2TMPA

N-terminal domain of tissue inhibitor of metalloproteinase-2 (n-timp-2), nmr, 49 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease inhibitor
molecule keywords TISSUE INHIBITOR OF METALLOPROTEINASES-2
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 1998-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tmpA00
3OHXC 1PXUA 3HRZC 5FO8B 2XWJB 5FO7B 3CKIB 2ICEC 1D2BA 1GXDC 2E2DC 3HS0C 5FO9B 3I70A 1JC7A 3MA2B 3FRPB 5FOBB 2XWBB 5JPMC 2TMPA 1BQQT 2A73B 3V96A 1BUVT 2QKIC 1JB3A 5JPNC 2I07B 3G6JB 2B39A 3CU7A 4FXGC 2WINB 2A74C 3T4AC 1BR9A 1XWEA 4FXKC 3L3OC 1UEAB 1OO9B 4ILWA 2WIIB 3KLSA 1UAPA 2J0TD
chains in the Genus database with same CATH superfamily
1RHPA 1NCVA 1E3PA 3PGZA 2IX1A 3KF6A 1F77A 2VQFL 4C3HB 1I4RA 3CCUA 1HJPA 2L0CA 3J80L 1SRUA 1AEXA 1PHJA 4J15A 2HHHL 1A3TA 5C4HA 4N8FA 3LNNA 3P75A 4LF5L 2Y0SE 3STBC 1HCZA 4EVOA 4BA1I 3E6ZX 3I3CA 1R4PB 4DV1Q 2RKSA 5CMDA 4LUVA 3I4NB 2HT1A 1EZ6A 4F8MA 1KD1C 1UE5A 1X65A 3H0GH 1BOSA 2Q8IB 1XPRA 3T1YQ 2A69D 1Z6HA 2YTYA 1EY6A 4A3JB 1I50H 3PIP3 3PUXA 2UXCL 1FVIA 1Y1VB 2XRSD 4UP9A 1E7ZA 4ZAIA 4JI3L 4OO1H 3CPWA 2Z9HA 5IGGA 1LT4D 2JP1A 5J22A 2R7DA 1RL2A 2F0DA 2FFKB 3QOJA 1YJWA 2E2IH 3C1EA 4KN4C 1TR5A 4DR2L 5LMNW 4RHSA 3E9HA 5KRUA 2YU9H 3KYHC 3T51B 1S4ZA 4QB4A 3T56B 2OTJA 1Z7TA 1XMQQ 1SROA 1WTPA 1CKNB 4MTNA 1HRJA 1D8LA 5EPLA 3SK8A 3ZYYX 3T1YL 3PO3H 4IURA 4OWTB 2WB1G 4HSVA 1E1TA 4DU9A 3MFYA 4PMWA 1AH9A 3AEVA 2UUBQ 1SNMA 3BDOA 2B2YC 3TZDA 1M4VA 3NBHA 2SDFA 5CORA 3G71A 4LF8L 1DOKA 1QUQA 2I5HA 1E0BA 3S15B 5IP9H 2EPBA 4QL5A 1WI5A 3K81C 4LF9Q 2YTXA 4EQPA 2DJGC 2IJ0A 3WOFA 5CGKA 2HQLA 4WFN3 1PRTB 4G7ZC 2RCNA 3J80i 2JA7B 5C6AA 4DA2A 4GKKL 1G6PA 5IYCG 1UE1A 2GN5A 3D3RA 1PH5A 1CA6A 1N32Q 1G2TA 5CR3A 1SMXA 4A3EB 4IPDA 3TMEA 1JT8A 5FKAC 1Y14B 1MJCA 2L5TA 3MXUA 5IT9L 3I4NH 1VQOA 3S16H 1CK1A 4IOCA 1EQRA 5JEAH 4EX5A 1HQRD 1VQIA 1BQQT 2B8FA 4JI0Q 1A15A 2KJXA 1SFOH 4OWWB 3J7A5 3V2TA 3QR8A 4LF4Q 4XDXA 4IUNA 4F87A 5KYIA 5ELCA 5HGQA 3H3VI 1RODA 4RHRA 2JA6B 1OO9B 4F7XA 3SDZA 5IYCH 2UUCL 1NJIC 4XIGS 5KIXA 2D5DA 1YHAA 1N33L 1TT2A 4DV0L 2Z1CA 4FNFA 4QIWE 4A3DG 1TVXA 2XIWA 2JSOA 1NY4A 2LXJA 5I2XA 1J8IA 3T1HQ 1IXRA 2X6GA 3J81j 4BY7H 3K0YA 4OO1I 2JA5B 1RTNA 2ZJRA 3UDFA 2XTIA 2OTLA 1ESFA 2F0OA 4IFDI 4KJNA 3K57A 1SYDA 4R1JA 4ABNA 3NQTA 3U58A 4DV6Q 4FF3A 1F2LA 4WJWA 3I4NG 1JE4A 3I90A 3WOEA 2MGSA 1KLGD 4XXEA 3EN2A 2R93B 4OELB 2CVRA 1TU2B 1Q1BA 4K0KQ 3PQIA 4UAIA 2HUGA 4LF4L 2QEJC 1I4PA 2Z0SA 4GOPA 1N9WA 2B2VC 2EVBA 3H3VC 3CCQA 3W1GA 2E5LQ 3I73A 3M7GA 4CJ0B 2BE5D 3PO2B 2F3VA 1SAPA 3NUCA 3EVQA 4DFAA 4HJ7A 3SGIA 1ET6A 1AP0A 2CQOA 1PRTD 3JAME 4DUYQ 1VQ6A 2L55A 4L5TA 2D2CC 5I9OA 1A2TA 2K5NA 4TQUS 2E2DC 4N9TA 2NVQB 1I6HH 1V9PA 3DXJC 4IQZA 3QJYA 1QOHA 2FHTA 4XT1B 1BBWA 4FF1A 5C0XH 2OQ0A 3D6CA 3OIPA 2WFWA 5JEAJ 5DEHA 1EIGA 4BBSH 2DNEA 1FYCA 1STBA 1XNQQ 3S1QH 3H91A 1IBKQ 1FGBD 2R92G 3H94A 1YNJD 3AB9A 1CA5A 2VL6A 3S1QB 5IYBH 2KA7A 1J9OA 4FP5D 1ONLA 1GXDC 4RA8A 4B9WA 4JI8L 2A68D 1GUWA 4ODGA 1HNXQ 1HXYD 4K5WA 3PMFA 3IFTA 1I94L 3JAMi 1STAA 5JVG3 5M3MH 1CKMA 2E2HH 1PYBA 2Q2HA 1VQ8A 2VNUD 4LFBL 2VQEQ 2N49A 5CBAE 3U9SA 2F0TA 1SJED 2EJGC 2KCTA 1VQ5A 1S5FD 3NWTA 5I9PA 1YVCA 1JOQA 1PTOC 5EAYA 4C3IB 3S2HH 1HR0W 3RZOB 1B9NA 3PIO3 1FJGQ 1A0IA 1V1QA 5C4JB 1MGSA 5BR8Q 3PUYA 1DD2A 1PH8A 1XTDA 2AKWB 2DN8A 1PH6A 1IBML 5E4XA 1YJ9A 1RDPD 2C5CA 4K14A 2EZVA 2E8GA 3TRZA 4GOPC 1V1PA 2VS1A 4PZ7A 1PFNA 3HGBA 2JQOA 1C48A 4RGMA 1NAPA 3FRPB 4R4CA 2A69C 3BDCA 2NWGA 1OTCA 1E24A 5D3IB 4A3DB 1SYEA 1PH3A 3OIQA 1AN8A 4PMBA 1BCPB 2Q2UA 2KCCA 1MHWC 2L9HA 1NR4A 3HOYB 5ELDA 1IKLA 2IL8A 3SVMA 1E2VA 2NVYH 2C35B 4K6DA 5C0XJ 1XX8A 2O5IC 2QW7A 5FJ8H 5IODA 2D62A 4DK1A 4LF9L 5CV7A 2B2UA 3CPFA 2OWOA 1DONA 2PZTA 3A8KE 3ULJA 1BUVT 1FNUA 2QDBA 4AYBE 2I07B 4DV2Q 1SFOB 3STBD 1ZXTA 4GN3B 5EBCA 5M5YH 3PCOB 1SNDA 2RA4A 3N52A 1PRTF 4ZRZA 2B2VA 1VQFA 3ITPA 4JW0A 5FK9C 5I4DA 4JI4Q 1KDAA 5LL6S 4UY8C 2JA8B 2Z8LA 4JI6L 3RLOA 2NN6H 2JYOA 1CM9A 2A8VA 2RSOA 2OQKA 1EOVA 1A6XA 4FF4A 4DR1L 1F9PA 1L2FA 4A75A 1O7IA 3VR4A 5KGUA 3OTOQ 1XMOQ 2IWHA 4C2MB 3PV0A 2EIFA 1I94Q 2VQFQ 1QZHA 2WB1B 1BR9A 2I5MX 3U4ZA 5LMUL 3CMAA 1EFWA 3P1HA 3H0GB 2MHVA 3HOVG 2CH4A 1T5XD 1BCPC 1VMPA 5I6WA 1K8GA 1X54A 5DM63 4C3HG 1AZQA 1BNZA 1QNKA 4IOAA 2E2HB 4KJOA 5M3FG 5BN5A 1AFPA 4GNXC 4IUUA 4QUCA 3G4SA 4PQXA 3E3XA 2JA7G 3NEMA 3R3OA 5K5PA 3TBIB 1PH2A 3FMCA 1HNZL 2K6AA 1LLRD 3A74A 1IW7D 1WTOA 2XRQD 1ASZA 1GHJA 2FINB 1STYA 1CQFA 3L2PA 3EFXD 4E6IA 1BXTA 4GLVB 1JB7A 1GOZA 2AWOA 2WKDA 4IUVA 1Q82C 1SEBD 3HOWH 2KVMA 4IFDG 1IYVA 3TS0A 4CDEC 2E76C 4JV5L 4DKAC 1BVSA 1STGA 4X3TA 3A8IE 3IAYA 4JI7L 4G4KA 4JK1C 1Y8NB 2GA4B 5JJKA 2OF1A 2ZTDA 1S40A 5CV4A 1XMQL 2FJ2A 2N8NA 3DMUA 1TWGH 4DR7Q 4KI0A 3NHHA 2ENBA 3J80c 4DR1Q 3AQQA 1EU4A 2G9HD 4POFA 3SK5A 1M1KC 3M4OB 2RHQB 2F0FA 1ASYA 4R4IA 3PO2H 2MP1A 4HCSA 2XWJB 3VYTA 3GTLH 1AE2A 1D1IA 3GTQB 4JVZA 1DZ1A 1B3QA 3I91A 3KBGA 3DWAA 2R6GA 3HOXH 2BE5C 5GADC 1GUGA 1TWAH 3P7JA 2FXQA 2FMMA 3OW7A 4L5QA 1PZJD 4X66L 1VMCA 4O42A 3L3OC 3B6YA 2XGTA 3A7LA 4DXFA 4DAMA 1ESRA 5DM73 4DF7A 1SR3A 3D4RA 4MN3A 3TP7A 1EQTA 1RCVD 2A6HC 1X32A 1PXUA 1N34Q 3K7UC 1L1OB 1BKBA 4CDCC 3GTPH 1TY2A 1JC7A 1X3GA 1LT6D 2EXDA 2MJ8A 2LS01 4ZYSA 1PTOF 3QO2A 4AIMA 2JXMB 2GVAA 3A0JA 1I4HA 3S14H 4JYAQ 2KQ3A 3IRBA 5D3DA 1JORA 3CC4A 2IX0A 1FR3A 4C56C 4I7AA 3TDQA 2F4IA 1V1PB 2YYZA 4ZCKA 1HFGA 5GROA 1NUCA 1E22A 1KDBA 2J0TD 2R7FA 5H1SE 4AH6A 1X9NA 1JJCB 1Q12A 2Z4HA 2CQAA 3GD7A 4JI2L 4A3EH 3E0EA 4GN5A 3FDTA 4KKTA 3D4DA 3RD4A 2I46A 3RLFA 1O7ZA 3HEJA 1EYCA 1IYJB 2R92B 1MI2A 2B29A 3JAML 3OPOA 2E5LL 5IP9G 3C3LA 4FDBA 5AJ3Q 2MO0A 3FPUB 4RMFA 2Q2TA 3M4YA 3QB3A 3HKZB 5FLMG 4C3JG 4X66Q 4IPHA 5A2QL 1K8AC 1LYLA 1TY0A 3K8AA 4CGYB 4X62Q 4B9XA 2JA5G 2XVSA 2F0IA 1ENCA 4NXML 4YIJA 3S2DH 2RVLA 4IZ8A 1D6EC 3LWEA 4L63B 4X64Q 3KBXA 4FYDA 3SE0A 4YWKA 1RIPA 5E3FA 1Y1WB 3I55A 2DUDA 1D2BA 3VDYA 5EKKA 2AMCB 4WRDA 1VQ7A 3DLLA 4L5RC 4GKJQ 4DPGA 4JOIC 5D14A 4CKEA 2L4NA 4RCOA 4TSSA 1AZPA 5JOBA 3HKZE 3MTSA 1FJGL 5FLMH 1II3A 4B3RL 2H5XA 4JV5Q 1VQPA 4FO2A 4XQQA 1PFSA 1JJ2A 3SK6A 3F2CA 1IKMA 1P16A 3HOVH 1A62A 1KXLA 1KAWA 4DNTB 4A3BG 4KY6A 3ER0A 1TQOA 1IBKL 1XXGA 1U4LA 3I4OA 4OHJA 5CYUA 4QQBX 1KC8C 3VR6A 1HR0Q 1Y1VH 4G7OC 5LMNQ 4GOPB 4OO1G 1STEA 4HJ8A 2EE1A 4RFBA 2IT1A 4P74A 2OXPA 1OXVA 2QKIC 4DV5L 3PUZA 4DN4M 1G2SA 4CHTB 5K36H 2KEDA 3MXNB 5CBEE 4FVMA 3FVQA 4LUOA 5IP7H 4DUZL 1MD2D 3K80C 2F0NA 5C3WA 3MAQA 4LFBQ 4QJFA 4APVA 1VQBA 3DHQA 4A3FH 2YV5A 3J81E 4KK7A 3T4AC 3K5NA 2MPMA 5T1GA 4C3HH 3KJPA 3NQIA 1TS4A 2NYZD 2WB1E 1QG7A 4X65L 1PH9A 2NTSA 1EWIA 3ICEA 2NTTA 2K7VA 3CMEA 4R9WA 2K5WA 3NXWA 2F0WA 3I4MG 3J81L 5ELEA 4DGZA 4OIKA 2BOSA 1SSOA 4HIMA 5C44B 1Q86C 4NMZA 3G48A 3GO5A 3RZDH 4L5SA 1NMGA 2XN9C 5IP7G 2Z4IA 4TVAB 1I4GA 4XQNA 4X3KA 3L7ZC 2Y0SB 3DUZA 3D31A 3NTIA 2RCFA 1NR2A 1CI3M 2R7ZG 2NZOA 1F9QA 1H95A 2XWBB 3GV3A 5E1FA 5G3LF 3BJUA 4O2DA 1CFMA 2F1MA 2RDGA 4Y7NB 4L6TB 2LKVA 3GTQH 1S5BD 1EL0A 1TWGB 1PLFA 3G7LA 4BXXH 5GAGC 4ME5A 4J6HA 4KN7C 1TS2A 3A55A 1KRSA 1ML0D 1C7YA 2F0UA 1BDOA 4XTCS 3K5MA 1XTCD 2ATWA 4DK6C 4GLXA 3HS0C 1K9MC 3D0FA 4K5XA 4A93H 2N55A 3K58A 4C3JH 4YWLA 2B39A 4K0KL 3S15H 4P72A 3HOWB 4HMIA 3GTMB 5IGDA 1ILPA 3FKIH 1MBYA 2MQHA 2YTVA 1ZYRC 2NVTH 2ZXOA 1IW7C 4QF4A 2HCIA 4ALPA 2F0LA 4N9PA 3NTHA 4JOIA 3OSOA 2ZTCA 2MFIA 3V96A 3CQZH 3TP5A 2AHOB 3HP3A 3PO3B 2F0QA 2P5ZX 4FXGC 1EQVA 3EBEA 4JBKA 3S1MH 2CKZB 4TKOB 4ZLTF 1VF5C 4LFAL 2DGYA 1LTLA 4JC0A 3GTMH 3HZXA 3TEHB 1WFQA 1I6HB 1GVPA 4QGUA 1STNA 3F2DA 4IPCA 5HGTA 1R4QB 3HOXG 1I5FA 1YHBA 2UU9Q 3GTGH 2O5JC 3MZ5A 1NNXA 2F0HA 5ELFA 1HFNA 1SE8A 4GS3A 4A3LG 1YHQA 1U0LA 3I7FA 2K5HA 3NE5B 1WD1A 2B2WA 1EU3A 3BG3A 2OEOA 2JEBI 3R8BA 4DR7L 3W2DA 3CC2A 2NN6G 5M5WH 3CKIB 3GV6A 3DWPA 3I70A 3RMHA 1VQ4A 1PRTC 1FGUA 1U5KA 2G9DA 1IZ6A 1ZKOA 1WYDA 4LK1C 1WTXA 3PUVA 2EYOA 4DAPA 1WTQA 4EGVA 1HUMA 2AUJD 4OL7A 2UXDL 5BN4A 1X55A 3CHBD 1HZCA 1L0WA 3ULLA 5GAHC 1K83B 1MIUA 4DR4Q 3HKSA 1YNNC 5AFWA 5C3EG 4BY7B 5G3LD 1C0AA 1B7YB 1SN8A 1AE3A 2CHBD 2EYFA 2N88A 