AH9A 3NTHA 2ALYB 3F2BA 2NVQB 3TS2A 4KJNA 3K7AH 2Q2UA 2HCCA 4V190 4JI8L 3H3VI 1S72A 2EYJA 2D0OA 3OWFA 2DGYA 2PW5A 1PFSA 4K8IA 1VF7A 1PV4A 1SFOH 1ASYA 2I5HA 2K6AA 2K4KA 4LFBL 3VR3A 3QIAA 3S1NH 2KCTA 3BS1A 4PG3A 5E1FA 4R4OA 2JA6B 2ICIA 3S2DH 2IX0A 1R9TH 2XWJB 4KD3A 1EZ8A 4HN7A 3PMFA 4UPAA 1XNQL 2XN9C 3G6EA 2K04A 2PZTA 3FHWA 4DXGA 2BE5D 4A3JB 1EUJA 2K5DA 2KHIA 2M9VA 1QVFA 4C2MB 2RSNA 2A69C 2DJGC 1JR0D 3SE0A 4DR3L 2F0KA 1NUCA 2N8NA 4JK1C 4XTCS 1PYWD 3ND8A 2SDFA 4LNQA 1QB5D 1LLRD 3S14B 1I6HB 2L9HA 3I4MH 4DA2A 3H3VH 3NBIA 4A3KH 4HAEA 2JSOA 3AEVA 4GLAC 4P71A 3CCQA 4L5TA 2JA5G 3HG9A 4RGNA 5M3MB 3ER0A 1VQDA 1XTDA 2G9HD 2Z9HA 4QF4A 1B3AA 2MO1A 4GKKL 1JC7A 2BA0A 4A3MG 3GTLH 2KQ3A 1T9HA 1X6OA 3E6ZX 1S5FD 1BKBA 1SNCA 4PZ6A 2EJFC 1U9RA 2EJMA 4OELB 1HNWQ 5I6YA 2L55A 4QQBX 1E24A 3GTPH 4GOPB 3OYYA 4J8QA 4ZCKA 1VQEA 2YYZA 4C3JB 1YI2A 4OO1G 2UXDQ 3J7AV 4LK1C 2JA6G 5ELDA 1VQ9A 3W3AA 2FMMA 2ZXRA 1BNZA 2RCFA 2A5HA 2B2UA 4PNYA 4IPGA 1GD7A 1UE7A 3HOYH 1O78A 1F2ZA 2FJ2A 1D5XC 5KYLA 3G7LA 4A3JG 1GO3E 1Q8KA 5EPLA 1JE4A 2BOSA 3HFZB 1BUVT 2F0HA 4QJFA 3CAMA 1L1OC 1UAPA 1BVSA 3CMAA 1SJED 4B08A 5I4DA 4BS9A 1FNWA 3SR1A 1I50B 4WJ4A 2EY1A 1HUMA 2VXWA 3PIP3 1IBLL 1S4ZA 1X3QA 3QR8A 4C1NK 4CDEC 5FLMH 3ONAB 1SXTA 2AQ2B 3BU2A 2PNHA 1EY9A 4Q0FA 1H9KA 2FINB 3K59A 2Q8RE 1UUPA 4PMBA 5M3MG 3GTQH 2MFIA 2DY8A 3CCSA 3A56A 4HJ8A 1BQQT 5FLXL 4B3RL 2OXPA 4KV6A 1I3QH 3J81L 4IFDH 2GVAA 2D2CC 4HSVA 2VB2X 1VMPA 1B70B 2K5VA 4OX9Q 5L37A 3A55A 3BYTB 3AFQA 4FXDA 3AYHB 2KECA 5FJ8H 4A3IH 1MHWC 4X3UA 4GN5A 4C3JG 1I4RA 3CQZH 3NENA 3Q0AA 3DM3A 1BCPB 1H9RA 3S2DB 1R9TB 3RR5A 5IP9H 1QG7A 4HMIA 4QUFA 2C35B 3BZKA 1KQSA 2ZTEA 5C0XJ 1UWVA 1VQIA 3E9IA 4A3LG 1T5XD 4ME5A 1Q81C 4KHPQ 3WOFA 1OXVA 2ZT9C 4POGA 1RIPA 3LWUA 3U50C 3RZDB 5D65A 3KF8A 2F3VA 4HJAA 4IJLA 3SK4A 2A19A 5JJKA 4X64Q 3I4MB 3H15A 1A3VA 5C4ZA 1WJJA 4A3KB 1HQRD 1TR5A 2D62A 2ZJQA 1E0BA 4DV7Q 2EXDA 2NZ1D 3R3OA 2VS1A 1V8QA 3D6WA 2B3GA 4YWMA 1SROA 2EYHA 1AW7A 1OXUA 4QMGA 2ZTDA 1GXDC 3KLWA 1SNDA 3J80L 1CTMA 1Q90A 1L0YB 1VQ6A 1LT4D 2FHTA 1G8ZD 2ZXOA 1PFBA 3ERQA 3M4PA 1EY7A 1SYBA 4L5QA 4NDXA 2L0CA 1GOZA 1HFNA 3PUXA 2KEDA 5KEEA 4OX9L 4HMJA 2JJQA 1QUQB 1HZ9A 3I8ZA 3HKSA 5JPNC 4DF7A 3HOYB 3T1HL 3A0JA 4Y52H 4OONA 3KF6A 2OWOA 1LTSD 2IHEA 1Y1WB 5E3FA 2D9UA 2K52A 3KDFB 4R1JA 2JA8B 5FOBB 4P75A 3STBD 4DUZQ 2IT1A 2F03A 3IL8A 1CSQA 1JICA 3M4YA 3DUZA 4AYBE 3EFXD 3E3XA 3I4MG 1PTOD 5M5YH 4KHPL 2K5WA 4ZK9B 4J1MA 3CCMA 4A3KG 1DOMA 1SYDA 2OQ0A 2EIFA 3DHQA 1TXYA 1WTXA 4B3TQ 4DN4M 3HOZH 1WTRA 4LMQD 4JI6Q 2KVMA 4C3IB 1GUNA 5C3EH 4R9WA 4UY8C 1EFID 2IX1A 4DV7L 1KIXA 3I2ZA 5C4JB 1Y14B 5IYDG 4HEDA 1XTCD 5BN3A 2ZTCA 4L5SA 1D8LA 1JJCB 2F1MA 3CQZB 2BCOA 1EIYB 1FNVA 5LL6X 5FO9B 2R61A 3GTMB 1NY4A 4M8AA 3V2TA 3K57A 3NQTA 3QOJA 4R8IA 1FL0A 2H4OA 4O42A 1STEA 1YHAA 1JQYD 3ZYYX 1WTWA 3KDFA 4LAAA 2RBMA 1CI3M 3FDTA 3HOYG 3C1EA 1Q8IA 2NWGA 1DGSA 1W3SA 5GROA 3P20A 1LTAD 2F0DA 1Y1WG 1D5ZC 2JA8G 2X6GA 4OWTB 2QILA 2F3IA 2L12A 4C3HH 1SYFA 2F0OA 2ID0A 3KLSX 3CCLA 4DAYB 1SLJA 4GLXA 1M90C 3CC2A 5C4XH 3S1QB 1Q82C 1NTGA 3GTGH 2E75C 2F0FA 3FEWX 4IUNA 1ENAA 3PV0A 1IBMQ 3PUWA 3BVZA 5LMUQ 4H44C 2AKWB 4DUZL 4QL5A 4R4IA 3KLRA 4KD4A 3CRLC 3K5OA 1A6XA 1WCMB 1PH1A 4AYBB 4GOPC 4C3IG 2SNSA 2PZWA 3H09A 4IFDG 1JWMD 2LY7A 1SNOA 2EY5A 1PH7A 5FK9C 1MGSA 2NZOA 4MNOA 1IL2A 2PYKA 4O2DA 2CH4A 2A69D 5M5XH 1XNRQ 2RDFA 4JI6L 1HA6A 4BA2I 3GV3A 3L7ZC 1SNPA 3SHLA 4EGVA 1LT3D 3S1RB 2TMPA 4HIKA 1YVCA 2VQEQ 4JI7Q 1CK1A 1STBA 1V9PA 4G4KA 2I07B 1F2LA 1F77A 2R3ZA 2X6LA 4MTNA 3DEPA 4JOIA 1N8RC 3S15H 2AUKA 2B63H 5ELOA 2F0PA 3M9BA 2CWAA 4A3GH 4WRDA 1CKOA 1Q1BA 4LF9Q 3PF5A 5LMNL 4JI3Q 2I46A 1H9SA 3Q22A 2KHJA 4QGUA 2AQ3B 2Y0SE 1KTKA 1UEAB 3NE5B 1SYEA 2R92B 1G2TA 5BN4A 5GQOA 4A3BB 4DGZA 1K8MA 4XDXA 4AH6A 1C48A 3MHBA 3AU7A 3PF4A 5C3EB 3UDGA 3RN5A 1D7QA 1P8LA 1WCMG 2UUCQ 2RVLA 1AZQA 1DYQA 2CQAA 2R93B 4AYBG 4E6IA 1E1TA 2A1AA 4UP8A 4DAMA 1STGA 2MP1A 5IWAQ 1IBML 5LMUL 1XMOQ 1PLFA 4U673 2EE1A 3NHHA 3CCRA 1JJ2A 3IFDA 3CC4A 4DK1A 4KY6A 4HTHA 2Q2HA 2HDLA 1I4PA 3ULJA 4NXNL 4IALA 1TY2A 4I7AA 5E7NA 1VMCA 1MJCA 4OO1I 1DCZA 5JJLA 1YNXA 5C0XH 1XNRL 4G7ZC 3RN2A 1V1PB 3T56B 3GP7A 4DV0L 1PHJA 1Y8OB 5HGQA 4OEMB 5KNDA 3DWAA 4CDDC 4HIMA 3SK8A 4JV5Q 2VQEL 1HCZA 1XXGA 1F9QA 2Z1CA 3L3OC 4CKBA 4JI4L 3H3VC 1S5BD 2I5LX 2XTIA 2RSOA 2NVXH 2L11A 2YTYA 2KCNA 2PMZE 4GNXA 5CV8A 2MUYA 4DR5L 3HOUH 3NTIA 1TT2A 3AFPA 3NWSA 1A15A 4JYAQ 3CCVA 4B3SL 3FMCA 4DK3C 2R92G 1I5FA 4A3BG 1HRJA 4ZQ3A 3EVQA 2WKDA 1QZHA 4JI3L 1WTOA 4L8JA 1VQ5A 2XVSA 2QA4A 1SE3A 5C3EG 1G291 4R4QA 1GUSA 5IGCA 1D1IA 2R93G 1LACA 4YCUA 4UHVA 2Y0SB 4LUVA 1LTLA 4HIDA 3NBHB 3RNUA 1IYUA 5M5XB 1SYGA 3V96A 1Q1EA 5EQ0A 4JI1L 2KENA 4DFAA 4DNIA 1XMOL 3F2DA 2N88A 4N8FA 1LTRD 3K58A 1HPCA 1EYAA 1A8VA 1K8OA 1C0AA 2FFKB 1F2MA 5M5WH 4FO2A 1W6KA 3F2CA 4X3SA 2QDLA 4FYDA 3A8KE 2R7FA 4EVOA 4L6TB 1FYCA 4A3GB 1H95A 3HOVH 2WIIB 3A54A 2MO0A 2RKSA 1HZAA 4FP5D 4CJ1B 1QOHA 4JV5L 3LWEA 3BG3A 4JG2A 2D5DA 3MEFA 1I4QA 5GAGC 3OWEB 1VQMA 1N9WA 2F0VA 4DR3Q 2E2JH 4BY1B 4B9WA 1OXXK 1KAWA 1Z6HA 2TSSA 3GTKH 4H02A 4Y7NH 4F88A 2IWHA 3S16H 4JYAL 3TZUA 1B2TA 4DKAC 4K8JA 2X69A 2XRSD 3PQIA 4OHJA 2WACA 2Y0SG 1C7YA 1GVPA 3S1MH 1ILPA 2CHBD 1K73C 4BXXH 4LFAQ 3K5MA 5C44B 1JT8A 5EJWA 5IP7H 5CR3A 5JOBA 1GUOA 1K83H 2F3WA 3J7AF 5IE8A 3BZDB 1X65A 3VYUA 4JI0Q 4HR7B 1PRTC 4G57A 5DLQE 3T4AC 1GHKA 1RCVD 1IW7C 4JOIC 1CQFA 1KDBA 1LT5D 5IOCA 3K6OA 3JAML 1ZYRC 3A5UA 2R6GA 2UXBQ 4BA1I 1EEID 1Q3LA 5BR8L 4V0BA 3DEOA 1SBBB 3BDLA 2UUBQ 1A2UA 1SRUA 3VA7A 4UP9A 4LWCA 4A3GG 1EQVA 1Q7YC 2CW0C 1JWSD 4Q5VA 5FO7B 1OXTA 2XIWA 3HOUB 5D3DA 3BYYB 4OL7A 1QNUA 4OIJA 1O7YA 3HOWB 3IKJA 1DZ1A 4KTAA 4A93H 4DNRB 2WP8J 4LUOA 1PRTF 1X55A 2NZHA 2PNRC 5I9OA 2VW9A 2M2LA 2HUGA 4KKTA 2LFNA 1JOQA 4BY1G 1A0IA 5CV9A 2VZAA 3D8GA 4IOCA 1MIUA 4R4CA 3CCUA 1KLGD 5I9PA 1EWCA 1T5EA 1TWCB 2L15A 1IBLQ 1BF4A 3PIOA 2OT2A 4APVA 3GTOH 2IHFA 5GAEC 5C44G 4A3FB 5J3BA 1PYBA 1TWHH 2JEAI 5ELCA 2NN6G 3TQYA 4B3RQ 3BDOA 2QF7A 4PMCA 1CSPA 3PSIA 2A6HD 5KYIA 3ITPA 4B9XA 5C0XG 4RHSA 4LFAL 1K8AC 5M5WB 2PW7A 3G71A 4ZLTF 1NBWA 2AWNA 4XQNA 4JI0L 1J9OA 4BWGB 4B3ML 1DM0B 2PO4A 4KMUC 1U0LA 3MZ5A 2UXBL 4KN4C 4ULLA 2EQSA 1N34L 3HOUG 2EDGA 1FVIA 2JEBI 3B6YA 4DR2Q 4PZ7A 3HOWG 2UUBL 1L0WA 1JOKA 1N32L 1RKNA 2E2JB 5DAUA 2N78A 3GTKB 2HCIA 2QCPX 4ZKBB 3J81E 1LTGD 2B2YA 3S16B 1WI5A 3X3NA 1IZ6A 4KJOA 2AWOA 4NW2A 4L63B 4ZUIA 1KRSA 1B9NA 3S1MB 1LV9A 4A75A 1OO9B 5FKAC 4OWWB 3E5SA 2WINB 3HOXH 3KJOA 1SE2A 4IUTA 2JQOA 2O4XA 4A3FG 1IYJB 3EIVA 4A3EH 1AFPA 1E3PA 4C1NI 3KF8B 2D0PA 3H94A 1YNJC 2K75A 3RD4A 1ZXTA 3T16A 1BXTA 1M8AA 3K7AB 2WAQE 3VYTA 4U68A 4G7HC 1F2YA 5ISRA 4F87A 1KAAA 4IUUA 1DONA 1SFOB 4AQYQ 2SNMA 3UE0A 2G5DA 1JWUD 4WJWA 3F2UA 4GZYC 1D5MC 3S1NB 2G9DA 2F0IA 2DJFC 1X3EA 2B2WA 3H91A 3OOCA 1BCPD 3T1HQ 1TWGH 3PO3H 4O1NA 2KHSA 1TVXA 4JBKA 3OMCA 2F4VQ 3JC66 4IPCA 1KLUD 3MFGA 3QJYA 4BBSH 3NPPA 4DR2L 1SE8A 1LABA 4EX5A 1AE3A 4HIOA 3DM1A 3KF6B 4C56C 1A3UA 1I4HA 1TWHB 2Z4IA 4KK7A 2BDNA 3GQBA 1O80A 1Q86C 1LTID 1YZ6A 1CT1D 4X6AH 2A6EC 4KHZA 1J5EQ 1A62A 4CKCA 4NP5A 1X54A 4M1UB 1S5DD 4XYOA 1YEZA 3GTLB 1EOTA 5KRUA 3UDFA 1TKWB 4P72A 2MGSA 3A5ZB 4XIGS 1PH3A 3GTPB 1VQLA 3ND9A 2J0TD 4JPBW 5GAHC 