2TMPA

N-terminal domain of tissue inhibitor of metalloproteinase-2 (n-timp-2), nmr, 49 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease inhibitor
molecule keywords TISSUE INHIBITOR OF METALLOPROTEINASES-2
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 1998-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tmpA00
3OHXC 3HRZC 3L3OC 1GXDC 5JPNC 2A74C 1UAPA 5JPMC 2WIIB 1BR9A 3CU7A 1OO9B 5FOBB 2A73B 2ICEC 2TMPA 4ILWA 3V96A 1BQQT 4FXKC 3MA2B 1D2BA 2QKIC 3FRPB 1JB3A 3HS0C 4FXGC 5FO7B 3T4AC 3I70A 1JC7A 2B39A 2E2DC 1UEAB 1XWEA 5FO8B 2WINB 2J0TD 3CKIB 1PXUA 5FO9B 2XWJB 3G6JB 1BUVT 3KLSA 2XWBB 2I07B
chains in the Genus database with same CATH superfamily
4R1JA 2A1AA 4YY3Q 2JJQA 1BCPD 3AFQA 5LMNQ 2B2VC 1GHKA 2F1MA 4H0LC 1XPUA 5ELFA 4F87A 1X55A 3TZDA 1BNZA 3ULJA 4DR4Q 4DR4L 2RVLA 2JA8H 3MXGA 1EY5A 4K5WA 3HOWH 3J80c 1N33L 1TQOA 2PNHA 1DZ1A 2RDHA 4CJ0B 4JI0Q 3NTKA 4H13C 4ULLA 3NWSA 3H3VH 4DR5Q 1K9MC 3KJOA 1R9TB 3D8GA 4DR3Q 3PIOA 3ICEA 2VXWA 4ZCKA 5IGFA 5IWAL 4OWXB 2ICEC 5CV7A 4UHVA 1VQOA 1PH9A 2JE6I 2PO4A 2K1BA 5D3IB 2I5LX 3PIPA 3GTPH 3OWFA 4HAEA 4OELB 3D4DA 2A5HA 4JI2Q 3I4NH 1FL0A 4BY7G 1JT8A 3NUCA 1ASZA 3CPFA 3NQIA 4C3HB 5IE8A 1CA6A 2L15A 2FFKB 4G4KA 1PDQA 2K50A 1IZ6A 2JSOA 4GOPB 1D7QA 2LMCB 1GO3E 4FO2A 1YHAA 5KRUA 4DNTB 4QUFA 4KKUA 2K5HA 2AUJD 3V96A 3I4LA 1EY6A 1SR3A 1G6ZA 1K73C 2RSOA 3HEJA 1OXVA 4RGOS 3PUVA 4LF4Q 1PTOD 2N8NA 2UXBQ 4R9WA 3TP8A 1WI5A 3BZKA 4DAYA 1PYBA 2B2YC 4A3CH 4DFAA 1K0SA 3SK5A 1TWFH 3QG1A 5H1SE 2V4DA 2SOBA 1D5XC 2LKVA 2LY7A 4YCWA 4B9WA 3U4ZA 4L6TB 2F0WA 3K0XA 1PHJA 1A0IA 2EY2A 3TS0A 1CI3M 2NVXB 3K5LA 3V05A 1T9HA 4FYDA 1I6VC 3UDXA 1PYWD 4F88A 5IP7G 4HJ9A 2ZT9C 5IGGA 4CHTB 3TDQA 1YZ6A 3STBC 1X56A 3K0YA 4LF7L 1XMOQ 2VB3X 1LTSD 3G48A 1I4GA 4C3JB 5EKIA 2A68C 2NB0A 3CRKC 1JOKA 3H0GH 4UP8A 1A63A 4FXDA 2NVTB 2HHHQ 4JBMA 1I4XA 2F0TA 3I72A 2WAQG 4R4OA 3FRPB 1DXMA 3AQQA 1VQNA 3KK7A 4DV4L 1W6KA 2K33A 2WKDA 2UUAQ 4L5RC 2O5JC 1JOQA 2ZM6L 4B3RL 4DUYQ 3KJPA 2JA6G 1K3RA 1ET9A 3RR5A 4A3CG 2A6ED 1NE3A 1B7YB 3OYYA 4DK1A 4HIDA 3A56A 4BY1H 5M3MG 3L2PA 1B4OA 5JOBA 1PH2A 1U4PA 1KLUD 4HN7A 5BR8Q 2I46A 3K58A 2F4VL 3D3RA 1JOOA 4AYBE 2B2WC 1U5KA 4GLVB 1CTMA 2NN6G 1KNAA 4NW2A 1H9JA 1I3QB 4X62L 5AJ3L 4JYAQ 2BH2A 1HZAA 2OWOA 3I4MB 4JI6Q 5HGTA 3J80i 2HUGA 4GN4B 4AYBB 2EE1A 5JJLA 3QR8A 5JVH3 4B3MQ 3HOWG 1G51A 2O2LD 1X65A 3S1RH 1Y14B 1SBBB 1PTOH 5C4XH 5CV6A 2JA5H 5C3WA 3S1QB 3VA5A 2F0UA 2R93H 5EPLA 4RGTA 4DR7Q 2JK8A 5I2YA 5CV4A 3CQZB 4A3IB 3I4NG 3AMUA 1SNPA 3TP7A 1LTBD 5C44G 2WACA 3CCEA 2ZJQA 4JI4Q 4V190 3RMHA 4XT3B 4CBVA 2IX1A 2D9UA 3UE0A 4CDCC 4A93B 1JB3A 4JI1L 4DV2Q 1NMGA 1RHPA 2Y0SB 2HT1A 1EY0A 2A69C 2JP1A 1UWVA 3OIPA 3CCLA 1EEFD 2MNAA 2JA5B 5M5YH 2MFIA 2PI2A 5M3FG 3OHXC 5C4XB 2EYMA 1FNWA 4QL5A 3SHLA 1C4QA 3I73A 4KKSA 4KY7A 2EDGA 1G291 4BY1G 3PO3G 2R93G 2A6HC 2KJXA 3QJYA 4DR6Q 3ERSX 1GKHA 3DEOA 3T4AC 1EYAA 1J6QA 1XTDA 4DV5Q 1F2ZA 1JE4A 4BXXG 2K01A 3E0EA 3AFPA 1H95A 4R4CA 4BBSB 1YBYA 2XWJB 4OHJA 4KJNA 3CAMA 2I0QA 3KLSA 2F0SA 1TWAH 2RA4A 3BS1A 3C3LA 2PPBC 3GTKB 2WB1B 4AH6A 2YTYA 2KA7A 3BVMA 1QZGA 5ELOA 2QDBA 3ONAB 5IP7H 1ENAA 1IBML 1HR0Q 3HOVB 1K8AC 1CA5A 1DD2A 3KDFA 2RBMA 1X6OA 3Q22A 3KDFB 4K14A 1H9SA 4IUVA 4CJ1B 2NWGA 5M5WH 1JICA 3RNUA 4LF5Q 2WB1G 2NVYB 1HJPA 2XVSA 5IP9H 2HQEA 2YU9H 3RN2A 4J15A 1Y1VB 1VQGA 1VQ9A 4POFA 1J5EL 3EBEA 3SVMA 4YWMA 4Y7NH 3U4VA 2Z4IA 1WCMG 4ZYSA 1IW7D 1EU4A 3K5OA 4KHPL 4DV4Q 1JC7A 4LFBQ 1YNJC 3H94A 4FF3A 4DUYL 2D0PA 3H0GG 3G6EA 1S40A 1DM0B 2R92H 3BDOA 3SK6A 1WTXA 4B3TL 5C4XG 2NVXH 1QOHA 4RCOA 1K8GA 2ZM6Q 2A6HD 4A3BG 4HJAA 2D62A 1UUPA 4POGA 3CD6A 4A3KH 3ULPA 4DUZQ 1VQ4A 2LFNA 2VY3A 5IGCA 2E2DC 4DXFA 1N8RC 4JPBW 1O80A 1F9QA 3HG9A 1QUQB 3OPOA 3Q23A 4PZ7A 5DEHA 1M1KC 1U4RA 1PRTB 2F0DA 1WTHA 3MC0B 1WFQA 1QCBD 4JK1C 2OEOA 1TIID 3BVZA 1FVIA 1PTOC 5KGUA 2E2IH 2KEEA 2K5QA 3GTQB 4NXNL 5AJ3Q 1N34Q 3PMFA 1U4MA 3X3MA 3K7AB 3NHHA 4AQYQ 2F0QA 1T5XD 3EN2A 1A3TA 3E9HA 1KDAA 2ZJRA 2OQ0A 1HFGA 4X66Q 3ULLA 4OO1I 5JEAH 1MIUA 1FD7D 2Z8LA 2KOLA 1G91A 1XNRL 1KRTA 3QOJA 2TSSA 3E0JA 1L0YB 1DOKA 4DV1L 1N36L 2OTLA 2A19A 3RD4A 4MN3A 4ZKBB 2N49A 2ALYB 2R3ZA 4EGVA 2Q2HA 3FPPA 3R2TA 3KF6B 4RHRA 3MZ5A 3L9AX 4DAYB 5IYBG 2M9VA 3CRLC 2JXMB 3J81E 1HH2P 2MO0A 1PH7A 3J81c 2UXCL 2YTVA 2Q8TA 2IHFA 3H6MA 1SYBA 3A7LA 2XIWA 4NKLA 4QY7A 3A55A 3G7LA 1YHQA 4JBJA 4O0AA 2B2WA 3P7JA 2NVTH 2WFWA 4IUNA 1CK1A 4IUQA 2R61A 4JI8Q 1F77A 3HKZG 5C6AA 4WJ3M 1VQ5A 2IWHA 3S24A 1VQJA 4WRDA 4KK7A 3GTQH 2EQSA 3VDYA 4A3GB 1BBWA 4YHHL 2DY7A 4XTCS 1CKOA 1SE2A 4IFDG 4GKJQ 5TSSA 1YVCA 4J1MA 3GV6A 3J7AV 2EJGC 2R92B 3W1GA 5CR3A 2L9HA 2B2VA 3VR2A 3S1RB 1VDZA 2XTIA 1RIPA 2CHBD 4HIOA 3J7A5 2JA8G 1VQBA 1STHA 1S5FD 2HDMA 2K6AA 3J7ZC 1O7YA 1HCZA 1CSQA 2L12A 4IUPA 4Y7NB 1PFSA 1OO9B 5FOBB 4FF2A 5JAVA 2AQ1B 4ZUIA 3S15H 2UXBL 2B29A 4RWSC 2E5LL 4FVMA 4BWGB 1NJIC 5KNCA 4JI3Q 4TRDA 4AIMA 1EY7A 1SNCA 1SE3A 4XQJA 2KENA 4RGNA 5CV8A 2HD3A 4C3JG 2MHVA 1HZ9A 3CCSA 2PZUA 3HOXH 1D8LA 2CQAA 2D2CC 2GVBA 5IIFA 4B3TQ 1I94L 2ICIA 3HOYH 1MD2D 2R7ZH 5KYLA 1LYLA 2TMPA 3JC66 4FXKC 2KHSA 1TWHB 2X6LA 3HS0C 5T1IA 1TWAB 2K03A 2B39A 2OTJA 1K8MA 4CDDC 3M4OB 2SDFA 2Z0SA 3E3XA 3S14B 3S15B 3NEMA 1J5EQ 1PZID 4JYAL 2F3WA 2EYJA 1IKLA 2BDOA 3H0GB 1HNWL 1MBYA 3IAYA 3LX0A 4ID6A 3CPWA 1UE5A 2JA8B 1G8ZD 3LWEA 1HFNA 1A15A 4YY3L 3BG3A 4CJ2C 1UE1A 4AQYL 2VUMG 2PYKA 1JJGA 4CKCA 1PMRA 3NWTA 2X6GA 1A3UA 1K3BC 2VW9A 1VQ7A 2F0MA 2J7ZA 4A75A 1VQLA 4GOPA 1YJ9A 4KN4C 1HRJA 3N52A 1DYQA 1EOVA 4A3LG 3TQYA 1B3QA 2V1CC 4QQBX 4JI4L 1EFWA 3D6WA 4BY7B 1M90C 2H4OA 1XNRQ 5M5YB 1BOSA 1EQVA 1B9NA 2AKWB 3GTGH 4BY7H 3T51B 3D4RA 3VR5A 3AEVA 1OXUA 5EQ0A 3HOUH 3PUXA 1EWIA 3GDEA 4K0KL 2QF7A 5IT9L 4XYQA 1LTID 2KCCA 3VR4A 4A93H 2Q8IB 4IO9A 2UU9Q 1VF5C 4LWCA 2DY8A 2KQ3A 3HOXG 2UXCQ 3FEWX 5JPNC 2O5IC 2MP1A 2J4XA 4OONA 4CKBA 2UXDL 1HUNA 2HDLA 1E24A 3U9SA 1JWUD 1YNXA 1HUMA 4GN3B 4C3HH 1PRTF 2EJMA 1SE8A 3Q0AA 1A6XA 1RODA 1ZYRD 3FPUB 5C4ZA 3CW2C 2JA5G 2JA9A 1RDPD 4DV5L 1CKNA 4P75A 1HNXQ 1CHQD 3OOCA 3NBHA 4GNXA 3KFUA 1G6PA 1SNDA 3PGZA 3CU7A 2M2LA 2R7ZB 4OXPA 4MTNA 4X65Q 1FJGL 1EWCA 4N9TA 1SFOB 4EQ5A 4CDEC 1QJOA 2UUCL 5J22A 3PCOB 1AN8A 1F9PA 2R7ZG 1OXSC 1IBMQ 1EIHA 3GTJH 5C44B 1PH5A 2A68D 4BBRG 1CKMA 4A3IG 1VQFA 4HSVA 2EY5A 2H1EA 1F2MA 2PQAB 2ZXOA 3HGBA 5T1GA 1Y1WB 3VR3A 4RKLA 3WDNA 5BN4A 4EQOA 2K5WA 3I56A 1XPRA 4LF7Q 3A54A 4Q5VA 4QB4A 1HA6A 2F0HA 1A3VA 5C5LA 3M3YH 4MNOA 2B2TA 2E5LQ 1HXYD 3HOZB 2EPBA 5CV9A 4DV7Q 3F2BA 1Q7YC 3PF4A 1LT3D 5LMUQ 1YJNA 3BVGA 1V8QA 1YNND 1I94Q 3ZYYX 2XSCA 3S1NH 5EJWA 5DM73 1TS2A 1WTWA 2DNCA 1L1OB 2PQEA 5GROA 4H02A 4IALA 5KEEA 4OO1H 3H3VI 5C4HA 1VQCA 4B3SQ 1RTNA 1V9PA 1F9SA 3OW7A 1BBXC 3G71A 4QIWB 3TRZA 1I4HA 4G7HC 3T1YL 1QVFA 3X3NA 4DR2Q 5ISRA 3O13A 4KHVA 3ERQA 3J80E 1Y1WH 4A3GH 1TWFB 1KD1C 4Q0FA 1GUSA 3PO3B 1Y1VG 4L5QA 4OIKA 1V1PA 2VUMB 4BA1I 2BCOA 1O78A 1VQDA 5LMNL 4DN4M 5M3FB 4OWTB 1KC8C 2K05A 4ZQ3A 2RQXA 4ZK9B 2NTSA 2XWBB 4X64Q 5C44H 1AEXA 1K28A 2XRSD 1X54A 2Z9HA 1YJWA 4KTAA 4JI0L 1M4VA 3MA2B 1RD9D 2R7DA 4XQNA 2KHJA 4JW0A 1ZXTA 2UUBQ 3HP3A 5IWAQ 1Y8OB 1GOZA 2J0TD 3NK9A 