2PZWA 1STHA 3T53B 3EROA 3TP8A 1SNOA 4LFCQ 3I4LA 1OXXK 4AQYL 3BU2A 2PQAA 1SNCA 3FHWA 3S17H 2JE6I 4J8QA 3QIAA 1HTLD 3A54A 3HOYH 2KECA 1LTID 2KEEA 3GDEA 1RD9D 1NTGA 1JOKA 3S1RH 1YITA 2VXWA 3BVGA 5K36G 4DR3L 5FJ8G 5JJIA 1QCBD 3NBIA 4AYBG 2R7ZH 4S3SA 3CP0A 1K8OA 1VQMA 3KJOA 4LF7Q 1PYSB 3CF5A 1KRTA 1PTOH 1T5EA 4JI7Q 2K50A 1Y1VG 3GTOH 2ES2A 4DV6L 1X3EA 2NN6I 2PI2E 2PW5A 1QUQB 4RGOS 3TN2A 4HCEA 2PI2A 3MXNA 4NB3A 3IL8A 1XYIA 1BCPD 2NVXH 2EDGA 3NBHB 3RN2A 4FXDA 2VUMB 1K3RA 5J39A 1ICWA 5M3MB 4NXNQ 1N8RC 4JPBW 2X6LA 2KOLA 2N3SA 3HOUB 4LWCA 1EUJA 1YNJC 4A3GH 2AWNA 4GKKQ 1N36Q 4DK3C 5KNDA 4OX9Q 2IPKD 1S5DD 3OHXC 4A3KH 1Q46A 1SMYC 2CH4W 1U4RA 5C5LA 2ZM6L 1V43A 2B2YA 1VCIA 1ENFA 2IHFA 2ZXPA 1EQQA 1XMOL 3MC0B 1YJNA 4LNQA 1H9JA 2KENA 1A2UA 2EOTA 3CQZB 4A3BH 2CWPA 1AW7A 2UU9L 2QCPX 1CTMA 1S3OA 1GM5A 4U673 4FXKC 4BBSB 3UDGA 4UHVA 5M5XH 1EYGA 3S24A 2E75C 4RKLA 4GKJL 2KHSA 3K7AB 1VQDA 4DR4L 2JJQA 2B2UC 5JJLA 4KD4A 4IJLA 2H1EA 3HKZG 3MA2B 4C3JB 2QILA 3FKIB 4ULLA 4C1NI 3SEBA 2VQEL 1KABA 2VZAA 2NVQH 3AMUA 5IGBA 3Q8DA 3M9BA 4YCVA 2B2TA 2UXCQ 2F0PA 2D0PA 2NZHA 2QA4A 4A93B 2EYHA 2A6EC 3VYUA 5EGTA 3SK4A 5IGFA 1SMYD 3NPPA 3LWUA 5C44G 5EPKA 2HDLA 4HIKA 3NTKA 3CCSA 1J5EQ 2PMZE 1P8LA 1TWCH 3GTKH 4A3MB 1JB3A 2KBNA 3K0XA 3KLWA 1ET9A 1BBUA 2WINB 1KIXA 1XWEA 2RHSB 2R93H 5IYDH 2F52A 1LTSD 1U9RA 3UDXA 2R7ZB 2EYMA 1X3PA 4DV7Q 2BA1A 2V4DA 4DV3L 5C3XA 2E74C 3PIPA 2BH2A 4A3IB 1EY9A 1IL8A 3K5LA 2QF7A 2WAQE 1PZID 1T9HA 2JA5H 4YY3Q 1Q1EA 4EQ5A 1W6JA 1EOTA 1O80A 4IUTA 4A3BB 4BA2I 4KD3A 1PMRA 4KKUA 4B3MQ 1SNPA 4OX9L 1NSNS 2WIIB 4AYBB 1W2BA 3MXGA 1J6QA 5FLXc 1ZYRD 2A19A 2A6ED 3VYRA 3BDLA 3IKJA 2L12A 1WTRA 2H4OA 2LSSA 5ELOA 3SR1A 5M3FH 1L1OA 3EIVA 4I7ZC 4K8IA 2E2JB 4A3FB 1VF7A 4KHZA 5IYDG 1C4QA 3VA5A 3WWVA 3PF5A 4PNYA 5A2QE 4FF2A 4A76A 1PYWD 1PVOA 2A1AA 5FLXE 4NDXA 3U9OA 3A5ZB 2PW7A 4A3MH 2KUMA 5DLQE 3OMCA 2QEXA 1H9RA 1VQJA 1QE6A 5FO8B 1VQLA 1LTRD 3KLSX 1EY7A 4BY1H 2MO1A 1TIID 3NWSA 2WP8J 3DEPA 1D5ZC 2HD3A 2ZXRA 3R2TA 1B3AA 2LFNA 4A3EG 3X3MA 3RZOH 4DR3Q 3W3AA 3S2HB 1L0YB 1TS3A 5J3BA 2OCEA 1PA6A 2UXBL 4BXXG 4LJZC 2PMZB 3MWYW 2F0EA 4DR6L 1X3QA 1IBLQ 2K33A 1Q90A 2AQ3B 1JICA 4QY7A 4AQYQ 2ZM6Q 4BBSG 1A3VA 5HY6A 2OT2A 1GUTA 1I3QB 4JI5Q 2K32A 4DV1L 1JE5A 3F8TA 2JEAI 4XT3B 2ZJPA 4BY1G 1D5XC 2A6HD 1QVCA 2F0VA 1NBWA 4JI0L 3CCRA 2A68C 1F9SA 1DCZA 1TWHH 3FKIG 1UAPA 1S5ED 4P75A 1N32L 2EY1A 4K5VA 5IWAQ 4LF5Q 1GO3E 4HJAA 1LTBD 1Y1WH 1HZBA 4X6AH 3ONAB 4R8NA 2I0QA 4B3ML 4ZKCB 4K8JA 1GKHA 4OGQC 2YU9B 2B3GA 2O4XA 4C3IG 2R3ZA 5KNCA 1PV4A 2DY7A 1JWMD 3L0OA 2E2IB 3EA6A 3CW2C 2K1BA 4IO9A 3Q24A 1LM0A 3CAMA 2PNHA 2B63G 2PO4A 2NVXB 2K03A 4PMCA 1EWHA 1RJTA 3DWQA 4UPAA 5C4XH 1MJEA 4K2KA 4M1UB 1I50B 5T1IA 2PZUA 1YIJA 1WJJA 4X3UA 1XPOA 3G6JB 2ASBA 1K0SA 4IN3A 4DNIA 3OYYA 4NW2A 4HN7A 2K14A 4OEMB 4JI1L 4A4IA 1RTOA 3P20A 4LF7L 1G8ZD 3I56A 4HSPA 4DV3Q 1W6KA 3AYHB 5CC4A 2DNCA 2WACA 2SOBA 5C0XG 5FO7B 1WCMB 1VQGA 1TWHB 1VDZA 2ICEC 3RR5A 1RF2D 3S1RB 1L0XB 1HNWQ 5JPMC 3S1MB 1QILA 2TMPA 1Q7YC 1X6OA 3CCEA 4BBRH 2A5HA 3PIOA 1I3QH 4A3FG 3KFUA 3JC66 3O13A 1OXUA 1CHQD 1HH2P 5C4ZA 1CT1D 2VUMG 2L11A 4A3GB 3K5OA 5M3MG 2F3WA 5KYLA 2SNMA 3E0JA 4UP7A 3BYYB 5JJZA 3MFGA 1E2ZA 1VQAA 3OW2A 1LTAD 3U50C 1K3BC 1EZ8A 4GZYC 4DR5Q 1HR0L 1CKOA 4JI8Q 4R4TA 3DEOA 4LMQD 3VR2A 2QDLA 1LUZA 4JI3Q 1TWCB 1PH1A 1PH7A 1SNQA 1JCKB 5EPJA 1B53A 1B44D 1H9SB 1LT5D 3S1NH 3KK7A 1A8VA 4JG2A 2HCCA 1HA6A 1YNXA 3S1NB 1EWCA 1F2ZA 5AJ3L 3J7AF 4QIWB 4BY7G 2PPBC 3Q6SA 1EY8A 3VR3A 1E1OA 2ZT9C 1HUNA 5M3FB 4K6LA 4NP5A 3NP8A 1IBLL 1GHKA 1OXTA 4G7HC 3F2UA 4JI2Q 3Q23A 1M8AA 4I65A 4DAYA 4RGTA 4ZQ3A 4NXNL 4MHEA 2AUKA 4V190 1SE3A 3S17B 2ALYB 3A5UA 5COYA 1E2WA 4R4QA 3MHBA 2K4KA 4P71A 4H44C 5F2DA 4XYOA 2R61A 4YWMA 1YEZA 5IGEA 4A93G 1KNEA 1SBBB 2J4XA 3OTOL 2M00A 1XNRQ 5CV9A 1WTWA 1M90C 3A8JE 4Y52H 1FL0A 1Z9FA 1EEFD 1EYAA 1KTKA 2Q2IA 2RQXA 3KOJA 1HHVA 4IALA 3ND9A 3M85A 2KHJA 4A3MG 1WVLA 1CHPD 1RKNA 1BO0A 2MNAA 3C1FA 4KTAA 4PZ8A 1WCMH 1UE6A 4A3KB 1O78A 2EYPA 1B8AA 2Z6KA 5C3EH 1EFID 3BZDB 4DR2Q 4HIDA 2I5LX 2CWAA 4P2CB 4WJ3M 2F0GA 2A74C 1N36L 1CKNA 2ZJQA 2IW3A 4JBJA 2B2TC 5M9OA 2EYLA 1TWFH 2JA8G 4IJHA 4N8X1 3K6OA 4EQOA 3T1HL 1HNZQ 3HG9A 4POGA 1HTPA 1HA5A 3TZUA 3VA7A 1EYDA 2KHIA 3F1ZA 1XNQL 2Q8RE 4JCVE 1Q8IA 1SJHD 5D65A 1I4XA 3HOZB 2F4VL 1ZEQX 4DUYL 3T13A 2QGQA 1PTOB 3MEFA 3CRKC 2F03A 2NB0A 1WCMG 3ERQA 1LACA 2VY3A 3EJIA 1CSQA 4HAEA 1GUSA 1S72A 1J5EL 5IE8A 2KCMA 2HIXA 1HPCA 1EY5A 1MSGA 2L1BA 2Z6BA 4LFAQ 2XNAC 3HOVB 1U4MA 5GQOA 1PZKD 4NPSA 5EQ0A 2RBMA 5E4WC 1D7QA 1DXMA 3J7YW 1Q8KA 3FP9A 1QJOA 4B3TQ 1GD7A 3BYTB 5EBDA 4ZUJA 4JI4L 4X65Q 2JA8H 2BDNA 4WJ4A 5ELNA 1KLUD 4GLAC 4A3CG 5LHY1 2M9VA 4TRDA 2EQSA 4DAYB 1PFMA 1DM0B 3RN5A 1XPUA 1B70B 5EKLA 4OXPA 2EY5A 3LGJA 2B63H 1KHIA 1CZWA 1LTGD 5IT9E 4QCLA 4QMGA 1TS5A 2PCFB 2JA6H 4JBMA 1BCPF 4Q5VA 2WAQB 4F88A 3KF6B 1DGSA 2VUMH 3DM3A 4C1NK 5J1ZA 5JVH3 1QVGA 2RDHA 1LV9A 3NK9A 1R9TB 3SXHA 2F3IA 3CRLC 4Q0FA 4CJ2C 3UE1A 2IY5B 2EYJA 1TWAB 4KLKA 2C9OA 2K5VA 3GP7A 1JR0D 4JBWA 1SE2A 4NKLA 1EIFA 1KDCA 5M5WB 1CUKA 4BY1B 4EQNA 1S5CD 3AU7A 3OWEB 4A3IG 4PV1C 3W5OA 4A3CH 3I8ZA 4OWXB 1Q3LA 1GJXA 5IOCA 1KNAA 4RAUC 1A3UA 1FNVA 2K75A 3I72A 4P73A 4LF6Q 1PDQA 3C46A 2B8GA 5ELBA 3GTGB 1Y8OB 4DR5L 1R9TH 3M7NA 4YCWA 1O7LA 4MZ9A 1KL9A 4G57A 4IPGA 3RLNA 3NENA 5E7NA 3FEWX 5LL6X 3A7AB 4X62L 2CFMA 1IBMQ 2F0JA 2SNSA 2J7ZA 4RGNA 2SEBD 5C44H 1Y1WG 5CV6A 3TS2A 2B63B 3S14B 3J80E 5CV8A 4A3JG 1C9OA 3CU7A 1G291 1MKHA 3T16A 4CDDC 2PQEA 3KF8A 1B9MA 4JI5L 1K83H 1HZ9A 4RH6A 2KCNA 1QVFA 1G91A 4O0AA 3U4VA 1EY4A 1KQSA 4HJ9A 1OXSC 4K2LA 2K04A 4BWGB 3S9WA 4DR6Q 5FO9B 4UDUC 1CSPA 4ID6A 2UXBQ 1NMFA 1B50A 1QZGA 1K0RA 1JWUD 1PH4A 4JI6Q 1UWVA 4GNXA 3GQBA 1F2YA 3ULPA 4CBVA 4ILWA 1G6ZA 3IFDA 3OOCA 4B3SQ 1V1OA 4DV2L 3M4OH 3J7AV 3H6MA 5KNBA 4A3JH 4RCNA 2D0OA 2VB3X 4M8AA 2A73B 1SXTA 1I6VC 4YHHL 1WTVA 2JN4A 4KHPL 3CD6A 5BR8L 4L8JA 4A3GG 1D5MC 1KAAA 5FLXL 1Z47A 2R92H 3BZCA 2JA9A 3G6EA 1F9RA 2BH8A 5C4XG 3J81i 4B3RQ 2CW0D 3K7AH 4CJ1B 4HJ5A 4CKCA 1PFBA 5IGCA 2UUAL 2K28A 5TSSA 4A3LH 2HQEA 3OMGA 4LW1A 3JAMc 2M2LA 1W3SA 4ME3A 5M5YB 4KY5A 3ZJYC 3I4MH 1EIHA 4YCUA 2WAQG 3QG1A 5IT9c 4R8IA 4HTHA 1VS0A 2DY8A 3BVMA 4DK0A 4DV5Q 1B2TA 1EY0A 3KLSA 5IIFA 1EEID 2NVTB 1X56A 4KHPQ 1NE3A 2B2WC 1UE7A 1WTHA 4ZKBB 2Y0SG 3J7ZC 3GTJH 2EY2A 3QWNA 1YBYA 2HIVA 2L15A 2JK8A 3PSIA 2JA6G 2BDOA 3H3VH 3I2ZA 4BS9A 3K59A 1O7YA 3MXPA 1XNRL 3NSWA 1Q81C 1H9SA 1BBXC 1K8MA 2IX3A 4DXGA 3N6RA 2PYKA 2K5QA 4IFDH 4HR7B 1JQYD 2LXKA 1YZ6A 2CW0C 3E5SA 4IUQA 1WD0A 2AQ2B 3GTLB 3CCLA 1CQVA 1JMCA 2TSSA 3CCMA 3GTOB 2NBFA 3L9AX 5JAVA 5BN3A 2R93G 3R93A 1U4PA 4IUPA 1SYFA 4CDFC 4XYQA 3Q0AA 3MEHA 1FD7D 3D4WA 3C2PA 1H9MA 5HURA 1QNUA 3CXCA 4A3KG 1MSHA 3NELA 2CCZA 3Q22A 3HOWG 4ZK9B 3PF4A 4CKBA 1X3FA 3FPPA 4V0BA 1IYUA 1JWSD 1QWYA 2G5DA 2E2JH 3PO2G 2XSCA 5IYBG 3MVVA 1ILQA 1LO5D 5IY0A 3HFZB 2RSNA 1N33Q 2F4VQ 4RG1A 5JPNC 1TKWB 2RF4A 2K01A 5A35A 3AFQA 1FNWA 1VQNA 3M3YB 3GTJB 3PO3G 3URYA 3GTPB 2EXZA 2UUAQ 1SLJA 4KHVA 1UUPA 1Y69U 4LF6L 3HOZG 4B3SL 3W1BA 3RNUA 3M4PA 3EQLC 1WOCA 1CZGA 2LY7A 4DV7L 3I4MB 1HZAA 2LMCB 3J81c 4YY3L 2BA0A 1QB5D 4XQJA 4A3IH 4OIJA 3KDFA 4BBRG 2F0SA 4U68A 4B08A 1VQ9A 3DM1A 4YHHQ 2VB2X 1F2MA 4MTKA 3HOXB 5EKIA 1YI2A 4KMUC 5C0XI 4JI1Q 3TREA 2UUBL 3PUWA 2K52A 3SHLA 3GTKB 3CCVA 4LUZA 3ND8A 1JJGA 4X64L 3UDIA 2WV6D 2IHEA 2EY6A 5FOBB 4DV4L 2O2LD 5C4XB 4RWSC 3TQYA 1DOMA 1HQMC 2ID0A 1VQHA 3WDNA 3HOZH 1DYQA 1ICFB 5I6YA 4C3IH 1SE4A 1TWFB 5GAEC 1N34L 2NUCA 2UUCQ 2WKCA 1SYBA 2GVBA 4R4OA 4C2MH 2HDMA 1SYCA 2ICIA 3TP6A 3TSSA 4LAAA 3KLRA 3E9IA 3HRZC 2BCOA 4H0LC 2V1CC 2DJFC 1G51A 1HNXL 1K73C 1SYGA 3UE0A 4KKSA 1PTOD 4MNOA 1GUOA 2EJMA 5C3EB 3H09A 2FMCA 4KY7A 1TXYA 2MUYA 3ERSX 4ZUIA 1UEAB 4DV4Q 5M5XB 4B3TL 4OONA 3D8GA 3LX0A 4KV6A 4Z9CB 4PG3A 1B4OA 3VYSA 2HHHQ 4GNXB 1IL2A 3BVZA 2UXDQ 3OWFA 5LMNL 3KDFB 3D6WA 1UEBA 2AQ1B 5IWAL 5KEEA 4H7BA 3S2DB 3RUZA 3M3YH 3VR5A 2K5DA 3V05A 5DAUA 3X3NA 4JYAL 1UNSA 1LABA 4QUFA 3R2IA 5I2YA 3BS1A 2Q8TA 3HOUH 5L37A 3H15A 3AFPA 4DUZQ 1BF4A 3HOYG 3KF8B 3CCJA 1VQEA 4HIOA 3A56A 4A3DH 4UP8A 1EIYB 2PNRC 4HEDA 4RKBA 4IFDJ 1I4QA 1A63A 1IHZA 1ENAA 2Z6KC 1H9KA 4DAVA 1GUNA 2N78A 1LTTD 1DOLA 1DJRD 3S16B 4PZ6A 4H13C 4GN4B 2K05A 4Y7NH 1C8CA 4NXMQ 4MIUA 2F0KA 3CC7A 1K28A 2EJFC 2ZTEA 2X69A 4HMJA 1JOOA 1D1KA 4LFCL 3QOLA 5C4JH 4DNRB 1YNND 4LF8Q 5JEAG 3UI2A 2VW9A 3KUPA 5C5MA 1VQCA 4O1NA 3HOUG 2JA7H 1LT3D 2PQAB 4WORA 3RZDB 1XJVA 5LMUQ 5NUCA 1HNWL 2F0MA 5DNFA 3M4QA 1VQKA 1V8QA 3BZKA 1Y8PB 3F2BA 1B1ZA 1L1OC 2NZ1D 5ISRA 2RDFA 4J1MA 3H0GG 2D9UA 4X3SA 1SDFA 4BBRB 4DV0Q 5EJWA 4H02A 2NVYB 5CV5A