1X3GA 5FLXc 2DNCA 1TS5A 3CMEA 2CKZB 1PZJD 3J81c 3TS0A 2B2VA 2WAQB 4CJ0B 3KBXA 4K6LA 4ME3A 4AQYL 3EJIA 3PIPA 2B39A 5HURA 1RJTA 3FVQA 2PZUA 1SNMA 4GS3A 5JVG3 1HUNA 2DY7A 1STYA 4WFN3 1VCIA 2MNAA 4KY7A 2N55A 2WFWA 2F4VL 4KKUA 2ENBA 1CA6A 3KFUA 1FGBD 4A3EB 1ASZA 4TVAB 1B53A 2JXMB 1PFMA 3TP7A 1YJNA 2QGQA 4IN3A 3OSOA 2A68D 2E2IH 2EYFA 5ELFA 5A2QE 1H9MA 3GTQB 2KUMA 4BY7H 4IQZA 1KDCA 1LUZA 2K7VA 2OEOA 1I3QB 1JORA 4H13C 1UNSA 1FJGL 1RL2A 3N6RA 2WV6D 1TIID 1J5EL 3K0XA 2EPBA 1B1ZA 5C3WA 1WD0A 2JE6I 2BH2A 1KHIA 4RHRA 5J39A 1AE2A 4A3IB 2SEBD 3PO3B 1SMYC 1HFGA 1EYDA 5CC4A 3J7ZC 5G3LF 4BBRH 2WAQG 2A73B 3A7LA 4WJ3M 5T1IA 3I4NH 3QWNA 1KABA 3MC0B 2JN4A 3J80c 4KKSA 4A3DH 2B2YC 3A7AB 5IT9L 4DV6L 2B2UC 3TRZA 4BBSB 5DM63 3P7JA 3CD6A 3CCJA 3PO2H 1CA5A 1SNQA 4CHTB 2I5MX 5LMNQ 2NB0A 3OW2A 1PRTB 1QZGA 2CH4W 1WTQA 1K9MC 1VQBA 1ZYRD 3NWTA 1HHVA 1Q12A 1BBXC 1CKMA 1QE6A 4RGMA 5HY6A 4YY3L 4DV2Q 1PH9A 2XWBB 1GUWA 3LGJA 5ELNA 3HP3A 1D6EC 3MTSA 4A3EG 2CW0D 2BE5C 3NSWA 5FLMG 3I72A 3CPWA 2F0MA 4XT1B 1H9SB 4J6HA 3T51B 1GUTA 3LNNA 2A74C 2IPKD 4DV3Q 3ERSX 1SSOA 1RD9D 2J7ZA 2UUAL 3I91A 4R4TA 1YITA 3HKZE 4NXNQ 4ILWA 2N3SA 3S9WA 3J81j 1NNXA 1HNZQ 3I3CA 1GKHA 1TS2A 4RWSC 2F0GA 3EA6A 1SR3A 3KUPA 5JEAH 2VL6A 1UEBA 3AQQA 4IUPA 3TEHB 2B2WC 2R7ZH 3G6JB 4QUCA 5D3IB 3T1YQ 3DMUA 5FJ8G 4A3IG 1Y8NB 3PO3G 4DV0Q 3OW7A 1UE1A 3GV6A 3GTJH 4HJ5A 1KDAA 4JI4Q 1KXLA 4A3CH 3RZOH 1VQOA 5IP9G 1B50A 1A2TA 4BBSG 2L5TA 1KC8C 3C1FA 1NMGA 1QVCA 4CDCC 1GUGA 3EN2A 5C3XA 4DR5Q 1EIHA 2ZXPA 2VUMH 1V43A 4NB3A 3WWVA 1EY4A 1U4MA 1PMRA 4B3SQ 1JOOA 3S24A 2PCFB 1C9OA 3L9AX 3U4VA 1ZKOA 4G7OC 5M5YB 4PV1C 3BJUA 2HT1A 2E2HH 2Q2TA 5IYCH 4GNXB 4DR7Q 3A8JE 4TRDA 5KIXA 4DV2L 5CV6A 3R2IA 3MXNA 1GM5A 1KD1C 3HOZB 4RG1A 4BY7B 3K7UC 1Q46A 1VQ8A 1C4QA 4JI1Q 2NYZD 3S2HH 1FNUA 5ELBA 5C4XG 2E2HB 3OPOA 1JJGA 4NXMQ 4DV3L 4H0LC 1QCBD 2B2VC 3CF5A 5C5MA 1MI2A 4BBRB 3K81C 1EU4A 2HQLA 2HIVA 3I4NB 2OCEA 1HNZL 3DWQA 4GN3B 3HKZB 1SDFA 4UDUC 3H0GH 3T1YL 3PO2B 2WKCA 1YNJD 4ZUJA 4LFCQ 1JCKB 3VYRA 2IX3A 3KLSA 3IAYA 3K80C 2HIXA 3L2PA 3GD7A 4ZAIA 4ZYSA 2CQOA 3MVVA 2XNAC 2A8VA 2VQFQ 2K14A 1QWYA 4C3HB 3M3YH 2FMCA 1BDOA 1VQCA 5AJ3Q 1EL0A 2NVTH 1R4PB 5C4XB 1CKNA 1XX8A 4IZ8A 4DV1Q 3GTGB 3TZDA 1RF2D 1K0RA 5EKKA 3T13A 4DXFA 1EY8A 4A3MH 2P5ZX 1VS0A 2VB3X 3D31A 5FO8B 2GN5A 3HOZG 4BY7G 4P73A 5F2DA 4X66Q 1VQ7A 2R7DA 3VDYA 4DR7L 3SEBA 3E0JA 3CW2C 4I65A 3URYA 3I4LA 1PVOA 4HJ9A 1PDQA 1ET9A 3W2DA 1HTPA 4OO1H 1X9NA 2JP1A 3GTJB 2HDMA 4X62Q 4BBRG 1E1OA 1B7YB 1A63A 3I4NG 4KI0A 2JYOA 5BR8Q 4NXML 1E2ZA 1CFMA 3K5NA 4DR1Q 3RZOB 3HKZG 4ID6A 2CFMA 2LKVA 1I4XA 3PO2G 2AMCB 3A74A 3FPUB 3ULPA 3S15B 5KNBA 3IFTA 5EPJA 2B63B 2F0NA 2PI2A 4WORA 1Y8PB 3P75A 1IBKQ 1SMXA 1RODA 3K8AA 1L1OA 1IKLA 1I4GA 4I7ZC 5CGKA 4LFCL 3S14H 4IUQA 3GO5A 4C3HG 3SXHA 1TY0A 4LF4Q 2ZJPA 2Z8LA 1CM9A 3MXUA 3M7GA 1B9MA 4N9TA
chains in the Genus database with same CATH topology
2F0SA 2EYPA 3BVMA 3JAME 5DM73 5C4HA 4RKLA 4RH6A 1KNAA 3QO2A 3NUCA 4ZRZA 1E2VA 3VYSA 4PQXA 3DWPA 2EJGC 3O13A 2O5JC 5TSSA 3J7YW 2C5CA 4DAVA 2PPBC 4OGQC 3H0GB 1SEBD 5M9OA 5DEHA 2AUJD 1EYCA 4FF2A 1RTNA 2MJ8A 2B8GA 1PTOF 1M4VA 2NVXB 3BVGA 4X3KA 2NVTB 3VA5A 1O7ZA 4QCLA 3RUZA 1RDPD 2K05A 5LHY1 1SMYD 1NAPA 3NP8A 4A3MB 4RGOS 2ICEC 1MD2D 1EY6A 2K03A 2H1EA 1G91A 3MA2B 1E2WA 1DD2A 1TS4A 1ENFA 3KBGA 3MEHA 1IHZA 3QOLA 5EBDA 1CZGA 3UI2A 2F0EA 3WOEA 2E2DC 1ESFA 2MPMA 3MFYA 4TQUS 2F4IA 4QB4A 5CV7A 1XYIA 4NMZA 1G6ZA 3P1HA 1WD1A 1R4QB 1YNNC 2QDBA 1ESRA 2M00A 4DNTB 1JB3A 3CRKC 3SDZA 3AMUA 3HOVB 1NCVA 5EPKA 4XXEA 5JEAJ 3OMGA 2DNEA 1B4OA 3M85A 1U4RA 1SAPA 5A35A 5FLXE 5BN5A 1NR4A 2RA4A 4Y7NB 2YU9B 4FXKC 2EXZA 3M4OB 3T53B 4K5XA 4FF1A 5EGTA 4KN7C 5IGFA 4FF4A 1U4PA 3NK9A 4IFDI 5E4WC 1PXUA 1CQVA 3FKIB 4DK0A 4LJZC 3R93A 1K83B 4IURA 2NTSA 1AP0A 3C46A 1NR2A 5E4XA 1X3PA 1LT6D 1TU2B 1D1KA 2K01A 3KK7A 3M7NA 3CKIB 3TP5A 3H6MA 2XSCA 2EYOA 4PMWA 3D4WA 2BDOA 4HSPA 3MAQA 1U4LA 1B44D 2O2LD 1QILA 3I90A 3AB9A 3PUYA 1GJXA 5IGDA 1L0XB 2HQEA 1PTOH 4A93B 1PFNA 1CHQD 3MWYW 3SK6A 1FD7D 5CORA 2V4DA 1V1OA 2C9OA 3I70A 1S5CD 4EQOA 3V05A 4TKOB 1DJRD 3J80E 4K14A 2NTTA 3R2TA 3X3MA 3GTOB 2EYMA 4XYQA 3R8BA 1SJHD 1WVLA 5DNFA 4OIKA 2Z4HA 3DXJC 4UAIA 2MHVA 5KGUA 3HGBA 4N9PA 3OIPA 1OXSC 4Z9CB 5IIFA 3C2PA 5K5PA 1TWFB 4RKBA 1VF5C 4ABNA 1GHJA 1F9SA 2L4NA 2LS01 2KA7A 1QNKA 5LL6S 5NUCA 4KY5A 1ZEQX 3CHBD 1MBYA 3TBIB 1Y1VB 5D14A 1TWAB 2B2TA 2QEJC 4K5VA 2F0QA 2NVYB 5CMDA 3QG1A 4MN3A 4S3SA 3HOXB 1CZWA 3WDNA 3PUZA 2F0JA 4RAUC 1AZPA 1AEXA 3EROA 5IODA 5JJZA 5IT9E 4RA8A 5I6WA 3MXPA 1EEFD 4FVMA 1ICWA 4DAPA 1QJOA 2J4XA 3Q24A 1X32A 5IGBA 1Z47A 3VR4A 1DXMA 3D3RA 1I6VC 3VR5A 1KNEA 2K28A 5K36H 3I73A 4NKLA 1PZKD 4RCNA 4DU9A 1PTOB 1TWGB 4EQPA 2AQ1B 2GA4B 4FNFA 3Q6SA 2WB1B 4XT3B 1D2BA 2F0TA 2NBFA 4K2LA 2IW3A 1PRTD 5C6AA 3MXGA 2Q8TA 1IW7D 1EY5A 2K1BA 2O5IC 4MHEA 3OIQA 4RFBA 2QKIC 1HA5A 5JAVA 3K5LA 3RMHA 1J8IA 1IYVA 1MSGA 3HS0C 4ZKCB 5J1ZA 5A2QL 3HZXA 3NXWA 2SOBA 4CGYB 3TDQA 1F9PA 1ONLA 1W6JA 5CYUA 1G2SA 1EIGA 3NTKA 1NSNS 4XQJA 3VR2A 1HTLD 1AN8A 3FRPB 2A6HC 2K32A 1SE4A 5KNCA 1IKMA 2KOLA 3HEJA 4RCOA 2F0UA 2E76C 4K5WA 3VR6A 4F7XA 2VNUD 1MSHA 2E74C 1BR9A 3A8IE 1LTTD 3U9OA 5CV4A 5I2XA 4YIJA 5ELEA 4R8NA 1F9RA 1O7LA 2F0WA 1HQMC 4MIUA 1ENCA 1C8CA 1YNND 4TSSA 4EQNA 3TP6A 5CBEE 3LX0A 4CKEA 2E2IB 2NN6I 4CJ2C 4CBVA 5C0XI 5CBAE 1STAA 4DAYA 2B8FA 1DOLA 3D6CA 2JA7B 5COYA 1Y69U 1PZID 1SYCA 1WTVA 4KHVA 1XWEA 2CVRA 1EWHA 2EZVA 1ET6A 1DOKA 2BA1A 4F8MA 5IGGA 3PUVA 4A3DB 1IL8A 2NUCA 2B2TC 5JVH3 1II3A 1LO5D 1BCPC 4QIWB 1STHA 5EKLA 4K2KA 2PQEA 4P2CB 2K5QA 3RLFA 2NN6H 4XQQA 4K6DA 1LTBD 1S5ED 1VDZA 3SVMA 1WTPA 2RDHA 5EBCA 2EY2A 1BCPF 1FR3A 4IFDJ 3SK5A 1H9JA 5K36G 2XRQD 4RGTA 1RHPA 2R7ZB 1EZ6A 2RQXA 4JBWA 3CU7A 4HCSA 4H7BA 5EKIA 2KEEA 3FPPA 2OF1A 5IGEA 2KCCA 5I2YA 1STNA 1ML0D 2Q8IB 2DN8A 3TSSA 2A6ED 1EQTA 2F0LA 5C5LA 1ILQA 5M3FB 3N52A 3HRZC 2VUMB 3QB3A 4X3TA 1BO0A 2IL8A 1TQOA 1V1PA 3C3LA 2RDGA 2EVBA 1Z7TA 3TN2A 3BDCA 5JPMC 2LMCB 3PIO3 5T1GA 4FF3A 3S2HB 5HGTA 3D4DA 3EQLC 1PTOC 3K0YA 4FXGC 4HCEA 2L1BA 5JEAG 2A68C 3TP8A 2IJ0A 2KJXA 3NQIA 3TMEA 1A3TA 5CV5A 2K33A 3OHXC 2PMZB 1EU3A 3NBHA 3D4RA 4ODGA 4IUVA 5G3LD 1EY0A 2EYLA 3Q23A 2EY6A 1RTOA 5AFWA 2EOTA 1TS3A 1CHPD 5J22A 3M3YB 1BOSA 3U9SA 2JA5B 3S17B 1HXYD 3NTHA 2NVQB 4KJNA 2HCCA 4V190 2EYJA 3OWFA 2PW5A 4K8IA 1VF7A 2K6AA 3VR3A 3QIAA 3BS1A 5E1FA 2JA6B 2ICIA 2IX0A 2XWJB 4KD3A 1EZ8A 4HN7A 3PMFA 2XN9C 2K04A 2PZTA 4DXGA 2BE5D 4A3JB 2K5DA 2M9VA 4C2MB 2RSNA 2A69C 1JR0D 3SE0A 2F0KA 1NUCA 4JK1C 4XTCS 1PYWD 3ND8A 2SDFA 1QB5D 1LLRD 3S14B 1I6HB 2L9HA 4DA2A 3NBIA 4HAEA 2JSOA 3HG9A 4RGNA 5M3MB 2G9HD 4QF4A 1B3AA 1JC7A 2BA0A 2KQ3A 3E6ZX 1S5FD 1SNCA 2EJFC 1U9RA 2EJMA 5I6YA 2L55A 4J8QA 2YYZA 4C3JB 4OO1G 3J7AV 4LK1C 5ELDA 3W3AA 2FMMA 2ZXRA 1BNZA 2A5HA 2B2UA 4PNYA 1O78A 1F2ZA 2FJ2A 1D5XC 5KYLA 3G7LA 5EPLA 1JE4A 2BOSA 1BUVT 2F0HA 1UAPA 1SJED 4B08A 5I4DA 4BS9A 1FNWA 3SR1A 1I50B 2EY1A 1HUMA 2VXWA 3PIP3 1S4ZA 1X3QA 4C1NK 3ONAB 1SXTA 2AQ2B 1EY9A 4Q0FA 1H9KA 2FINB 3K59A 2Q8RE 1UUPA 4PMBA 2DY8A 3A56A 1BQQT 5FLXL 2OXPA 4KV6A 3J81L 4IFDH 2D2CC 4HSVA 2VB2X 1VMPA 3A55A 3BYTB 4FXDA 2KECA 4X3UA 4C3JG 1I4RA 3Q0AA 1BCPB 1H9RA 3S2DB 1R9TB 1QG7A 4HMIA 4QUFA 5C0XJ 1T5XD 