1RJTA 2YYZA 2JA7G 1E7ZA 4R4TA 4BS9A 4DAVA 4X3KA 3LWUA 3KLSX 3MXPA 4KI0A 2RF4A 1EZ6A 4HSPA 1O7IA 1NCVA 2VQEL 4M8AA 4DGZA 4HIKA 2E76C 4YWLA 3CMEA 1LUZA 1Q86C 4GLAC 4R4QA 4B3ML 4JG2A 1SSOA 1SMYC 1IXRA 1CZWA 1Z7TA 3BZCA 1S72A 3RZDB 4KLKA 2BE5C 3HOUB 2F3IA 4JCVE 5E4XA 3JAME 1NR4A 4DAMA 1LT4D 3KF8A 4C3IB 2E2HB 2KCNA 2CH4W 4JI8L 3R93A 1SLJA 1Y69U 4UP9A 5K5PA 2VQFL 1N32Q 1WD1A 4F8MA 1U0LA 1RKNA 3HRZC 2A74C 5FJ8G 4LF4L 1I4QA 3PUWA 2ZTCA 1VMPA 3TREA 3OTOL 1KNEA 4RH6A 1XPOA 3A74A 2DJGC 5J1ZA 1E3PA 3A5ZB 5C4JH 2D5DA 1L0WA 1XMQQ 2MPMA 5IGBA 1KLGD 1EY9A 4JC0A 2C35B 3CC7A 2K5DA 4H7BA 4RAUC 2EYOA 2F0JA 4JV5Q 2QGQA 1FNVA 4DPGA 3MEFA 1MI2A 2GN5A 5BN3A 5KYIA 1SAPA 4YCUA 3I70A 5IYCG 4DV7L 3CCRA 5C0XI 2NVYH 3G4SA 1LTAD 1KAWA 3CC2A 3M4PA 2PW5A 1QNKA 1VQKA 3A5UA 4JI3L 2JN4A 2HCCA 4KHZA 5JVG3 2L5TA 1VQ6A 1PRTC 2YU9B 3EVQA 4K2KA 3JAMc 2DJFC 2IL8A 2BA1A 1YNNC 4DK3C 4UAIA 1VQ8A 1M8AA 1ET6A 4P74A 1MHWC 3A0JA 2OT2A 1SMYD 1BUVT 1BCPF 2IX3A 5A2QE 4KKTA 2SNMA 1LABA 1XYIA 4HCEA 4LK1C 4PQXA 1FYCA 1SMXA 3M9BA 1PYSB 2JA7H 2F0OA 4B3RQ 5FJ8H 4DR2L 5CGKA 1GUWA 1TS4A 3LNNA 2PMZE 2B3GA 2K14A 1GVPA 4WJ4A 2G5DA 4RKBA 3C1FA 1SE4A 2I5MX 3T53B 2XRQD 1EY8A 2VZAA 5JJKA 1T5EA 3IRBA 3AB9A 2B2UA 2KECA 2ZTEA 4LJZC 1X32A 3NSWA 4DA2A 3S17B 5BR8L 1IBLQ 2MQHA 1MGSA 3J7YW 3SR1A 4IUUA 3T13A 4J6HA 3RZDH 1KQSA 4OO1G 1CQFA 2BA0A 3VA7A 1IW7C 4K2LA 1CQVA 2CWAA 5EGTA 4WFN3 1IL2A 1SROA 2EXDA 3OIQA 4QJFA 1Q12A 5CV5A 2NYZD 1KAAA 1PTOB 1WCMB 4KN7C 2VQEQ 1P16A 3UDGA 4L5TA 5JEAJ 2FMMA 4PMBA 4HJ8A 1KIXA 4A3JH 1STBA 4G57A 1HZCA 1ZYRC 5HURA 5C0XH 3CQZH 1O7ZA 1Z47A 4A3IH 3M7NA 1NSNS 2AMCB 3RLNA 4DF7A 1HNZL 1HQRD 3MXNB 1H9RA 1TU2B 1LT6D 2I5HA 4A3BH 2E2JH 1RF2D 1EOTA 1QILA 1G2SA 2AHOB 4YCVA 4K5XA 4UPAA 3EIVA 2FINB 2BOSA 4LFCL 5D3DA 4OGQC 5C3XA 2H5XA 2JEBI 1YIJA 2BE5D 1PTOF 3S16H 5IT9c 5EKLA 4QCLA 1TY0A 2K52A 4JI1Q 1J8IA 4YHHQ 2B8FA 4LF6L 3K7AH 1H9MA 4DAPA 4LF6Q 4EX5A 5EAYA 2P5ZX 4XIGS 4OWWB 3Q8DA 2E2JB 2JEAI 1S5BD 2B63G 1CKNB 3A8JE 3G6JB 1PH1A 3D6CA 3SE0A 3LGJA 5IP9G 1B53A 1LT5D 3L7ZC 4BY1B 3T56B 1ICWA 2HQLA 3K59A 4NXMQ 2CW0D 3GTOH 3P20A 2NZHA 4TVAB 4XQQA 2EIFA 5EKKA 4C3JH 2F0VA 3F2DA 1D6EC 3KLRA 5DLQE 1LTLA 2Y0SG 2OF1A 3HOYG 1PLFA 4KD3A 5M9OA 4MIUA 1DOLA 4GKJL 2E74C 2A6EC 1JR0D 2MO1A 3FDTA 4FP5D 1WTRA 1BKBA 4LFAL 4WJWA 3MFGA 4LF5L 1VQEA 5FO7B 1TVXA 4LAAA 1C0AA 1HZBA 4MZ9A 4A3FG 2R6GA 3PIO3 2F0GA 2ES2A 2ATWA 1DJRD 1N9WA 1F9RA 1PH6A 1KXLA 1XWEA 2KVMA 5IOCA 1B8AA 1XXGA 3T16A 1EWHA 3S1NB 4IPHA 2K04A 1LV9A 2Q8RE 2EJFC 1NNXA 2CFMA 1FNUA 2B8GA 1HPCA 4DR1Q 3VYRA 4GOPC 2FJ2A 5A35A 3GTJB 2RHQB 1Q1EA 3CHBD 3T1HL 4QUCA 3WWVA 4A3EH 3I4MG 1JJCB 4GZYC 2EY1A 4LFBL 2QEXA 2VS1A 4IZ8A 3I3CA 2RCFA 1TY2A 3IKJA 1S4ZA 1AE2A 3NTIA 2I07B 4P72A 1VCIA 1LACA 2WAQE 3U50C 3L3OC 5M5WB 3PF5A 1HA5A 5M3MB 3CMAA 5KNDA 4RCNA 1PFBA 4DNRB 1CUKA 3F8TA 4LF9L 1SFOH 4BBSH 3M4YA 2NBFA 1PH4A 4A3DB 4FXGC 5JJZA 4BBRH 1JB7A 3NBIA 1WTQA 2F4VQ 1TS3A 1UEAB 3NENA 2A69D 3R3OA 1BVSA 5FO8B 1UE6A 1GM5A 3H09A 4O1NA 1IBLL 2IY5B 2F0EA 4CDFC 2RSNA 4HMIA 2DGYA 3PSIA 5C0XG 4ME3A 5GADC 1UAPA 1V1PB 4NXNQ 3D4WA 2F0FA 2MGSA 1D2BA 4A3MG 4C2MB 4DV3L 3K81C 3BU2A 1C48A 1B2TA 5F2DA 4JBWA 4PZ6A 1PRTD 4A3JB 2VL6A 2WAQB 3KLWA 1UE7A 1QVGA 3NQTA 1ENCA 4DR5L 1HR0W 2VUMH 2PNRC 3MHBA 1VQPA 2CH4A 3HKZE 3J81L 3FVQA 3EQLC 3EROA 1PFMA 1ZEQX 2KEDA 1EU3A 4RFBA 4DR3L 2A8VA 4HIMA 5IT9E 5D65A 4A4IA 4JI7Q 1DONA 1S5ED 1Y8NB 3A8IE 4GKKQ 5CYUA 4IPCA 1I50B 1F2YA 4OL7A 3OTOQ 4A3FB 2E75C 1SYCA 1IBKQ 4LF8L 4K0KQ 3BJUA 4IJLA 1ML0D 5ELCA 3HOUG 1ICFB 3SEBA 2LXJA 1J9OA 3GD7A 1DOMA 2BDNA 1Q8KA 3PUYA 4Y52H 1VQMA 1SYGA 1IL8A 3PV0A 2C9OA 2K4KA 1ENFA 3S1QH 2A73B 3M4QA 4DR6L 3S9WA 3I4OA 5C0XJ 3MWYW 3OMGA 3CC4A 2NTTA 2WV6D 3L0OA 4S3SA 1TKWB 2Q2IA 5IYBH 1HNXL 4C3HG 2JA7B 2EYPA 2Z6BA 3VYUA 3NXWA 3NE5B 2NN6H 3EA6A 4DK6C 1P8LA 2CQOA 2ENBA 4A3EG 3I4MH 2R92G 1KDBA 2VNUD 1I3QH 1WYDA 1JE5A 1QB5D 2FXQA 1WD0A 1XNQQ 5M3MH 1EZ8A 2NZ1D 1VF7A 3IFTA 3C46A 1IKMA 1V1QA 1VS0A 2LS01 3V2TA 4NB3A 3TP6A 2CCZA 5CBEE 3NPPA 1Q90A 2F3VA 1ZKOA 1TXYA 2XNAC 4V0BA 5M3FH 3GTLB 2L55A 1SEBD 2OXPA 3TP5A 4A3EB 3GTKH 4HMJA 2HHHL 2CKZB 4K6LA 5K36H 3P1HA 2F52A 1SNQA 1X3FA 2WB1E 5IGEA 1EIGA 4KY5A 3DLLA 4NDXA 4P73A 1GUOA 1SN8A 1YHBA 2RKSA 3BDLA 3QOLA 1ESRA 2F0LA 3PO2B 3S2HB 3AU7A 2PW7A 4B9XA 4PNYA 3TEHB 5J39A 2Q2TA 1OTCA 5C4JB 1BR9A 2NUCA 1JWMD 4O2DA 5G3LF 3FKIB 1I50H 3T1YQ 4HEDA 1B1ZA 2JA6H 1K0RA 5C5MA 4FDBA 2OCEA 1B50A 4YWKA 3VYTA 3E6ZX 3S1MB 3RZOH 1DCZA 3DWQA 1H9KA 3HOZH 1C9OA 2UUBL 3MFYA 5E3FA 1X3QA 3H15A 4OIJA 1MKHA 4GNXC 3CXCA 4APVA 1CSPA 4FF4A 2KCMA 3UDIA 1STEA 2RHSB 1IYVA 3SK8A 3FHWA 1L2FA 4LUZA 3E9IA 5ELBA 1RL2A 2R93B 2VB2X 3U58A 4IFDJ 1SJHD 2AWNA 5L37A 1BXTA 1CHPD 2SNSA 1S3OA 1STYA 3BYTB 2AWOA 4I7AA 1AE3A 1SNMA 4RHSA 3F2UA 2L11A 1LTGD 1PZJD 2EVBA 5I2XA 1EL0A 1I4RA 4X3TA 1D1KA 4FNFA 4DKAC 1EIFA 4A3DH 4HJ5A 3DWAA 5FLXc 1U9RA 3PIP3 4OEMB 3RLOA 1QZHA 2UXDQ 1IHZA 2CW0C 1Q8IA 4DV2L 2EOTA 1IBKL 4DV3Q 4LF8Q 1JWSD 2E2IB 3CF5A 2PZWA 4A3JG 2Z6KA 4C1NI 4DV0L 1TWCH 2BH8A 4DV0Q 2YV5A 2Z1CA 3HOXB 4NXML 2EZVA 3CCMA 1PFNA 4DR7L 3DM3A 3BYYB 4A3MB 5E4WC 4XDXA 4FF1A 1HHVA 4MHEA 2F4IA 2JYOA 4IURA 3HZXA 2IHEA 5FLXL 3S1MH 2CVRA 1QUQA 1PXUA 3J7AF 1AZQA 2PCFB 1Q81C 1EQRA 1QE6A 4X65L 3ND9A 1FJGQ 1LM0A 1L0XB 1EY4A 4M1UB 4QF4A 2NVQH 3HOVG 3S17H 1NBWA 3GTGB 2K5NA 1HTPA 1UNSA 1I6HB 4C56C 5FLXE 1WVLA 1LLRD 4L8JA 3MTSA 4A3DG 1MSHA 5A2QL 4R8IA 1A62A 2Q2UA 2NN6I 4IPGA 5HGQA 3VR6A 3SXHA 2UUCQ 4C3IG 5K36G 4RGMA 1S5DD 3CCJA 1X9NA 1E0BA 1STNA 3U9OA 1L1OA 4EQPA 1W2BA 3IL8A 2N3SA 3KUPA 1Y1VH 4PMWA 2SEBD 4KY6A 3D0FA 4K8JA 1SJED 1STGA 2WIIB 4LW1A 5IYDG 1WTVA 1LO5D 5CC4A 3JAML 1SYFA 1OXXK 4K8IA 3R8BA 5ELDA 3WOFA 3TSSA 5IGDA 3HKSA 1XTCD 4G7ZC 5I9PA 3S2DB 2R7FA 4LNQA 4L63B 5C3EB 5EPJA 4BXXH 5M5XB 1WTPA 5ELNA 4KMUC 3UE1A 1EYDA 4IFDH 2KCTA 2Z4HA 4JOIA 3K7UC 5I9OA 1NTGA 2XN9C 5E1FA 5M5XH 3R2IA 1ASYA 3P75A 3GO5A 4HR7B 1X3EA 5JEAG 5GAHC 1K83H 4QGUA 3HKZB 1EQQA 2F0KA 3I4NB 3ND8A 2IPKD 2XGTA 2G9DA 4PV1C 2ZJPA 3T1HQ 1HNWQ 1R4QB 1VQHA 1ESFA 2ZXRA 1V43A 1X3GA 4UP7A 1E2WA 2FHTA 4KD4A 4YIJA 4DU9A 1B70B 4DK0A 2PQAA 4AYBG 1G2TA 1HQMC 1C7YA 1SYEA 4I65A 3HFZB 2GA4B 3GP7A 1TWGH 1S5CD 1N34L 1QWYA 1QG7A 1JCKB 2MUYA 4BA2I 1PH8A 3MEHA 4H44C 1LTTD 4X64L 4A3FH 2PZTA 2B63B 1YI2A 4L5SA 1A8VA 3W2DA 3RLFA 3SK4A 4KV6A 5ELEA 1A2TA 1KTKA 3KF6A 4IFDI 2VQFQ 1N32L 2QW7A 4X6AH 3K8AA 4DV1Q 1N36Q 4GKKL 5FKAC 4XT1B 3SGIA 4JI6L 1GUNA 3B6YA 2F03A 2K5VA 2QEJC 3M85A 5CMDA 2E8GA 3CKIB 3GTOB 2KUMA 1K8OA 4C3IH 2E2HH 3I91A 1Z6HA 2N88A 4ODGA 4C1NK 1TWGB 2UU9L 4QIWE 2HIXA 2B2YA 4A76A 5J3BA 3D31A 1STAA 5CBAE 3ER0A 5HY6A 4PMCA 3SDZA 1WJJA 4X66L 3I55A 1H9SB 2HIVA 2RDFA 1Y8PB 2LXKA 1OXTA 3VYSA 5D14A 4N8X1 4U673 1RTOA 4RMFA 3S16B 3K6OA 1B9MA 4JI5L 5G3LD 4JI5Q 2PI2E 4C2MH 3A7AB 4X3SA 4P71A 2OQKA 3FP9A 4BBRB 5LMNW 1NUCA 3FKIG 1PV4A 4IUTA 5EBDA 3S14H 1SRUA 5KNBA 1KDCA 3K5NA 4A3BB 3W3AA 1TWHH 1JJ2A 2LSSA 1MJCA 4ZRZA 1XMQL 5LHY1 1O7LA 1YEZA 1EFID 1GUTA 1XX8A 3W5OA 3HOYB 3HOVH 1QNUA 5AFWA 4MTKA 2Y0SE 3KF8B 4LUVA 3QO2A 1AFPA 1DGSA 1IYJB 4IQZA 4JV5L 3OWEB 4IJHA 1WCMH 3PO3H 2N78A 4ALPA 