chains in the Genus database with same CATH topology
1RHPA 1NCVA 2IX1A 1F77A 4C3HB 1I4RA 2L0CA 3J80L 1AEXA 1A3TA 5C4HA 3LNNA 3P75A 1HCZA 4EVOA 4BA1I 3E6ZX 3I3CA 1R4PB 2RKSA 5CMDA 3I4NB 1EZ6A 4F8MA 1BOSA 2Q8IB 2A69D 1Z6HA 1EY6A 4A3JB 3PIP3 3PUXA 1Y1VB 2XRSD 4ZAIA 4OO1H 5IGGA 1LT4D 2JP1A 5J22A 2F0DA 2FFKB 3QOJA 3C1EA 4KN4C 1TR5A 4RHSA 5KRUA 3T51B 1S4ZA 4QB4A 3T56B 1Z7TA 1WTPA 1HRJA 5EPLA 3SK8A 3ZYYX 4IURA 4HSVA 4DU9A 3MFYA 4PMWA 1SNMA 3BDOA 2B2YC 3TZDA 1M4VA 3NBHA 2SDFA 5CORA 1DOKA 1E0BA 3S15B 2EPBA 4EQPA 2IJ0A 3WOFA 5CGKA 4WFN3 1PRTB 4G7ZC 2JA7B 5C6AA 4DA2A 3D3RA 1CA6A 1G2TA 5CR3A 4A3EB 3TMEA 5FKAC 2L5TA 3MXUA 5IT9L 1CK1A 5JEAH 1HQRD 1BQQT 2B8FA 1A15A 2KJXA 3V2TA 4XDXA 4IUNA 4F87A 5KYIA 5ELCA 1RODA 4RHRA 2JA6B 1OO9B 4F7XA 3SDZA 4XIGS 5KIXA 2D5DA 1TT2A 2Z1CA 4FNFA 1TVXA 2XIWA 2JSOA 5I2XA 1J8IA 2X6GA 3K0YA 4OO1I 2JA5B 1RTNA 1ESFA 2F0OA 4IFDI 4KJNA 3K57A 1SYDA 4ABNA 3NQTA 4FF3A 1F2LA 4WJWA 1JE4A 3I90A 3WOEA 2MGSA 1KLGD 4XXEA 2R93B 2CVRA 1TU2B 1Q1BA 4UAIA 2HUGA 2QEJC 1I4PA 2B2VC 2EVBA 3H3VC 3I73A 3M7GA 4CJ0B 2BE5D 3PO2B 2F3VA 1SAPA 3NUCA 3EVQA 4DFAA 1ET6A 1AP0A 1PRTD 3JAME 2L55A 2D2CC 5I9OA 1A2TA 4TQUS 2E2DC 4N9TA 2NVQB 3DXJC 4IQZA 3QJYA 1QOHA 2FHTA 4XT1B 4FF1A 5C0XH 3D6CA 3OIPA 5JEAJ 5DEHA 1EIGA 2DNEA 1FYCA 1STBA 3H91A 1FGBD 3H94A 1YNJD 3AB9A 1CA5A 3S1QB 2KA7A 1J9OA 4FP5D 1ONLA 1GXDC 4RA8A 4B9WA 2A68D 1GUWA 4ODGA 1HXYD 4K5WA 3PMFA 3IFTA 1STAA 5JVG3 2VNUD 5CBAE 3U9SA 2F0TA 1SJED 2EJGC 1S5FD 3NWTA 5I9PA 1JOQA 1PTOC 4C3IB 3RZOB 1B9NA 3PIO3 5C4JB 1MGSA 3PUYA 1DD2A 2DN8A 5E4XA 1RDPD 2C5CA 4K14A 2EZVA 1V1PA 1PFNA 3HGBA 1C48A 4RGMA 1NAPA 3FRPB 2A69C 3BDCA 2NWGA 5D3IB 4A3DB 1SYEA 3OIQA 1AN8A 4PMBA 1BCPB 2KCCA 2L9HA 1NR4A 3HOYB 5ELDA 1IKLA 2IL8A 3SVMA 1E2VA 5C0XJ 4K6DA 1XX8A 2O5IC 5IODA 2D62A 4DK1A 5CV7A 2B2UA 1DONA 2PZTA 3A8KE 1BUVT 1FNUA 2QDBA 2I07B 1SFOB 1ZXTA 5EBCA 1SNDA 2RA4A 3N52A 1PRTF 4ZRZA 2B2VA 5FK9C 3ITPA 5I4DA 1KDAA 5LL6S 2JA8B 2Z8LA 2NN6H 2JYOA 1CM9A 2RSOA 1A6XA 4FF4A 1F9PA 3VR4A 5KGUA 2IWHA 4C2MB 3PV0A 2WB1B 1BR9A 3P1HA 3H0GB 2MHVA 1T5XD 1BCPC 1VMPA 5I6WA 5DM63 4C3HG 1AZQA 1BNZA 1QNKA 2E2HB 4KJOA 5BN5A 1AFPA 4IUUA 4QUCA 4PQXA 3R3OA 5K5PA 3TBIB 3FMCA 2K6AA 1LLRD 1IW7D 1WTOA 2XRQD 1GHJA 2FINB 1STYA 1CQFA 3EFXD 4E6IA 1BXTA 1GOZA 2AWOA 2WKDA 4IUVA 1SEBD 2KVMA 4IFDG 1IYVA 2E76C 1STGA 4X3TA 3A8IE 3IAYA 4G4KA 4JK1C 1Y8NB 2GA4B 2OF1A 5CV4A 2FJ2A 3DMUA 4KI0A 3NHHA 2ENBA 1EU4A 2G9HD 3SK5A 3M4OB 2F0FA 2MP1A 4HCSA 2XWJB 3VYTA 3GTQB 1D1IA 1DZ1A 3I91A 3KBGA 3DWAA 2R6GA 2BE5C 1GUGA 3P7JA 2FMMA 3OW7A 1PZJD 1VMCA 4O42A 3L3OC 3A7LA 4DXFA 1ESRA 5DM73 4DF7A 3D4RA 4MN3A 3TP7A 1EQTA 1RCVD 2A6HC 1X32A 1PXUA 1TY2A 1JC7A 1LT6D 2MJ8A 2LS01 4ZYSA 1PTOF 3QO2A 2JXMB 1I4HA 2KQ3A 5D3DA 1JORA 2IX0A 1FR3A 4C56C 3TDQA 2F4IA 1V1PB 2YYZA 1HFGA 1NUCA 1KDBA 2J0TD 1Q12A 2Z4HA 2CQAA 3GD7A 3FDTA 4KKTA 3D4DA 3RD4A 2I46A 3RLFA 1O7ZA 3HEJA 1EYCA 2R92B 1MI2A 3JAML 3OPOA 3C3LA 3FPUB 3M4YA 3QB3A 3HKZB 4C3JG 5A2QL 1TY0A 4CGYB 4B9XA 2XVSA 2F0IA 1ENCA 4YIJA 2RVLA 4IZ8A 1D6EC 3LWEA 4L63B 3KBXA 4FYDA 3SE0A 5E3FA 1Y1WB 1D2BA 5EKKA 4WRDA 5D14A 4CKEA 2L4NA 4RCOA 4TSSA 1AZPA 5JOBA 3MTSA 1II3A 4FO2A 4XQQA 3SK6A 1IKMA 4DNTB 4KY6A 1TQOA 1XXGA 1U4LA 4OHJA 5CYUA 3VR6A 4G7OC 4OO1G 1STEA 2EE1A 4RFBA 2IT1A 2OXPA 1OXVA 2QKIC 3PUZA 4DN4M 1G2SA 4CHTB 5K36H 2KEDA 5CBEE 4FVMA 3FVQA 1MD2D 2F0NA 5C3WA 3MAQA 3DHQA 3J81E 4KK7A 3T4AC 3K5NA 2MPMA 5T1GA 3NQIA 1TS4A 2NYZD 1QG7A 2NTSA 2NTTA 2K7VA 4R9WA 2K5WA 3NXWA 2F0WA 3J81L 5ELEA 4DGZA 4OIKA 2BOSA 1SSOA 5C44B 4NMZA 3GO5A 2XN9C 2Z4IA 1I4GA 4XQNA 4X3KA 3L7ZC 2Y0SB 3DUZA 3D31A 3NTIA 1NR2A 1CI3M 1F9QA 2XWBB 3GV3A 5E1FA 5G3LF 1CFMA 2F1MA 2RDGA 4Y7NB 4L6TB 2LKVA 1S5BD 1EL0A 1TWGB 1PLFA 3G7LA 4ME5A 4J6HA 4KN7C 1TS2A 3A55A 1ML0D 2F0UA 1BDOA 4XTCS 3K5MA 1XTCD 3HS0C 4K5XA 2N55A 3K58A 2B39A 3HOWB 4HMIA 3GTMB 5IGDA 1ILPA 1MBYA 1ZYRC 2ZXOA 1IW7C 4QF4A 2HCIA 2F0LA 4N9PA 3NTHA 3OSOA 3V96A 3TP5A 3HP3A 3PO3B 2F0QA 4FXGC 1EQVA 4TKOB 4ZLTF 1VF5C 3HZXA 1I6HB 1STNA 5HGTA 1R4QB 2O5JC 3MZ5A 2F0HA 5ELFA 1HFNA 3NE5B 1WD1A 2B2WA 1EU3A 3BG3A 2OEOA 2JEBI 3R8BA 3W2DA 2NN6G 3CKIB 3GV6A 3DWPA 3I70A 3RMHA 1PRTC 2G9DA 1ZKOA 4LK1C 1WTXA 3PUVA 2EYOA 4DAPA 1WTQA 4EGVA 1HUMA 2AUJD 4OL7A 5BN4A 3CHBD 1K83B 5AFWA 1YNNC 4BY7B 5G3LD 2N88A 2EYFA 3T53B 2CHBD 2PZWA 1STHA 3EROA 3TP8A 1SNOA 3I4LA 1OXXK 1SNCA 2JE6I 4J8QA 3QIAA 1HTLD 3A54A 2KECA 1LTID 2KEEA 1RD9D 1JOKA 2VXWA 3BVGA 5K36G 1QCBD 3NBIA 4S3SA 1K8OA 1PTOH 1T5EA 2NN6I 2PW5A 4RGOS 3TN2A 4HCEA 3MXNA 3IL8A 1XYIA 1BCPD 2EDGA 4FXDA 2VUMB 5J39A 1ICWA 5M3MB 2X6LA 2KOLA 3HOUB 1YNJC 2AWNA 5KNDA 2IPKD 1S5DD 3OHXC 1SMYC 1U4RA 5C5LA 1V43A 2B2YA 1VCIA 1ENFA 2ZXPA 3MC0B 1H9JA 1A2UA 2EOTA 3CQZB 1AW7A 2QCPX 1CTMA 4U673 4FXKC 4BBSB 2E75C 4RKLA 2KHSA 3K7AB 2B2UC 4KD4A 2H1EA 3MA2B 4C3JB 2QILA 3FKIB 4ULLA 4C1NI 3SEBA 1KABA 3AMUA 5IGBA 2B2TA 2F0PA 4A93B 2EYHA 2A6EC 3VYUA 5EGTA 3SK4A 5IGFA 1SMYD 3NPPA 3LWUA 5EPKA 2HDLA 3NTKA 4A3MB 1JB3A 1ET9A 2WINB 1XWEA 1LTSD 1U9RA 2R7ZB 2EYMA 1X3PA 2BA1A 2V4DA 5C3XA 2E74C 4A3IB 1EY9A 1IL8A 3K5LA 2QF7A 1PZID 1Q1EA 1W6JA 1EOTA 1O80A 4IUTA 4A3BB 4BA2I 4KD3A 1PMRA 4KKUA 1SNPA 1NSNS 2WIIB 4AYBB 3MXGA 1ZYRD 2A6ED 3VYRA 3BDLA 3IKJA 2L12A 1WTRA 2H4OA 3SR1A 4K8IA 2E2JB 4I7ZC 4A3FB 1VF7A 4KHZA 1C4QA 3VA5A 4PNYA 5A2QE 4FF2A 1PYWD 5FLXE 4NDXA 3U9OA 2PW7A 2KUMA 3OMCA 1H9RA 1QE6A 5FO8B 1LTRD 3KLSX 1EY7A 1TIID 3NWSA 2WP8J 3DEPA 1D5ZC 2ZXRA 3R2TA 1B3AA 2LFNA 3X3MA 3W3AA 3S2HB 1L0YB 1TS3A 4LJZC 2PMZB 3MWYW 2F0EA 1X3QA 2K33A 1Q90A 2AQ3B 1JICA 1A3VA 2OT2A 1GUTA 1I3QB 2K32A 2JEAI 4XT3B 1D5XC 2A6HD 2F0VA 2A68C 1F9SA 1DCZA 1UAPA 1S5ED 2EY1A 4K5VA 1LTBD 3ONAB 4R8NA 4ZKCB 4K8JA 4OGQC 2YU9B 2O4XA 5KNCA 4C3IG 2R3ZA 2DY7A 1JWMD 2E2IB 3EA6A 2K1BA 3Q24A 2PO4A 2NVXB 2K03A 4PMCA 1EWHA 1RJTA 3DWQA 4K2KA 4M1UB 1I50B 5T1IA 2PZUA 4X3UA 3G6JB 4IN3A 4NW2A 4HN7A 1RTOA 3P20A 1G8ZD 4HSPA 1W6KA 5CC4A 2DNCA 2WACA 2SOBA 5C0XG 5FO7B 1WCMB 3S1RB 1TWHB 1VDZA 2ICEC 1RF2D 1L0XB 5JPMC 3S1MB 1QILA 2TMPA 2A5HA 3O13A 1OXUA 1CHQD 5C4ZA 1CT1D 2L11A 4A3GB 3K5OA 2F3WA 5KYLA 2SNMA 3E0JA 3BYYB 5JJZA 3MFGA 1E2ZA 1LTAD 1EZ8A 4GZYC 3DEOA 4LMQD 3VR2A 1TWCB 1SNQA 5EPJA 1JCKB 1B53A 1B44D 1H9SB 1LT5D 3KK7A 1HA6A 2HCCA 3S1NB 1EWCA 1F2ZA 3J7AF 4QIWB 2PPBC 3Q6SA 1EY8A 3VR3A 2ZT9C 1HUNA 5M3FB 4K6LA 4NP5A 3NP8A 1GHKA 1OXTA 4G7HC 3F2UA 3Q23A 1M8AA 4I65A 4DAYA 4RGTA 4ZQ3A 4V190 4MHEA 2AUKA 1SE3A 3S17B 5COYA 1E2WA 3MHBA 5F2DA 4H44C 4XYOA 2R61A 5IGEA 1KNEA 1SBBB 2J4XA 2M00A 5CV9A 1WTWA 3A8JE 1EEFD 1EYAA 1KTKA 2RQXA 1HHVA 4IALA 3ND9A 3M85A 1WVLA 1CHPD 1RKNA 1BO0A 3C1FA 4KTAA 4A3KB 1O78A 2EYPA 1EFID 3BZDB 4P2CB 2F0GA 2A74C 2IW3A 2B2TC 5M9OA 2EYLA 3K6OA 4EQOA 3HG9A 1HTPA 1HA5A 3TZUA 3VA7A 1EYDA 2Q8RE 1Q8IA 1SJHD 5D65A 1I4XA 3HOZB 1ZEQX 3T13A 1PTOB 3CRKC 2F03A 2NB0A 3ERQA 1LACA 3EJIA 4HAEA 1GUSA 1HPCA 1EY5A 1MSGA 2L1BA 3HOVB 2XNAC 1U4MA 1PZKD 5EQ0A 5E4WC 2RBMA 1DXMA 3J7YW 1QJOA 5EBDA 3BYTB 4ZUJA 2BDNA 1KLUD 5LHY1 2M9VA 4TRDA 1PFMA 1DM0B 5EKLA 2EY5A 1CZWA 1LTGD 5IT9E 4QCLA 4QMGA 1TS5A 2PCFB 1BCPF 4Q5VA 2WAQB 4F88A 4C1NK 5JVH3 5J1ZA 2RDHA 1LV9A 3NK9A 1R9TB 3SXHA 3CRLC 4Q0FA 4CJ2C 2EYJA 1TWAB 2C9OA 3GP7A 1JR0D 4JBWA 1SE2A 4NKLA 1KDCA 5M5WB 4BY1B 4EQNA 1S5CD 3AU7A 3OWEB 4PV1C 3I8ZA 1Q3LA 1GJXA 5IOCA 1KNAA 4RAUC 1A3UA 1FNVA 3I72A 1PDQA 3C46A 2B8GA 5ELBA 3GTGB 1Y8OB 3M7NA 1O7LA 4G57A 3FEWX 5LL6X 3A7AB 2F0JA 2SNSA 2J7ZA 4RGNA 2SEBD 5CV6A 2B63B 3S14B 3J80E 5CV8A 3CU7A 1G291 3T16A 