4ME5A 3WOFA 1OXVA 2ZT9C 3LWUA 3RZDB 5D65A 3KF8A 2F3VA 3SK4A 3I4MB 1A3VA 5C4ZA 4A3KB 1HQRD 1TR5A 2D62A 1E0BA 2NZ1D 3R3OA 1V8QA 3D6WA 2EYHA 1AW7A 1OXUA 4QMGA 1GXDC 1SNDA 3J80L 1CTMA 1Q90A 1L0YB 1LT4D 2FHTA 1G8ZD 2ZXOA 1PFBA 3ERQA 1EY7A 1SYBA 4NDXA 2L0CA 1GOZA 1HFNA 3PUXA 2KEDA 5KEEA 4HMJA 3I8ZA 5JPNC 4DF7A 3HOYB 1LTSD 1Y1WB 5E3FA 2D9UA 2JA8B 5FOBB 2IT1A 2F03A 3IL8A 1JICA 3M4YA 3DUZA 3EFXD 1PTOD 2K5WA 4ZK9B 4J1MA 1DOMA 1SYDA 3DHQA 1WTXA 4DN4M 1WTRA 4LMQD 2KVMA 4C3IB 1GUNA 4R9WA 1EFID 2IX1A 5C4JB 4HEDA 1XTCD 5BN3A 2F1MA 3CQZB 2BCOA 1FNVA 5LL6X 5FO9B 2R61A 3GTMB 4M8AA 3V2TA 3K57A 3NQTA 3QOJA 4R8IA 2H4OA 4O42A 1STEA 1JQYD 3ZYYX 1WTWA 4LAAA 2RBMA 1CI3M 3FDTA 3C1EA 1Q8IA 2NWGA 3P20A 1LTAD 2F0DA 1D5ZC 2X6GA 2QILA 2L12A 1SYFA 2F0OA 2ID0A 3KLSX 3S1QB 2E75C 2F0FA 3FEWX 4IUNA 1ENAA 3PV0A 3PUWA 3BVZA 4H44C 3KLRA 4KD4A 3CRLC 3K5OA 1A6XA 1WCMB 4AYBB 4C3IG 2SNSA 2PZWA 3H09A 4IFDG 1JWMD 2LY7A 1SNOA 2EY5A 5FK9C 1MGSA 2PYKA 2A69D 1HA6A 2RDFA 4BA2I 3GV3A 3L7ZC 1SNPA 3SHLA 4EGVA 1LT3D 3S1RB 2TMPA 1CK1A 1STBA 4G4KA 2I07B 1F2LA 1F77A 2R3ZA 2X6LA 3DEPA 2AUKA 2F0PA 4WRDA 1Q1BA 2I46A 1H9SA 3Q22A 2AQ3B 1KTKA 1UEAB 3NE5B 1SYEA 2R92B 1G2TA 5BN4A 4A3BB 4DGZA 1K8MA 4XDXA 1C48A 3MHBA 3AU7A 5C3EB 2RVLA 1AZQA 1DYQA 2CQAA 2R93B 4E6IA 1STGA 2MP1A 1PLFA 4U673 2EE1A 3NHHA 3IFDA 4DK1A 4KY6A 4HTHA 2HDLA 1I4PA 4IALA 1TY2A 1VMCA 4OO1I 1DCZA 5C0XH 4G7ZC 1V1PB 3T56B 3GP7A 1Y8OB 5KNDA 3DWAA 3SK8A 1HCZA 1XXGA 1F9QA 2Z1CA 3L3OC 4CKBA 3H3VC 1S5BD 2RSOA 2L11A 2KCNA 5CV8A 2MUYA 3NTIA 1TT2A 3NWSA 1A15A 3FMCA 1HRJA 4ZQ3A 3EVQA 2WKDA 1WTOA 4L8JA 2XVSA 1SE3A 1G291 1GUSA 5IGCA 1D1IA 1LACA 2Y0SB 1IYUA 5M5XB 3V96A 1SYGA 1Q1EA 5EQ0A 4DFAA 2N88A 1LTRD 3K58A 1HPCA 1EYAA 1K8OA 2FFKB 1F2MA 4FO2A 1W6KA 4X3SA 4FYDA 3A8KE 4EVOA 4L6TB 1FYCA 4A3GB 2WIIB 3A54A 2RKSA 4FP5D 4CJ1B 1QOHA 3LWEA 3BG3A 2D5DA 1I4QA 3OWEB 2F0VA 4BY1B 4B9WA 1OXXK 1Z6HA 2TSSA 4F88A 2IWHA 3TZUA 1B2TA 4K8JA 2X69A 2XRSD 4OHJA 2WACA 1ILPA 2CHBD 3K5MA 5C44B 5EJWA 5CR3A 5JOBA 1GUOA 2F3WA 3J7AF 3BZDB 3VYUA 4HR7B 1PRTC 4G57A 3T4AC 1GHKA 1RCVD 1IW7C 1CQFA 1KDBA 5IOCA 1LT5D 3K6OA 3JAML 1ZYRC 2R6GA 4BA1I 1EEID 1Q3LA 4V0BA 3DEOA 1SBBB 3BDLA 1A2UA 3VA7A 1EQVA 2CW0C 1JWSD 4Q5VA 5FO7B 1OXTA 2XIWA 3HOUB 5D3DA 3BYYB 4OL7A 1QNUA 4OIJA 1O7YA 3HOWB 3IKJA 1DZ1A 4KTAA 4DNRB 2WP8J 1PRTF 5I9OA 2PNRC 2M2LA 2HUGA 4KKTA 2LFNA 1JOQA 5CV9A 3D8GA 1KLGD 5I9PA 1EWCA 1T5EA 1TWCB 1BF4A 2OT2A 4A3FB 2JEAI 5ELCA 2NN6G 3BDOA 2QF7A 4PMCA 2A6HD 5KYIA 3ITPA 4B9XA 5C0XG 4RHSA 5M5WB 2PW7A 4ZLTF 2AWNA 4XQNA 1J9OA 4BWGB 1DM0B 2PO4A 4KMUC 3MZ5A 4KN4C 4ULLA 2EDGA 2JEBI 1JOKA 1RKNA 2E2JB 5DAUA 3GTKB 2HCIA 2QCPX 4ZKBB 3J81E 1LTGD 2B2YA 3S16B 3X3NA 4KJOA 2AWOA 4NW2A 4L63B 4ZUIA 1B9NA 3S1MB 1LV9A 1OO9B 5FKAC 3E5SA 2WINB 1SE2A 4IUTA 2O4XA 1AFPA 4C1NI 3H94A 1YNJC 3RD4A 1ZXTA 3T16A 1BXTA 1M8AA 3K7AB 3VYTA 4U68A 4G7HC 1F2YA 5ISRA 4F87A 1KAAA 4IUUA 1DONA 1SFOB 2SNMA 4GZYC 1JWUD 4WJWA 3F2UA 1D5MC 3S1NB 2G9DA 2F0IA 2B2WA 3H91A 3OOCA 1BCPD 4O1NA 2KHSA 1TVXA 3OMCA 1KLUD 3MFGA 3QJYA 3NPPA 1LABA 3DM1A 4C56C 1A3UA 1I4HA 1TWHB 2Z4IA 4KK7A 2BDNA 3GQBA 1O80A 1LTID 1CT1D 2A6EC 4KHZA 4CKCA 4NP5A 4M1UB 1S5DD 4XYOA 3GTLB 1EOTA 5KRUA 1TKWB 2MGSA 4XIGS 3GTPB 3ND9A 2J0TD 2DNCA 1TS5A 1PZJD 2B2VA 2WAQB 4CJ0B 3KBXA 4K6LA 3EJIA 2B39A 5HURA 1RJTA 3FVQA 2PZUA 1SNMA 5JVG3 1HUNA 2DY7A 1STYA 4WFN3 1VCIA 4KY7A 2N55A 4KKUA 2ENBA 1CA6A 1FGBD 4A3EB 1B53A 2JXMB 1PFMA 3TP7A 4IN3A 3OSOA 2A68D 2EYFA 5ELFA 5A2QE 1H9MA 3GTQB 2KUMA 4IQZA 1KDCA 2K7VA 2OEOA 1I3QB 1JORA 4H13C 1UNSA 3N6RA 2WV6D 1TIID 2EPBA 1B1ZA 5C3WA 1WD0A 2JE6I 4RHRA 5J39A 4A3IB 2SEBD 3PO3B 1SMYC 1HFGA 1EYDA 5CC4A 5G3LF 2A73B 3A7LA 5T1IA 3QWNA 1KABA 3MC0B 4KKSA 2B2YC 3A7AB 5IT9L 2B2UC 4BBSB 5DM63 3P7JA 1CA5A 1SNQA 4CHTB 2NB0A 1PRTB 1WTQA 1ZYRD 3NWTA 1HHVA 1Q12A 1BBXC 4RGMA 1QE6A 2XWBB 1GUWA 3HP3A 1D6EC 3MTSA 2CW0D 2BE5C 3NSWA 3I72A 2F0MA 4XT1B 1H9SB 4J6HA 3T51B 1GUTA 3LNNA 2A74C 2IPKD 1SSOA 1RD9D 2J7ZA 3I91A 4ILWA 3S9WA 3I3CA 4RWSC 1TS2A 2F0GA 3EA6A 3KUPA 5JEAH 4IUPA 2B2WC 3G6JB 4QUCA 5D3IB 3DMUA 1Y8NB 3OW7A 3GV6A 1KDAA 1B50A 1A2TA 2L5TA 3C1FA 1GUGA 5C3XA 1EIHA 2ZXPA 1V43A 1EY4A 1U4MA 1PMRA 1JOOA 2PCFB 3L9AX 1ZKOA 4G7OC 5M5YB 4PV1C 3A8JE 4TRDA 5KIXA 5CV6A 3R2IA 3MXNA 3HOZB 4BY7B 1C4QA 2NYZD 1FNUA 5ELBA 2E2HB 3OPOA 4H0LC 1QCBD 2B2VC 5C5MA 1MI2A 4BBRB 1EU4A 3I4NB 3DWQA 3HKZB 1SDFA 4UDUC 3PO2B 2WKCA 1YNJD 4ZUJA 1JCKB 3VYRA 2IX3A 3KLSA 3IAYA 3GD7A 4ZAIA 4ZYSA 3MVVA 2XNAC 1QWYA 4C3HB 2FMCA 1BDOA 1EL0A 1R4PB 5C4XB 1XX8A 4IZ8A 3GTGB 3TZDA 1RF2D 5EKKA 3T13A 4DXFA 1EY8A 2VB3X 3D31A 5FO8B 5F2DA 3SEBA 3E0JA 4I65A 3URYA 3I4LA 1PDQA 1ET9A 3W2DA 1HTPA 4OO1H 2JP1A 3GTJB 2HDMA 4KI0A 2JYOA 1E2ZA 1CFMA 3K5NA 3RZOB 4ID6A 2LKVA 1I4XA 3FPUB 3S15B 5KNBA 3IFTA 5EPJA 2B63B 2F0NA 4WORA 1Y8PB 3P75A 1RODA 1IKLA 1I4GA 4I7ZC 5CGKA 4IUQA 3GO5A 4C3HG 3SXHA 1TY0A 2Z8LA 1CM9A 3MXUA 3M7GA 1B9MA 4N9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3O C;  3MA2 B;  1UEA B;  2I07 B;  1BR9 A;  2B39 A;  1JC7 A;  5FO7 B;  2XWB B;  4ILW A;  5JPM C;  1XWE A;  5JPN C;  2A73 B;  3V96 A;  5FO9 B;  4FXK C;  1GXD C;  1JB3 A;  3FRP B;  3HRZ C;  3OHX C;  3T4A C;  3CU7 A;  1D2B A;  3G6J B;  2E2D C;  2QKI C;  3CKI B;  2J0T D;  1BQQ T;  2ICE C;  5FOB B;  3I70 A;  4FXG C;  1OO9 B;  1BUV T;  2WII B;  2XWJ B;  3KLS A;  3HS0 C;  2TMP A;  1PXU A;  1UAP A;  2WIN B;  5FO8 B;  2A74 C; 
#chains in the Genus database with same CATH topology
 2F0S A;  1MKH A;  2EYP A;  5M3M H;  2VQF L;  3BVM A;  3JAM E;  5DM7 3;  5C4H A;  4RKL A;  4RH6 A;  4NPS A;  4RMF A;  5AJ3 L;  1KNA A;  3QO2 A;  3DLL A;  3NUC A;  4DV1 L;  4ZRZ A;  2YU9 H;  3M4O H;  4A4I A;  3W1G A;  4IJH A;  3CXC A;  1E2V A;  3VYS A;  4PQX A;  3DWP A;  1MJE A;  2V1C C;  5EAY A;  2EJG C;  3FKI H;  3KOJ A;  3O13 A;  4X66 L;  2O5J C;  5TSS A;  1WFQ A;  2KBN A;  3J7Y W;  2C5C A;  4DAV A;  2PPB C;  4OGQ C;  1XMQ Q;  3H0G B;  1X3F A;  1EFW A;  4JI5 Q;  1SEB D;  4A3C G;  4A3L H;  5M9O A;  5DEH A;  4AIM A;  2AUJ D;  1EYC A;  4B3M Q;  1HR0 W;  4FF2 A;  1RTN A;  2MJ8 A;  1J6Q A;  4QY7 A;  2B8G A;  4X62 L;  1PTO F;  1N34 Q;  2B63 G;  3E0E A;  4DR1 L;  1UE6 A;  1M4V A;  2NVX B;  1B3Q A;  4DR4 Q;  1N32 Q;  4YCW A;  3BVG A;  4X3K A;  2NVT B;  3VA5 A;  2PQA A;  1O7Z A;  3TRE A;  4QCL A;  1IBK L;  3RUZ A;  1RDP D;  2K05 A;  5IYC G;  1JMC A;  5LHY 1;  1SMY D;  1NAP A;  3NP8 A;  4A3M B;  2OTL A;  2UU9 Q;  4RGO S;  1PH5 A;  4DV4 L;  2ICE C;  1MD2 D;  2B29 A;  2Q2I A;  2Z6K A;  4MTK A;  1EY6 A;  2K03 A;  4LF4 L;  2H1E A;  1K8G A;  1G91 A;  4JI2 Q;  2BH8 A;  3MA2 B;  2VY3 A;  4LF7 L;  1E2W A;  4KLK A;  1DD2 A;  1TS4 A;  1ENF A;  2JA9 A;  1PH8 A;  3RLN A;  3KBG A;  3MEH A;  4CDF C;  1IHZ A;  3QOL A;  5EBD A;  1CZG A;  1PA6 A;  3UI2 A;  2F0E A;  3WOE A;  2E2D C;  1ESF A;  4LF5 Q;  2MPM A;  3MFY A;  4TQU S;  1N33 Q;  4YWK A;  2F4I A;  3H0G G;  4QB4 A;  5CV7 A;  1JB7 A;  1TWF H;  3U58 A;  1XYI A;  1HZB A;  4NMZ A;  1G6Z A;  3P1H A;  1EIF A;  4GLV B;  1WD1 A;  1YHB A;  1R4Q B;  1YNN C;  2QDB A;  1ESR A;  3ICE A;  2M00 A;  3RZD H;  1XMQ L;  4JI5 L;  4DNT B;  1JB3 A;  4YHH Q;  3CRK C;  3SDZ A;  3AMU A;  4GNX C;  3F8T A;  