3RZOB 4ZUJA 2EYHA 4RG1A 4EQNA 4NP5A 4IPDA 5C3EH 4B08A 4KHPQ 3EFXD 1NR2A 2C5CA 3FKIH 2G9HD 2KBNA 3I8ZA 5LMUL 1BCPC 2FMCA 3EJIA 3IFDA 1XNQL 2PMZB 3OMCA 3DMUA 1II3A 3TBIB 2K7VA 2F0PA 1D1IA 1BBUA 4DV6Q 3ITPA 3S2HH 3DUZA 1PA6A 1Q46A 3UDFA 3PO2H 5I6WA 1XJVA 1E2VA 2MJ8A 4DUZL 1JORA 1X3PA 4B3SL 3OSOA 1EQTA 4JOIC 4R4IA 3GQBA 4N9PA 5EBCA 1F2LA 1EYGA 4P2CB 3MXNA 1Q82C 3RN5A 3W1BA 2O4XA 5FO9B 4DR1L 5IY0A 4RA8A 5GAEC 2QILA 4A3MH 1FGBD 3DXJC 1GXDC 5FLMH 4GLXA 4PG3A 1U4LA 3K5MA 1E1OA 2QDLA 3J80L 2IW3A 5IYCH 1BCPB 1I4PA 4J8QA 5DAUA 4O42A 4XYOA 2F0NA 5IODA 3JAMi 4KJOA 4DNIA 1NY4A 5COYA 2F0IA 3J81i 4DXGA 2EXZA 4NMZA 2ASBA 2AQ3B 4NPSA 3PUZA 3DWPA 3BZDB 4LF9Q 3MXUA 1R4PB 2WKCA 5DM63 3GV3A 1R9TH 4CKEA 4A93G 1AW7A 3F1ZA 4N8FA 2B2TC 3BDCA 3GTPB 4K6DA 3QIAA 2QA4A 4TQUS 1NMFA 5C3EG 4K5VA 1UEBA 1KL9A 2HCIA 4BBSG 2WINB 2DNEA 3CCUA 3Q6SA 5FLMG 4EVOA 2YTXA 2ZXPA 4LUOA 4Z9CB 3PQIA 3ZJYC 2NZOA 3F2CA 1AP0A 1D5MC 1B44D 3KOJA 5KIXA 3HOWB 5JPMC 1FGUA 1SYDA 1N33Q 4IN3A 1GHJA 4JVZA 3FMCA 3N6RA 3K57A 4TSSA 4QMGA 4IOCA 3STBD 3CCQA 1E1TA 4ZAIA 1GJXA 1HNZQ 4E6IA 1KABA 2AQ2B 2IJ0A 5DNFA 3NP8A 4ME5A 1LTRD 3C2PA 1A2UA 1TT2A 5JJIA 1KRSA 2EYLA 3RUZA 4LMQD 1MJEA 3GTMH 2B63H 4JI2L 3NELA 1AZPA 2L4NA 4JI7L 4LFCQ 4A3GG 2IX0A 1ILPA 5I6YA 3A8KE 3MVVA 4R8NA 2DUDA 4OX9L 4A3KB 4OX9Q 1YITA 1JQYD 1Q3LA 1CZGA 4G7OC 2JA6B 2ID0A 1ONLA 1Z9FA 2GVAA 3DHQA 4GN5A 1HR0L 3DM1A 2QCPX 1D5ZC 1B3AA 1CM9A 2L0CA 2N55A 5NUCA 1WOCA 3TS2A 4CGYB 4IOAA 4UDUC 4PZ8A 1E22A 2K28A 3TZUA 1GD7A 1GUGA 3CCVA 1WTOA 1I5FA 3J81j 1EEID 1HTLD 4XXEA 3M3YB 2DN8A 3HOZG 3I2ZA 1K83B 3MAQA 3GTLH 1KHIA 3AYHB 3URYA 1ILQA 1CFMA 1L1OC 2ZTDA 1V1OA 3Q24A 3M4OH 4A3KG 2UUAL 3NBHB 1VQAA 4GNXB 1W6JA 1SNOA 2AUKA 1E2ZA 4X3UA 1BQQT 2KHIA 2X69A 1PH3A 4LFAQ 3S2DH 2QKIC 4F7XA 5I4DA 3QWNA 1EIYB 1PVOA 4A3LH 4ABNA 2D0OA 4ZLTF 1C8CA 3TN2A 5EPKA 3KYHC 1BF4A 1TS5A 5GQOA 4HJ7A 3E5SA 2RDGA 1XMOL 1W3SA 3KBGA 2EYFA 3H91A 1FR3A 1SDFA 2K75A 4U68A 5IYDH 1Q1BA 3WOEA 1PZKD 3NTHA 3OW2A 4ILWA 4GS3A 1EYCA 2K32A 4JBKA 1AH9A 5FK9C 4HCSA 1EUJA 1RCVD 2JQOA 2Z6KC 1MSGA 1SXTA 4I7ZC 3CP0A 5LL6X 4DV6L 1Y1WG 1QVCA 1TR5A 5GAGC 1I6HH 1BO0A 1VQIA 1YNJD 3K80C 4HTHA 3H3VC 1VMCA 2NVQB 3DEPA 4ZKCB 2RCNA 5BN5A 3QB3A 3GTMB 1NAPA 2B2UC 3C1EA 3UI2A 4X62Q 3M7GA 4TKOB 1CT1D 5E7NA 2EY6A 2L1BA 3I90A 3PO2G 2IT1A 3KBXA 2M00A 2WP8J 4WORA 3TMEA 5LL6S 5CORA 1BDOA 1JMCA 4UY8C 2CWPA 1IYUA 1TWCB 3I7FA
chains in the Genus database with same CATH topology
1BCPD 2B2VC 1GHKA 2F1MA 4H0LC 5ELFA 4F87A 3TZDA 1BNZA 2RVLA 3MXGA 1EY5A 4K5WA 1TQOA 1DZ1A 2RDHA 4CJ0B 3NTKA 4H13C 4ULLA 3NWSA 1R9TB 3D8GA 2VXWA 5IGFA 2ICEC 5CV7A 2JE6I 2PO4A 2K1BA 5D3IB 3OWFA 4HAEA 3D4DA 2A5HA 3NUCA 3NQIA 4C3HB 1CA6A 2FFKB 4G4KA 1PDQA 2JSOA 2LMCB 4FO2A 5KRUA 4DNTB 4QUFA 4KKUA 2AUJD 3V96A 3I4LA 1EY6A 1G6ZA 2RSOA 3HEJA 1OXVA 4RGOS 3PUVA 1PTOD 4R9WA 3TP8A 4DAYA 2B2YC 4DFAA 3SK5A 3QG1A 2V4DA 2SOBA 1D5XC 2LKVA 2LY7A 4B9WA 4L6TB 2F0WA 2EY2A 1CI3M 2NVXB 3K5LA 3V05A 4FYDA 1I6VC 1PYWD 4F88A 2ZT9C 5IGGA 4CHTB 3TDQA 3K0YA 2VB3X 1LTSD 1I4GA 4C3JB 5EKIA 2A68C 2NB0A 3CRKC 1JOKA 4FXDA 2NVTB 1I4XA 2F0TA 3I72A 3FRPB 1DXMA 3KK7A 1W6KA 2K33A 2WKDA 2O5JC 1JOQA 1ET9A 2A6ED 4DK1A 3A56A 1B4OA 5JOBA 1U4PA 1KLUD 4HN7A 2I46A 3K58A 3D3RA 1JOOA 2B2WC 1CTMA 2NN6G 1KNAA 4NW2A 1H9JA 1I3QB 3I4MB 5HGTA 2HUGA 4AYBB 2EE1A 5JVH3 2O2LD 1SBBB 1PTOH 5CV6A 5C3WA 3S1QB 3VA5A 2F0UA 5EPLA 4RGTA 5I2YA 5CV4A 3CQZB 4A3IB 3AMUA 1SNPA 3TP7A 1LTBD 2WACA 4V190 3RMHA 4XT3B 4CBVA 2IX1A 2D9UA 4A93B 1JB3A 1RHPA 2Y0SB 1EY0A 2A69C 2JP1A 3OIPA 1EEFD 2JA5B 3OHXC 5C4XB 2EYMA 1FNWA 3SHLA 1C4QA 3I73A 4KKSA 4KY7A 2EDGA 1G291 2A6HC 2KJXA 3QJYA 3DEOA 3T4AC 1EYAA 1F2ZA 1JE4A 2K01A 4BBSB 2XWJB 4OHJA 4KJNA 3KLSA 2F0SA 2RA4A 3BS1A 3C3LA 2PPBC 3GTKB 2WB1B 2KA7A 3BVMA 2QDBA 3ONAB 1ENAA 3HOVB 1CA5A 1DD2A 2RBMA 3Q22A 4K14A 1H9SA 4IUVA 4CJ1B 2NWGA 1JICA 2NVYB 2XVSA 2HQEA 1Y1VB 3SVMA 2Z4IA 4ZYSA 1IW7D 1EU4A 3K5OA 1JC7A 1YNJC 3H94A 4FF3A 1DM0B 3BDOA 3SK6A 1WTXA 1QOHA 4RCOA 2A6HD 2D62A 1UUPA 2LFNA 5IGCA 2E2DC 4DXFA 1O80A 1F9QA 3HG9A 3OPOA 3Q23A 5DEHA 1U4RA 1PRTB 2F0DA 3MC0B 1QCBD 2OEOA 4JK1C 1TIID 3BVZA 1PTOC 5KGUA 2KEEA 2K5QA 3GTQB 3PMFA 1U4MA 3X3MA 3K7AB 3NHHA 2F0QA 1T5XD 1A3TA 1KDAA 1HFGA 4OO1I 5JEAH 1FD7D 2Z8LA 2KOLA 1G91A 3QOJA 2TSSA 3E0JA 1L0YB 1DOKA 3RD4A 4MN3A 4ZKBB 2R3ZA 4EGVA 3FPPA 3R2TA 4RHRA 3MZ5A 3L9AX 2M9VA 3CRLC 2JXMB 3J81E 2Q8TA 3H6MA 1SYBA 3A7LA 2XIWA 4NKLA 3A55A 3G7LA 2B2WA 3P7JA 4IUNA 1CK1A 4IUQA 2R61A 1F77A 5C6AA 2IWHA 4WRDA 4KK7A 4A3GB 2DY7A 4XTCS 1SE2A 4IFDG 5TSSA 4J1MA 3GV6A 3J7AV 2EJGC 2R92B 5CR3A 2L9HA 2B2VA 3VR2A 3S1RB 1VDZA 2CHBD 1STHA 1S5FD 2HDMA 2K6AA 1O7YA 1HCZA 2L12A 4IUPA 4Y7NB 1OO9B 5FOBB 4FF2A 5JAVA 2AQ1B 4ZUIA 4RWSC 4FVMA 4BWGB 5KNCA 4TRDA 1EY7A 1SNCA 1SE3A 4XQJA 4RGNA 5CV8A 4C3JG 2MHVA 2PZUA 2CQAA 2D2CC 5IIFA 2ICIA 1MD2D 5KYLA 2TMPA 4FXKC 2KHSA 1TWHB 2X6LA 3HS0C 5T1IA 1TWAB 2K03A 2B39A 1K8MA 3M4OB 2SDFA 3S14B 3S15B 1PZID 2F3WA 2EYJA 1IKLA 2BDOA 3H0GB 1MBYA 3IAYA 3LX0A 4ID6A 2JA8B 1G8ZD 3LWEA 1HFNA 1A15A 3BG3A 4CJ2C 2PYKA 4CKCA 1PMRA 2X6GA 1A3UA 3NWTA 2F0MA 2J7ZA 4KN4C 1HRJA 3N52A 1DYQA 3D6WA 4BY7B 2H4OA 5M5YB 1BOSA 1EQVA 1B9NA 3T51B 3D4RA 3VR5A 1OXUA 5EQ0A 3PUXA 2QF7A 5IT9L 4XYQA 1LTID 2KCCA 3VR4A 2Q8IB 1VF5C 2DY8A 2KQ3A 3FEWX 5JPNC 2O5IC 2MP1A 2J4XA 4CKBA 1HUNA 2HDLA 3U9SA 1JWUD 1HUMA 1PRTF 2EJMA 3Q0AA 1A6XA 1RODA 1ZYRD 3FPUB 5C4ZA 1RDPD 1CHQD 3OOCA 3NBHA 1SNDA 3CU7A 2M2LA 2R7ZB 1EWCA 4N9TA 1SFOB 1QJOA 5J22A 1AN8A 1F9PA 1OXSC 1EIHA 5C44B 2A68D 1Y1WB 2ZXOA 2EY5A 2H1EA 1F2MA 3HGBA 4HSVA 5T1GA 3VR3A 4RKLA 3WDNA 5BN4A 4EQOA 2K5WA 3A54A 4Q5VA 4QB4A 1HA6A 2F0HA 1A3VA 5C5LA 2B2TA 1HXYD 3HOZB 2EPBA 5CV9A 1LT3D 3BVGA 1V8QA 1YNND 3ZYYX 2XSCA 5EJWA 5DM73 1TS2A 1WTWA 2DNCA 2PQEA 4IALA 5KEEA 4OO1H 5C4HA 1RTNA 1F9SA 3OW7A 1BBXC 4QIWB 1I4HA 4G7HC 3X3NA 5ISRA 3O13A 4KHVA 3ERQA 3J80E 1TWFB 4Q0FA 1GUSA 3PO3B 4OIKA 1V1PA 2VUMB 4BA1I 2BCOA 1O78A 4DN4M 5M3FB 2K05A 4ZQ3A 2RQXA 4ZK9B 2NTSA 2XWBB 1AEXA 2XRSD 4KTAA 1M4VA 3MA2B 1RD9D 4XQNA 1ZXTA 3HP3A 1Y8OB 1GOZA 2J0TD 3NK9A 1RJTA 2YYZA 4BS9A 4DAVA 4X3KA 3LWUA 3KLSX 3MXPA 4KI0A 1EZ6A 4HSPA 1NCVA 4M8AA 4DGZA 2E76C 1SSOA 1SMYC 1CZWA 1Z7TA 3RZDB 2BE5C 3HOUB 5E4XA 3JAME 1NR4A 1LT4D 3KF8A 4C3IB 2E2HB 2KCNA 3R93A 1Y69U 5K5PA 1WD1A 4F8MA 1RKNA 3HRZC 2A74C 1I4QA 3PUWA 1VMPA 1KNEA 4RH6A 5J1ZA 2D5DA 2MPMA 5IGBA 1KLGD 1EY9A 2K5DA 4H7BA 4RAUC 2EYOA 2F0JA 1FNVA 1MI2A 5BN3A 5KYIA 1SAPA 3I70A 5C0XI 1LTAD 2PW5A 1QNKA 2HCCA 4KHZA 5JVG3 2L5TA 1PRTC 2YU9B 3EVQA 4K2KA 2IL8A 2BA1A 1YNNC 4UAIA 1M8AA 1ET6A 2OT2A 1SMYD 1BUVT 1BCPF 2IX3A 5A2QE 4KKTA 2SNMA 1LABA 1XYIA 4HCEA 4LK1C 4PQXA 1FYCA 2F0OA 5CGKA 1GUWA 1TS4A 3LNNA 3T53B 3C1FA 1SE4A 4RKBA 2XRQD 1EY8A 1T5EA 3AB9A 2B2UA 2KECA 4LJZC 1X32A 3NSWA 4DA2A 3S17B 1MGSA 3J7YW 3SR1A 4IUUA 3T13A 4J6HA 4OO1G 1CQFA 2BA0A 3VA7A 1IW7C 4K2LA 1CQVA 5EGTA 4WFN3 3OIQA 1Q12A 5CV5A 2NYZD 1KAAA 1PTOB 1WCMB 4KN7C 5JEAJ 2FMMA 4PMBA 1STBA 4G57A 1ZYRC 5HURA 5C0XH 1O7ZA 1Z47A 3M7NA 1NSNS 4DF7A 1HQRD 1H9RA 1TU2B 1LT6D 1RF2D 1EOTA 1QILA 1G2SA 4K5XA 2FINB 2BOSA 5D3DA 4OGQC 5C3XA 