2PQEA 3KF8A 1B9MA 4RH6A 2KCNA 1G91A 1EY4A 1OXSC 4K2LA 2K04A 4BWGB 3S9WA 5FO9B 4UDUC 4ID6A 1B50A 1JWUD 3GQBA 1F2YA 4CBVA 4ILWA 1G6ZA 3IFDA 3OOCA 1V1OA 3J7AV 3H6MA 5KNBA 4RCNA 2VB3X 4M8AA 2A73B 1SXTA 1I6VC 1WTVA 4L8JA 1D5MC 1KAAA 5FLXL 1Z47A 1F9RA 2CW0D 4CJ1B 4CKCA 1PFBA 5IGCA 2K28A 5TSSA 2HQEA 3OMGA 2M2LA 5M5YB 4KY5A 1EIHA 3QG1A 4R8IA 4HTHA 3BVMA 2DY8A 4DK0A 1B2TA 1EY0A 3KLSA 5IIFA 1EEID 2NVTB 2B2WC 4ZKBB 2EY2A 3QWNA 2BDOA 4BS9A 3K59A 1O7YA 3MXPA 3NSWA 1H9SA 1BBXC 1K8MA 2IX3A 4DXGA 3N6RA 2PYKA 2K5QA 4IFDH 4HR7B 1JQYD 2CW0C 3E5SA 4IUQA 1WD0A 2AQ2B 3GTLB 1CQVA 2TSSA 3GTOB 2NBFA 3L9AX 5JAVA 5BN3A 3R93A 1U4PA 4IUPA 1SYFA 4XYQA 3Q0AA 3MEHA 1FD7D 3D4WA 3C2PA 1H9MA 5HURA 1QNUA 1MSHA 3Q22A 4ZK9B 4CKBA 3FPPA 4V0BA 1IYUA 1JWSD 1QWYA 2XSCA 3MVVA 1ILQA 1LO5D 2RSNA 5JPNC 1TKWB 5A35A 2K01A 1FNWA 3M3YB 3GTJB 3URYA 3GTPB 2EXZA 4KHVA 1UUPA 1Y69U 3EQLC 1CZGA 2LY7A 3I4MB 2LMCB 2BA0A 1QB5D 4XQJA 4OIJA 2F0SA 4U68A 4B08A 3DM1A 2VB2X 1F2MA 3HOXB 5EKIA 4KMUC 5C0XI 3PUWA 3SHLA 3GTKB 3ND8A 2WV6D 2EY6A 5FOBB 2O2LD 5C4XB 4RWSC 1DOMA 1HQMC 2ID0A 3WDNA 1DYQA 5I6YA 1SE4A 1TWFB 2NUCA 2WKCA 1SYBA 2HDMA 1SYCA 2ICIA 3TP6A 3TSSA 4LAAA 3KLRA 3HRZC 2BCOA 4H0LC 1SYGA 1PTOD 4KKSA 1GUOA 2EJMA 5C3EB 3H09A 2FMCA 4KY7A 2MUYA 4ZUIA 1UEAB 5M5XB 3D8GA 3LX0A 4KV6A 4Z9CB 1B4OA 3VYSA 3BVZA 3OWFA 3D6WA 2AQ1B 5KEEA 4H7BA 3S2DB 3RUZA 3VR5A 2K5DA 3V05A 5DAUA 3X3NA 1UNSA 1LABA 4QUFA 3R2IA 5I2YA 3BS1A 2Q8TA 1BF4A 3A56A 2PNRC 4HEDA 4RKBA 4IFDJ 1I4QA 1IHZA 1ENAA 1H9KA 4DAVA 1GUNA 1LTTD 1DOLA 1DJRD 3S16B 4H13C 2K05A 1C8CA 4MIUA 2F0KA 2EJFC 2X69A 4HMJA 1JOOA 1D1KA 3QOLA 4DNRB 1YNND 5JEAG 3UI2A 3KUPA 5C5MA 4O1NA 1LT3D 4WORA 3RZDB 5NUCA 2F0MA 5DNFA 1V8QA 1Y8PB 1B1ZA 2NZ1D 5ISRA 2RDFA 4J1MA 2D9UA 4X3SA 1SDFA 4BBRB 5EJWA 2NVYB 5CV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHX C;  1PXU A;  3HRZ C;  5FO8 B;  2XWJ B;  5FO7 B;  3CKI B;  2ICE C;  1D2B A;  1GXD C;  2E2D C;  3HS0 C;  5FO9 B;  3I70 A;  1JC7 A;  3MA2 B;  3FRP B;  5FOB B;  2XWB B;  5JPM C;  2TMP A;  1BQQ T;  2A73 B;  3V96 A;  1BUV T;  2QKI C;  1JB3 A;  5JPN C;  2I07 B;  3G6J B;  2B39 A;  3CU7 A;  4FXG C;  2WIN B;  2A74 C;  3T4A C;  1BR9 A;  1XWE A;  4FXK C;  3L3O C;  1UEA B;  1OO9 B;  4ILW A;  2WII B;  3KLS A;  1UAP A;  2J0T D; 
#chains in the Genus database with same CATH topology
 1RHP A;  1NCV A;  1E3P A;  3PGZ A;  2IX1 A;  3KF6 A;  1F77 A;  2VQF L;  4C3H B;  1I4R A;  3CCU A;  1HJP A;  2L0C A;  3J80 L;  1SRU A;  1AEX A;  1PHJ A;  4J15 A;  2HHH L;  1A3T A;  5C4H A;  4N8F A;  3LNN A;  3P75 A;  4LF5 L;  2Y0S E;  3STB C;  1HCZ A;  4EVO A;  4BA1 I;  3E6Z X;  3I3C A;  1R4P B;  4DV1 Q;  2RKS A;  5CMD A;  4LUV A;  3I4N B;  2HT1 A;  1EZ6 A;  4F8M A;  1KD1 C;  1UE5 A;  1X65 A;  3H0G H;  1BOS A;  2Q8I B;  1XPR A;  3T1Y Q;  2A69 D;  1Z6H A;  2YTY A;  1EY6 A;  4A3J B;  1I50 H;  3PIP 3;  3PUX A;  2UXC L;  1FVI A;  1Y1V B;  2XRS D;  4UP9 A;  1E7Z A;  4ZAI A;  4JI3 L;  4OO1 H;  3CPW A;  2Z9H A;  5IGG A;  1LT4 D;  2JP1 A;  5J22 A;  2R7D A;  1RL2 A;  2F0D A;  2FFK B;  3QOJ A;  1YJW A;  2E2I H;  3C1E A;  4KN4 C;  1TR5 A;  4DR2 L;  5LMN W;  4RHS A;  3E9H A;  5KRU A;  2YU9 H;  3KYH C;  3T51 B;  1S4Z A;  4QB4 A;  3T56 B;  2OTJ A;  1Z7T A;  1XMQ Q;  1SRO A;  1WTP A;  1CKN B;  4MTN A;  1HRJ A;  1D8L A;  5EPL A;  3SK8 A;  3ZYY X;  3T1Y L;  3PO3 H;  4IUR A;  4OWT B;  2WB1 G;  4HSV A;  1E1T A;  4DU9 A;  3MFY A;  4PMW A;  1AH9 A;  3AEV A;  2UUB Q;  1SNM A;  3BDO A;  2B2Y C;  3TZD A;  1M4V A;  3NBH A;  2SDF A;  5COR A;  3G71 A;  4LF8 L;  1DOK A;  1QUQ A;  2I5H A;  1E0B A;  3S15 B;  5IP9 H;  2EPB A;  4QL5 A;  1WI5 A;  3K81 C;  4LF9 Q;  2YTX A;  4EQP A;  2DJG C;  2IJ0 A;  3WOF A;  5CGK A;  2HQL A;  4WFN 3;  1PRT B;  4G7Z C;  2RCN A;  3J80 i;  2JA7 B;  5C6A A;  4DA2 A;  4GKK L;  1G6P A;  5IYC G;  1UE1 A;  2GN5 A;  3D3R A;  1PH5 A;  1CA6 A;  1N32 Q;  1G2T A;  5CR3 A;  1SMX A;  4A3E B;  4IPD A;  3TME A;  1JT8 A;  5FKA C;  1Y14 B;  1MJC A;  2L5T A;  3MXU A;  5IT9 L;  3I4N H;  1VQO A;  3S16 H;  1CK1 A;  4IOC A;  1EQR A;  5JEA H;  4EX5 A;  1HQR D;  1VQI A;  1BQQ T;  2B8F A;  4JI0 Q;  1A15 A;  2KJX A;  1SFO H;  4OWW B;  3J7A 5;  3V2T A;  3QR8 A;  4LF4 Q;  4XDX A;  4IUN A;  4F87 A;  5KYI A;  5ELC A;  5HGQ A;  3H3V I;  1ROD A;  4RHR A;  2JA6 B;  1OO9 B;  4F7X A;  3SDZ A;  5IYC H;  2UUC L;  1NJI C;  4XIG S;  5KIX A;  2D5D A;  1YHA A;  1N33 L;  1TT2 A;  4DV0 L;  2Z1C A;  4FNF A;  4QIW E;  4A3D G;  1TVX A;  2XIW A;  2JSO A;  1NY4 A;  2LXJ A;  5I2X A;  1J8I A;  3T1H Q;  1IXR A;  2X6G A;  3J81 j;  4BY7 H;  3K0Y A;  4OO1 I;  2JA5 B;  1RTN A;  2ZJR A;  3UDF A;  2XTI A;  2OTL A;  1ESF A;  2F0O A;  4IFD I;  4KJN A;  3K57 A;  1SYD A;  4R1J A;  4ABN A;  3NQT A;  3U58 A;  4DV6 Q;  4FF3 A;  1F2L A;  4WJW A;  3I4N G;  1JE4 A;  3I90 A;  3WOE A;  2MGS A;  1KLG D;  4XXE A;  3EN2 A;  2R93 B;  4OEL B;  2CVR A;  1TU2 B;  1Q1B A;  4K0K Q;  3PQI A;  4UAI A;  2HUG A;  4LF4 L;  2QEJ C;  1I4P A;  2Z0S A;  4GOP A;  1N9W A;  2B2V C;  2EVB A;  3H3V C;  3CCQ A;  3W1G A;  2E5L Q;  3I73 A;  3M7G A;  4CJ0 B;  2BE5 D;  3PO2 B;  2F3V A;  1SAP A;  3NUC A;  3EVQ A;  4DFA A;  4HJ7 A;  3SGI A;  1ET6 A;  1AP0 A;  2CQO A;  1PRT D;  3JAM E;  4DUY Q;  1VQ6 A;  2L55 A;  4L5T A;  2D2C C;  5I9O A;  1A2T A;  2K5N A;  4TQU S;  2E2D C;  4N9T A;  2NVQ B;  1I6H H;  1V9P A;  3DXJ C;  4IQZ A;  3QJY A;  1QOH A;  2FHT A;  4XT1 B;  1BBW A;  4FF1 A;  5C0X H;  2OQ0 A;  3D6C A;  3OIP A;  2WFW A;  5JEA J;  5DEH A;  1EIG A;  4BBS H;  2DNE A;  1FYC A;  1STB A;  1XNQ Q;  3S1Q H;  3H91 A;  1IBK Q;  1FGB D;  2R92 G;  3H94 A;  1YNJ D;  3AB9 A;  1CA5 A;  2VL6 A;  3S1Q B;  5IYB H;  2KA7 A;  1J9O A;  4FP5 D;  1ONL A;  1GXD C;  4RA8 A;  4B9W A;  4JI8 L;  2A68 D;  1GUW A;  4ODG A;  1HNX Q;  1HXY D;  4K5W A;  3PMF A;  3IFT A;  1I94 L;  3JAM i;  1STA A;  5JVG 3;  5M3M H;  1CKM A;  2E2H H;  1PYB A;  2Q2H A;  1VQ8 A;  2VNU D;  4LFB L;  2VQE Q;  2N49 A;  5CBA E;  3U9S A;  2F0T A;  1SJE D;  2EJG C;  2KCT A;  1VQ5 A;  1S5F D;  3NWT A;  5I9P A;  1YVC A;  1JOQ A;  1PTO C;  5EAY A;  4C3I B;  3S2H H;  1HR0 W;  3RZO B;  1B9N A;  3PIO 3;  1FJG Q;  1A0I A;  1V1Q A;  5C4J B;  1MGS A;  5BR8 Q;  3PUY A;  1DD2 A;  1PH8 A;  1XTD A;  2AKW B;  2DN8 A;  1PH6 A;  1IBM L;  5E4X A;  1YJ9 A;  1RDP D;  2C5C A;  4K14 A;  2EZV A;  2E8G A;  3TRZ A;  4GOP C;  1V1P A;  2VS1 A;  4PZ7 A;  1PFN A;  3HGB A;  2JQO A;  1C48 A;  4RGM A;  1NAP A;  3FRP B;  4R4C A;  2A69 C;  3BDC A;  2NWG A;  1OTC A;  1E24 A;  5D3I B;  4A3D B;  1SYE A;  1PH3 A;  3OIQ A;  1AN8 A;  4PMB A;  1BCP B;  2Q2U A;  2KCC A;  1MHW C;  2L9H A;  1NR4 A;  3HOY B;  5ELD A;  1IKL A;  2IL8 A;  3SVM A;  1E2V A;  2NVY H;  2C35 B;  4K6D A;  5C0X J;  1XX8 A;  2O5I C;  2QW7 A;  5FJ8 H;  5IOD A;  2D62 A;  4DK1 A;  4LF9 L;  5CV7 A;  2B2U A;  3CPF A;  2OWO A;  1DON A;  2PZT A;  3A8K E;  3ULJ A;  1BUV T;  1FNU A;  2QDB A;  4AYB E;  2I07 B;  4DV2 Q;  1SFO B;  3STB D;  1ZXT A;  4GN3 B;  5EBC A;  5M5Y H;  3PCO B;  1SND A;  2RA4 A;  3N52 A;  1PRT F;  4ZRZ A;  2B2V A;  1VQF A;  3ITP A;  4JW0 A;  5FK9 C;  5I4D A;  4JI4 Q;  1KDA A;  5LL6 S;  4UY8 C;  2JA8 B;  2Z8L A;  4JI6 L;  3RLO A;  2NN6 H;  2JYO A;  1CM9 A;  2A8V A;  2RSO A;  2OQK A;  1EOV A;  1A6X A;  4FF4 A;  4DR1 L;  1F9P A;  1L2F A;  4A75 A;  1O7I A;  3VR4 A;  5KGU A;  3OTO Q;  1XMO Q;  2IWH A;  4C2M B;  3PV0 A;  2EIF A;  1I94 Q;  2VQF Q;  1QZH A;  2WB1 B;  1BR9 A;  2I5M X;  3U4Z A;  5LMU L;  3CMA A;  1EFW A;  3P1H A;  3H0G B;  2MHV A;  3HOV G;  2CH4 A;  1T5X D;  1BCP C;  1VMP A;  5I6W A;  1K8G A;  1X54 A;  5DM6 3;  4C3H G;  1AZQ A;  1BNZ A;  1QNK A;  4IOA A;  2E2H B;  4KJO A;  5M3F G;  5BN5 A;  1AFP A;  4GNX C;  4IUU A;  4QUC A;  3G4S A;  4PQX A;  3E3X A;  2JA7 G;  3NEM A;  3R3O A;  5K5P A;  3TBI B;  1PH2 A;  3FMC A;  1HNZ L;  2K6A A;  1LLR D;  3A74 A;  1IW7 D;  1WTO A;  2XRQ D;  1ASZ A;  1GHJ A;  2FIN B;  1STY A;  1CQF A;  3L2P A;  3EFX D;  4E6I A;  1BXT A;  