3JAM c;  1NCV A;  3HOV B;  5EPK A;  4XXE A;  4X65 L;  3JAM i;  5JEA J;  3OMG A;  2DNE A;  4IPD A;  1B4O A;  4N8X 1;  2LSS A;  3M85 A;  1U4R A;  1SAP A;  4DR4 L;  5A35 A;  4YCV A;  1Y1V H;  5FLX E;  5BN5 A;  1NR4 A;  2RA4 A;  4Y7N B;  2F52 A;  1TWA H;  2YU9 B;  4FXK C;  2EXZ A;  4IOA A;  1EWI A;  1JE5 A;  1HJP A;  3I56 A;  3T53 B;  4K5X A;  1VQ4 A;  1W2B A;  1YBY A;  4KN7 C;  5EGT A;  5IGF A;  4FF1 A;  4FF4 A;  2UXC Q;  1EYG A;  2UU9 L;  5IYD H;  3W1B A;  2H5X A;  1U4P A;  3NK9 A;  4IFD I;  4LF6 Q;  2NVY H;  1EQQ A;  5E4W C;  1PXU A;  1CQV A;  3FKI B;  4DK0 A;  4JI2 L;  4LJZ C;  3R93 A;  4JW0 A;  1K83 B;  4IUR A;  2NTS A;  1AP0 A;  3C46 A;  1NR2 A;  3EBE A;  3KYH C;  5E4X A;  1VQF A;  2CWP A;  1X3P A;  1LT6 D;  1TU2 B;  3RLO A;  1D1K A;  2K01 A;  3KK7 A;  3M7N A;  3CKI B;  1Y1W H;  4LF5 L;  3TP5 A;  2JA8 H;  3IRB A;  1OTC A;  1IXR A;  3H6M A;  4L5R C;  2XSC A;  2EYO A;  4PMW A;  1N33 L;  3D4W A;  2BDO A;  4HSP A;  3MAQ A;  2ZJR A;  1U4L A;  1B44 D;  2O2L D;  1QIL A;  3I90 A;  3AB9 A;  3PUY A;  1GJX A;  5IGD A;  1L0X B;  3HOV G;  4JBJ A;  2HQE A;  3I7F A;  4GN4 B;  1PTO H;  4A93 B;  1XJV A;  1PFN A;  1CHQ D;  3MWY W;  4DR6 Q;  3SK6 A;  3M4O B;  1FD7 D;  5COR A;  4YHH L;  2V4D A;  1V1O A;  4C3I H;  2C9O A;  3I70 A;  1S5C D;  4EQO A;  2RHS B;  3V05 A;  4GOP A;  3NEL A;  4TKO B;  1DJR D;  4JBM A;  1VQJ A;  3J80 E;  5C4J H;  4K14 A;  1O7I A;  2NTT A;  3R2T A;  3X3M A;  3GTO B;  2EYM A;  4XYQ A;  3R8B A;  1SJH D;  1WVL A;  4BXX G;  1CUK A;  3FKI G;  5DNF A;  1HNW L;  4OIK A;  5IP7 G;  2Z4H A;  3GTM H;  3DXJ C;  4UAI A;  2MHV A;  5KGU A;  2QEX A;  3HGB A;  4N9P A;  1VQP A;  2UXC L;  1M1K C;  3OIP A;  1OXS C;  4LF6 L;  3UE1 A;  4Z9C B;  5IIF A;  3C2P A;  1FJG Q;  5K5P A;  1TWF B;  2UXD L;  2MQH A;  4RKB A;  5H1S E;  4DK6 C;  1VF5 C;  4ABN A;  2CCZ A;  2LXK A;  3CC7 A;  1GHJ A;  2WB1 E;  1F9S A;  4P74 A;  2L4N A;  1LM0 A;  2LS0 1;  4JVZ A;  4OXP A;  2KA7 A;  1QNK A;  5LL6 S;  3I4O A;  2KCM A;  5NUC A;  3S1Q H;  4KY5 A;  4DV6 Q;  1YHQ A;  4LW1 A;  1ICF B;  1ZEQ X;  3CHB D;  1MBY A;  4A76 A;  3TBI B;  4A93 G;  2FXQ A;  2Z6K C;  1Z9F A;  1Y1V B;  3J81 i;  1WCM H;  4YY3 Q;  3F1Z A;  5D14 A;  1TWA B;  2B2T A;  2QEJ C;  4K5V A;  2F0Q A;  4DR6 L;  1VQG A;  5JJI A;  2NVY B;  5CMD A;  3QG1 A;  3ZJY C;  4MN3 A;  4S3S A;  3HOX B;  2K5H A;  4O0A A;  3S1R H;  1CZW A;  3WDN A;  3PUZ A;  3U4Z A;  2F0J A;  4RAU C;  1AZP A;  2OQK A;  1AEX A;  2YTX A;  1WYD A;  3ERO A;  5IOD A;  5JJZ A;  1LYL A;  5IT9 E;  4RA8 A;  5I6W A;  1G51 A;  3MXP A;  1PH2 A;  2UUA Q;  3G48 A;  2GVB A;  4JC0 A;  2Z0S A;  3UDX A;  1EEF D;  4FVM A;  1ICW A;  4DUY Q;  4DAP A;  1QJO A;  1V1Q A;  2ES2 A;  2J4X A;  3Q24 A;  4K0K Q;  1X32 A;  5IGB A;  1Z47 A;  3VR4 A;  2JA7 H;  1DXM A;  3D3R A;  1I6V C;  3VR5 A;  1KNE A;  2K28 A;  5K36 H;  3I73 A;  4NKL A;  1PZK D;  2IY5 B;  4RCN A;  4DU9 A;  2R92 H;  1PTO B;  1TWG B;  4EQP A;  4A3B H;  2AQ1 B;  2GA4 B;  4FDB A;  4FNF A;  4X64 L;  1YJ9 A;  3Q6S A;  2ATW A;  2WB1 B;  4XT3 B;  1D2B A;  2F0T A;  3L0O A;  1Y1V G;  2E5L Q;  2NBF A;  1NE3 A;  2R93 H;  4K2L A;  1G6P A;  3J80 i;  2IW3 A;  1PRT D;  5C6A A;  3MXG A;  2Q8T A;  1L2F A;  1IW7 D;  1EY5 A;  1K0S A;  2LXJ A;  1YIJ A;  3CPF A;  2K1B A;  2O5I C;  1QUQ A;  3HOX G;  4MHE A;  3OIQ A;  4RFB A;  2QKI C;  1HA5 A;  5JAV A;  3K5L A;  2DUD A;  3RMH A;  1J8I A;  1IYV A;  1MSG A;  2N49 A;  3HS0 C;  4ZKC B;  5J1Z A;  5A2Q L;  3HZX A;  3NXW A;  2SOB A;  3GDE A;  4CGY B;  2ZM6 Q;  3TDQ A;  3MXN B;  1F9P A;  1ONL A;  1W6J A;  5CYU A;  1G2S A;  1EIG A;  3NTK A;  1NSN S;  4XQJ A;  3VR2 A;  1HTL D;  1BBU A;  1X56 A;  4IO9 A;  1AN8 A;  3FRP B;  4DUY L;  2A6H C;  2JK8 A;  2K32 A;  1SE4 A;  4K0K L;  4QIW E;  4POF A;  5KNC A;  1IKM A;  3Q8D A;  2KOL A;  3HEJ A;  4RCO A;  2F0U A;  2E76 C;  4K5W A;  1I94 Q;  3VR6 A;  4F7X A;  1XPO A;  1FGU A;  1MSH A;  2PI2 E;  2I0Q A;  2VNU D;  3ULL A;  2WB1 G;  2E74 C;  1BR9 A;  1K3B C;  3A8I E;  2RF4 A;  1LTT D;  3U9O A;  5CV4 A;  5I2X A;  4OWX B;  4YIJ A;  4B3T L;  5ELE A;  3PCO B;  4R8N A;  1O7L A;  1F9R A;  2F0W A;  5M3F H;  1HQM C;  4MIU A;  1ENC A;  5IT9 c;  2E5L L;  3CP0 A;  1C8C A;  1YNN D;  4TSS A;  4EQN A;  2RHQ B;  3TP6 A;  1WTH A;  5CBE E;  3LX0 A;  4DPG A;  2ASB A;  3G4S A;  5IYB H;  1KL9 A;  4CKE A;  1PH4 A;  2E2I B;  2NN6 I;  4CJ2 C;  1CKN B;  4CBV A;  4UP7 A;  5C0X I;  5CBA E;  1STA A;  4DAY A;  1NMF A;  2B8F A;  1DOL A;  3D6C A;  2JA7 B;  1EQR A;  5COY A;  1Y69 U;  1PZI D;  2ZM6 L;  1SYC A;  4LF8 Q;  1WTV A;  2HHH Q;  4KHV A;  1XWE A;  2CVR A;  1EWH A;  4YWL A;  2EZV A;  1ET6 A;  4BY1 H;  1DOK A;  2BA1 A;  3CCE A;  4F8M A;  5IGG A;  3PUV A;  4A3D B;  1QVG A;  1IL8 A;  5IY0 A;  2NUC A;  2B2T C;  4ALP A;  1KRT A;  5JVH 3;  4PZ8 A;  1PYS B;  1II3 A;  4J15 A;  1I94 L;  1LO5 D;  1WOC A;  1BCP C;  4QIW B;  3FP9 A;  1VQN A;  1STH A;  5EKL A;  4K2K A;  2PQE A;  4P2C B;  5C44 H;  2K5Q A;  3RLF A;  1HR0 Q;  2K50 A;  1P16 A;  5LMN W;  2NN6 H;  1L1O B;  4JCV E;  4IPH A;  2JA5 H;  1VQK A;  3W5O A;  3S17 H;  1NJI C;  3PGZ A;  1N36 Q;  1HZC A;  2NVQ H;  4XQQ A;  4EQ5 A;  1LTB D;  1S5E D;  4K6D A;  3KJP A;  1HH2 P;  1VDZ A;  3SVM A;  4JI7 L;  3E9H A;  1WTP A;  2RDH A;  1VQH A;  5EBC A;  2EY2 A;  1BCP F;  1FR3 A;  2JA7 G;  4IFD J;  1U5K A;  3SK5 A;  1H9J A;  4GKJ Q;  5K36 G;  2XRQ D;  4DV5 Q;  4RGT A;  1RHP A;  2R7Z B;  1HNX Q;  1EZ6 A;  1K28 A;  2RQX A;  4JBW A;  3D0F A;  3HOW H;  3CU7 A;  4HCS A;  4H7B A;  5EKI A;  2KEE A;  3FPP A;  2JA6 H;  5GAD C;  3OTO Q;  2OF1 A;  2XGT A;  4LF9 L;  5IGE A;  2KCC A;  5I2Y A;  1XPU A;  1STN A;  1K3R A;  1B8A A;  1ML0 D;  2Q8I B;  4LF8 L;  4A3D G;  2DN8 A;  3TSS A;  2HHH L;  4A3J H;  1TWC H;  2A6E D;  1EQT A;  1EOV A;  2F0L A;  4C2M H;  3BZC A;  5C5L A;  1ILQ A;  5M3F B;  3N52 A;  3HRZ C;  1YJW A;  2VUM B;  3QB3 A;  4X3T A;  1BO0 A;  2IL8 A;  2UUC L;  4A3F H;  5IWA L;  4JI8 Q;  4DV4 Q;  1I6H H;  1TQO A;  1V1P A;  3C3L A;  2RDG A;  2EVB A;  1Z7T A;  4LF7 Q;  3TN2 A;  2AHO B;  2PQA B;  1HR0 L;  3BDC A;  4LFB Q;  5JPM C;  2LMC B;  2YV5 A;  3PIO 3;  3STB C;  4MZ9 A;  5T1G A;  4FF3 A;  3S2H B;  5HGT A;  2RCN A;  3D4D A;  1N36 L;  3EQL C;  1PTO C;  3K0Y A;  4FXG C;  3UDI A;  1XNQ Q;  3NEM A;  1E22 A;  4HCE A;  2L1B A;  5JEA G;  2A68 C;  1PH6 A;  2R7Z G;  3TP8 A;  4C3J H;  2IJ0 A;  2KJX A;  2E8G A;  3NQI A;  3TME A;  1UE5 A;  4LUZ A;  3M4Q A;  3SGI A;  1S3O A;  1A3T A;  5CV5 A;  4GKJ L;  4HJ7 A;  2K33 A;  4DV5 L;  3OHX C;  1HNX L;  1VQA A;  1EU3 A;  2PMZ B;  3NBH A;  3D4R A;  4ODG A;  4IUV A;  5G3L D;  1EY0 A;  1BBW A;  2EYL A;  3OTO L;  3Q23 A;  2Z6B A;  2EY6 A;  1RTO A;  1XPR A;  4X65 Q;  5AFW A;  2EOT A;  1TS3 A;  5M3F G;  1CHP D;  2VUM G;  2QW7 A;  5J22 A;  3M3Y B;  4GKK Q;  1I50 H;  3I55 A;  2OTJ A;  1BOS A;  1E7Z A;  1S40 A;  2YTV A;  3U9S A;  1SN8 A;  2JA5 B;  3J7A 5;  3S17 B;  1HXY D;  2K5N A;  2HD3 A;  5IYB G;  1AH9 A;  3NTH A;  2ALY B;  3F2B A;  2NVQ B;  3TS2 A;  4KJN A;  3K7A H;  2Q2U A;  2HCC A;  4V19 0;  4JI8 L;  3H3V I;  1S72 A;  2EYJ A;  2D0O A;  3OWF A;  2DGY A;  2PW5 A;  1PFS