2JEBI 2BE5D 1PTOF 4QCLA 5EKLA 1TY0A 1J8IA 2B8FA 1H9MA 4DAPA 4XIGS 2E2JB 2JEAI 1S5BD 3A8JE 3G6JB 3D6CA 3SE0A 1B53A 1LT5D 3L7ZC 4BY1B 3T56B 1ICWA 3K59A 2CW0D 3P20A 4XQQA 5EKKA 2F0VA 1D6EC 3KLRA 2OF1A 1PLFA 4KD3A 5M9OA 4MIUA 1DOLA 2E74C 2A6EC 1JR0D 3FDTA 4FP5D 1WTRA 4WJWA 3MFGA 5FO7B 1TVXA 4LAAA 2R6GA 3PIO3 2F0GA 1DJRD 1F9RA 1XWEA 2KVMA 5IOCA 3T16A 1XXGA 1EWHA 3S1NB 2K04A 1LV9A 2Q8RE 2EJFC 1FNUA 2B8GA 1HPCA 3VYRA 2FJ2A 5A35A 3GTJB 1Q1EA 3CHBD 4QUCA 4GZYC 2EY1A 4IZ8A 3I3CA 1TY2A 3IKJA 1S4ZA 3NTIA 2I07B 1VCIA 1LACA 3L3OC 5M5WB 1HA5A 5M3MB 5KNDA 4RCNA 1PFBA 4DNRB 3M4YA 2NBFA 4A3DB 4FXGC 5JJZA 3NBIA 1WTQA 1TS3A 1UEAB 2A69D 3R3OA 5FO8B 3H09A 4O1NA 2F0EA 2RSNA 4HMIA 5C0XG 1UAPA 1V1PB 3D4WA 2F0FA 2MGSA 1D2BA 4C2MB 1C48A 1B2TA 5F2DA 4JBWA 1PRTD 4A3JB 2WAQB 3NQTA 1ENCA 2PNRC 3MHBA 3J81L 3FVQA 3EQLC 3EROA 1PFMA 1ZEQX 2KEDA 1EU3A 4RFBA 5IT9E 5D65A 1DONA 1S5ED 1Y8NB 3A8IE 5CYUA 1I50B 1F2YA 4OL7A 4A3FB 2E75C 1SYCA 1ML0D 5ELCA 3SEBA 1J9OA 3GD7A 1DOMA 2BDNA 3PUYA 1SYGA 1IL8A 3PV0A 2C9OA 1ENFA 2A73B 3S9WA 5C0XJ 3MWYW 3OMGA 2NTTA 2WV6D 4S3SA 1TKWB 4C3HG 2JA7B 2EYPA 3VYUA 3NXWA 3NE5B 2NN6H 3EA6A 2ENBA 1KDBA 2VNUD 1QB5D 1WD0A 1EZ8A 2NZ1D 1VF7A 3IFTA 3C46A 1IKMA 2LS01 3V2TA 3TP6A 5CBEE 3NPPA 1Q90A 2F3VA 1ZKOA 2XNAC 4V0BA 3GTLB 2L55A 1SEBD 2OXPA 3TP5A 4A3EB 4HMJA 4K6LA 5K36H 3P1HA 1SNQA 5IGEA 1EIGA 4KY5A 4NDXA 1GUOA 2RKSA 3BDLA 3QOLA 1ESRA 2F0LA 3PO2B 3S2HB 3AU7A 2PW7A 4B9XA 4PNYA 5J39A 5C4JB 1BR9A 2NUCA 1JWMD 5G3LF 3FKIB 4HEDA 1B1ZA 5C5MA 1B50A 3VYTA 3E6ZX 3S1MB 1DCZA 3DWQA 1H9KA 3MFYA 5E3FA 1X3QA 4OIJA 4FF4A 1STEA 1IYVA 3SK8A 5ELBA 2R93B 2VB2X 4IFDJ 1SJHD 2AWNA 1BXTA 1CHPD 2SNSA 1STYA 3BYTB 2AWOA 1SNMA 4RHSA 3F2UA 2L11A 1LTGD 1PZJD 2EVBA 5I2XA 1EL0A 1I4RA 4X3TA 1D1KA 4FNFA 3DWAA 1U9RA 3PIP3 1IHZA 2CW0C 1Q8IA 2EOTA 2E2IB 1JWSD 2PZWA 4C1NI 2Z1CA 3HOXB 2EZVA 1PFNA 3BYYB 4A3MB 5E4WC 4XDXA 4FF1A 1HHVA 2F4IA 2JYOA 4MHEA 4IURA 3HZXA 5FLXL 2CVRA 1PXUA 3J7AF 1AZQA 2PCFB 1QE6A 3ND9A 1L0XB 1EY4A 4M1UB 4QF4A 3GTGB 1HTPA 1UNSA 1I6HB 4C56C 5FLXE 1WVLA 1LLRD 4L8JA 3MTSA 1MSHA 5A2QL 4R8IA 2NN6I 3VR6A 3SXHA 4C3IG 5K36G 4RGMA 1S5DD 1E0BA 1STNA 3U9OA 4EQPA 3IL8A 3KUPA 4PMWA 2SEBD 4KY6A 4K8JA 1SJED 1STGA 2WIIB 1WTVA 1LO5D 5CC4A 3JAML 1SYFA 1OXXK 4K8IA 3R8BA 5ELDA 3WOFA 3TSSA 5IGDA 1XTCD 4G7ZC 5I9PA 3S2DB 4L63B 5C3EB 5EPJA 5M5XB 1WTPA 4KMUC 1EYDA 4IFDH 2Z4HA 5I9OA 2XN9C 5E1FA 3R2IA 3P75A 3GO5A 4HR7B 5JEAG 3HKZB 2F0KA 3I4NB 3ND8A 2IPKD 2G9DA 4PV1C 1R4QB 1ESFA 2ZXRA 1V43A 1E2WA 2FHTA 4KD4A 4YIJA 4DU9A 4DK0A 1G2TA 1HQMC 1SYEA 4I65A 2GA4B 3GP7A 1S5CD 1QWYA 1QG7A 1JCKB 2MUYA 4BA2I 3MEHA 4H44C 1LTTD 2PZTA 2B63B 3W2DA 3RLFA 3SK4A 4KV6A 5ELEA 1A2TA 1KTKA 4IFDI 5FKAC 4XT1B 1GUNA 2F03A 2QEJC 3M85A 5CMDA 3CKIB 3GTOB 2KUMA 1K8OA 3I91A 1Z6HA 2N88A 4ODGA 4C1NK 1TWGB 2B2YA 3D31A 1STAA 5CBAE 4PMCA 3SDZA 1H9SB 2RDFA 1Y8PB 4U673 1OXTA 3VYSA 5D14A 1RTOA 3S16B 3K6OA 1B9MA 5G3LD 3A7AB 4X3SA 4BBRB 1NUCA 4IUTA 5EBDA 5KNBA 1KDCA 3K5NA 4A3BB 3W3AA 4ZRZA 5LHY1 1O7LA 1EFID 1GUTA 1XX8A 3HOYB 1QNUA 5AFWA 3QO2A 1AFPA 4IQZA 3OWEB 3RZOB 4ZUJA 2EYHA 4EQNA 4NP5A 4B08A 3EFXD 1NR2A 2C5CA 2G9HD 3I8ZA 1BCPC 2FMCA 3EJIA 3IFDA 2PMZB 3OMCA 3DMUA 1II3A 3TBIB 2K7VA 2F0PA 1D1IA 3ITPA 3DUZA 5I6WA 1JORA 1E2VA 2MJ8A 1X3PA 3OSOA 1EQTA 3GQBA 4N9PA 5EBCA 1F2LA 4P2CB 3MXNA 2O4XA 5FO9B 4RA8A 2QILA 1FGBD 3DXJC 1GXDC 1U4LA 3K5MA 3J80L 2IW3A 1BCPB 1I4PA 4J8QA 5DAUA 4O42A 4XYOA 2F0NA 5IODA 4KJOA 5COYA 2F0IA 4DXGA 2EXZA 4NMZA 2AQ3B 3PUZA 3DWPA 3BZDB 3MXUA 1R4PB 2WKCA 5DM63 3GV3A 4CKEA 1AW7A 2B2TC 3BDCA 3GTPB 4K6DA 3QIAA 4TQUS 4K5VA 2HCIA 2WINB 2DNEA 3Q6SA 4EVOA 2ZXPA 4Z9CB 1AP0A 1D5MC 1B44D 5KIXA 3HOWB 5JPMC 1SYDA 4IN3A 1GHJA 3FMCA 3N6RA 3K57A 4TSSA 4QMGA 1GJXA 4ZAIA 4E6IA 1KABA 2AQ2B 2IJ0A 5DNFA 3NP8A 4ME5A 1LTRD 3C2PA 1A2UA 1TT2A 2EYLA 3RUZA 4LMQD 1AZPA 2L4NA 2IX0A 1ILPA 5I6YA 3A8KE 3MVVA 4R8NA 4A3KB 1JQYD 1Q3LA 1CZGA 4G7OC 2JA6B 2ID0A 1ONLA 3DHQA 3DM1A 2QCPX 1D5ZC 1B3AA 1CM9A 2L0CA 2N55A 5NUCA 4CGYB 4UDUC 2K28A 3TZUA 1GUGA 1WTOA 1EEID 1HTLD 4XXEA 3M3YB 2DN8A 1K83B 3MAQA 3URYA 1ILQA 1CFMA 1V1OA 3Q24A 1W6JA 1SNOA 2AUKA 1E2ZA 4X3UA 1BQQT 2X69A 2QKIC 4F7XA 5I4DA 3QWNA 4ABNA 4ZLTF 1C8CA 3TN2A 5EPKA 1BF4A 1TS5A 3E5SA 2RDGA 3KBGA 2EYFA 3H91A 1FR3A 1SDFA 4U68A 1Q1BA 3WOEA 1PZKD 3NTHA 4ILWA 1EYCA 2K32A 5FK9C 4HCSA 1RCVD 1MSGA 1SXTA 4I7ZC 5LL6X 1TR5A 1BO0A 1YNJD 4HTHA 3H3VC 1VMCA 2NVQB 3DEPA 4ZKCB 5BN5A 3QB3A 3GTMB 1NAPA 2B2UC 3C1EA 3UI2A 3M7GA 4TKOB 1CT1D 2EY6A 2L1BA 3I90A 2IT1A 3KBXA 3TMEA 2M00A 2WP8J 4WORA 5LL6S 5CORA 1BDOA 1IYUA 1TWCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHX C;  3HRZ C;  3L3O C;  1GXD C;  5JPN C;  2A74 C;  1UAP A;  5JPM C;  2WII B;  1BR9 A;  3CU7 A;  1OO9 B;  5FOB B;  2A73 B;  2ICE C;  2TMP A;  4ILW A;  3V96 A;  1BQQ T;  4FXK C;  3MA2 B;  1D2B A;  2QKI C;  3FRP B;  1JB3 A;  3HS0 C;  4FXG C;  5FO7 B;  3T4A C;  3I70 A;  1JC7 A;  2B39 A;  2E2D C;  1UEA B;  1XWE A;  5FO8 B;  2WIN B;  2J0T D;  3CKI B;  1PXU A;  5FO9 B;  2XWJ B;  3G6J B;  1BUV T;  3KLS A;  2XWB B;  2I07 B; 
#chains in the Genus database with same CATH topology
 4R1J A;  2A1A A;  4YY3 Q;  2JJQ A;  1BCP D;  3AFQ A;  5LMN Q;  2B2V C;  1GHK A;  2F1M A;  4H0L C;  1XPU A;  5ELF A;  4F87 A;  1X55 A;  3TZD A;  1BNZ A;  3ULJ A;  4DR4 Q;  4DR4 L;  2RVL A;  2JA8 H;  3MXG A;  1EY5 A;  4K5W A;  3HOW H;  3J80 c;  1N33 L;  1TQO A;  2PNH A;  1DZ1 A;  2RDH A;  4CJ0 B;  4JI0 Q;  3NTK A;  4H13 C;  4ULL A;  3NWS A;  3H3V H;  4DR5 Q;  1K9M C;  3KJO A;  1R9T B;  3D8G A;  4DR3 Q;  3PIO A;  3ICE A;  2VXW A;  4ZCK A;  5IGF A;  5IWA L;  4OWX B;  2ICE C;  5CV7 A;  4UHV A;  1VQO A;  1PH9 A;  2JE6 I;  2PO4 A;  2K1B A;  5D3I B;  2I5L X;  3PIP A;  3GTP H;  3OWF A;  4HAE A;  4OEL B;  3D4D A;  2A5H A;  4JI2 Q;  3I4N H;  1FL0 A;  4BY7 G;  1JT8 A;  3NUC A;  1ASZ A;  3CPF A;  3NQI A;  4C3H B;  5IE8 A;  1CA6 A;  2L15 A;  2FFK B;  4G4K A;  1PDQ A;  2K50 A;  1IZ6 A;  2JSO A;  4GOP B;  1D7Q A;  2LMC B;  1GO3 E;  4FO2 A;  1YHA A;  5KRU A;  4DNT B;  4QUF A;  4KKU A;  2K5H A;  2AUJ D;  3V96 A;  3I4L A;  1EY6 A;  1SR3 A;  1G6Z A;  1K73 C;  2RSO A;  3HEJ A;  1OXV A;  4RGO S;  3PUV A;  4LF4 Q;  1PTO D;  2N8N A;  2UXB Q;  4R9W A;  3TP8 A;  1WI5 A;  3BZK A;  4DAY A;  1PYB A;  2B2Y C;  4A3C H;  4DFA A;  1K0S A;  3SK5 A;  1TWF H;  3QG1 A;  5H1S E;  2V4D A;  2SOB A;  1D5X C;  2LKV A;  2LY7 A;  4YCW A;  4B9W A;  3U4Z A;  4L6T B;  2F0W A;  3K0X A;  1PHJ A;  1A0I A;  2EY2 A;  3TS0 A;  1CI3 M;  2NVX B;  3K5L A;  3V05 A;  1T9H A;  4FYD A;  1I6V C;  3UDX A;  1PYW D;  4F88 A;  5IP7 G;  4HJ9 A;  2ZT9 C;  5IGG A;  4CHT B;  3TDQ A;  1YZ6 A;  3STB C;  1X56 A;  3K0Y A;  4LF7 L;  1XMO Q;  2VB3 X;  1LTS D;  3G48 A;  1I4G A;  4C3J B;  5EKI A;  2A68 C;  2NB0 A;  3CRK C;  1JOK A;  3H0G H;  4UP8 A;  1A63 A;  4FXD A;  2NVT B;  2HHH Q;  4JBM A;  1I4X A;  2F0T A;  3I72 A;  2WAQ G;  4R4O A;  3FRP B;  1DXM A;  3AQQ A;  1VQN A;  3KK7 A;  4DV4 L;  1W6K A;  2K33 A;  2WKD A;  2UUA Q;  4L5R C;  2O5J C;  1JOQ A;  2ZM6 L;  4B3R L;  4DUY Q;  3KJP A;  2JA6 G;  1K3R