4GLV B;  1JB7 A;  1GOZ A;  2AWO A;  2WKD A;  4IUV A;  1Q82 C;  1SEB D;  3HOW H;  2KVM A;  4IFD G;  1IYV A;  3TS0 A;  4CDE C;  2E76 C;  4JV5 L;  4DKA C;  1BVS A;  1STG A;  4X3T A;  3A8I E;  3IAY A;  4JI7 L;  4G4K A;  4JK1 C;  1Y8N B;  2GA4 B;  5JJK A;  2OF1 A;  2ZTD A;  1S40 A;  5CV4 A;  1XMQ L;  2FJ2 A;  2N8N A;  3DMU A;  1TWG H;  4DR7 Q;  4KI0 A;  3NHH A;  2ENB A;  3J80 c;  4DR1 Q;  3AQQ A;  1EU4 A;  2G9H D;  4POF A;  3SK5 A;  1M1K C;  3M4O B;  2RHQ B;  2F0F A;  1ASY A;  4R4I A;  3PO2 H;  2MP1 A;  4HCS A;  2XWJ B;  3VYT A;  3GTL H;  1AE2 A;  1D1I A;  3GTQ B;  4JVZ A;  1DZ1 A;  1B3Q A;  3I91 A;  3KBG A;  3DWA A;  2R6G A;  3HOX H;  2BE5 C;  5GAD C;  1GUG A;  1TWA H;  3P7J A;  2FXQ A;  2FMM A;  3OW7 A;  4L5Q A;  1PZJ D;  4X66 L;  1VMC A;  4O42 A;  3L3O C;  3B6Y A;  2XGT A;  3A7L A;  4DXF A;  4DAM A;  1ESR A;  5DM7 3;  4DF7 A;  1SR3 A;  3D4R A;  4MN3 A;  3TP7 A;  1EQT A;  1RCV D;  2A6H C;  1X32 A;  1PXU A;  1N34 Q;  3K7U C;  1L1O B;  1BKB A;  4CDC C;  3GTP H;  1TY2 A;  1JC7 A;  1X3G A;  1LT6 D;  2EXD A;  2MJ8 A;  2LS0 1;  4ZYS A;  1PTO F;  3QO2 A;  4AIM A;  2JXM B;  2GVA A;  3A0J A;  1I4H A;  3S14 H;  4JYA Q;  2KQ3 A;  3IRB A;  5D3D A;  1JOR A;  3CC4 A;  2IX0 A;  1FR3 A;  4C56 C;  4I7A A;  3TDQ A;  2F4I A;  1V1P B;  2YYZ A;  4ZCK A;  1HFG A;  5GRO A;  1NUC A;  1E22 A;  1KDB A;  2J0T D;  2R7F A;  5H1S E;  4AH6 A;  1X9N A;  1JJC B;  1Q12 A;  2Z4H A;  2CQA A;  3GD7 A;  4JI2 L;  4A3E H;  3E0E A;  4GN5 A;  3FDT A;  4KKT A;  3D4D A;  3RD4 A;  2I46 A;  3RLF A;  1O7Z A;  3HEJ A;  1EYC A;  1IYJ B;  2R92 B;  1MI2 A;  2B29 A;  3JAM L;  3OPO A;  2E5L L;  5IP9 G;  3C3L A;  4FDB A;  5AJ3 Q;  2MO0 A;  3FPU B;  4RMF A;  2Q2T A;  3M4Y A;  3QB3 A;  3HKZ B;  5FLM G;  4C3J G;  4X66 Q;  4IPH A;  5A2Q L;  1K8A C;  1LYL A;  1TY0 A;  3K8A A;  4CGY B;  4X62 Q;  4B9X A;  2JA5 G;  2XVS A;  2F0I A;  1ENC A;  4NXM L;  4YIJ A;  3S2D H;  2RVL A;  4IZ8 A;  1D6E C;  3LWE A;  4L63 B;  4X64 Q;  3KBX A;  4FYD A;  3SE0 A;  4YWK A;  1RIP A;  5E3F A;  1Y1W B;  3I55 A;  2DUD A;  1D2B A;  3VDY A;  5EKK A;  2AMC B;  4WRD A;  1VQ7 A;  3DLL A;  4L5R C;  4GKJ Q;  4DPG A;  4JOI C;  5D14 A;  4CKE A;  2L4N A;  4RCO A;  4TSS A;  1AZP A;  5JOB A;  3HKZ E;  3MTS A;  1FJG L;  5FLM H;  1II3 A;  4B3R L;  2H5X A;  4JV5 Q;  1VQP A;  4FO2 A;  4XQQ A;  1PFS A;  1JJ2 A;  3SK6 A;  3F2C A;  1IKM A;  1P16 A;  3HOV H;  1A62 A;  1KXL A;  1KAW A;  4DNT B;  4A3B G;  4KY6 A;  3ER0 A;  1TQO A;  1IBK L;  1XXG A;  1U4L A;  3I4O A;  4OHJ A;  5CYU A;  4QQB X;  1KC8 C;  3VR6 A;  1HR0 Q;  1Y1V H;  4G7O C;  5LMN Q;  4GOP B;  4OO1 G;  1STE A;  4HJ8 A;  2EE1 A;  4RFB A;  2IT1 A;  4P74 A;  2OXP A;  1OXV A;  2QKI C;  4DV5 L;  3PUZ A;  4DN4 M;  1G2S A;  4CHT B;  5K36 H;  2KED A;  3MXN B;  5CBE E;  4FVM A;  3FVQ A;  4LUO A;  5IP7 H;  4DUZ L;  1MD2 D;  3K80 C;  2F0N A;  5C3W A;  3MAQ A;  4LFB Q;  4QJF A;  4APV A;  1VQB A;  3DHQ A;  4A3F H;  2YV5 A;  3J81 E;  4KK7 A;  3T4A C;  3K5N A;  2MPM A;  5T1G A;  4C3H H;  3KJP A;  3NQI A;  1TS4 A;  2NYZ D;  2WB1 E;  1QG7 A;  4X65 L;  1PH9 A;  2NTS A;  1EWI A;  3ICE A;  2NTT A;  2K7V A;  3CME A;  4R9W A;  2K5W A;  3NXW A;  2F0W A;  3I4M G;  3J81 L;  5ELE A;  4DGZ A;  4OIK A;  2BOS A;  1SSO A;  4HIM A;  5C44 B;  1Q86 C;  4NMZ A;  3G48 A;  3GO5 A;  3RZD H;  4L5S A;  1NMG A;  2XN9 C;  5IP7 G;  2Z4I A;  4TVA B;  1I4G A;  4XQN A;  4X3K A;  3L7Z C;  2Y0S B;  3DUZ A;  3D31 A;  3NTI A;  2RCF A;  1NR2 A;  1CI3 M;  2R7Z G;  2NZO A;  1F9Q A;  1H95 A;  2XWB B;  3GV3 A;  5E1F A;  5G3L F;  3BJU A;  4O2D A;  1CFM A;  2F1M A;  2RDG A;  4Y7N B;  4L6T B;  2LKV A;  3GTQ H;  1S5B D;  1EL0 A;  1TWG B;  1PLF A;  3G7L A;  4BXX H;  5GAG C;  4ME5 A;  4J6H A;  4KN7 C;  1TS2 A;  3A55 A;  1KRS A;  1ML0 D;  1C7Y A;  2F0U A;  1BDO A;  4XTC S;  3K5M A;  1XTC D;  2ATW A;  4DK6 C;  4GLX A;  3HS0 C;  1K9M C;  3D0F A;  4K5X A;  4A93 H;  2N55 A;  3K58 A;  4C3J H;  4YWL A;  2B39 A;  4K0K L;  3S15 H;  4P72 A;  3HOW B;  4HMI A;  3GTM B;  5IGD A;  1ILP A;  3FKI H;  1MBY A;  2MQH A;  2YTV A;  1ZYR C;  2NVT H;  2ZXO A;  1IW7 C;  4QF4 A;  2HCI A;  4ALP A;  2F0L A;  4N9P A;  3NTH A;  4JOI A;  3OSO A;  2ZTC A;  2MFI A;  3V96 A;  3CQZ H;  3TP5 A;  2AHO B;  3HP3 A;  3PO3 B;  2F0Q A;  2P5Z X;  4FXG C;  1EQV A;  3EBE A;  4JBK A;  3S1M H;  2CKZ B;  4TKO B;  4ZLT F;  1VF5 C;  4LFA L;  2DGY A;  1LTL A;  4JC0 A;  3GTM H;  3HZX A;  3TEH B;  1WFQ A;  1I6H B;  1GVP A;  4QGU A;  1STN A;  3F2D A;  4IPC A;  5HGT A;  1R4Q B;  3HOX G;  1I5F A;  1YHB A;  2UU9 Q;  3GTG H;  2O5J C;  3MZ5 A;  1NNX A;  2F0H A;  5ELF A;  1HFN A;  1SE8 A;  4GS3 A;  4A3L G;  1YHQ A;  1U0L A;  3I7F A;  2K5H A;  3NE5 B;  1WD1 A;  2B2W A;  1EU3 A;  3BG3 A;  2OEO A;  2JEB I;  3R8B A;  4DR7 L;  3W2D A;  3CC2 A;  2NN6 G;  5M5W H;  3CKI B;  3GV6 A;  3DWP A;  3I70 A;  3RMH A;  1VQ4 A;  1PRT C;  1FGU A;  1U5K A;  2G9D A;  1IZ6 A;  1ZKO A;  1WYD A;  4LK1 C;  1WTX A;  3PUV A;  2EYO A;  4DAP A;  1WTQ A;  4EGV A;  1HUM A;  2AUJ D;  4OL7 A;  2UXD L;  5BN4 A;  1X55 A;  3CHB D;  1HZC A;  1L0W A;  3ULL A;  5GAH C;  1K83 B;  1MIU A;  4DR4 Q;  3HKS A;  1YNN C;  5AFW A;  5C3E G;  4BY7 B;  5G3L D;  1C0A A;  1B7Y B;  1SN8 A;  1AE3 A;  2CHB D;  2EYF A;  2N88 A;  2PZW A;  1STH A;  3T53 B;  3ERO A;  3TP8 A;  1SNO A;  4LFC Q;  3I4L A;  1OXX K;  4AQY L;  3BU2 A;  2PQA A;  1SNC A;  3FHW A;  3S17 H;  2JE6 I;  4J8Q A;  3QIA A;  1HTL D;  3A54 A;  3HOY H;  2KEC A;  1LTI D;  2KEE A;  3GDE A;  1RD9 D;  1NTG A;  1JOK A;  3S1R H;  1YIT A;  2VXW A;  3BVG A;  5K36 G;  4DR3 L;  5FJ8 G;  5JJI A;  1QCB D;  3NBI A;  4AYB G;  2R7Z H;  4S3S A;  3CP0 A;  1K8O A;  1VQM A;  3KJO A;  4LF7 Q;  1PYS B;  3CF5 A;  1KRT A;  1PTO H;  1T5E A;  4JI7 Q;  2K50 A;  1Y1V G;  3GTO H;  2ES2 A;  4DV6 L;  1X3E A;  2NN6 I;  2PI2 E;  2PW5 A;  1QUQ B;  4RGO S;  3TN2 A;  4HCE A;  2PI2 A;  3MXN A;  4NB3 A;  3IL8 A;  1XYI A;  1BCP D;  2NVX H;  2EDG A;  3NBH B;  3RN2 A;  4FXD A;  2VUM B;  1K3R A;  5J39 A;  1ICW A;  5M3M B;  4NXN Q;  1N8R C;  4JPB W;  2X6L A;  2KOL A;  2N3S A;  3HOU B;  4LWC A;  1EUJ A;  1YNJ C;  4A3G H;  2AWN A;  4GKK Q;  1N36 Q;  4DK3 C;  5KND A;  4OX9 Q;  2IPK D;  1S5D D;  3OHX C;  4A3K H;  1Q46 A;  1SMY C;  2CH4 W;  1U4R A;  5C5L A;  2ZM6 L;  1V43 A;  2B2Y A;  1VCI A;  1ENF A;  2IHF A;  2ZXP A;  1EQQ A;  1XMO L;  3MC0 B;  1YJN A;  4LNQ A;  1H9J A;  2KEN A;  1A2U A;  2EOT A;  3CQZ B;  4A3B H;  2CWP A;  1AW7 A;  2UU9 L;  2QCP X;  1CTM A;  1S3O A;  1GM5 A;  4U67 3;  4FXK C;  4BBS B;  3UDG A;  4UHV A;  5M5X H;  1EYG A;  3S24 A;  2E75 C;  4RKL A;  4GKJ L;  2KHS A;  3K7A B;  1VQD A;  4DR4 L;  2JJQ A;  2B2U C;  5JJL A;  4KD4 A;  4IJL A;  2H1E A;  3HKZ G;  3MA2 B;  4C3J B;  2QIL A;  3FKI B;  4ULL A;  4C1N I;  3SEB A;  2VQE L;  1KAB A;  2VZA A;  2NVQ H;  3AMU A;  5IGB A;  3Q8D A;  3M9B A;  4YCV A;  2B2T A;  2UXC Q;  2F0P A;  2D0P A;  2NZH A;  2QA4 A;  4A93 B;  2EYH A;  2A6E C;  3VYU A;  5EGT A;  3SK4 A;  5IGF A;  1SMY D;  3NPP A;  3LWU A;  5C44 G;  5EPK A;  2HDL A;  4HIK A;  3NTK A;  3CCS A;  1J5E Q;  2PMZ E;  1P8L A;  1TWC H;  3GTK H;  4A3M B;  1JB3 A;  2KBN A;  3K0X A;  3KLW A;  1ET9 A;  1BBU A;  2WIN B;  1KIX A;  1XWE A;  2RHS B;  2R93 H;  5IYD H;  2F52 A;  1LTS D;  1U9R A;  3UDX A;  2R7Z B;  2EYM A;  1X3P A;  4DV7 Q;  2BA1 A;  2V4D A;  4DV3 L;  5C3X A;  2E74 C;  3PIP A;  2BH2 A;  4A3I B;  1EY9 A;  1IL8 A;  3K5L A;  2QF7 A;  2WAQ E;  1PZI D;  1T9H A;  2JA5 H;  4YY3 Q;  1Q1E A;  4EQ5 A;  1W6J A;  1EOT A;  1O80 A;  4IUT A;  4A3B B;  4BA2 I;  4KD3 A;  1PMR A;  4KKU A;  4B3M Q;  1SNP A;  4OX9 L;  1NSN S;  2WII B;  4AYB B;  1W2B A;  3MXG A;  1J6Q A;  5FLX c;  1ZYR D;  2A19 A;  2A6E D;  3VYR A;  3BDL A;  3IKJ A;  2L12 A;  1WTR A;  2H4O A;  2LSS A;  5ELO A;  3SR1 A;  5M3F H;  1L1O A;  3EIV A;  4I7Z C;  4K8I A;  2E2J B;  4A3F B;  1VF7 A;  4KHZ A;  5IYD G;  1C4Q A;  3VA5 A;  3WWV A;  3PF5 A;  4PNY A;  5A2Q E;  4FF2 A;  4A76 A;  1PYW D;  1PVO A;  2A1A A;  5FLX E;  4NDX A;  3U9O A;  3A5Z B;  2PW7 A;  4A3M H;  2KUM A;  5DLQ E;  3OMC A;  2QEX A;  1H9R A;  1VQJ A;  1QE6 A;  5FO8 B;  1VQL A;  1LTR D;  3KLS X;  1EY7 A;  4BY1 H;  2MO1 A;  1TII D;  3NWS A;  2WP8 J;  3DEP A;  1D5Z C;  2HD3 A;  2ZXR A;  3R2T A;  1B3A A;  2LFN A;  4A3E G;  3X3M A;  3RZO H;  4DR3 Q;  3W3A A;  3S2H B;  1L0Y B;  1TS3 A;  5J3B A;  2OCE A;  1PA6 A;  2UXB L;  4BXX G;  4LJZ C;  2PMZ B;  3MWY W;  2F0E A;  4DR6 L;  1X3Q A;  1IBL Q;  2K33 A;  1Q90 A;  2AQ3 B;  1JIC A;  4QY7 A;  4AQY Q;  2ZM6 Q;  4BBS G;  1A3V A;  5HY6 A;  2OT2 A;  1GUT A;  1I3Q B;  4JI5 Q;  2K32 A;  4DV1 L;  1JE5 A;  3F8T A;  2JEA I;  4XT3 B;  2ZJP A;  4BY1 G;  1D5X C;  2A6H D;  1QVC A;  2F0V A;  1NBW A;  4JI0 L;  3CCR A;  2A68 C;  1F9S A;  1DCZ A;  1TWH H;  3FKI G;  1UAP A;  1S5E D;  4P75 A;  1N32 L;  2EY1 A;  4K5V A;  5IWA Q;  4LF5 Q;  1GO3 E;  4HJA A;  1LTB D;  1Y1W H;  1HZB A;  4X6A H;  3ONA B;  4R8N A;  2I0Q A;  4B3M L;  4ZKC B;  4K8J A;  1GKH A;  4OGQ C;  2YU9 B;  2B3G A;  2O4X A;  4C3I G;  2R3Z A;  5KNC A;  1PV4 A;  2DY7 A;  1JWM D;  3L0O A;  2E2I B;  3EA6 A;  3CW2 C;  2K1B A;  4IO9 A;  3Q24 A;  1LM0 A;  3CAM A;  2PNH A;  2B63 G;  2PO4 A;  2NVX B;  2K03 A;  4PMC A;  1EWH A;  1RJT A;  3DWQ A;  4UPA A;  5C4X H;  1MJE A;  4K2K A;  4M1U B;  1I50 B;  5T1I A;  2PZU A;  1YIJ A;  1WJJ A;  4X3U A;  1XPO A;  3G6J B;  2ASB A;  1K0S A;  4IN3 A;  4DNI A;  3OYY A;  4NW2 A;  4HN7 A;  2K14 A;  4OEM B;  4JI1 L;  4A4I A;  1RTO A;  3P20 A;  4LF7 L;  1G8Z D;  3I56 A;  4HSP A;  4DV3 Q;  1W6K A;  3AYH B;  5CC4 A;  2DNC A;  2WAC A;  2SOB A;  5C0X G;  5FO7 B;  1WCM B;  1VQG A;  1TWH B;  1VDZ A;  2ICE C;  3RR5 A;  1RF2 D;  3S1R B;  1L0X B;  1HNW Q;  5JPM C;  3S1M B;  1QIL A;  2TMP A;  1Q7Y C;  1X6O A;  3CCE A;  4BBR H;  2A5H A;  3PIO A;  1I3Q H;  4A3F G;  3KFU A;  3JC6 6;  3O13 A;  1OXU A;  1CHQ D;  1HH2 P;  5C4Z A;  1CT1 D;  2VUM G;  2L11 A;  4A3G B;  3K5O A;  5M3M G;  2F3W A;  5KYL A;  2SNM A;  3E0J A;  4UP7 A;  3BYY B;  5JJZ A;  3MFG A;  1E2Z A;  1VQA A;  3OW2 A;  1LTA D;  3U50 C;  1K3B C;  1EZ8 A;  4GZY C;  4DR5 Q;  1HR0 L;  1CKO A;  4JI8 Q;  4R4T A;  3DEO A;  4LMQ D;  3VR2 A;  2QDL A;  1LUZ A;  4JI3 Q;  1TWC B;  1PH1 A;  1PH7 A;  1SNQ A;  1JCK B;  5EPJ A;  1B53 A;  1B44 D;  1H9S B;  1LT5 D;  3S1N H;  3KK7 A;  1A8V A;  4JG2 A;  2HCC A;  1HA6 A;  1YNX A;  3S1N B;  1EWC A;  1F2Z A;  5AJ3 L;  3J7A F;  4QIW B;  4BY7 G;  2PPB C;  3Q6S A;  1EY8 A;  3VR3 A;  1E1O A;  2ZT9 C;  1HUN A;  5M3F B;  4K6L A;  4NP5 A;  3NP8 A;  1IBL L;  1GHK A;  1OXT A;  4G7H C;  3F2U A;  4JI2 Q;  3Q23 A;  1M8A A;  4I65 A;  4DAY A;  4RGT A;  4ZQ3 A;  4NXN L;  4MHE A;  2AUK A;  4V19 0;  1SE3 A;  3S17 B;  2ALY B;  3A5U A;  5COY A;  1E2W A;  4R4Q A;  3MHB A;  2K4K A;  4P71 A;  4H44 C;  5F2D A;  4XYO A;  2R61 A;  4YWM A;  1YEZ A;  5IGE A;  4A93 G;  1KNE A;  1SBB B;  2J4X A;  3OTO L;  2M00 A;  1XNR Q;  5CV9 A;  1WTW A;  1M90 C;  3A8J E;  4Y52 H;  1FL0 A;  1Z9F A;  1EEF D;  1EYA A;  1KTK A;  2Q2I A;  2RQX A;  3KOJ A;  1HHV A;  4IAL A;  3ND9 A;  3M85 A;  2KHJ A;  4A3M G;  1WVL A;  1CHP D;  1RKN A;  1BO0 A;  2MNA A;  3C1F A;  4KTA A;  4PZ8 A;  1WCM H;  1UE6 A;  4A3K B;  1O78 A;  2EYP A;  1B8A A;  2Z6K A;  5C3E H;  1EFI D;  3BZD B;  4DR2 Q;  4HID A;  2I5L X;  2CWA A;  4P2C B;  4WJ3 M;  2F0G A;  2A74 C;  1N36 L;  1CKN A;  2ZJQ A;  2IW3 A;  4JBJ A;  2B2T C;  5M9O A;  2EYL A;  1TWF H;  2JA8 G;  4IJH A;  4N8X 1;  3K6O A;  4EQO A;  3T1H L;  1HNZ Q;  3HG9 A;  4POG A;  1HTP A;  1HA5 A;  3TZU A;  3VA7 A;  1EYD A;  2KHI A;  3F1Z A;  1XNQ L;  2Q8R E;  4JCV E;  1Q8I A;  1SJH D;  5D65 A;  1I4X A;  3HOZ B;  2F4V L;  1ZEQ X;  4DUY L;  3T13 A;  2QGQ A;  1PTO B;  3MEF A;  3CRK C;  2F03 A;  2NB0 A;  1WCM G;  3ERQ A;  1LAC A;  2VY3 A;  3EJI A;  1CSQ A;  4HAE A;  1GUS A;  1S72 A;  1J5E L;  5IE8 A;  2KCM A;  2HIX A;  1HPC A;  1EY5 A;  1MSG A;  2L1B A;  2Z6B A;  4LFA Q;  2XNA C;  3HOV B;  1U4M A;  5GQO A;  1PZK D;  4NPS A;  5EQ0 A;  2RBM A;  5E4W C;  1D7Q A;  1DXM A;  3J7Y W;  1Q8K A;  3FP9 A;  1QJO A;  4B3T Q;  1GD7 A;  3BYT B;  5EBD A;  4ZUJ A;  4JI4 L;  4X65 Q;  2JA8 H;  2BDN A;  4WJ4 A;  5ELN A;  1KLU D;  4GLA C;  4A3C G;  5LHY 1;  2M9V A;  4TRD A;  2EQS A;  4DAY B;  1PFM A;  1DM0 B;  3RN5 A;  1XPU A;  1B70 B;  5EKL A;  4OXP A;  2EY5 A;  3LGJ A;  2B63 H;  1KHI A;  1CZW A;  1LTG D;  5IT9 E;  4QCL A;  4QMG A;  1TS5 A;  2PCF B;  2JA6 H;  4JBM A;  1BCP F;  4Q5V A;  2WAQ B;  4F88 A;  3KF6 B;  1DGS A;  2VUM H;  3DM3 A;  4C1N K;  5J1Z A;  5JVH 3;  1QVG A;  2RDH A;  1LV9 A;  3NK9 A;  1R9T B;  3SXH A;  2F3I A;  3CRL C;  4Q0F A;  4CJ2 C;  3UE1 A;  2IY5 B;  2EYJ A;  1TWA B;  4KLK A;  2C9O A;  2K5V A;  3GP7 A;  1JR0 D;  4JBW A;  1SE2 A;  4NKL A;  1EIF A;  1KDC A;  5M5W B;  1CUK A;  4BY1 B;  4EQN A;  1S5C D;  3AU7 A;  3OWE B;  4A3I G;  4PV1 C;  3W5O A;  4A3C H;  3I8Z A;  4OWX B;  1Q3L A;  1GJX A;  5IOC A;  1KNA A;  4RAU C;  1A3U A;  1FNV A;  2K75 A;  3I72 A;  4P73 A;  4LF6 Q;  1PDQ A;  3C46 A;  2B8G A;  5ELB A;  3GTG B;  1Y8O B;  4DR5 L;  1R9T H;  3M7N A;  4YCW A;  1O7L A;  4MZ9 A;  1KL9 A;  4G57 A;  4IPG A;  3RLN A;  3NEN A;  5E7N A;  3FEW X;  5LL6 X;  3A7A B;  4X62 L;  2CFM A;  1IBM Q;  2F0J A;  2SNS A;  2J7Z A;  4RGN A;  2SEB D;  5C44 H;  1Y1W G;  5CV6 A;  3TS2 A;  2B63 B;  3S14 B;  3J80 E;  5CV8 A;  4A3J G;  1C9O A;  3CU7 A;  1G29 1;  1MKH A;  3T16 A;  4CDD C;  2PQE A;  3KF8 A;  1B9M A;  4JI5 L;  1K83 H;  1HZ9 A;  4RH6 A;  2KCN A;  1QVF A;  1G91 A;  4O0A A;  3U4V A;  1EY4 A;  1KQS A;  4HJ9 A;  1OXS C;  4K2L A;  2K04 A;  4BWG B;  3S9W A;  4DR6 Q;  5FO9 B;  4UDU C;  1CSP A;  4ID6 A;  2UXB Q;  1NMF A;  1B50 A;  1QZG A;  1K0R A;  1JWU D;  1PH4 A;  4JI6 Q;  1UWV A;  4GNX A;  3GQB A;  1F2Y A;  3ULP A;  4CBV A;  4ILW A;  1G6Z A;  3IFD A;  3OOC A;  4B3S Q;  1V1O A;  4DV2 L;  3M4O H;  3J7A V;  3H6M A;  5KNB A;  4A3J H;  4RCN A;  2D0O A;  2VB3 X;  4M8A A;  2A73 B;  1SXT A;  1I6V C;  4YHH L;  1WTV A;  2JN4 A;  4KHP L;  3CD6 A;  5BR8 L;  4L8J A;  4A3G G;  1D5M C;  1KAA A;  5FLX L;  1Z47 A;  2R92 H;  3BZC A;  2JA9 A;  3G6E A;  1F9R A;  2BH8 A;  5C4X G;  3J81 i;  4B3R Q;  2CW0 D;  3K7A H;  4CJ1 B;  4HJ5 A;  4CKC A;  1PFB A;  5IGC A;  2UUA L;  2K28 A;  5TSS A;  4A3L H;  2HQE A;  3OMG A;  4LW1 A;  3JAM c;  2M2L A;  1W3S A;  4ME3 A;  5M5Y B;  4KY5 A;  3ZJY C;  3I4M H;  1EIH A;  4YCU A;  2WAQ G;  3QG1 A;  5IT9 c;  4R8I A;  4HTH A;  1VS0 A;  2DY8 A;  3BVM A;  4DK0 A;  4DV5 Q;  1B2T A;  1EY0 A;  3KLS A;  5IIF A;  1EEI D;  2NVT B;  1X56 A;  4KHP Q;  1NE3 A;  2B2W C;  1UE7 A;  1WTH A;  4ZKB B;  2Y0S G;  3J7Z C;  3GTJ H;  2EY2 A;  3QWN A;  1YBY A;  2HIV A;  2L15 A;  2JK8 A;  3PSI A;  2JA6 G;  2BDO A;  3H3V H;  3I2Z A;  4BS9 A;  3K59 A;  1O7Y A;  3MXP A;  1XNR L;  3NSW A;  1Q81 C;  1H9S A;  1BBX C;  1K8M A;  2IX3 A;  4DXG A;  3N6R A;  2PYK A;  2K5Q A;  4IFD H;  4HR7 B;  1JQY D;  2LXK A;  1YZ6 A;  2CW0 C;  3E5S A;  4IUQ A;  1WD0 A;  2AQ2 B;  3GTL B;  3CCL A;  1CQV A;  1JMC A;  2TSS A;  3CCM A;  3GTO B;  2NBF A;  3L9A X;  5JAV A;  5BN3 A;  2R93 G;  3R93 A;  1U4P A;  4IUP A;  1SYF A;  4CDF C;  4XYQ A;  3Q0A A;  3MEH A;  1FD7 D;  3D4W A;  3C2P A;  1H9M A;  5HUR A;  1QNU A;  3CXC A;  4A3K G;  1MSH A;  3NEL A;  2CCZ A;  3Q22 A;  3HOW G;  4ZK9 B;  3PF4 A;  4CKB A;  1X3F A;  3FPP A;  4V0B A;  1IYU A;  1JWS D;  1QWY A;  2G5D A;  2E2J H;  3PO2 G;  2XSC A;  5IYB G;  3MVV A;  1ILQ A;  1LO5 D;  5IY0 A;  3HFZ B;  2RSN A;  1N33 Q;  2F4V Q;  4RG1 A;  5JPN C;  1TKW B;  2RF4 A;  2K01 A;  5A35 A;  3AFQ A;  1FNW A;  1VQN A;  3M3Y B;  3GTJ B;  3PO3 G;  3URY A;  3GTP B;  2EXZ A;  2UUA Q;  1SLJ A;  4KHV A;  1UUP A;  1Y69 U;  4LF6 L;  3HOZ G;  4B3S L;  3W1B A;  3RNU A;  3M4P A;  3EQL C;  1WOC A;  1CZG A;  2LY7 A;  4DV7 L;  3I4M B;  1HZA A;  2LMC B;  3J81 c;  4YY3 L;  2BA0 A;  1QB5 D;  4XQJ A;  4A3I H;  4OIJ A;  3KDF A;  4BBR G;  2F0S A;  4U68 