A;  4K8I A;  1VF7 A;  1PV4 A;  1SFO H;  1ASY A;  2I5H A;  2K6A A;  2K4K A;  4LFB L;  3VR3 A;  3QIA A;  3S1N H;  2KCT A;  3BS1 A;  4PG3 A;  5E1F A;  4R4O A;  2JA6 B;  2ICI A;  3S2D H;  2IX0 A;  1R9T H;  2XWJ B;  4KD3 A;  1EZ8 A;  4HN7 A;  3PMF A;  4UPA A;  1XNQ L;  2XN9 C;  3G6E A;  2K04 A;  2PZT A;  3FHW A;  4DXG A;  2BE5 D;  4A3J B;  1EUJ A;  2K5D A;  2KHI A;  2M9V A;  1QVF A;  4C2M B;  2RSN A;  2A69 C;  2DJG C;  1JR0 D;  3SE0 A;  4DR3 L;  2F0K A;  1NUC A;  2N8N A;  4JK1 C;  4XTC S;  1PYW D;  3ND8 A;  2SDF A;  4LNQ A;  1QB5 D;  1LLR D;  3S14 B;  1I6H B;  2L9H A;  3I4M H;  4DA2 A;  3H3V H;  3NBI A;  4A3K H;  4HAE A;  2JSO A;  3AEV A;  4GLA C;  4P71 A;  3CCQ A;  4L5T A;  2JA5 G;  3HG9 A;  4RGN A;  5M3M B;  3ER0 A;  1VQD A;  1XTD A;  2G9H D;  2Z9H A;  4QF4 A;  1B3A A;  2MO1 A;  4GKK L;  1JC7 A;  2BA0 A;  4A3M G;  3GTL H;  2KQ3 A;  1T9H A;  1X6O A;  3E6Z X;  1S5F D;  1BKB A;  1SNC A;  4PZ6 A;  2EJF C;  1U9R A;  2EJM A;  4OEL B;  1HNW Q;  5I6Y A;  2L55 A;  4QQB X;  1E24 A;  3GTP H;  4GOP B;  3OYY A;  4J8Q A;  4ZCK A;  1VQE A;  2YYZ A;  4C3J B;  1YI2 A;  4OO1 G;  2UXD Q;  3J7A V;  4LK1 C;  2JA6 G;  5ELD A;  1VQ9 A;  3W3A A;  2FMM A;  2ZXR A;  1BNZ A;  2RCF A;  2A5H A;  2B2U A;  4PNY A;  4IPG A;  1GD7 A;  1UE7 A;  3HOY H;  1O78 A;  1F2Z A;  2FJ2 A;  1D5X C;  5KYL A;  3G7L A;  4A3J G;  1GO3 E;  1Q8K A;  5EPL A;  1JE4 A;  2BOS A;  3HFZ B;  1BUV T;  2F0H A;  4QJF A;  3CAM A;  1L1O C;  1UAP A;  1BVS A;  3CMA A;  1SJE D;  4B08 A;  5I4D A;  4BS9 A;  1FNW A;  3SR1 A;  1I50 B;  4WJ4 A;  2EY1 A;  1HUM A;  2VXW A;  3PIP 3;  1IBL L;  1S4Z A;  1X3Q A;  3QR8 A;  4C1N K;  4CDE C;  5FLM H;  3ONA B;  1SXT A;  2AQ2 B;  3BU2 A;  2PNH A;  1EY9 A;  4Q0F A;  1H9K A;  2FIN B;  3K59 A;  2Q8R E;  1UUP A;  4PMB A;  5M3M G;  3GTQ H;  2MFI A;  2DY8 A;  3CCS A;  3A56 A;  4HJ8 A;  1BQQ T;  5FLX L;  4B3R L;  2OXP A;  4KV6 A;  1I3Q H;  3J81 L;  4IFD H;  2GVA A;  2D2C C;  4HSV A;  2VB2 X;  1VMP A;  1B70 B;  2K5V A;  4OX9 Q;  5L37 A;  3A55 A;  3BYT B;  3AFQ A;  4FXD A;  3AYH B;  2KEC A;  5FJ8 H;  4A3I H;  1MHW C;  4X3U A;  4GN5 A;  4C3J G;  1I4R A;  3CQZ H;  3NEN A;  3Q0A A;  3DM3 A;  1BCP B;  1H9R A;  3S2D B;  1R9T B;  3RR5 A;  5IP9 H;  1QG7 A;  4HMI A;  4QUF A;  2C35 B;  3BZK A;  1KQS A;  2ZTE A;  5C0X J;  1UWV A;  1VQI A;  3E9I A;  4A3L G;  1T5X D;  4ME5 A;  1Q81 C;  4KHP Q;  3WOF A;  1OXV A;  2ZT9 C;  4POG A;  1RIP A;  3LWU A;  3U50 C;  3RZD B;  5D65 A;  3KF8 A;  2F3V A;  4HJA A;  4IJL A;  3SK4 A;  2A19 A;  5JJK A;  4X64 Q;  3I4M B;  3H15 A;  1A3V A;  5C4Z A;  1WJJ A;  4A3K B;  1HQR D;  1TR5 A;  2D62 A;  2ZJQ A;  1E0B A;  4DV7 Q;  2EXD A;  2NZ1 D;  3R3O A;  2VS1 A;  1V8Q A;  3D6W A;  2B3G A;  4YWM A;  1SRO A;  2EYH A;  1AW7 A;  1OXU A;  4QMG A;  2ZTD A;  1GXD C;  3KLW A;  1SND A;  3J80 L;  1CTM A;  1Q90 A;  1L0Y B;  1VQ6 A;  1LT4 D;  2FHT A;  1G8Z D;  2ZXO A;  1PFB A;  3ERQ A;  3M4P A;  1EY7 A;  1SYB A;  4L5Q A;  4NDX A;  2L0C A;  1GOZ A;  1HFN A;  3PUX A;  2KED A;  5KEE A;  4OX9 L;  4HMJ A;  2JJQ A;  1QUQ B;  1HZ9 A;  3I8Z A;  3HKS A;  5JPN C;  4DF7 A;  3HOY B;  3T1H L;  3A0J A;  4Y52 H;  4OON A;  3KF6 A;  2OWO A;  1LTS D;  2IHE A;  1Y1W B;  5E3F A;  2D9U A;  2K52 A;  3KDF B;  4R1J A;  2JA8 B;  5FOB B;  4P75 A;  3STB D;  4DUZ Q;  2IT1 A;  2F03 A;  3IL8 A;  1CSQ A;  1JIC A;  3M4Y A;  3DUZ A;  4AYB E;  3EFX D;  3E3X A;  3I4M G;  1PTO D;  5M5Y H;  4KHP L;  2K5W A;  4ZK9 B;  4J1M A;  3CCM A;  4A3K G;  1DOM A;  1SYD A;  2OQ0 A;  2EIF A;  3DHQ A;  1TXY A;  1WTX A;  4B3T Q;  4DN4 M;  3HOZ H;  1WTR A;  4LMQ D;  4JI6 Q;  2KVM A;  4C3I B;  1GUN A;  5C3E H;  4R9W A;  4UY8 C;  1EFI D;  2IX1 A;  4DV7 L;  1KIX A;  3I2Z A;  5C4J B;  1Y14 B;  5IYD G;  4HED A;  1XTC D;  5BN3 A;  2ZTC A;  4L5S A;  1D8L A;  1JJC B;  2F1M A;  3CQZ B;  2BCO A;  1EIY B;  1FNV A;  5LL6 X;  5FO9 B;  2R61 A;  3GTM B;  1NY4 A;  4M8A A;  3V2T A;  3K57 A;  3NQT A;  3QOJ A;  4R8I A;  1FL0 A;  2H4O A;  4O42 A;  1STE A;  1YHA A;  1JQY D;  3ZYY X;  1WTW A;  3KDF A;  4LAA A;  2RBM A;  1CI3 M;  3FDT A;  3HOY G;  3C1E A;  1Q8I A;  2NWG A;  1DGS A;  1W3S A;  5GRO A;  3P20 A;  1LTA D;  2F0D A;  1Y1W G;  1D5Z C;  2JA8 G;  2X6G A;  4OWT B;  2QIL A;  2F3I A;  2L12 A;  4C3H H;  1SYF A;  2F0O A;  2ID0 A;  3KLS X;  3CCL A;  4DAY B;  1SLJ A;  4GLX A;  1M90 C;  3CC2 A;  5C4X H;  3S1Q B;  1Q82 C;  1NTG A;  3GTG H;  2E75 C;  2F0F A;  3FEW X;  4IUN A;  1ENA A;  3PV0 A;  1IBM Q;  3PUW A;  3BVZ A;  5LMU Q;  4H44 C;  2AKW B;  4DUZ L;  4QL5 A;  4R4I A;  3KLR A;  4KD4 A;  3CRL C;  3K5O A;  1A6X A;  1WCM B;  1PH1 A;  4AYB B;  4GOP C;  4C3I G;  2SNS A;  2PZW A;  3H09 A;  4IFD G;  1JWM D;  2LY7 A;  1SNO A;  2EY5 A;  1PH7 A;  5FK9 C;  1MGS A;  2NZO A;  4MNO A;  1IL2 A;  2PYK A;  4O2D A;  2CH4 A;  2A69 D;  5M5X H;  1XNR Q;  2RDF A;  4JI6 L;  1HA6 A;  4BA2 I;  3GV3 A;  3L7Z C;  1SNP A;  3SHL A;  4EGV A;  1LT3 D;  3S1R B;  2TMP A;  4HIK A;  1YVC A;  2VQE Q;  4JI7 Q;  1CK1 A;  1STB A;  1V9P A;  4G4K A;  2I07 B;  1F2L A;  1F77 A;  2R3Z A;  2X6L A;  4MTN A;  3DEP A;  4JOI A;  1N8R C;  3S15 H;  2AUK A;  2B63 H;  5ELO A;  2F0P A;  3M9B A;  2CWA A;  4A3G H;  4WRD A;  1CKO A;  1Q1B A;  4LF9 Q;  3PF5 A;  5LMN L;  4JI3 Q;  2I46 A;  1H9S A;  3Q22 A;  2KHJ A;  4QGU A;  2AQ3 B;  2Y0S E;  1KTK A;  1UEA B;  3NE5 B;  1SYE A;  2R92 B;  1G2T A;  5BN4 A;  5GQO A;  4A3B B;  4DGZ A;  1K8M A;  4XDX A;  4AH6 A;  1C48 A;  3MHB A;  3AU7 A;  3PF4 A;  5C3E B;  3UDG A;  3RN5 A;  1D7Q A;  1P8L A;  1WCM G;  2UUC Q;  2RVL A;  1AZQ A;  1DYQ A;  2CQA A;  2R93 B;  4AYB G;  4E6I A;  1E1T A;  2A1A A;  4UP8 A;  4DAM A;  1STG A;  2MP1 A;  5IWA Q;  1IBM L;  5LMU L;  1XMO Q;  1PLF A;  4U67 3;  2EE1 A;  3NHH A;  3CCR A;  1JJ2 A;  3IFD A;  3CC4 A;  4DK1 A;  4KY6 A;  4HTH A;  2Q2H A;  2HDL A;  1I4P A;  3ULJ A;  4NXN L;  4IAL A;  1TY2 A;  4I7A A;  5E7N A;  1VMC A;  1MJC A;  4OO1 I;  1DCZ A;  5JJL A;  1YNX A;  5C0X H;  1XNR L;  4G7Z C;  3RN2 A;  1V1P B;  3T56 B;  3GP7 A;  4DV0 L;  1PHJ A;  1Y8O B;  5HGQ A;  4OEM B;  5KND A;  3DWA A;  4CDD C;  4HIM A;  3SK8 A;  4JV5 Q;  2VQE L;  1HCZ A;  1XXG A;  1F9Q A;  2Z1C A;  3L3O C;  4CKB A;  4JI4 L;  3H3V C;  1S5B D;  2I5L X;  2XTI A;  2RSO A;  2NVX H;  2L11 A;  2YTY A;  2KCN A;  2PMZ E;  4GNX A;  5CV8 A;  2MUY A;  4DR5 L;  3HOU H;  3NTI A;  1TT2 A;  3AFP A;  3NWS A;  1A15 A;  4JYA Q;  3CCV A;  4B3S L;  3FMC A;  4DK3 C;  2R92 G;  1I5F A;  4A3B G;  1HRJ A;  4ZQ3 A;  3EVQ A;  2WKD A;  1QZH A;  4JI3 L;  1WTO A;  4L8J A;  1VQ5 A;  2XVS A;  2QA4 A;  1SE3 A;  5C3E G;  1G29 1;  4R4Q A;  1GUS A;  5IGC A;  1D1I A;  2R93 G;  1LAC A;  4YCU A;  4UHV A;  2Y0S B;  4LUV A;  1LTL A;  4HID A;  3NBH B;  3RNU A;  1IYU A;  5M5X B;  1SYG A;  3V96 A;  1Q1E A;  5EQ0 A;  4JI1 L;  2KEN A;  4DFA A;  4DNI A;  1XMO L;  3F2D A;  2N88 A;  4N8F A;  1LTR D;  3K58 A;  1HPC A;  1EYA A;  1A8V A;  1K8O A;  1C0A A;  2FFK B;  1F2M A;  5M5W H;  4FO2 A;  1W6K A;  3F2C A;  4X3S A;  2QDL A;  4FYD A;  3A8K E;  2R7F A;  4EVO A;  4L6T B;  1FYC A;  4A3G B;  1H95 A;  3HOV H;  2WII B;  3A54 A;  2MO0 A;  2RKS A;  1HZA A;  4FP5 D;  