A;  1ET9 A;  3RR5 A;  4A3C G;  2A6E D;  1NE3 A;  1B7Y B;  3OYY A;  4DK1 A;  4HID A;  3A56 A;  4BY1 H;  5M3M G;  3L2P A;  1B4O A;  5JOB A;  1PH2 A;  1U4P A;  1KLU D;  4HN7 A;  5BR8 Q;  2I46 A;  3K58 A;  2F4V L;  3D3R A;  1JOO A;  4AYB E;  2B2W C;  1U5K A;  4GLV B;  1CTM A;  2NN6 G;  1KNA A;  4NW2 A;  1H9J A;  1I3Q B;  4X62 L;  5AJ3 L;  4JYA Q;  2BH2 A;  1HZA A;  2OWO A;  3I4M B;  4JI6 Q;  5HGT A;  3J80 i;  2HUG A;  4GN4 B;  4AYB B;  2EE1 A;  5JJL A;  3QR8 A;  5JVH 3;  4B3M Q;  3HOW G;  1G51 A;  2O2L D;  1X65 A;  3S1R H;  1Y14 B;  1SBB B;  1PTO H;  5C4X H;  5CV6 A;  2JA5 H;  5C3W A;  3S1Q B;  3VA5 A;  2F0U A;  2R93 H;  5EPL A;  4RGT A;  4DR7 Q;  2JK8 A;  5I2Y A;  5CV4 A;  3CQZ B;  4A3I B;  3I4N G;  3AMU A;  1SNP A;  3TP7 A;  1LTB D;  5C44 G;  2WAC A;  3CCE A;  2ZJQ A;  4JI4 Q;  4V19 0;  3RMH A;  4XT3 B;  4CBV A;  2IX1 A;  2D9U A;  3UE0 A;  4CDC C;  4A93 B;  1JB3 A;  4JI1 L;  4DV2 Q;  1NMG A;  1RHP A;  2Y0S B;  2HT1 A;  1EY0 A;  2A69 C;  2JP1 A;  1UWV A;  3OIP A;  3CCL A;  1EEF D;  2MNA A;  2JA5 B;  5M5Y H;  2MFI A;  2PI2 A;  5M3F G;  3OHX C;  5C4X B;  2EYM A;  1FNW A;  4QL5 A;  3SHL A;  1C4Q A;  3I73 A;  4KKS A;  4KY7 A;  2EDG A;  1G29 1;  4BY1 G;  3PO3 G;  2R93 G;  2A6H C;  2KJX A;  3QJY A;  4DR6 Q;  3ERS X;  1GKH A;  3DEO A;  3T4A C;  1EYA A;  1J6Q A;  1XTD A;  4DV5 Q;  1F2Z A;  1JE4 A;  4BXX G;  2K01 A;  3E0E A;  3AFP A;  1H95 A;  4R4C A;  4BBS B;  1YBY A;  2XWJ B;  4OHJ A;  4KJN A;  3CAM A;  2I0Q A;  3KLS A;  2F0S A;  1TWA H;  2RA4 A;  3BS1 A;  3C3L A;  2PPB C;  3GTK B;  2WB1 B;  4AH6 A;  2YTY A;  2KA7 A;  3BVM A;  1QZG A;  5ELO A;  2QDB A;  3ONA B;  5IP7 H;  1ENA A;  1IBM L;  1HR0 Q;  3HOV B;  1K8A C;  1CA5 A;  1DD2 A;  3KDF A;  2RBM A;  1X6O A;  3Q22 A;  3KDF B;  4K14 A;  1H9S A;  4IUV A;  4CJ1 B;  2NWG A;  5M5W H;  1JIC A;  3RNU A;  4LF5 Q;  2WB1 G;  2NVY B;  1HJP A;  2XVS A;  5IP9 H;  2HQE A;  2YU9 H;  3RN2 A;  4J15 A;  1Y1V B;  1VQG A;  1VQ9 A;  4POF A;  1J5E L;  3EBE A;  3SVM A;  4YWM A;  4Y7N H;  3U4V A;  2Z4I A;  1WCM G;  4ZYS A;  1IW7 D;  1EU4 A;  3K5O A;  4KHP L;  4DV4 Q;  1JC7 A;  4LFB Q;  1YNJ C;  3H94 A;  4FF3 A;  4DUY L;  2D0P A;  3H0G G;  3G6E A;  1S40 A;  1DM0 B;  2R92 H;  3BDO A;  3SK6 A;  1WTX A;  4B3T L;  5C4X G;  2NVX H;  1QOH A;  4RCO A;  1K8G A;  2ZM6 Q;  2A6H D;  4A3B G;  4HJA A;  2D62 A;  1UUP A;  4POG A;  3CD6 A;  4A3K H;  3ULP A;  4DUZ Q;  1VQ4 A;  2LFN A;  2VY3 A;  5IGC A;  2E2D C;  4DXF A;  1N8R C;  4JPB W;  1O80 A;  1F9Q A;  3HG9 A;  1QUQ B;  3OPO A;  3Q23 A;  4PZ7 A;  5DEH A;  1M1K C;  1U4R A;  1PRT B;  2F0D A;  1WTH A;  3MC0 B;  1WFQ A;  1QCB D;  4JK1 C;  2OEO A;  1TII D;  3BVZ A;  1FVI A;  1PTO C;  5KGU A;  2E2I H;  2KEE A;  2K5Q A;  3GTQ B;  4NXN L;  5AJ3 Q;  1N34 Q;  3PMF A;  1U4M A;  3X3M A;  3K7A B;  3NHH A;  4AQY Q;  2F0Q A;  1T5X D;  3EN2 A;  1A3T A;  3E9H A;  1KDA A;  2ZJR A;  2OQ0 A;  1HFG A;  4X66 Q;  3ULL A;  4OO1 I;  5JEA H;  1MIU A;  1FD7 D;  2Z8L A;  2KOL A;  1G91 A;  1XNR L;  1KRT A;  3QOJ A;  2TSS A;  3E0J A;  1L0Y B;  1DOK A;  4DV1 L;  1N36 L;  2OTL A;  2A19 A;  3RD4 A;  4MN3 A;  4ZKB B;  2N49 A;  2ALY B;  2R3Z A;  4EGV A;  2Q2H A;  3FPP A;  3R2T A;  3KF6 B;  4RHR A;  3MZ5 A;  3L9A X;  4DAY B;  5IYB G;  2M9V A;  3CRL C;  2JXM B;  3J81 E;  1HH2 P;  2MO0 A;  1PH7 A;  3J81 c;  2UXC L;  2YTV A;  2Q8T A;  2IHF A;  3H6M A;  1SYB A;  3A7L A;  2XIW A;  4NKL A;  4QY7 A;  3A55 A;  3G7L A;  1YHQ A;  4JBJ A;  4O0A A;  2B2W A;  3P7J A;  2NVT H;  2WFW A;  4IUN A;  1CK1 A;  4IUQ A;  2R61 A;  4JI8 Q;  1F77 A;  3HKZ G;  5C6A A;  4WJ3 M;  1VQ5 A;  2IWH A;  3S24 A;  1VQJ A;  4WRD A;  4KK7 A;  3GTQ H;  2EQS A;  3VDY A;  4A3G B;  1BBW A;  4YHH L;  2DY7 A;  4XTC S;  1CKO A;  1SE2 A;  4IFD G;  4GKJ Q;  5TSS A;  1YVC A;  4J1M A;  3GV6 A;  3J7A V;  2EJG C;  2R92 B;  3W1G A;  5CR3 A;  2L9H A;  2B2V A;  3VR2 A;  3S1R B;  1VDZ A;  2XTI A;  1RIP A;  2CHB D;  4HIO A;  3J7A 5;  2JA8 G;  1VQB A;  1STH A;  1S5F D;  2HDM A;  2K6A A;  3J7Z C;  1O7Y A;  1HCZ A;  1CSQ A;  2L12 A;  4IUP A;  4Y7N B;  1PFS A;  1OO9 B;  5FOB B;  4FF2 A;  5JAV A;  2AQ1 B;  4ZUI A;  3S15 H;  2UXB L;  2B29 A;  4RWS C;  2E5L L;  4FVM A;  4BWG B;  1NJI C;  5KNC A;  4JI3 Q;  4TRD A;  4AIM A;  1EY7 A;  1SNC A;  1SE3 A;  4XQJ A;  2KEN A;  4RGN A;  5CV8 A;  2HD3 A;  4C3J G;  2MHV A;  1HZ9 A;  3CCS A;  2PZU A;  3HOX H;  1D8L A;  2CQA A;  2D2C C;  2GVB A;  5IIF A;  4B3T Q;  1I94 L;  2ICI A;  3HOY H;  1MD2 D;  2R7Z H;  5KYL A;  1LYL A;  2TMP A;  3JC6 6;  4FXK C;  2KHS A;  1TWH B;  2X6L A;  3HS0 C;  5T1I A;  1TWA B;  2K03 A;  2B39 A;  2OTJ A;  1K8M A;  4CDD C;  3M4O B;  2SDF A;  2Z0S A;  3E3X A;  3S14 B;  3S15 B;  3NEM A;  1J5E Q;  1PZI D;  4JYA L;  2F3W A;  2EYJ A;  1IKL A;  2BDO A;  3H0G B;  1HNW L;  1MBY A;  3IAY A;  3LX0 A;  4ID6 A;  3CPW A;  1UE5 A;  2JA8 B;  1G8Z D;  3LWE A;  1HFN A;  1A15 A;  4YY3 L;  3BG3 A;  4CJ2 C;  1UE1 A;  4AQY L;  2VUM G;  2PYK A;  1JJG A;  4CKC A;  1PMR A;  3NWT A;  2X6G A;  1A3U A;  1K3B C;  2VW9 A;  1VQ7 A;  2F0M A;  2J7Z A;  4A75 A;  1VQL A;  4GOP A;  1YJ9 A;  4KN4 C;  1HRJ A;  3N52 A;  1DYQ A;  1EOV A;  4A3L G;  3TQY A;  1B3Q A;  2V1C C;  4QQB X;  4JI4 L;  1EFW A;  3D6W A;  4BY7 B;  1M90 C;  2H4O A;  1XNR Q;  5M5Y B;  1BOS A;  1EQV A;  1B9N A;  2AKW B;  3GTG H;  4BY7 H;  3T51 B;  3D4R A;  3VR5 A;  3AEV A;  1OXU A;  5EQ0 A;  3HOU H;  3PUX A;  1EWI A;  3GDE A;  4K0K L;  2QF7 A;  5IT9 L;  4XYQ A;  1LTI D;  2KCC A;  3VR4 A;  4A93 H;  2Q8I B;  4IO9 A;  2UU9 Q;  1VF5 C;  4LWC A;  2DY8 A;  2KQ3 A;  3HOX G;  2UXC Q;  3FEW X;  5JPN C;  2O5I C;  2MP1 A;  2J4X A;  4OON A;  4CKB A;  2UXD L;  1HUN A;  2HDL A;  1E24 A;  3U9S A;  1JWU D;  1YNX A;  1HUM A;  4GN3 B;  4C3H H;  1PRT F;  2EJM A;  1SE8 A;  3Q0A A;  1A6X A;  1ROD A;  1ZYR D;  3FPU B;  5C4Z A;  3CW2 C;  2JA5 G;  2JA9 A;  1RDP D;  4DV5 L;  1CKN A;  4P75 A;  1HNX Q;  1CHQ D;  3OOC A;  3NBH A;  4GNX A;  3KFU A;  1G6P A;  1SND A;  3PGZ A;  3CU7 A;  2M2L A;  2R7Z B;  4OXP A;  4MTN A;  4X65 Q;  1FJG L;  1EWC A;  4N9T A;  1SFO B;  4EQ5 A;  4CDE C;  1QJO A;  2UUC L;  5J22 A;  3PCO B;  1AN8 A;  1F9P A;  2R7Z G;  1OXS C;  1IBM Q;  1EIH A;  3GTJ H;  5C44 B;  1PH5 A;  2A68 D;  4BBR G;  1CKM A;  4A3I G;  1VQF A;  4HSV A;  2EY5 A;  2H1E A;  1F2M A;  2PQA B;  2ZXO A;  3HGB A;  5T1G A;  1Y1W B;  3VR3 A;  4RKL A;  3WDN A;  5BN4 A;  4EQO A;  2K5W A;  3I56 A;  1XPR A;  4LF7 Q;  3A54 A;  4Q5V A;  4QB4 A;  1HA6 A;  2F0H A;  1A3V A;  5C5L A;  3M3Y H;  4MNO A;  2B2T A;  2E5L Q;  1HXY D;  3HOZ B;  2EPB A;  5CV9 A;  4DV7 Q;  3F2B A;  1Q7Y C;  3PF4 A;  1LT3 D;  5LMU Q;  1YJN A;  3BVG A;  1V8Q A;  1YNN D;  1I94 Q;  3ZYY X;  2XSC A;  3S1N H;  5EJW A;  5DM7 3;  1TS2 A;  1WTW A;  2DNC A;  1L1O B;  2PQE A;  5GRO A;  4H02 A;  4IAL A;  5KEE A;  4OO1 H;  3H3V I;  5C4H A;  1VQC A;  4B3S Q;  1RTN A;  1V9P A;  1F9S A;  3OW7 A;  1BBX C;  3G71 A;  4QIW B;  3TRZ A;  1I4H A;  4G7H C;  3T1Y L;  1QVF A;  3X3N A;  4DR2 Q;  5ISR A;  3O13 A;  4KHV A;  3ERQ A;  3J80 E;  1Y1W H;  4A3G H;  1TWF B;  1KD1 C;  4Q0F A;  1GUS A;  3PO3 B;  1Y1V G;  4L5Q A;  4OIK A;  1V1P A;  2VUM B;  4BA1 I;  2BCO A;  1O78 A;  1VQD A;  5LMN L;  4DN4 M;  5M3F B;  4OWT B;  1KC8 C;  2K05 A;  4ZQ3 A;  2RQX A;  4ZK9 B;  2NTS A;  2XWB B;  4X64 Q;  5C44 H;  1AEX A;  1K28 A;  2XRS D;  1X54 A;  2Z9H A;  1YJW A;  4KTA A;  4JI0 L;  1M4V A;  3MA2 B;  1RD9 D;  2R7D A;  4XQN A;  2KHJ A;  4JW0 A;  1ZXT A;  2UUB Q;  3HP3 A;  5IWA Q;  1Y8O B;  1GOZ A;  2J0T D;  3NK9 A;  1RJT A;  2YYZ A;  2JA7 G;  1E7Z A;  4R4T A;  4BS9 A;  4DAV A;  4X3K A;  3LWU A;  3KLS X;  3MXP A;  4KI0 A;  2RF4 A;  1EZ6 A;  4HSP A;  1O7I A;  1NCV A;  2VQE L;  4M8A A;  4DGZ A;  4HIK A;  2E76 C;  4YWL A;  3CME A;  1LUZ A;  1Q86 C;  4GLA C;  4R4Q A;  4B3M L;  4JG2 A;  1SSO A;  1SMY C;  1IXR A;  1CZW A;  1Z7T A;  3BZC A;  1S72 A;  3RZD B;  4KLK A;  2BE5 C;  3HOU B;  2F3I A;  4JCV E;  5E4X A;  3JAM E;  1NR4 A;  4DAM A;  1LT4 D;  3KF8 A;  4C3I B;  2E2H B;  2KCN A;  2CH4 W;  4JI8 L;  3R93 A;  1SLJ A;  1Y69 U;  4UP9 A;  5K5P A;  2VQF L;  1N32 Q;  1WD1 A;  4F8M A;  1U0L A;  1RKN A;  3HRZ C;  2A74 C;  5FJ8 G;  4LF4 L;  1I4Q A;  3PUW A;  2ZTC A;  1VMP A;  3TRE A;  3OTO L;  1KNE A;  4RH6 A;  1XPO A;  3A74 A;  2DJG C;  5J1Z A;  1E3P A;  3A5Z B;  5C4J H;  2D5D A;  1L0W A;  1XMQ Q;  2MPM A;  5IGB A;  1KLG D;  1EY9 A;  4JC0 A;  2C35 B;  3CC7 A;  2K5D A;  4H7B A;  4RAU C;  2EYO A;  2F0J A;  4JV5 Q;  2QGQ A;  1FNV A;  4DPG A;  3MEF A;  1MI2 A;  2GN5 A;  5BN3 A;  5KYI A;  1SAP A;  4YCU A;  3I70 A;  5IYC G;  4DV7 L;  3CCR A;  5C0X I;  2NVY H;  3G4S A;  1LTA D;  1KAW A;  3CC2 A;  3M4P A;  2PW5 A;  1QNK A;  1VQK A;  3A5U A;  4JI3 L;  2JN4 A;  2HCC A;  4KHZ A;  5JVG 3;  2L5T A;  1VQ6 A;  1PRT C;  2YU9 B;  3EVQ A;  4K2K A;  3JAM c;  2DJF C;  2IL8 A;  2BA1 A;  1YNN C;  4DK3 C;  4UAI A;  1VQ8 A;  1M8A A;  1ET6 A;  4P74 A;  1MHW C;  3A0J A;  2OT2 A;  1SMY D;  1BUV T;  1BCP F;  2IX3 A;  5A2Q E;  4KKT A;  2SNM A;  1LAB A;  1XYI A;  4HCE A;  4LK1 C;  4PQX A;  1FYC A;  1SMX A;  3M9B A;  1PYS B;  2JA7 H;  2F0O A;  4B3R Q;  5FJ8 H;  4DR2 L;  5CGK A;  1GUW A;  1TS4 A;  3LNN A;  2PMZ E;  2B3G A;  2K14 A;  1GVP A;  4WJ4 A;  2G5D A;  4RKB A;  3C1F A;  1SE4 A;  2I5M X;  3T53 B;  2XRQ D;  1EY8 A;  2VZA A;  5JJK A;  1T5E A;  3IRB A;  3AB9 A;  2B2U A;  2KEC A;  2ZTE A;  4LJZ C;  1X32 A;  3NSW A;  4DA2 A;  3S17 B;  5BR8 L;  1IBL Q;  2MQH A;  1MGS A;  3J7Y W;  3SR1 A;  4IUU A;  3T13 A;  4J6H A;  3RZD H;  1KQS A;  4OO1 G;  1CQF A;  2BA0 A;  3VA7 A;  1IW7 C;  4K2L A;  1CQV A;  2CWA A;  5EGT A;  4WFN 3;  1IL2 A;  1SRO A;  2EXD A;  3OIQ A;  4QJF A;  1Q12 A;  5CV5 A;  2NYZ D;  1KAA A;  1PTO B;  1WCM B;  4KN7 C;  2VQE Q;  1P16 A;  3UDG A;  4L5T A;  5JEA J;  2FMM A;  4PMB A;  4HJ8 A;  1KIX A;  4A3J H;  1STB A;  4G57 A;  1HZC A;  1ZYR C;  5HUR A;  5C0X H;  3CQZ H;  1O7Z A;  1Z47 A;  4A3I H;  3M7N A;  1NSN S;  2AMC B;  3RLN A;  4DF7 A;  1HNZ L;  1HQR D;  3MXN B;  1H9R A;  1TU2 B;  1LT6 D;  2I5H A;  4A3B H;  2E2J H;  1RF2 D;  1EOT A;  1QIL A;  1G2S A;  2AHO B;  4YCV A;  4K5X A;  4UPA A;  3EIV A;  2FIN B;  2BOS A;  4LFC L;  5D3D A;  4OGQ C;  5C3X A;  2H5X A;  2JEB I;  1YIJ A;  2BE5 D;  1PTO F;  3S16 H;  5IT9 c;  5EKL A;  4QCL A;  1TY0 A;  2K52 A;  4JI1 Q;  1J8I A;  4YHH Q;  2B8F A;  4LF6 L;  3K7A H;  1H9M A;  4DAP A;  4LF6 Q;  4EX5 A;  5EAY A;  2P5Z X;  4XIG S;  4OWW B;  3Q8D A;  2E2J B;  2JEA I;  1S5B D;  2B63 G;  1CKN B;  3A8J E;  3G6J B;  1PH1 A;  3D6C A;  3SE0 A;  3LGJ A;  5IP9 G;  1B53 A;  1LT5 D;  3L7Z C;  4BY1 B;  3T56 B;  1ICW A;  2HQL A;  3K59 A;  4NXM Q;  2CW0 D;  3GTO H;  3P20 A;  2NZH A;  4TVA B;  4XQQ A;  2EIF A;  5EKK A;  4C3J H;  2F0V A;  3F2D A;  1D6E C;  3KLR A;  5DLQ E;  1LTL A;  2Y0S G;  2OF1 A;  3HOY G;  1PLF A;  4KD3 A;  5M9O A;  4MIU A;  1DOL A;  4GKJ L;  2E74 C;  2A6E C;  1JR0 D;  2MO1 A;  3FDT A;  4FP5 D;  1WTR A;  1BKB A;  4LFA L;  4WJW A;  3MFG A;  4LF5 L;  1VQE A;  5FO7 B;  1TVX A;  4LAA A;  1C0A A;  1HZB A;  4MZ9 A;  4A3F G;  2R6G A;  3PIO 3;  2F0G A;  2ES2 A;  2ATW A;  1DJR D;  1N9W A;  1F9R A;  1PH6 A;  1KXL A;  1XWE A;  2KVM A;  5IOC A;  1B8A A;  1XXG A;  3T16 A;  1EWH A;  3S1N B;  4IPH A;  2K04 A;  1LV9 A;  2Q8R E;  2EJF C;  1NNX A;  2CFM A;  1FNU A;  2B8G A;  1HPC A;  4DR1 Q;  3VYR A;  4GOP C;  2FJ2 A;  5A35 A;  3GTJ B;  2RHQ B;  1Q1E A;  3CHB D;  3T1H L;  4QUC A;  3WWV A;  4A3E H;  3I4M G;  1JJC B;  4GZY C;  2EY1 A;  4LFB L;  2QEX A;  2VS1 A;  4IZ8 A;  3I3C A;  2RCF A;  1TY2 A;  3IKJ A;  1S4Z A;  1AE2 A;  3NTI A;  2I07 B;  4P72 A;  1VCI A;  1LAC A;  2WAQ E;  3U50 C;  3L3O C;  5M5W B;  3PF5 A;  1HA5 A;  5M3M B;  3CMA A;  5KND A;  4RCN A;  1PFB A;  4DNR B;  1CUK A;  3F8T A;  4LF9 L;  1SFO H;  4BBS H;  3M4Y A;  2NBF A;  1PH4 A;  4A3D B;  4FXG C;  5JJZ A;  4BBR H;  1JB7 A;  3NBI A;  1WTQ A;  2F4V Q;  1TS3 A;  1UEA B;  3NEN A;  2A69 D;  3R3O A;  1BVS A;  5FO8 B;  1UE6 A;  1GM5 A;  3H09 A;  4O1N A;  1IBL L;  2IY5 B;  2F0E A;  4CDF C;  2RSN A;  4HMI A;  2DGY A;  3PSI A;  5C0X G;  4ME3 A;  5GAD C;  1UAP A;  1V1P B;  4NXN Q;  3D4W A;  2F0F A;  2MGS A;  1D2B A;  4A3M G;  4C2M B;  4DV3 L;  3K81 C;  3BU2 A;  1C48 A;  1B2T A;  5F2D A;  4JBW A;  4PZ6 A;  1PRT D;  4A3J B;  2VL6 A;  2WAQ B;  3KLW A;  1UE7 A;  1QVG A;  3NQT A;  1ENC A;  4DR5 L;  1HR0 W;  2VUM H;  2PNR C;  3MHB A;  1VQP A;  2CH4 A;  3HKZ E;  3J81 L;  3FVQ A;  3EQL C;  3ERO A;  1PFM A;  1ZEQ X;  2KED A;  1EU3 A;  4RFB A;  4DR3 L;  2A8V A;  4HIM A;  5IT9 E;  5D65 A;  4A4I A;  4JI7 Q;  1DON A;  1S5E D;  1Y8N B;  3A8I E;  4GKK Q;  5CYU A;  4IPC A;  1I50 B;  1F2Y A;  4OL7 A;  3OTO Q;  4A3F B;  2E75 C;  1SYC A;  1IBK Q;  4LF8 L;  4K0K Q;  3BJU A;  4IJL A;  1ML0 D;  5ELC A;  3HOU G;  1ICF B;  3SEB A;  2LXJ A;  1J9O A;  3GD7 A;  1DOM A;  2BDN A;  1Q8K A;  3PUY A;  4Y52 H;  1VQM A;  1SYG A;  1IL8 A;  3PV0 A;  2C9O A;  2K4K A;  1ENF A;  3S1Q H;  2A73 B;  3M4Q A;  4DR6 L;  3S9W A;  3I4O A;  5C0X J;  3MWY W;  3OMG A;  3CC4 A;  2NTT A;  2WV6 D;  3L0O A;  4S3S A;  1TKW B;  2Q2I A;  5IYB H;  1HNX L;  4C3H G;  2JA7 B;  2EYP A;  2Z6B A;  3VYU A;  3NXW A;  3NE5 B;  2NN6 H;  3EA6 A;  4DK6 C;  1P8L A;  2CQO A;  2ENB A;  4A3E G;  3I4M H;  2R92 G;  1KDB A;  2VNU D;  1I3Q H;  1WYD A;  1JE5 A;  1QB5 D;  2FXQ A;  1WD0 A;  1XNQ Q;  5M3M H;  1EZ8 A;  2NZ1 D;  1VF7 A;  3IFT A;  3C46 A;  1IKM A;  1V1Q A;  1VS0 A;  2LS0 1;  3V2T A;  4NB3 A;  3TP6 A;  2CCZ A;  5CBE E;  3NPP A;  1Q90 A;  2F3V A;  1ZKO A;  1TXY A;  2XNA C;  4V0B A;  5M3F H;  3GTL B;  2L55 A;  1SEB D;  2OXP A;  3TP5 A;  4A3E B;  3GTK H;  4HMJ A;  2HHH L;  2CKZ B;  4K6L A;  5K36 H;  3P1H A;  2F52 A;  1SNQ A;  1X3F A;  2WB1 E;  5IGE A;  1EIG A;  4KY5 A;  3DLL A;  4NDX A;  4P73 A;  1GUO A;  1SN8 A;  1YHB A;  2RKS A;  3BDL A;  3QOL A;  1ESR A;  2F0L A;  3PO2 B;  3S2H B;  3AU7 A;  2PW7 A;  4B9X A;  4PNY A;  3TEH B;  5J39 A;  2Q2T A;  1OTC A;  5C4J B;  1BR9 A;  2NUC A;  1JWM D;  4O2D A;  5G3L F;  3FKI B;  1I50 H;  3T1Y Q;  4HED A;  1B1Z