A;  4B08 A;  1VQ9 A;  3DM1 A;  4YHH Q;  2VB2 X;  1F2M A;  4MTK A;  3HOX B;  5EKI A;  1YI2 A;  4KMU C;  5C0X I;  4JI1 Q;  3TRE A;  2UUB L;  3PUW A;  2K52 A;  3SHL A;  3GTK B;  3CCV A;  4LUZ A;  3ND8 A;  1JJG A;  4X64 L;  3UDI A;  2WV6 D;  2IHE A;  2EY6 A;  5FOB B;  4DV4 L;  2O2L D;  5C4X B;  4RWS C;  3TQY A;  1DOM A;  1HQM C;  2ID0 A;  1VQH A;  3WDN A;  3HOZ H;  1DYQ A;  1ICF B;  5I6Y A;  4C3I H;  1SE4 A;  1TWF B;  5GAE C;  1N34 L;  2NUC A;  2UUC Q;  2WKC A;  1SYB A;  2GVB A;  4R4O A;  4C2M H;  2HDM A;  1SYC A;  2ICI A;  3TP6 A;  3TSS A;  4LAA A;  3KLR A;  3E9I A;  3HRZ C;  2BCO A;  4H0L C;  2V1C C;  2DJF C;  1G51 A;  1HNX L;  1K73 C;  1SYG A;  3UE0 A;  4KKS A;  1PTO D;  4MNO A;  1GUO A;  2EJM A;  5C3E B;  3H09 A;  2FMC A;  4KY7 A;  1TXY A;  2MUY A;  3ERS X;  4ZUI A;  1UEA B;  4DV4 Q;  5M5X B;  4B3T L;  4OON A;  3D8G A;  3LX0 A;  4KV6 A;  4Z9C B;  4PG3 A;  1B4O A;  3VYS A;  2HHH Q;  4GNX B;  1IL2 A;  3BVZ A;  2UXD Q;  3OWF A;  5LMN L;  3KDF B;  3D6W A;  1UEB A;  2AQ1 B;  5IWA L;  5KEE A;  4H7B A;  3S2D B;  3RUZ A;  3M3Y H;  3VR5 A;  2K5D A;  3V05 A;  5DAU A;  3X3N A;  4JYA L;  1UNS A;  1LAB A;  4QUF A;  3R2I A;  5I2Y A;  3BS1 A;  2Q8T A;  3HOU H;  5L37 A;  3H15 A;  3AFP A;  4DUZ Q;  1BF4 A;  3HOY G;  3KF8 B;  3CCJ A;  1VQE A;  4HIO A;  3A56 A;  4A3D H;  4UP8 A;  1EIY B;  2PNR C;  4HED A;  4RKB A;  4IFD J;  1I4Q A;  1A63 A;  1IHZ A;  1ENA A;  2Z6K C;  1H9K A;  4DAV A;  1GUN A;  2N78 A;  1LTT D;  1DOL A;  1DJR D;  3S16 B;  4PZ6 A;  4H13 C;  4GN4 B;  2K05 A;  4Y7N H;  1C8C A;  4NXM Q;  4MIU A;  2F0K A;  3CC7 A;  1K28 A;  2EJF C;  2ZTE A;  2X69 A;  4HMJ A;  1JOO A;  1D1K A;  4LFC L;  3QOL A;  5C4J H;  4DNR B;  1YNN D;  4LF8 Q;  5JEA G;  3UI2 A;  2VW9 A;  3KUP A;  5C5M A;  1VQC A;  4O1N A;  3HOU G;  2JA7 H;  1LT3 D;  2PQA B;  4WOR A;  3RZD B;  1XJV A;  5LMU Q;  5NUC A;  1HNW L;  2F0M A;  5DNF A;  3M4Q A;  1VQK A;  1V8Q A;  3BZK A;  1Y8P B;  3F2B A;  1B1Z A;  1L1O C;  2NZ1 D;  5ISR A;  2RDF A;  4J1M A;  3H0G G;  2D9U A;  4X3S A;  1SDF A;  4BBR B;  4DV0 Q;  5EJW A;  4H02 A;  2NVY B;  5CV5 A; 
#chains in the Genus database with same CATH homology
 1RHP A;  1NCV A;  2IX1 A;  1F77 A;  4C3H B;  1I4R A;  2L0C A;  3J80 L;  1AEX A;  1A3T A;  5C4H A;  3LNN A;  3P75 A;  1HCZ A;  4EVO A;  4BA1 I;  3E6Z X;  3I3C A;  1R4P B;  2RKS A;  5CMD A;  3I4N B;  1EZ6 A;  4F8M A;  1BOS A;  2Q8I B;  2A69 D;  1Z6H A;  1EY6 A;  4A3J B;  3PIP 3;  3PUX A;  1Y1V B;  2XRS D;  4ZAI A;  4OO1 H;  5IGG A;  1LT4 D;  2JP1 A;  5J22 A;  2F0D A;  2FFK B;  3QOJ A;  3C1E A;  4KN4 C;  1TR5 A;  4RHS A;  5KRU A;  3T51 B;  1S4Z A;  4QB4 A;  3T56 B;  1Z7T A;  1WTP A;  1HRJ A;  5EPL A;  3SK8 A;  3ZYY X;  4IUR A;  4HSV A;  4DU9 A;  3MFY A;  4PMW A;  1SNM A;  3BDO A;  2B2Y C;  3TZD A;  1M4V A;  3NBH A;  2SDF A;  5COR A;  1DOK A;  1E0B A;  3S15 B;  2EPB A;  4EQP A;  2IJ0 A;  3WOF A;  5CGK A;  4WFN 3;  1PRT B;  4G7Z C;  2JA7 B;  5C6A A;  4DA2 A;  3D3R A;  1CA6 A;  1G2T A;  5CR3 A;  4A3E B;  3TME A;  5FKA C;  2L5T A;  3MXU A;  5IT9 L;  1CK1 A;  5JEA H;  1HQR D;  1BQQ T;  2B8F A;  1A15 A;  2KJX A;  3V2T A;  4XDX A;  4IUN A;  4F87 A;  5KYI A;  5ELC A;  1ROD A;  4RHR A;  2JA6 B;  1OO9 B;  4F7X A;  3SDZ A;  4XIG S;  5KIX A;  2D5D A;  1TT2 A;  2Z1C A;  4FNF A;  1TVX A;  2XIW A;  2JSO A;  5I2X A;  1J8I A;  2X6G A;  3K0Y A;  4OO1 I;  2JA5 B;  1RTN A;  1ESF A;  2F0O A;  4IFD I;  4KJN A;  3K57 A;  1SYD A;  4ABN A;  3NQT A;  4FF3 A;  1F2L A;  4WJW A;  1JE4 A;  3I90 A;  3WOE A;  2MGS A;  1KLG D;  4XXE A;  2R93 B;  2CVR A;  1TU2 B;  1Q1B A;  4UAI A;  2HUG A;  2QEJ C;  1I4P A;  2B2V C;  2EVB A;  3H3V C;  3I73 A;  3M7G A;  4CJ0 B;  2BE5 D;  3PO2 B;  2F3V A;  1SAP A;  3NUC A;  3EVQ A;  4DFA A;  1ET6 A;  1AP0 A;  1PRT D;  3JAM E;  2L55 A;  2D2C C;  5I9O A;  1A2T A;  4TQU S;  2E2D C;  4N9T A;  2NVQ B;  3DXJ C;  4IQZ A;  3QJY A;  1QOH A;  2FHT A;  4XT1 B;  4FF1 A;  5C0X H;  3D6C A;  3OIP A;  5JEA J;  5DEH A;  1EIG A;  2DNE A;  1FYC A;  1STB A;  3H91 A;  1FGB D;  3H94 A;  1YNJ D;  3AB9 A;  1CA5 A;  3S1Q B;  2KA7 A;  1J9O A;  4FP5 D;  1ONL A;  1GXD C;  4RA8 A;  4B9W A;  2A68 D;  1GUW A;  4ODG A;  1HXY D;  4K5W A;  3PMF A;  3IFT A;  1STA A;  5JVG 3;  2VNU D;  5CBA E;  3U9S A;  2F0T A;  1SJE D;  2EJG C;  1S5F D;  3NWT A;  5I9P A;  1JOQ A;  1PTO C;  4C3I B;  3RZO B;  1B9N A;  3PIO 3;  5C4J B;  1MGS A;  3PUY A;  1DD2 A;  2DN8 A;  5E4X A;  1RDP D;  2C5C A;  4K14 A;  2EZV A;  1V1P A;  1PFN A;  3HGB A;  1C48 A;  4RGM A;  1NAP A;  3FRP B;  2A69 C;  3BDC A;  2NWG A;  5D3I B;  4A3D B;  1SYE A;  3OIQ A;  1AN8 A;  4PMB A;  1BCP B;  2KCC A;  2L9H A;  1NR4 A;  3HOY B;  5ELD A;  1IKL A;  2IL8 A;  3SVM A;  1E2V A;  5C0X J;  4K6D A;  1XX8 A;  2O5I C;  5IOD A;  2D62 A;  4DK1 A;  5CV7 A;  2B2U A;  1DON A;  2PZT A;  3A8K E;  1BUV T;  1FNU A;  2QDB A;  2I07 B;  1SFO B;  1ZXT A;  5EBC A;  1SND A;  2RA4 A;  3N52 A;  1PRT F;  4ZRZ A;  2B2V A;  5FK9 C;  3ITP A;  5I4D A;  1KDA A;  5LL6 S;  2JA8 B;  2Z8L A;  2NN6 H;  2JYO A;  1CM9 A;  2RSO A;  1A6X A;  4FF4 A;  1F9P A;  3VR4 A;  5KGU A;  2IWH A;  4C2M B;  3PV0 A;  2WB1 B;  1BR9 A;  3P1H A;  3H0G B;  2MHV A;  1T5X D;  1BCP C;  1VMP A;  5I6W A;  5DM6 3;  4C3H G;  1AZQ A;  1BNZ A;  1QNK A;  2E2H B;  4KJO A;  5BN5 A;  1AFP A;  4IUU A;  4QUC A;  4PQX A;  3R3O A;  5K5P A;  3TBI B;  3FMC A;  2K6A A;  1LLR D;  1IW7 D;  1WTO A;  2XRQ D;  1GHJ A;  2FIN B;  1STY A;  1CQF A;  3EFX D;  4E6I A;  1BXT A;  1GOZ A;  2AWO A;  2WKD A;  4IUV A;  1SEB D;  2KVM A;  4IFD G;  1IYV A;  2E76 C;  1STG A;  4X3T A;  3A8I E;  3IAY A;  4G4K A;  4JK1 C;  1Y8N B;  2GA4 B;  2OF1 A;  5CV4 A;  2FJ2 A;  3DMU A;  4KI0 A;  3NHH A;  2ENB A;  1EU4 A;  2G9H D;  3SK5 A;  3M4O B;  2F0F A;  2MP1 A;  4HCS A;  2XWJ B;  3VYT A;  3GTQ B;  1D1I A;  1DZ1 A;  3I91 A;  3KBG A;  3DWA A;  2R6G A;  2BE5 C;  1GUG A;  3P7J A;  2FMM A;  3OW7 A;  1PZJ D;  1VMC A;  4O42 A;  3L3O C;  3A7L A;  4DXF A;  1ESR A;  5DM7 3;  4DF7 A;  3D4R A;  4MN3 A;  3TP7 A;  1EQT A;  1RCV D;  2A6H C;  1X32 A;  1PXU A;  1TY2 A;  1JC7 A;  1LT6 D;  2MJ8 A;  2LS0 1;  4ZYS A;  1PTO F;  3QO2 A;  2JXM B;  1I4H A;  2KQ3 A;  5D3D A;  1JOR A;  2IX0 A;  1FR3 A;  4C56 C;  3TDQ A;  2F4I A;  1V1P B;  2YYZ A;  1HFG A;  1NUC A;  1KDB A;  2J0T D;  1Q12 A;  2Z4H A;  2CQA A;  3GD7 A;  3FDT A;  4KKT A;  3D4D A;  3RD4 A;  2I46 A;  3RLF A;  1O7Z A;  3HEJ A;  1EYC A;  2R92 B;  1MI2 A;  3JAM L;  3OPO A;  3C3L A;  3FPU B;  3M4Y A;  3QB3 A;  3HKZ B;  4C3J G;  5A2Q L;  1TY0 A;  4CGY B;  4B9X A;  2XVS A;  2F0I A;  1ENC A;  4YIJ A;  2RVL A;  4IZ8 A;  1D6E C;  3LWE A;  4L63 B;  3KBX A;  4FYD A;  3SE0 A;  5E3F A;  1Y1W B;  1D2B A;  5EKK A;  4WRD A;  5D14 A;  4CKE A;  2L4N A;  4RCO A;  4TSS A;  1AZP A;  5JOB A;  3MTS A;  1II3 A;  4FO2 A;  4XQQ A;  3SK6 A;  1IKM A;  4DNT B;  4KY6 A;  1TQO A;  1XXG A;  1U4L A;  4OHJ A;  5CYU A;  3VR6 A;  4G7O C;  4OO1 G;  1STE A;  2EE1 A;  4RFB A;  2IT1 A;  2OXP A;  1OXV A;  2QKI C;  3PUZ A;  4DN4 M;  1G2S A;  4CHT B;  5K36 H;  2KED A;  5CBE E;  4FVM A;  3FVQ A;  1MD2 D;  2F0N A;  5C3W A;  3MAQ A;  3DHQ A;  3J81 E;  4KK7 A;  3T4A C;  3K5N A;  2MPM A;  5T1G A;  3NQI A;  1TS4 A;  2NYZ D;  1QG7 A;  2NTS A;  2NTT A;  2K7V A;  4R9W A;  2K5W A;  3NXW A;  2F0W A;  3J81 L;  5ELE A;  4DGZ A;  4OIK A;  2BOS A;  1SSO A;  5C44 B;  4NMZ A;  3GO5 A;  2XN9 C;  2Z4I A;  1I4G A;  4XQN A;  4X3K A;  3L7Z C;  2Y0S B;  3DUZ A;  3D31 A;  3NTI A;  1NR2 A;  1CI3 M;  1F9Q A;  2XWB B;  3GV3 A;  5E1F A;  5G3L F;  1CFM A;  2F1M A;  2RDG A;  4Y7N B;  4L6T B;  2LKV A;  1S5B D;  1EL0 A;  1TWG B;  1PLF A;  3G7L A;  4ME5 A;  4J6H A;  4KN7 C;  1TS2 A;  3A55 A;  1ML0 D;  2F0U A;  1BDO A;  4XTC S;  3K5M A;  1XTC D;  3HS0 C;  4K5X A;  2N55 A;  3K58 A;  2B39 A;  3HOW B;  4HMI A;  3GTM B;  5IGD A;  1ILP A;  1MBY A;  1ZYR C;  2ZXO A;  1IW7 C;  4QF4 A;  2HCI A;  2F0L A;  4N9P A;  3NTH A;  3OSO A;  3V96 