4CJ1 B;  1QOH A;  4JV5 L;  3LWE A;  3BG3 A;  4JG2 A;  2D5D A;  3MEF A;  1I4Q A;  5GAG C;  3OWE B;  1VQM A;  1N9W A;  2F0V A;  4DR3 Q;  2E2J H;  4BY1 B;  4B9W A;  1OXX K;  1KAW A;  1Z6H A;  2TSS A;  3GTK H;  4H02 A;  4Y7N H;  4F88 A;  2IWH A;  3S16 H;  4JYA L;  3TZU A;  1B2T A;  4DKA C;  4K8J A;  2X69 A;  2XRS D;  3PQI A;  4OHJ A;  2WAC A;  2Y0S G;  1C7Y A;  1GVP A;  3S1M H;  1ILP A;  2CHB D;  1K73 C;  4BXX H;  4LFA Q;  3K5M A;  5C44 B;  1JT8 A;  5EJW A;  5IP7 H;  5CR3 A;  5JOB A;  1GUO A;  1K83 H;  2F3W A;  3J7A F;  5IE8 A;  3BZD B;  1X65 A;  3VYU A;  4JI0 Q;  4HR7 B;  1PRT C;  4G57 A;  5DLQ E;  3T4A C;  1GHK A;  1RCV D;  1IW7 C;  4JOI C;  1CQF A;  1KDB A;  1LT5 D;  5IOC A;  3K6O A;  3JAM L;  1ZYR C;  3A5U A;  2R6G A;  2UXB Q;  4BA1 I;  1EEI D;  1Q3L A;  5BR8 L;  4V0B A;  3DEO A;  1SBB B;  3BDL A;  2UUB Q;  1A2U A;  1SRU A;  3VA7 A;  4UP9 A;  4LWC A;  4A3G G;  1EQV A;  1Q7Y C;  2CW0 C;  1JWS D;  4Q5V A;  5FO7 B;  1OXT A;  2XIW A;  3HOU B;  5D3D A;  3BYY B;  4OL7 A;  1QNU A;  4OIJ A;  1O7Y A;  3HOW B;  3IKJ A;  1DZ1 A;  4KTA A;  4A93 H;  4DNR B;  2WP8 J;  4LUO A;  1PRT F;  1X55 A;  2NZH A;  2PNR C;  5I9O A;  2VW9 A;  2M2L A;  2HUG A;  4KKT A;  2LFN A;  1JOQ A;  4BY1 G;  1A0I A;  5CV9 A;  2VZA A;  3D8G A;  4IOC A;  1MIU A;  4R4C A;  3CCU A;  1KLG D;  5I9P A;  1EWC A;  1T5E A;  1TWC B;  2L15 A;  1IBL Q;  1BF4 A;  3PIO A;  2OT2 A;  4APV A;  3GTO H;  2IHF A;  5GAE C;  5C44 G;  4A3F B;  5J3B A;  1PYB A;  1TWH H;  2JEA I;  5ELC A;  2NN6 G;  3TQY A;  4B3R Q;  3BDO A;  2QF7 A;  4PMC A;  1CSP A;  3PSI A;  2A6H D;  5KYI A;  3ITP A;  4B9X A;  5C0X G;  4RHS A;  4LFA L;  1K8A C;  5M5W B;  2PW7 A;  3G71 A;  4ZLT F;  1NBW A;  2AWN A;  4XQN A;  4JI0 L;  1J9O A;  4BWG B;  4B3M L;  1DM0 B;  2PO4 A;  4KMU C;  1U0L A;  3MZ5 A;  2UXB L;  4KN4 C;  4ULL A;  2EQS A;  1N34 L;  3HOU G;  2EDG A;  1FVI A;  2JEB I;  3B6Y A;  4DR2 Q;  4PZ7 A;  3HOW G;  2UUB L;  1L0W A;  1JOK A;  1N32 L;  1RKN A;  2E2J B;  5DAU A;  2N78 A;  3GTK B;  2HCI A;  2QCP X;  4ZKB B;  3J81 E;  1LTG D;  2B2Y A;  3S16 B;  1WI5 A;  3X3N A;  1IZ6 A;  4KJO A;  2AWO A;  4NW2 A;  4L63 B;  4ZUI A;  1KRS A;  1B9N A;  3S1M B;  1LV9 A;  4A75 A;  1OO9 B;  5FKA C;  4OWW B;  3E5S A;  2WIN B;  3HOX H;  3KJO A;  1SE2 A;  4IUT A;  2JQO A;  2O4X A;  4A3F G;  1IYJ B;  3EIV A;  4A3E H;  1AFP A;  1E3P A;  4C1N I;  3KF8 B;  2D0P A;  3H94 A;  1YNJ C;  2K75 A;  3RD4 A;  1ZXT A;  3T16 A;  1BXT A;  1M8A A;  3K7A B;  2WAQ E;  3VYT A;  4U68 A;  4G7H C;  1F2Y A;  5ISR A;  4F87 A;  1KAA A;  4IUU A;  1DON A;  1SFO B;  4AQY Q;  2SNM A;  3UE0 A;  2G5D A;  1JWU D;  4WJW A;  3F2U A;  4GZY C;  1D5M C;  3S1N B;  2G9D A;  2F0I A;  2DJF C;  1X3E A;  2B2W A;  3H91 A;  3OOC A;  1BCP D;  3T1H Q;  1TWG H;  3PO3 H;  4O1N A;  2KHS A;  1TVX A;  4JBK A;  3OMC A;  2F4V Q;  3JC6 6;  4IPC A;  1KLU D;  3MFG A;  3QJY A;  4BBS H;  3NPP A;  4DR2 L;  1SE8 A;  1LAB A;  4EX5 A;  1AE3 A;  4HIO A;  3DM1 A;  3KF6 B;  4C56 C;  1A3U A;  1I4H A;  1TWH B;  2Z4I A;  4KK7 A;  2BDN A;  3GQB A;  1O80 A;  1Q86 C;  1LTI D;  1YZ6 A;  1CT1 D;  4X6A H;  2A6E C;  4KHZ A;  1J5E Q;  1A62 A;  4CKC A;  4NP5 A;  1X54 A;  4M1U B;  1S5D D;  4XYO A;  1YEZ A;  3GTL B;  1EOT A;  5KRU A;  3UDF A;  1TKW B;  4P72 A;  2MGS A;  3A5Z B;  4XIG S;  1PH3 A;  3GTP B;  1VQL A;  3ND9 A;  2J0T D;  4JPB W;  5GAH C;  1X3G A;  5FLX c;  2DNC A;  1TS5 A;  3CME A;  2CKZ B;  1PZJ D;  3J81 c;  3TS0 A;  2B2V A;  2WAQ B;  4CJ0 B;  3KBX A;  4K6L A;  4ME3 A;  4AQY L;  3EJI A;  3PIP A;  2B39 A;  5HUR A;  1RJT A;  3FVQ A;  2PZU A;  1SNM A;  4GS3 A;  5JVG 3;  1HUN A;  2DY7 A;  1STY A;  4WFN 3;  1VCI A;  2MNA A;  4KY7 A;  2N55 A;  2WFW A;  2F4V L;  4KKU A;  2ENB A;  1CA6 A;  3KFU A;  1FGB D;  4A3E B;  1ASZ A;  4TVA B;  1B53 A;  2JXM B;  1PFM A;  3TP7 A;  1YJN A;  2QGQ A;  4IN3 A;  3OSO A;  2A68 D;  2E2I H;  2EYF A;  5ELF A;  5A2Q E;  1H9M A;  3GTQ B;  2KUM A;  4BY7 H;  4IQZ A;  1KDC A;  1LUZ A;  2K7V A;  2OEO A;  1I3Q B;  1JOR A;  4H13 C;  1UNS A;  1FJG L;  1RL2 A;  3N6R A;  2WV6 D;  1TII D;  1J5E L;  3K0X A;  2EPB A;  1B1Z A;  5C3W A;  1WD0 A;  2JE6 I;  2BH2 A;  1KHI A;  4RHR A;  5J39 A;  1AE2 A;  4A3I B;  2SEB D;  3PO3 B;  1SMY C;  1HFG A;  1EYD A;  5CC4 A;  3J7Z C;  5G3L F;  4BBR H;  2WAQ G;  2A73 B;  3A7L A;  4WJ3 M;  5T1I A;  3I4N H;  3QWN A;  1KAB A;  3MC0 B;  2JN4 A;  3J80 c;  4KKS A;  4A3D H;  2B2Y C;  3A7A B;  5IT9 L;  4DV6 L;  2B2U C;  3TRZ A;  4BBS B;  5DM6 3;  3P7J A;  3CD6 A;  3CCJ A;  3PO2 H;  1CA5 A;  1SNQ A;  4CHT B;  2I5M X;  5LMN Q;  2NB0 A;  3OW2 A;  1PRT B;  1QZG A;  2CH4 W;  1WTQ A;  1K9M C;  1VQB A;  1ZYR D;  3NWT A;  1HHV A;  1Q12 A;  1BBX C;  1CKM A;  1QE6 A;  4RGM A;  5HY6 A;  4YY3 L;  4DV2 Q;  1PH9 A;  2XWB B;  1GUW A;  3LGJ A;  5ELN A;  3HP3 A;  1D6E C;  3MTS A;  4A3E G;  2CW0 D;  2BE5 C;  3NSW A;  5FLM G;  3I72 A;  3CPW A;  2F0M A;  4XT1 B;  1H9S B;  4J6H A;  3T51 B;  1GUT A;  3LNN A;  2A74 C;  2IPK D;  4DV3 Q;  3ERS X;  1SSO A;  1RD9 D;  2J7Z A;  2UUA L;  3I91 A;  4R4T A;  1YIT A;  3HKZ E;  4NXN Q;  4ILW A;  2N3S A;  3S9W A;  3J81 j;  1NNX A;  1HNZ Q;  3I3C A;  1GKH A;  1TS2 A;  4RWS C;  2F0G A;  3EA6 A;  1SR3 A;  3KUP A;  5JEA H;  2VL6 A;  1UEB A;  3AQQ A;  4IUP A;  3TEH B;  2B2W C;  2R7Z H;  3G6J B;  4QUC A;  5D3I B;  3T1Y Q;  3DMU A;  5FJ8 G;  4A3I G;  1Y8N B;  3PO3 G;  4DV0 Q;  3OW7 A;  1UE1 A;  3GV6 A;  3GTJ H;  4HJ5 A;  1KDA A;  4JI4 Q;  1KXL A;  4A3C H;  3RZO H;  1VQO A;  5IP9 G;  1B50 A;  1A2T A;  4BBS G;  2L5T A;  1KC8 C;  3C1F A;  1NMG A;  1QVC A;  4CDC C;  1GUG A;  3EN2 A;  5C3X A;  4DR5 Q;  1EIH A;  2ZXP A;  2VUM H;  1V43 A;  4NB3 A;  3WWV A;  1EY4 A;  1U4M A;  1PMR A;  4B3S Q;  1JOO A;  3S24 A;  2PCF B;  1C9O A;  3L9A X;  3U4V A;  1ZKO A;  4G7O C;  5M5Y B;  4PV1 C;  3BJU A;  2HT1 A;  2E2H H;  2Q2T A;  5IYC H;  4GNX B;  4DR7 Q;  3A8J E;  4TRD A;  5KIX A;  4DV2 L;  5CV6 A;  3R2I A;  3MXN A;  1GM5 A;  1KD1 C;  3HOZ B;  4RG1 A;  4BY7 B;  3K7U C;  1Q46 A;  1VQ8 A;  1C4Q A;  4JI1 Q;  2NYZ D;  3S2H H;  1FNU A;  5ELB A;  5C4X G;  2E2H B;  3OPO A;  1JJG A;  4NXM Q;  4DV3 L;  4H0L C;  1QCB D;  2B2V C;  3CF5 A;  5C5M A;  1MI2 A;  4BBR B;  3K81 C;  1EU4 A;  2HQL A;  2HIV A;  3I4N B;  2OCE A;  1HNZ L;  3DWQ A;  4GN3 B;  3HKZ B;  1SDF A;  4UDU C;  3H0G H;  3T1Y L;  3PO2 B;  2WKC A;  1YNJ D;  4ZUJ A;  4LFC Q;  1JCK B;  3VYR A;  2IX3 A;  3KLS A;  3IAY A;  3K80 C;  2HIX A;  3L2P A;  3GD7 A;  4ZAI A;  4ZYS A;  2CQO A;  3MVV A;  2XNA C;  2A8V A;  2VQF Q;  2K14 A;  1QWY A;  4C3H B;  3M3Y H;  2FMC A;  1BDO A;  1VQC A;  5AJ3 Q;  1EL0 A;  2NVT H;  1R4P B;  5C4X B;  1CKN A;  1XX8 A;  4IZ8 A;  4DV1 Q;  3GTG B;  3TZD A;  1RF2 D;  1K0R A;  5EKK A;  3T13 A;  4DXF A;  1EY8 A;  4A3M H;  2P5Z X;  1VS0 A;  2VB3 X;  3D31 A;  5FO8 B;  2GN5 A;  3HOZ G;  4BY7 G;  4P73 A;  5F2D A;  4X66 Q;  1VQ7 A;  2R7D A;  3VDY A;  4DR7 L;  3SEB A;  3E0J A;  3CW2 C;  4I65 A;  3URY A;  3I4L A;  1PVO A;  4HJ9 A;  1PDQ A;  1ET9 A;  3W2D A;  1HTP A;  4OO1 H;  1X9N A;  2JP1 A;  3GTJ B;  2HDM A;  4X62 Q;  4BBR G;  1E1O A;  1B7Y B;  1A63 A;  3I4N G;  4KI0 A;  2JYO A;  5BR8 Q;  4NXM L;  1E2Z A;  1CFM A;  3K5N A;  4DR1 Q;  3RZO B;  3HKZ G;  4ID6 A;  2CFM A;  2LKV A;  1I4X A;  3PO2 G;  2AMC B;  3A74 A;  3FPU B;  3ULP A;  3S15 B;  5KNB A;  3IFT A;  5EPJ A;  2B63 B;  2F0N A;  2PI2 A;  4WOR A;  1Y8P B;  3P75 A;  1IBK Q;  1SMX A;  1ROD A;  3K8A A;  1L1O A;  1IKL A;  1I4G A;  4I7Z C;  5CGK A;  4LFC L;  3S14 H;  4IUQ A;  3GO5 A;  4C3H G;  3SXH A;  1TY0 A;  4LF4 Q;  2ZJP A;  2Z8L A;  1CM9 A;  3MXU A;  3M7G A;  1B9M A;  4N9T A; 