A;  2JA6 H;  1K0R A;  5C5M A;  4FDB A;  2OCE A;  1B50 A;  4YWK A;  3VYT A;  3E6Z X;  3S1M B;  3RZO H;  1DCZ A;  3DWQ A;  1H9K A;  3HOZ H;  1C9O A;  2UUB L;  3MFY A;  5E3F A;  1X3Q A;  3H15 A;  4OIJ A;  1MKH A;  4GNX C;  3CXC A;  4APV A;  1CSP A;  4FF4 A;  2KCM A;  3UDI A;  1STE A;  2RHS B;  1IYV A;  3SK8 A;  3FHW A;  1L2F A;  4LUZ A;  3E9I A;  5ELB A;  1RL2 A;  2R93 B;  2VB2 X;  3U58 A;  4IFD J;  1SJH D;  2AWN A;  5L37 A;  1BXT A;  1CHP D;  2SNS A;  1S3O A;  1STY A;  3BYT B;  2AWO A;  4I7A A;  1AE3 A;  1SNM A;  4RHS A;  3F2U A;  2L11 A;  1LTG D;  1PZJ D;  2EVB A;  5I2X A;  1EL0 A;  1I4R A;  4X3T A;  1D1K A;  4FNF A;  4DKA C;  1EIF A;  4A3D H;  4HJ5 A;  3DWA A;  5FLX c;  1U9R A;  3PIP 3;  4OEM B;  3RLO A;  1QZH A;  2UXD Q;  1IHZ A;  2CW0 C;  1Q8I A;  4DV2 L;  2EOT A;  1IBK L;  4DV3 Q;  4LF8 Q;  1JWS D;  2E2I B;  3CF5 A;  2PZW A;  4A3J G;  2Z6K A;  4C1N I;  4DV0 L;  1TWC H;  2BH8 A;  4DV0 Q;  2YV5 A;  2Z1C A;  3HOX B;  4NXM L;  2EZV A;  3CCM A;  1PFN A;  4DR7 L;  3DM3 A;  3BYY B;  4A3M B;  5E4W C;  4XDX A;  4FF1 A;  1HHV A;  4MHE A;  2F4I A;  2JYO A;  4IUR A;  3HZX A;  2IHE A;  5FLX L;  3S1M H;  2CVR A;  1QUQ A;  1PXU A;  3J7A F;  1AZQ A;  2PCF B;  1Q81 C;  1EQR A;  1QE6 A;  4X65 L;  3ND9 A;  1FJG Q;  1LM0 A;  1L0X B;  1EY4 A;  4M1U B;  4QF4 A;  2NVQ H;  3HOV G;  3S17 H;  1NBW A;  3GTG B;  2K5N A;  1HTP A;  1UNS A;  1I6H B;  4C56 C;  5FLX E;  1WVL A;  1LLR D;  4L8J A;  3MTS A;  4A3D G;  1MSH A;  5A2Q L;  4R8I A;  1A62 A;  2Q2U A;  2NN6 I;  4IPG A;  5HGQ A;  3VR6 A;  3SXH A;  2UUC Q;  4C3I G;  5K36 G;  4RGM A;  1S5D D;  3CCJ A;  1X9N A;  1E0B A;  1STN A;  3U9O A;  1L1O A;  4EQP A;  1W2B A;  3IL8 A;  2N3S A;  3KUP A;  1Y1V H;  4PMW A;  2SEB D;  4KY6 A;  3D0F A;  4K8J A;  1SJE D;  1STG A;  2WII B;  4LW1 A;  5IYD G;  1WTV A;  1LO5 D;  5CC4 A;  3JAM L;  1SYF A;  1OXX K;  4K8I A;  3R8B A;  5ELD A;  3WOF A;  3TSS A;  5IGD A;  3HKS A;  1XTC D;  4G7Z C;  5I9P A;  3S2D B;  2R7F A;  4LNQ A;  4L63 B;  5C3E B;  5EPJ A;  4BXX H;  5M5X B;  1WTP A;  5ELN A;  4KMU C;  3UE1 A;  1EYD A;  4IFD H;  2KCT A;  2Z4H A;  4JOI A;  3K7U C;  5I9O A;  1NTG A;  2XN9 C;  5E1F A;  5M5X H;  3R2I A;  1ASY A;  3P75 A;  3GO5 A;  4HR7 B;  1X3E A;  5JEA G;  5GAH C;  1K83 H;  4QGU A;  3HKZ B;  1EQQ A;  2F0K A;  3I4N B;  3ND8 A;  2IPK D;  2XGT A;  2G9D A;  4PV1 C;  2ZJP A;  3T1H Q;  1HNW Q;  1R4Q B;  1VQH A;  1ESF A;  2ZXR A;  1V43 A;  1X3G A;  4UP7 A;  1E2W A;  2FHT A;  4KD4 A;  4YIJ A;  4DU9 A;  1B70 B;  4DK0 A;  2PQA A;  4AYB G;  1G2T A;  1HQM C;  1C7Y A;  1SYE A;  4I65 A;  3HFZ B;  2GA4 B;  3GP7 A;  1TWG H;  1S5C D;  1N34 L;  1QWY A;  1QG7 A;  1JCK B;  2MUY A;  4BA2 I;  1PH8 A;  3MEH A;  4H44 C;  1LTT D;  4X64 L;  4A3F H;  2PZT A;  2B63 B;  1YI2 A;  4L5S A;  1A8V A;  3W2D A;  3RLF A;  3SK4 A;  4KV6 A;  5ELE A;  1A2T A;  1KTK A;  3KF6 A;  4IFD I;  2VQF Q;  1N32 L;  2QW7 A;  4X6A H;  3K8A A;  4DV1 Q;  1N36 Q;  4GKK L;  5FKA C;  4XT1 B;  3SGI A;  4JI6 L;  1GUN A;  3B6Y A;  2F03 A;  2K5V A;  2QEJ C;  3M85 A;  5CMD A;  2E8G A;  3CKI B;  3GTO B;  2KUM A;  1K8O A;  4C3I H;  2E2H H;  3I91 A;  1Z6H A;  2N88 A;  4ODG A;  4C1N K;  1TWG B;  2UU9 L;  4QIW E;  2HIX A;  2B2Y A;  4A76 A;  5J3B A;  3D31 A;  1STA A;  5CBA E;  3ER0 A;  5HY6 A;  4PMC A;  3SDZ A;  1WJJ A;  4X66 L;  3I55 A;  1H9S B;  2HIV A;  2RDF A;  1Y8P B;  2LXK A;  1OXT A;  3VYS A;  5D14 A;  4N8X 1;  4U67 3;  1RTO A;  4RMF A;  3S16 B;  3K6O A;  1B9M A;  4JI5 L;  5G3L D;  4JI5 Q;  2PI2 E;  4C2M H;  3A7A B;  4X3S A;  4P71 A;  2OQK A;  3FP9 A;  4BBR B;  5LMN W;  1NUC A;  3FKI G;  1PV4 A;  4IUT A;  5EBD A;  3S14 H;  1SRU A;  5KNB A;  1KDC A;  3K5N A;  4A3B B;  3W3A A;  1TWH H;  1JJ2 A;  2LSS A;  1MJC A;  4ZRZ A;  1XMQ L;  5LHY 1;  1O7L A;  1YEZ A;  1EFI D;  1GUT A;  1XX8 A;  3W5O A;  3HOY B;  3HOV H;  1QNU A;  5AFW A;  4MTK A;  2Y0S E;  3KF8 B;  4LUV A;  3QO2 A;  1AFP A;  1DGS A;  1IYJ B;  4IQZ A;  4JV5 L;  3OWE B;  4IJH A;  1WCM H;  3PO3 H;  2N78 A;  4ALP A;  3RZO B;  4ZUJ A;  2EYH A;  4RG1 A;  4EQN A;  4NP5 A;  4IPD A;  5C3E H;  4B08 A;  4KHP Q;  3EFX D;  1NR2 A;  2C5C A;  3FKI H;  2G9H D;  2KBN A;  3I8Z A;  5LMU L;  1BCP C;  2FMC A;  3EJI A;  3IFD A;  1XNQ L;  2PMZ B;  3OMC A;  3DMU A;  1II3 A;  3TBI B;  2K7V A;  2F0P A;  1D1I A;  1BBU A;  4DV6 Q;  3ITP A;  3S2H H;  3DUZ A;  1PA6 A;  1Q46 A;  3UDF A;  3PO2 H;  5I6W A;  1XJV A;  1E2V A;  2MJ8 A;  4DUZ L;  1JOR A;  1X3P A;  4B3S L;  3OSO A;  1EQT A;  4JOI C;  4R4I A;  3GQB A;  4N9P A;  5EBC A;  1F2L A;  1EYG A;  4P2C B;  3MXN A;  1Q82 C;  3RN5 A;  3W1B A;  2O4X A;  5FO9 B;  4DR1 L;  5IY0 A;  4RA8 A;  5GAE C;  2QIL A;  4A3M H;  1FGB D;  3DXJ C;  1GXD C;  5FLM H;  4GLX A;  4PG3 A;  1U4L A;  3K5M A;  1E1O A;  2QDL A;  3J80 L;  2IW3 A;  5IYC H;  1BCP B;  1I4P A;  4J8Q A;  5DAU A;  4O42 A;  4XYO A;  2F0N A;  5IOD A;  3JAM i;  4KJO A;  4DNI A;  1NY4 A;  5COY A;  2F0I A;  3J81 i;  4DXG A;  2EXZ A;  4NMZ A;  2ASB A;  2AQ3 B;  4NPS A;  3PUZ A;  3DWP A;  3BZD B;  4LF9 Q;  3MXU A;  1R4P B;  2WKC A;  5DM6 3;  3GV3 A;  1R9T H;  4CKE A;  4A93 G;  1AW7 A;  3F1Z A;  4N8F A;  2B2T C;  3BDC A;  3GTP B;  4K6D A;  3QIA A;  2QA4 A;  4TQU S;  1NMF A;  5C3E G;  4K5V A;  1UEB A;  1KL9 A;  2HCI A;  4BBS G;  2WIN B;  2DNE A;  3CCU A;  3Q6S A;  5FLM G;  4EVO A;  2YTX A;  2ZXP A;  4LUO A;  4Z9C B;  3PQI A;  3ZJY C;  2NZO A;  3F2C A;  1AP0 A;  1D5M C;  1B44 D;  3KOJ A;  5KIX A;  3HOW B;  5JPM C;  1FGU A;  1SYD A;  1N33 Q;  4IN3 A;  1GHJ A;  4JVZ A;  3FMC A;  3N6R A;  3K57 A;  4TSS A;  4QMG A;  4IOC A;  3STB D;  3CCQ A;  1E1T A;  4ZAI A;  1GJX A;  1HNZ Q;  4E6I A;  1KAB A;  2AQ2 B;  2IJ0 A;  5DNF A;  3NP8 A;  4ME5 A;  1LTR D;  3C2P A;  1A2U A;  1TT2 A;  5JJI A;  1KRS A;  2EYL A;  3RUZ A;  4LMQ D;  1MJE A;  3GTM H;  2B63 H;  4JI2 L;  3NEL A;  1AZP A;  2L4N A;  4JI7 L;  4LFC Q;  4A3G G;  2IX0 A;  1ILP A;  5I6Y A;  3A8K E;  3MVV A;  4R8N A;  2DUD A;  4OX9 L;  4A3K B;  4OX9 Q;  1YIT A;  1JQY D;  1Q3L A;  1CZG A;  4G7O C;  2JA6 B;  2ID0 A;  1ONL A;  1Z9F A;  2GVA A;  3DHQ A;  4GN5 A;  1HR0 L;  3DM1 A;  2QCP X;  1D5Z C;  1B3A A;  1CM9 A;  2L0C A;  2N55 A;  5NUC A;  1WOC A;  3TS2 A;  4CGY B;  4IOA A;  4UDU C;  4PZ8 A;  1E22 A;  2K28 A;  3TZU A;  1GD7 A;  1GUG A;  3CCV A;  1WTO A;  1I5F A;  3J81 j;  1EEI D;  1HTL D;  4XXE A;  3M3Y B;  2DN8 A;  3HOZ G;  3I2Z A;  1K83 B;  3MAQ A;  3GTL H;  1KHI A;  3AYH B;  3URY A;  1ILQ A;  1CFM A;  1L1O C;  2ZTD A;  1V1O A;  3Q24 A;  3M4O H;  4A3K G;  2UUA L;  3NBH B;  1VQA A;  4GNX B;  1W6J A;  1SNO A;  2AUK A;  1E2Z A;  4X3U A;  1BQQ T;  2KHI A;  2X69 A;  1PH3 A;  4LFA Q;  3S2D H;  2QKI C;  4F7X A;  5I4D A;  3QWN A;  1EIY B;  1PVO A;  4A3L H;  4ABN A;  2D0O A;  4ZLT F;  1C8C A;  3TN2 A;  5EPK A;  3KYH C;  1BF4 A;  1TS5 A;  5GQO A;  4HJ7 A;  3E5S A;  2RDG A;  1XMO L;  1W3S A;  3KBG A;  2EYF A;  3H91 A;  1FR3 A;  1SDF A;  2K75 A;  4U68 A;  5IYD H;  1Q1B A;  3WOE A;  1PZK D;  3NTH A;  3OW2 A;  4ILW A;  4GS3 A;  1EYC A;  2K32 A;  4JBK A;  1AH9 A;  5FK9 C;  4HCS A;  1EUJ A;  1RCV D;  2JQO A;  2Z6K C;  1MSG A;  1SXT A;  4I7Z C;  3CP0 A;  5LL6 X;  4DV6 L;  1Y1W G;  1QVC A;  1TR5 A;  5GAG C;  1I6H H;  1BO0 A;  1VQI A;  1YNJ D;  3K80 C;  4HTH A;  3H3V C;  1VMC A;  2NVQ B;  3DEP A;  4ZKC B;  2RCN A;  5BN5 A;  3QB3 A;  3GTM B;  1NAP A;  2B2U C;  3C1E A;  3UI2 A;  4X62 Q;  3M7G A;  4TKO B;  1CT1 D;  5E7N A;  2EY6 A;  2L1B A;  3I90 A;  3PO2 G;  2IT1 A;  3KBX A;  2M00 A;  2WP8 J;  4WOR A;  3TME A;  5LL6 S;  5COR A;  1BDO A;  1JMC A;  4UY8 C;  2CWP A;  1IYU A;  1TWC B;  3I7F A; 