A;  3TP5 A;  3HP3 A;  3PO3 B;  2F0Q A;  4FXG C;  1EQV A;  4TKO B;  4ZLT F;  1VF5 C;  3HZX A;  1I6H B;  1STN A;  5HGT A;  1R4Q B;  2O5J C;  3MZ5 A;  2F0H A;  5ELF A;  1HFN A;  3NE5 B;  1WD1 A;  2B2W A;  1EU3 A;  3BG3 A;  2OEO A;  2JEB I;  3R8B A;  3W2D A;  2NN6 G;  3CKI B;  3GV6 A;  3DWP A;  3I70 A;  3RMH A;  1PRT C;  2G9D A;  1ZKO A;  4LK1 C;  1WTX A;  3PUV A;  2EYO A;  4DAP A;  1WTQ A;  4EGV A;  1HUM A;  2AUJ D;  4OL7 A;  5BN4 A;  3CHB D;  1K83 B;  5AFW A;  1YNN C;  4BY7 B;  5G3L D;  2N88 A;  2EYF A;  3T53 B;  2CHB D;  2PZW A;  1STH A;  3ERO A;  3TP8 A;  1SNO A;  3I4L A;  1OXX K;  1SNC A;  2JE6 I;  4J8Q A;  3QIA A;  1HTL D;  3A54 A;  2KEC A;  1LTI D;  2KEE A;  1RD9 D;  1JOK A;  2VXW A;  3BVG A;  5K36 G;  1QCB D;  3NBI A;  4S3S A;  1K8O A;  1PTO H;  1T5E A;  2NN6 I;  2PW5 A;  4RGO S;  3TN2 A;  4HCE A;  3MXN A;  3IL8 A;  1XYI A;  1BCP D;  2EDG A;  4FXD A;  2VUM B;  5J39 A;  1ICW A;  5M3M B;  2X6L A;  2KOL A;  3HOU B;  1YNJ C;  2AWN A;  5KND A;  2IPK D;  1S5D D;  3OHX C;  1SMY C;  1U4R A;  5C5L A;  1V43 A;  2B2Y A;  1VCI A;  1ENF A;  2ZXP A;  3MC0 B;  1H9J A;  1A2U A;  2EOT A;  3CQZ B;  1AW7 A;  2QCP X;  1CTM A;  4U67 3;  4FXK C;  4BBS B;  2E75 C;  4RKL A;  2KHS A;  3K7A B;  2B2U C;  4KD4 A;  2H1E A;  3MA2 B;  4C3J B;  2QIL A;  3FKI B;  4ULL A;  4C1N I;  3SEB A;  1KAB A;  3AMU A;  5IGB A;  2B2T A;  2F0P A;  4A93 B;  2EYH A;  2A6E C;  3VYU A;  5EGT A;  3SK4 A;  5IGF A;  1SMY D;  3NPP A;  3LWU A;  5EPK A;  2HDL A;  3NTK A;  4A3M B;  1JB3 A;  1ET9 A;  2WIN B;  1XWE A;  1LTS D;  1U9R A;  2R7Z B;  2EYM A;  1X3P A;  2BA1 A;  2V4D A;  5C3X A;  2E74 C;  4A3I B;  1EY9 A;  1IL8 A;  3K5L A;  2QF7 A;  1PZI D;  1Q1E A;  1W6J A;  1EOT A;  1O80 A;  4IUT A;  4A3B B;  4BA2 I;  4KD3 A;  1PMR A;  4KKU A;  1SNP A;  1NSN S;  2WII B;  4AYB B;  3MXG A;  1ZYR D;  2A6E D;  3VYR A;  3BDL A;  3IKJ A;  2L12 A;  1WTR A;  2H4O A;  3SR1 A;  4K8I A;  2E2J B;  4I7Z C;  4A3F B;  1VF7 A;  4KHZ A;  1C4Q A;  3VA5 A;  4PNY A;  5A2Q E;  4FF2 A;  1PYW D;  5FLX E;  4NDX A;  3U9O A;  2PW7 A;  2KUM A;  3OMC A;  1H9R A;  1QE6 A;  5FO8 B;  1LTR D;  3KLS X;  1EY7 A;  1TII D;  3NWS A;  2WP8 J;  3DEP A;  1D5Z C;  2ZXR A;  3R2T A;  1B3A A;  2LFN A;  3X3M A;  3W3A A;  3S2H B;  1L0Y B;  1TS3 A;  4LJZ C;  2PMZ B;  3MWY W;  2F0E A;  1X3Q A;  2K33 A;  1Q90 A;  2AQ3 B;  1JIC A;  1A3V A;  2OT2 A;  1GUT A;  1I3Q B;  2K32 A;  2JEA I;  4XT3 B;  1D5X C;  2A6H D;  2F0V A;  2A68 C;  1F9S A;  1DCZ A;  1UAP A;  1S5E D;  2EY1 A;  4K5V A;  1LTB D;  3ONA B;  4R8N A;  4ZKC B;  4K8J A;  4OGQ C;  2YU9 B;  2O4X A;  5KNC A;  4C3I G;  2R3Z A;  2DY7 A;  1JWM D;  2E2I B;  3EA6 A;  2K1B A;  3Q24 A;  2PO4 A;  2NVX B;  2K03 A;  4PMC A;  1EWH A;  1RJT A;  3DWQ A;  4K2K A;  4M1U B;  1I50 B;  5T1I A;  2PZU A;  4X3U A;  3G6J B;  4IN3 A;  4NW2 A;  4HN7 A;  1RTO A;  3P20 A;  1G8Z D;  4HSP A;  1W6K A;  5CC4 A;  2DNC A;  2WAC A;  2SOB A;  5C0X G;  5FO7 B;  1WCM B;  3S1R B;  1TWH B;  1VDZ A;  2ICE C;  1RF2 D;  1L0X B;  5JPM C;  3S1M B;  1QIL A;  2TMP A;  2A5H A;  3O13 A;  1OXU A;  1CHQ D;  5C4Z A;  1CT1 D;  2L11 A;  4A3G B;  3K5O A;  2F3W A;  5KYL A;  2SNM A;  3E0J A;  3BYY B;  5JJZ A;  3MFG A;  1E2Z A;  1LTA D;  1EZ8 A;  4GZY C;  3DEO A;  4LMQ D;  3VR2 A;  1TWC B;  1SNQ A;  5EPJ A;  1JCK B;  1B53 A;  1B44 D;  1H9S B;  1LT5 D;  3KK7 A;  1HA6 A;  2HCC A;  3S1N B;  1EWC A;  1F2Z A;  3J7A F;  4QIW B;  2PPB C;  3Q6S A;  1EY8 A;  3VR3 A;  2ZT9 C;  1HUN A;  5M3F B;  4K6L A;  4NP5 A;  3NP8 A;  1GHK A;  1OXT A;  4G7H C;  3F2U A;  3Q23 A;  1M8A A;  4I65 A;  4DAY A;  4RGT A;  4ZQ3 A;  4V19 0;  4MHE A;  2AUK A;  1SE3 A;  3S17 B;  5COY A;  1E2W A;  3MHB A;  5F2D A;  4H44 C;  4XYO A;  2R61 A;  5IGE A;  1KNE A;  1SBB B;  2J4X A;  2M00 A;  5CV9 A;  1WTW A;  3A8J E;  1EEF D;  1EYA A;  1KTK A;  2RQX A;  1HHV A;  4IAL A;  3ND9 A;  3M85 A;  1WVL A;  1CHP D;  1RKN A;  1BO0 A;  3C1F A;  4KTA A;  4A3K B;  1O78 A;  2EYP A;  1EFI D;  3BZD B;  4P2C B;  2F0G A;  2A74 C;  2IW3 A;  2B2T C;  5M9O A;  2EYL A;  3K6O A;  4EQO A;  3HG9 A;  1HTP A;  1HA5 A;  3TZU A;  3VA7 A;  1EYD A;  2Q8R E;  1Q8I A;  1SJH D;  5D65 A;  1I4X A;  3HOZ B;  1ZEQ X;  3T13 A;  1PTO B;  3CRK C;  2F03 A;  2NB0 A;  3ERQ A;  1LAC A;  3EJI A;  4HAE A;  1GUS A;  1HPC A;  1EY5 A;  1MSG A;  2L1B A;  3HOV B;  2XNA C;  1U4M A;  1PZK D;  5EQ0 A;  5E4W C;  2RBM A;  1DXM A;  3J7Y W;  1QJO A;  5EBD A;  3BYT B;  4ZUJ A;  2BDN A;  1KLU D;  5LHY 1;  2M9V A;  4TRD A;  1PFM A;  1DM0 B;  5EKL A;  2EY5 A;  1CZW A;  1LTG D;  5IT9 E;  4QCL A;  4QMG A;  1TS5 A;  2PCF B;  1BCP F;  4Q5V A;  2WAQ B;  4F88 A;  4C1N K;  5JVH 3;  5J1Z A;  2RDH A;  1LV9 A;  3NK9 A;  1R9T B;  3SXH A;  3CRL C;  4Q0F A;  4CJ2 C;  2EYJ A;  1TWA B;  2C9O A;  3GP7 A;  1JR0 D;  4JBW A;  1SE2 A;  4NKL A;  1KDC A;  5M5W B;  4BY1 B;  4EQN A;  1S5C D;  3AU7 A;  3OWE B;  4PV1 C;  3I8Z A;  1Q3L A;  1GJX A;  5IOC A;  1KNA A;  4RAU C;  1A3U A;  1FNV A;  3I72 A;  1PDQ A;  3C46 A;  2B8G A;  5ELB A;  3GTG B;  1Y8O B;  3M7N A;  1O7L A;  4G57 A;  3FEW X;  5LL6 X;  3A7A B;  2F0J A;  2SNS A;  2J7Z A;  4RGN A;  2SEB D;  5CV6 A;  2B63 B;  3S14 B;  3J80 E;  5CV8 A;  3CU7 A;  1G29 1;  3T16 A;  2PQE A;  3KF8 A;  1B9M A;  4RH6 A;  2KCN A;  1G91 A;  1EY4 A;  1OXS C;  4K2L A;  2K04 A;  4BWG B;  3S9W A;  5FO9 B;  4UDU C;  4ID6 A;  1B50 A;  1JWU D;  3GQB A;  1F2Y A;  4CBV A;  4ILW A;  1G6Z A;  3IFD A;  3OOC A;  1V1O A;  3J7A V;  3H6M A;  5KNB A;  4RCN A;  2VB3 X;  4M8A A;  2A73 B;  1SXT A;  1I6V C;  1WTV A;  4L8J A;  1D5M C;  1KAA A;  5FLX L;  1Z47 A;  1F9R A;  2CW0 D;  4CJ1 B;  4CKC A;  1PFB A;  5IGC A;  2K28 A;  5TSS A;  2HQE A;  3OMG A;  2M2L A;  5M5Y B;  4KY5 A;  1EIH A;  3QG1 A;  4R8I A;  4HTH A;  3BVM A;  2DY8 A;  4DK0 A;  1B2T A;  1EY0 A;  3KLS A;  5IIF A;  1EEI D;  2NVT B;  2B2W C;  4ZKB B;  2EY2 A;  3QWN A;  2BDO A;  4BS9 A;  3K59 A;  1O7Y A;  3MXP A;  3NSW A;  1H9S A;  1BBX C;  1K8M A;  2IX3 A;  4DXG A;  3N6R A;  2PYK A;  2K5Q A;  4IFD H;  4HR7 B;  1JQY D;  2CW0 C;  3E5S A;  4IUQ A;  1WD0 A;  2AQ2 B;  3GTL B;  1CQV A;  2TSS A;  3GTO B;  2NBF A;  3L9A X;  5JAV A;  5BN3 A;  3R93 A;  1U4P A;  4IUP A;  1SYF A;  4XYQ A;  3Q0A A;  3MEH A;  1FD7 D;  3D4W A;  3C2P A;  1H9M A;  5HUR A;  1QNU A;  1MSH A;  3Q22 A;  4ZK9 B;  4CKB A;  3FPP A;  4V0B A;  1IYU A;  1JWS D;  1QWY A;  2XSC A;  3MVV A;  1ILQ A;  1LO5 D;  2RSN A;  5JPN C;  1TKW B;  5A35 A;  2K01 A;  1FNW A;  3M3Y B;  3GTJ B;  3URY A;  3GTP B;  2EXZ A;  4KHV A;  1UUP A;  1Y69 U;  3EQL C;  1CZG A;  2LY7 A;  3I4M B;  2LMC B;  2BA0 A;  1QB5 D;  4XQJ A;  4OIJ A;  2F0S A;  4U68 A;  4B08 A;  3DM1 A;  2VB2 X;  1F2M A;  3HOX B;  5EKI A;  4KMU C;  5C0X I;  3PUW A;  3SHL A;  3GTK B;  3ND8 A;  2WV6 D;  2EY6 A;  5FOB B;  2O2L D;  5C4X B;  4RWS C;  1DOM A;  1HQM C;  2ID0 A;  3WDN A;  1DYQ A;  5I6Y A;  1SE4 A;  1TWF B;  2NUC A;  2WKC A;  1SYB A;  2HDM A;  1SYC A;  2ICI A;  3TP6 A;  3TSS A;  4LAA A;  3KLR A;  3HRZ C;  2BCO A;  4H0L C;  1SYG A;  1PTO D;  4KKS A;  1GUO A;  2EJM A;  5C3E B;  3H09 A;  2FMC A;  4KY7 A;  2MUY A;  4ZUI A;  1UEA B;  5M5X B;  3D8G A;  3LX0 A;  4KV6 A;  4Z9C B;  1B4O A;  3VYS A;  3BVZ A;  3OWF A;  3D6W A;  2AQ1 B;  5KEE A;  4H7B A;  3S2D B;  3RUZ A;  3VR5 A;  2K5D A;  3V05 A;  5DAU A;  3X3N A;  1UNS A;  1LAB A;  4QUF A;  3R2I A;  5I2Y A;  3BS1 A;  2Q8T A;  1BF4 A;  3A56 A;  2PNR C;  4HED A;  4RKB A;  4IFD J;  1I4Q A;  1IHZ A;  1ENA A;  1H9K A;  4DAV A;  1GUN A;  1LTT D;  1DOL A;  1DJR D;  3S16 B;  4H13 C;  2K05 A;  1C8C A;  4MIU A;  2F0K A;  2EJF C;  2X69 A;  4HMJ A;  1JOO A;  1D1K A;  3QOL A;  4DNR B;  1YNN D;  5JEA G;  3UI2 A;  3KUP A;  5C5M A;  4O1N A;  1LT3 D;  4WOR A;  3RZD B;  5NUC A;  2F0M A;  5DNF A;  1V8Q A;  1Y8P B;  1B1Z A;  2NZ1 D;  5ISR A;  2RDF A;  4J1M A;  2D9U A;  4X3S A;  1SDF A;  4BBR B;  5EJW A;  2NVY B;  5CV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...