#chains in the Genus database with same CATH homology
 2F0S A;  2EYP A;  3BVM A;  3JAM E;  5DM7 3;  5C4H A;  4RKL A;  4RH6 A;  1KNA A;  3QO2 A;  3NUC A;  4ZRZ A;  1E2V A;  3VYS A;  4PQX A;  3DWP A;  2EJG C;  3O13 A;  2O5J C;  5TSS A;  3J7Y W;  2C5C A;  4DAV A;  2PPB C;  4OGQ C;  3H0G B;  1SEB D;  5M9O A;  5DEH A;  2AUJ D;  1EYC A;  4FF2 A;  1RTN A;  2MJ8 A;  2B8G A;  1PTO F;  1M4V A;  2NVX B;  3BVG A;  4X3K A;  2NVT B;  3VA5 A;  1O7Z A;  4QCL A;  3RUZ A;  1RDP D;  2K05 A;  5LHY 1;  1SMY D;  1NAP A;  3NP8 A;  4A3M B;  4RGO S;  2ICE C;  1MD2 D;  1EY6 A;  2K03 A;  2H1E A;  1G91 A;  3MA2 B;  1E2W A;  1DD2 A;  1TS4 A;  1ENF A;  3KBG A;  3MEH A;  1IHZ A;  3QOL A;  5EBD A;  1CZG A;  3UI2 A;  2F0E A;  3WOE A;  2E2D C;  1ESF A;  2MPM A;  3MFY A;  4TQU S;  2F4I A;  4QB4 A;  5CV7 A;  1XYI A;  4NMZ A;  1G6Z A;  3P1H A;  1WD1 A;  1R4Q B;  1YNN C;  2QDB A;  1ESR A;  2M00 A;  4DNT B;  1JB3 A;  3CRK C;  3SDZ A;  3AMU A;  3HOV B;  1NCV A;  5EPK A;  4XXE A;  5JEA J;  3OMG A;  2DNE A;  1B4O A;  3M85 A;  1U4R A;  1SAP A;  5A35 A;  5FLX E;  5BN5 A;  1NR4 A;  2RA4 A;  4Y7N B;  2YU9 B;  4FXK C;  2EXZ A;  3M4O B;  3T53 B;  4K5X A;  4FF1 A;  5EGT A;  4KN7 C;  5IGF A;  4FF4 A;  1U4P A;  3NK9 A;  4IFD I;  5E4W C;  1PXU A;  1CQV A;  3FKI B;  4DK0 A;  4LJZ C;  3R93 A;  1K83 B;  4IUR A;  2NTS A;  1AP0 A;  3C46 A;  1NR2 A;  5E4X A;  1X3P A;  1LT6 D;  1TU2 B;  1D1K A;  2K01 A;  3KK7 A;  3M7N A;  3CKI B;  3TP5 A;  3H6M A;  2XSC A;  2EYO A;  4PMW A;  3D4W A;  2BDO A;  4HSP A;  3MAQ A;  1U4L A;  1B44 D;  2O2L D;  1QIL A;  3I90 A;  3AB9 A;  3PUY A;  1GJX A;  5IGD A;  1L0X B;  2HQE A;  1PTO H;  4A93 B;  1PFN A;  1CHQ D;  3MWY W;  3SK6 A;  1FD7 D;  5COR A;  2V4D A;  1V1O A;  2C9O A;  3I70 A;  1S5C D;  4EQO A;  3V05 A;  4TKO B;  1DJR D;  3J80 E;  4K14 A;  2NTT A;  3R2T A;  3X3M A;  3GTO B;  2EYM A;  4XYQ A;  3R8B A;  1SJH D;  1WVL A;  5DNF A;  4OIK A;  2Z4H A;  3DXJ C;  4UAI A;  2MHV A;  5KGU A;  3HGB A;  4N9P A;  3OIP A;  1OXS C;  4Z9C B;  5IIF A;  3C2P A;  5K5P A;  1TWF B;  4RKB A;  1VF5 C;  4ABN A;  1GHJ A;  1F9S A;  2L4N A;  2LS0 1;  2KA7 A;  1QNK A;  5LL6 S;  5NUC A;  4KY5 A;  1ZEQ X;  3CHB D;  1MBY A;  3TBI B;  1Y1V B;  5D14 A;  1TWA B;  2B2T A;  2QEJ C;  4K5V A;  2F0Q A;  2NVY B;  5CMD A;  3QG1 A;  4MN3 A;  4S3S A;  3HOX B;  1CZW A;  3WDN A;  3PUZ A;  2F0J A;  4RAU C;  1AZP A;  1AEX A;  3ERO A;  5IOD A;  5JJZ A;  5IT9 E;  4RA8 A;  5I6W A;  3MXP A;  1EEF D;  4FVM A;  1ICW A;  4DAP A;  1QJO A;  2J4X A;  3Q24 A;  1X32 A;  5IGB A;  1Z47 A;  3VR4 A;  1DXM A;  3D3R A;  1I6V C;  3VR5 A;  1KNE A;  2K28 A;  5K36 H;  3I73 A;  4NKL A;  1PZK D;  4RCN A;  4DU9 A;  1PTO B;  1TWG B;  4EQP A;  2AQ1 B;  2GA4 B;  4FNF A;  3Q6S A;  2WB1 B;  4XT3 B;  1D2B A;  2F0T A;  2NBF A;  4K2L A;  2IW3 A;  1PRT D;  5C6A A;  3MXG A;  2Q8T A;  1IW7 D;  1EY5 A;  2K1B A;  2O5I C;  4MHE A;  3OIQ A;  4RFB A;  2QKI C;  1HA5 A;  5JAV A;  3K5L A;  3RMH A;  1J8I A;  1IYV A;  1MSG A;  3HS0 C;  4ZKC B;  5J1Z A;  5A2Q L;  3HZX A;  3NXW A;  2SOB A;  4CGY B;  3TDQ A;  1F9P A;  1ONL A;  1W6J A;  5CYU A;  1G2S A;  1EIG A;  3NTK A;  1NSN S;  4XQJ A;  3VR2 A;  1HTL D;  1AN8 A;  3FRP B;  2A6H C;  2K32 A;  1SE4 A;  5KNC A;  1IKM A;  2KOL A;  3HEJ A;  4RCO A;  2F0U A;  2E76 C;  4K5W A;  3VR6 A;  4F7X A;  2VNU D;  1MSH A;  2E74 C;  1BR9 A;  3A8I E;  1LTT D;  3U9O A;  5CV4 A;  5I2X A;  4YIJ A;  5ELE A;  4R8N A;  1F9R A;  1O7L A;  2F0W A;  1HQM C;  4MIU A;  1ENC A;  1C8C A;  1YNN D;  4TSS A;  4EQN A;  3TP6 A;  5CBE E;  3LX0 A;  4CKE A;  2E2I B;  2NN6 I;  4CJ2 C;  4CBV A;  5C0X I;  5CBA E;  1STA A;  4DAY A;  2B8F A;  1DOL A;  3D6C A;  2JA7 B;  5COY A;  1Y69 U;  1PZI D;  1SYC A;  1WTV A;  4KHV A;  1XWE A;  2CVR A;  1EWH A;  2EZV A;  1ET6 A;  1DOK A;  2BA1 A;  4F8M A;  5IGG A;  3PUV A;  4A3D B;  1IL8 A;  2NUC A;  2B2T C;  5JVH 3;  1II3 A;  1LO5 D;  1BCP C;  4QIW B;  1STH A;  5EKL A;  4K2K A;  2PQE A;  4P2C B;  2K5Q A;  3RLF A;  2NN6 H;  4XQQ A;  4K6D A;  1LTB D;  1S5E D;  1VDZ A;  3SVM A;  1WTP A;  2RDH A;  5EBC A;  2EY2 A;  1BCP F;  1FR3 A;  4IFD J;  3SK5 A;  1H9J A;  5K36 G;  2XRQ D;  4RGT A;  1RHP A;  2R7Z B;  1EZ6 A;  2RQX A;  4JBW A;  3CU7 A;  4HCS A;  4H7B A;  5EKI A;  2KEE A;  3FPP A;  2OF1 A;  5IGE A;  2KCC A;  5I2Y A;  1STN A;  1ML0 D;  2Q8I B;  2DN8 A;  3TSS A;  2A6E D;  1EQT A;  2F0L A;  5C5L A;  1ILQ A;  5M3F B;  3N52 A;  3HRZ C;  2VUM B;  3QB3 A;  4X3T A;  1BO0 A;  2IL8 A;  1TQO A;  1V1P A;  3C3L A;  2RDG A;  2EVB A;  1Z7T A;  3TN2 A;  3BDC A;  5JPM C;  2LMC B;  3PIO 3;  5T1G A;  4FF3 A;  3S2H B;  5HGT A;  3D4D A;  3EQL C;  1PTO C;  3K0Y A;  4FXG C;  4HCE A;  2L1B A;  5JEA G;  2A68 C;  3TP8 A;  2IJ0 A;  2KJX A;  3NQI A;  3TME A;  1A3T A;  5CV5 A;  2K33 A;  3OHX C;  2PMZ B;  1EU3 A;  3NBH A;  3D4R A;  4ODG A;  4IUV A;  5G3L D;  1EY0 A;  2EYL A;  3Q23 A;  2EY6 A;  1RTO A;  5AFW A;  2EOT A;  1TS3 A;  1CHP D;  5J22 A;  3M3Y B;  1BOS A;  3U9S A;  2JA5 B;  3S17 B;  1HXY D;  3NTH A;  2NVQ B;  4KJN A;  2HCC A;  4V19 0;  2EYJ A;  3OWF A;  2PW5 A;  4K8I A;  1VF7 A;  2K6A A;  3VR3 A;  3QIA A;  3BS1 A;  5E1F A;  2JA6 B;  2ICI A;  2IX0 A;  2XWJ B;  4KD3 A;  1EZ8 A;  4HN7 A;  3PMF A;  2XN9 C;  2K04 A;  2PZT A;  4DXG A;  2BE5 D;  4A3J B;  2K5D A;  2M9V A;  4C2M B;  2RSN A;  2A69 C;  1JR0 D;  3SE0 A;  2F0K A;  1NUC A;  4JK1 C;  4XTC S;  1PYW D;  3ND8 A;  2SDF A;  1QB5 D;  1LLR D;  3S14 B;  1I6H B;  2L9H A;  4DA2 A;  3NBI A;  4HAE A;  2JSO A;  3HG9 A;  4RGN A;  5M3M B;  2G9H D;  4QF4 A;  1B3A A;  1JC7 A;  2BA0 A;  2KQ3 A;  3E6Z X;  1S5F D;  1SNC A;  2EJF C;  1U9R A;  2EJM A;  5I6Y A;  2L55 A;  4J8Q A;  2YYZ A;  4C3J B;  4OO1 G;  3J7A V;  4LK1 C;  5ELD A;  3W3A A;  2FMM A;  2ZXR A;  1BNZ A;  2A5H A;  2B2U A;  4PNY A;  1O78 A;  1F2Z A;  2FJ2 A;  1D5X C;  5KYL A;  3G7L A;  5EPL A;  1JE4 A;  2BOS A;  1BUV T;  2F0H A;  1UAP A;  1SJE D;  4B08 A;  5I4D A;  4BS9 A;  1FNW A;  3SR1 A;  1I50 B;  2EY1 A;  1HUM A;  2VXW A;  3PIP 3;  1S4Z A;  1X3Q A;  4C1N K;  3ONA B;  1SXT A;  2AQ2 B;  1EY9 A;  4Q0F A;  1H9K A;  2FIN B;  3K59 A;  2Q8R E;  1UUP A;  4PMB A;  2DY8 A;  3A56 A;  1BQQ T;  5FLX L;  2OXP A;  4KV6 A;  3J81 L;  4IFD H;  2D2C C;  4HSV A;  2VB2 X;  1VMP A;  3A55 A;  3BYT B;  4FXD A;  2KEC A;  4X3U A;  4C3J G;  1I4R A;  3Q0A A;  1BCP B;  1H9R A;  3S2D B;  1R9T B;  1QG7 A;  4HMI A;  4QUF A;  5C0X J;  1T5X D;  4ME5 A;  3WOF A;  1OXV A;  2ZT9 C;  3LWU A;  3RZD B;  5D65 A;  3KF8 A;  2F3V A;  3SK4 A;  3I4M B;  1A3V A;  5C4Z A;  4A3K B;  1HQR D;  1TR5 A;  2D62 A;  1E0B A;  2NZ1 D;  3R3O A;  1V8Q A;  3D6W A;  2EYH A;  1AW7 A;  1OXU A;  4QMG A;  1GXD C;  1SND A;  3J80 L;  1CTM A;  1Q90 A;  1L0Y B;  1LT4 D;  2FHT A;  1G8Z D;  2ZXO A;  1PFB A;  3ERQ A;  1EY7 A;  1SYB A;  4NDX A;  2L0C A;  1GOZ A;  1HFN A;  3PUX A;  2KED A;  5KEE A;  4HMJ A;  3I8Z A;  5JPN C;  4DF7 A;  3HOY B;  1LTS D;  1Y1W B;  5E3F A;  2D9U A;  2JA8 B;  5FOB B;  2IT1 A;  2F03 A;  3IL8 A;  1JIC A;  3M4Y A;  3DUZ A;  3EFX D;  1PTO D;  2K5W A;  4ZK9 B;  4J1M A;  1DOM A;  1SYD A;  3DHQ A;  1WTX A;  4DN4 M;  1WTR A;  4LMQ D;  2KVM A;  4C3I B;  1GUN A;  4R9W A;  1EFI D;  2IX1 A;  5C4J B;  4HED A;  1XTC D;  5BN3 A;  2F1M A;  3CQZ B;  2BCO A;  1FNV A;  5LL6 X;  5FO9 B;  2R61 A;  3GTM B;  4M8A A;  3V2T A;  3K57 A;  3NQT A;  3QOJ A;  4R8I A;  2H4O A;  4O42 A;  1STE A;  1JQY D;  3ZYY X;  1WTW A;  4LAA A;  2RBM A;  1CI3 M;  3FDT A;  3C1E A;  1Q8I A;  2NWG A;  3P20 A;  1LTA D;  2F0D A;  1D5Z C;  2X6G A;  2QIL A;  2L12 A;  1SYF A;  2F0O A;  2ID0 A;  3KLS X;  3S1Q B;  2E75 C;  2F0F A;  3FEW X;  4IUN A;  1ENA A;  3PV0 A;  3PUW A;  3BVZ A;  4H44 C;  3KLR A;  4KD4 A;  3CRL C;  3K5O A;  1A6X A;  1WCM B;  4AYB B;  4C3I G;  2SNS A;  2PZW A;  3H09 A;  4IFD G;  1JWM D;  2LY7 A;  1SNO A;  2EY5 A;  5FK9 C;  1MGS A;  2PYK A;  2A69 D;  1HA6 A;  2RDF A;  4BA2 I;  3GV3 A;  3L7Z C;  1SNP A;  3SHL A;  4EGV A;  1LT3 D;  3S1R B;  2TMP A;  1CK1 A;  1STB A;  4G4K A;  2I07 B;  1F2L A;  1F77 A;  2R3Z A;  2X6L A;  3DEP A;  2AUK A;  2F0P A;  4WRD A;  1Q1B A;  2I46 A;  1H9S A;  3Q22 A;  2AQ3 B;  1KTK A;  1UEA B;  3NE5 B;  1SYE A;  2R92 B;  1G2T A;  5BN4 A;  4A3B B;  4DGZ A;  1K8M A;  4XDX A;  1C48 A;  3MHB A;  3AU7 A;  5C3E B;  2RVL A;  1AZQ A;  1DYQ A;  2CQA A;  2R93 B;  4E6I A;  1STG A;  2MP1 A;  1PLF A;  4U67 3;  2EE1 A;  3NHH A;  3IFD A;  4DK1 A;  4KY6 A;  4HTH A;  2HDL A;  1I4P A;  4IAL A;  1TY2 A;  1VMC A;  4OO1 I;  1DCZ A;  5C0X H;  4G7Z C;  1V1P B;  3T56 B;  3GP7 A;  1Y8O B;  5KND A;  3DWA A;  3SK8 A;  1HCZ A;  1XXG A;  1F9Q A;  2Z1C A;  3L3O C;  4CKB A;  3H3V C;  1S5B D;  2RSO A;  2L11 A;  2KCN A;  5CV8 A;  2MUY A;  3NTI A;  1TT2 A;  3NWS A;  1A15 A;  3FMC A;  1HRJ A;  4ZQ3 A;  3EVQ A;  2WKD A;  1WTO A;  4L8J A;  2XVS A;  1SE3 A;  1G29 1;  1GUS A;  5IGC A;  1D1I A;  1LAC A;  2Y0S B;  1IYU A;  5M5X B;  3V96 A;  1SYG A;  1Q1E A;  5EQ0 A;  4DFA A;  2N88 A;  1LTR D;  3K58 A;  1HPC A;  1EYA A;  1K8O A;  2FFK B;  1F2M A;  4FO2 A;  1W6K A;  4X3S A;  4FYD A;  3A8K E;  4EVO A;  4L6T B;  1FYC A;  4A3G B;  2WII B;  3A54 A;  2RKS A;  4FP5 D;  4CJ1 B;  1QOH A;  3LWE A;  3BG3 A;  2D5D A;  1I4Q A;  3OWE B;  2F0V A;  4BY1 B;  4B9W A;  1OXX K;  1Z6H A;  2TSS A;  4F88 A;  2IWH A;  3TZU A;  1B2T A;  4K8J A;  2X69 A;  2XRS D;  4OHJ A;  2WAC A;  1ILP A;  2CHB D;  3K5M A;  5C44 B;  5EJW A;  5CR3 A;  5JOB A;  1GUO A;  2F3W A;  3J7A F;  3BZD B;  3VYU A;  4HR7 B;  1PRT C;  4G57 A;  3T4A C;  1GHK A;  1RCV D;  1IW7 C;  1CQF A;  1KDB A;  5IOC A;  1LT5 D;  3K6O A;  3JAM L;  1ZYR C;  2R6G A;  4BA1 I;  1EEI D;  1Q3L A;  4V0B A;  3DEO A;  1SBB B;  3BDL A;  1A2U A;  3VA7 A;  1EQV A;  2CW0 C;  1JWS D;  4Q5V A;  5FO7 B;  1OXT A;  2XIW A;  3HOU B;  5D3D A;  3BYY B;  4OL7 A;  1QNU A;  4OIJ A;  1O7Y A;  3HOW B;  3IKJ A;  1DZ1 A;  4KTA A;  4DNR B;  2WP8 J;  1PRT F;  5I9O A;  2PNR C;  2M2L A;  2HUG A;  4KKT A;  2LFN A;  1JOQ A;  5CV9 A;  3D8G A;  1KLG D;  5I9P A;  1EWC A;  1T5E A;  1TWC B;  1BF4 A;  2OT2 A;  4A3F B;  2JEA I;  5ELC A;  2NN6 G;  3BDO A;  2QF7 A;  4PMC A;  2A6H D;  5KYI A;  3ITP A;  4B9X A;  5C0X G;  4RHS A;  5M5W B;  2PW7 A;  4ZLT F;  2AWN A;  4XQN A;  1J9O A;  4BWG B;  1DM0 B;  2PO4 A;  4KMU C;  3MZ5 A;  4KN4 C;  4ULL A;  2EDG A;  2JEB I;  1JOK A;  1RKN A;  2E2J B;  5DAU A;  3GTK B;  2HCI A;  2QCP X;  4ZKB B;  3J81 E;  1LTG D;  2B2Y A;  3S16 B;  3X3N A;  4KJO A;  2AWO A;  4NW2 A;  4L63 B;  4ZUI A;  1B9N A;  3S1M B;  1LV9 A;  1OO9 B;  5FKA C;  3E5S A;  2WIN B;  1SE2 A;  4IUT A;  2O4X A;  1AFP A;  4C1N I;  3H94 A;  1YNJ C;  3RD4 A;  1ZXT A;  3T16 A;  1BXT A;  1M8A A;  3K7A B;  3VYT A;  4U68 A;  4G7H C;  1F2Y A;  5ISR A;  4F87 A;  1KAA A;  4IUU A;  1DON A;  1SFO B;  2SNM A;  4GZY C;  1JWU D;  4WJW A;  3F2U A;  1D5M C;  3S1N B;  2G9D A;  2F0I A;  2B2W A;  3H91 A;  3OOC A;  1BCP D;  4O1N A;  2KHS A;  1TVX A;  3OMC A;  1KLU D;  3MFG A;  3QJY A;  3NPP A;  1LAB A;  3DM1 A;  4C56 C;  1A3U A;  1I4H A;  1TWH B;  2Z4I A;  4KK7 A;  2BDN A;  3GQB A;  1O80 A;  1LTI D;  1CT1 D;  2A6E C;  4KHZ A;  4CKC A;  4NP5 A;  4M1U B;  1S5D D;  4XYO A;  3GTL B;  1EOT A;  5KRU A;  1TKW B;  2MGS A;  4XIG S;  3GTP B;  3ND9 A;  2J0T D;  2DNC A;  1TS5 A;  1PZJ D;  2B2V A;  2WAQ B;  4CJ0 B;  3KBX A;  4K6L A;  3EJI A;  2B39 A;  5HUR A;  1RJT A;  3FVQ A;  2PZU A;  1SNM A;  5JVG 3;  1HUN A;  2DY7 A;  1STY A;  4WFN 3;  1VCI A;  4KY7 A;  2N55 A;  4KKU A;  2ENB A;  1CA6 A;  1FGB D;  4A3E B;  1B53 A;  2JXM B;  1PFM A;  3TP7 A;  4IN3 A;  3OSO A;  2A68 D;  2EYF A;  5ELF A;  5A2Q E;  1H9M A;  3GTQ B;  2KUM A;  4IQZ A;  1KDC A;  2K7V A;  2OEO A;  1I3Q B;  1JOR A;  4H13 C;  1UNS A;  3N6R A;  2WV6 D;  1TII D;  2EPB A;  1B1Z A;  5C3W A;  1WD0 A;  2JE6 I;  4RHR A;  5J39 A;  4A3I B;  2SEB D;  3PO3 B;  1SMY C;  1HFG A;  1EYD A;  5CC4 A;  5G3L F;  2A73 B;  3A7L A;  5T1I A;  3QWN A;  1KAB A;  3MC0 B;  4KKS A;  2B2Y C;  3A7A B;  5IT9 L;  2B2U C;  4BBS B;  5DM6 3;  3P7J A;  1CA5 A;  1SNQ A;  4CHT B;  2NB0 A;  1PRT B;  1WTQ A;  1ZYR D;  3NWT A;  1HHV A;  1Q12 A;  1BBX C;  4RGM A;  1QE6 A;  2XWB B;  1GUW A;  3HP3 A;  1D6E C;  3MTS A;  2CW0 D;  2BE5 C;  3NSW A;  3I72 A;  2F0M A;  4XT1 B;  1H9S B;  4J6H A;  3T51 B;  1GUT A;  3LNN A;  2A74 C;  2IPK D;  1SSO A;  1RD9 D;  2J7Z A;  3I91 A;  4ILW A;  3S9W A;  3I3C A;  4RWS C;  1TS2 A;  2F0G A;  3EA6 A;  3KUP A;  5JEA H;  4IUP A;  2B2W C;  3G6J B;  4QUC A;  5D3I B;  3DMU A;  1Y8N B;  3OW7 A;  3GV6 A;  1KDA A;  1B50 A;  1A2T A;  2L5T A;  3C1F A;  1GUG A;  5C3X A;  1EIH A;  2ZXP A;  1V43 A;  1EY4 A;  1U4M A;  1PMR A;  1JOO A;  2PCF B;  3L9A X;  1ZKO A;  4G7O C;  5M5Y B;  4PV1 C;  3A8J E;  4TRD A;  5KIX A;  5CV6 A;  3R2I A;  3MXN A;  3HOZ B;  4BY7 B;  1C4Q A;  2NYZ D;  1FNU A;  5ELB A;  2E2H B;  3OPO A;  4H0L C;  1QCB D;  2B2V C;  5C5M A;  1MI2 A;  4BBR B;  1EU4 A;  3I4N B;  3DWQ A;  3HKZ B;  1SDF A;  4UDU C;  3PO2 B;  2WKC A;  1YNJ D;  4ZUJ A;  1JCK B;  3VYR A;  2IX3 A;  3KLS A;  3IAY A;  3GD7 A;  4ZAI A;  4ZYS A;  3MVV A;  2XNA C;  1QWY A;  4C3H B;  2FMC A;  1BDO A;  1EL0 A;  1R4P B;  5C4X B;  1XX8 A;  4IZ8 A;  3GTG B;  3TZD A;  1RF2 D;  5EKK A;  3T13 A;  4DXF A;  1EY8 A;  2VB3 X;  3D31 A;  5FO8 B;  5F2D A;  3SEB A;  3E0J A;  4I65 A;  3URY A;  3I4L A;  1PDQ A;  1ET9 A;  3W2D A;  1HTP A;  4OO1 H;  2JP1 A;  3GTJ B;  2HDM A;  4KI0 A;  2JYO A;  1E2Z A;  1CFM A;  3K5N A;  3RZO B;  4ID6 A;  2LKV A;  1I4X A;  3FPU B;  3S15 B;  5KNB A;  3IFT A;  5EPJ A;  2B63 B;  2F0N A;  4WOR A;  1Y8P B;  3P75 A;  1ROD A;  1IKL A;  1I4G A;  4I7Z C;  5CGK A;  4IUQ A;  3GO5 A;  4C3H G;  3SXH A;  1TY0 A;  2Z8L A;  1CM9 A;  3MXU A;  3M7G A;  1B9M A;  4N9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...