#chains in the Genus database with same CATH homology
 1BCP D;  2B2V C;  1GHK A;  2F1M A;  4H0L C;  5ELF A;  4F87 A;  3TZD A;  1BNZ A;  2RVL A;  3MXG A;  1EY5 A;  4K5W A;  1TQO A;  1DZ1 A;  2RDH A;  4CJ0 B;  3NTK A;  4H13 C;  4ULL A;  3NWS A;  1R9T B;  3D8G A;  2VXW A;  5IGF A;  2ICE C;  5CV7 A;  2JE6 I;  2PO4 A;  2K1B A;  5D3I B;  3OWF A;  4HAE A;  3D4D A;  2A5H A;  3NUC A;  3NQI A;  4C3H B;  1CA6 A;  2FFK B;  4G4K A;  1PDQ A;  2JSO A;  2LMC B;  4FO2 A;  5KRU A;  4DNT B;  4QUF A;  4KKU A;  2AUJ D;  3V96 A;  3I4L A;  1EY6 A;  1G6Z A;  2RSO A;  3HEJ A;  1OXV A;  4RGO S;  3PUV A;  1PTO D;  4R9W A;  3TP8 A;  4DAY A;  2B2Y C;  4DFA A;  3SK5 A;  3QG1 A;  2V4D A;  2SOB A;  1D5X C;  2LKV A;  2LY7 A;  4B9W A;  4L6T B;  2F0W A;  2EY2 A;  1CI3 M;  2NVX B;  3K5L A;  3V05 A;  4FYD A;  1I6V C;  1PYW D;  4F88 A;  2ZT9 C;  5IGG A;  4CHT B;  3TDQ A;  3K0Y A;  2VB3 X;  1LTS D;  1I4G A;  4C3J B;  5EKI A;  2A68 C;  2NB0 A;  3CRK C;  1JOK A;  4FXD A;  2NVT B;  1I4X A;  2F0T A;  3I72 A;  3FRP B;  1DXM A;  3KK7 A;  1W6K A;  2K33 A;  2WKD A;  2O5J C;  1JOQ A;  1ET9 A;  2A6E D;  4DK1 A;  3A56 A;  1B4O A;  5JOB A;  1U4P A;  1KLU D;  4HN7 A;  2I46 A;  3K58 A;  3D3R A;  1JOO A;  2B2W C;  1CTM A;  2NN6 G;  1KNA A;  4NW2 A;  1H9J A;  1I3Q B;  3I4M B;  5HGT A;  2HUG A;  4AYB B;  2EE1 A;  5JVH 3;  2O2L D;  1SBB B;  1PTO H;  5CV6 A;  5C3W A;  3S1Q B;  3VA5 A;  2F0U A;  5EPL A;  4RGT A;  5I2Y A;  5CV4 A;  3CQZ B;  4A3I B;  3AMU A;  1SNP A;  3TP7 A;  1LTB D;  2WAC A;  4V19 0;  3RMH A;  4XT3 B;  4CBV A;  2IX1 A;  2D9U A;  4A93 B;  1JB3 A;  1RHP A;  2Y0S B;  1EY0 A;  2A69 C;  2JP1 A;  3OIP A;  1EEF D;  2JA5 B;  3OHX C;  5C4X B;  2EYM A;  1FNW A;  3SHL A;  1C4Q A;  3I73 A;  4KKS A;  4KY7 A;  2EDG A;  1G29 1;  2A6H C;  2KJX A;  3QJY A;  3DEO A;  3T4A C;  1EYA A;  1F2Z A;  1JE4 A;  2K01 A;  4BBS B;  2XWJ B;  4OHJ A;  4KJN A;  3KLS A;  2F0S A;  2RA4 A;  3BS1 A;  3C3L A;  2PPB C;  3GTK B;  2WB1 B;  2KA7 A;  3BVM A;  2QDB A;  3ONA B;  1ENA A;  3HOV B;  1CA5 A;  1DD2 A;  2RBM A;  3Q22 A;  4K14 A;  1H9S A;  4IUV A;  4CJ1 B;  2NWG A;  1JIC A;  2NVY B;  2XVS A;  2HQE A;  1Y1V B;  3SVM A;  2Z4I A;  4ZYS A;  1IW7 D;  1EU4 A;  3K5O A;  1JC7 A;  1YNJ C;  3H94 A;  4FF3 A;  1DM0 B;  3BDO A;  3SK6 A;  1WTX A;  1QOH A;  4RCO A;  2A6H D;  2D62 A;  1UUP A;  2LFN A;  5IGC A;  2E2D C;  4DXF A;  1O80 A;  1F9Q A;  3HG9 A;  3OPO A;  3Q23 A;  5DEH A;  1U4R A;  1PRT B;  2F0D A;  3MC0 B;  1QCB D;  2OEO A;  4JK1 C;  1TII D;  3BVZ A;  1PTO C;  5KGU A;  2KEE A;  2K5Q A;  3GTQ B;  3PMF A;  1U4M A;  3X3M A;  3K7A B;  3NHH A;  2F0Q A;  1T5X D;  1A3T A;  1KDA A;  1HFG A;  4OO1 I;  5JEA H;  1FD7 D;  2Z8L A;  2KOL A;  1G91 A;  3QOJ A;  2TSS A;  3E0J A;  1L0Y B;  1DOK A;  3RD4 A;  4MN3 A;  4ZKB B;  2R3Z A;  4EGV A;  3FPP A;  3R2T A;  4RHR A;  3MZ5 A;  3L9A X;  2M9V A;  3CRL C;  2JXM B;  3J81 E;  2Q8T A;  3H6M A;  1SYB A;  3A7L A;  2XIW A;  4NKL A;  3A55 A;  3G7L A;  2B2W A;  3P7J A;  4IUN A;  1CK1 A;  4IUQ A;  2R61 A;  1F77 A;  5C6A A;  2IWH A;  4WRD A;  4KK7 A;  4A3G B;  2DY7 A;  4XTC S;  1SE2 A;  4IFD G;  5TSS A;  4J1M A;  3GV6 A;  3J7A V;  2EJG C;  2R92 B;  5CR3 A;  2L9H A;  2B2V A;  3VR2 A;  3S1R B;  1VDZ A;  2CHB D;  1STH A;  1S5F D;  2HDM A;  2K6A A;  1O7Y A;  1HCZ A;  2L12 A;  4IUP A;  4Y7N B;  1OO9 B;  5FOB B;  4FF2 A;  5JAV A;  2AQ1 B;  4ZUI A;  4RWS C;  4FVM A;  4BWG B;  5KNC A;  4TRD A;  1EY7 A;  1SNC A;  1SE3 A;  4XQJ A;  4RGN A;  5CV8 A;  4C3J G;  2MHV A;  2PZU A;  2CQA A;  2D2C C;  5IIF A;  2ICI A;  1MD2 D;  5KYL A;  2TMP A;  4FXK C;  2KHS A;  1TWH B;  2X6L A;  3HS0 C;  5T1I A;  1TWA B;  2K03 A;  2B39 A;  1K8M A;  3M4O B;  2SDF A;  3S14 B;  3S15 B;  1PZI D;  2F3W A;  2EYJ A;  1IKL A;  2BDO A;  3H0G B;  1MBY A;  3IAY A;  3LX0 A;  4ID6 A;  2JA8 B;  1G8Z D;  3LWE A;  1HFN A;  1A15 A;  3BG3 A;  4CJ2 C;  2PYK A;  4CKC A;  1PMR A;  2X6G A;  1A3U A;  3NWT A;  2F0M A;  2J7Z A;  4KN4 C;  1HRJ A;  3N52 A;  1DYQ A;  3D6W A;  4BY7 B;  2H4O A;  5M5Y B;  1BOS A;  1EQV A;  1B9N A;  3T51 B;  3D4R A;  3VR5 A;  1OXU A;  5EQ0 A;  3PUX A;  2QF7 A;  5IT9 L;  4XYQ A;  1LTI D;  2KCC A;  3VR4 A;  2Q8I B;  1VF5 C;  2DY8 A;  2KQ3 A;  3FEW X;  5JPN C;  2O5I C;  2MP1 A;  2J4X A;  4CKB A;  1HUN A;  2HDL A;  3U9S A;  1JWU D;  1HUM A;  1PRT F;  2EJM A;  3Q0A A;  1A6X A;  1ROD A;  1ZYR D;  3FPU B;  5C4Z A;  1RDP D;  1CHQ D;  3OOC A;  3NBH A;  1SND A;  3CU7 A;  2M2L A;  2R7Z B;  1EWC A;  4N9T A;  1SFO B;  1QJO A;  5J22 A;  1AN8 A;  1F9P A;  1OXS C;  1EIH A;  5C44 B;  2A68 D;  1Y1W B;  2ZXO A;  2EY5 A;  2H1E A;  1F2M A;  3HGB A;  4HSV A;  5T1G A;  3VR3 A;  4RKL A;  3WDN A;  5BN4 A;  4EQO A;  2K5W A;  3A54 A;  4Q5V A;  4QB4 A;  1HA6 A;  2F0H A;  1A3V A;  5C5L A;  2B2T A;  1HXY D;  3HOZ B;  2EPB A;  5CV9 A;  1LT3 D;  3BVG A;  1V8Q A;  1YNN D;  3ZYY X;  2XSC A;  5EJW A;  5DM7 3;  1TS2 A;  1WTW A;  2DNC A;  2PQE A;  4IAL A;  5KEE A;  4OO1 H;  5C4H A;  1RTN A;  1F9S A;  3OW7 A;  1BBX C;  4QIW B;  1I4H A;  4G7H C;  3X3N A;  5ISR A;  3O13 A;  4KHV A;  3ERQ A;  3J80 E;  1TWF B;  4Q0F A;  1GUS A;  3PO3 B;  4OIK A;  1V1P A;  2VUM B;  4BA1 I;  2BCO A;  1O78 A;  4DN4 M;  5M3F B;  2K05 A;  4ZQ3 A;  2RQX A;  4ZK9 B;  2NTS A;  2XWB B;  1AEX A;  2XRS D;  4KTA A;  1M4V A;  3MA2 B;  1RD9 D;  4XQN A;  1ZXT A;  3HP3 A;  1Y8O B;  1GOZ A;  2J0T D;  3NK9 A;  1RJT A;  2YYZ A;  4BS9 A;  4DAV A;  4X3K A;  3LWU A;  3KLS X;  3MXP A;  4KI0 A;  1EZ6 A;  4HSP A;  1NCV A;  4M8A A;  4DGZ A;  2E76 C;  1SSO A;  1SMY C;  1CZW A;  1Z7T A;  3RZD B;  2BE5 C;  3HOU B;  5E4X A;  3JAM E;  1NR4 A;  1LT4 D;  3KF8 A;  4C3I B;  2E2H B;  2KCN A;  3R93 A;  1Y69 U;  5K5P A;  1WD1 A;  4F8M A;  1RKN A;  3HRZ C;  2A74 C;  1I4Q A;  3PUW A;  1VMP A;  1KNE A;  4RH6 A;  5J1Z A;  2D5D A;  2MPM A;  5IGB A;  1KLG D;  1EY9 A;  2K5D A;  4H7B A;  4RAU C;  2EYO A;  2F0J A;  1FNV A;  1MI2 A;  5BN3 A;  5KYI A;  1SAP A;  3I70 A;  5C0X I;  1LTA D;  2PW5 A;  1QNK A;  2HCC A;  4KHZ A;  5JVG 3;  2L5T A;  1PRT C;  2YU9 B;  3EVQ A;  4K2K A;  2IL8 A;  2BA1 A;  1YNN C;  4UAI A;  1M8A A;  1ET6 A;  2OT2 A;  1SMY D;  1BUV T;  1BCP F;  2IX3 A;  5A2Q E;  4KKT A;  2SNM A;  1LAB A;  1XYI A;  4HCE A;  4LK1 C;  4PQX A;  1FYC A;  2F0O A;  5CGK A;  1GUW A;  1TS4 A;  3LNN A;  3T53 B;  3C1F A;  1SE4 A;  4RKB A;  2XRQ D;  1EY8 A;  1T5E A;  3AB9 A;  2B2U A;  2KEC A;  4LJZ C;  1X32 A;  3NSW A;  4DA2 A;  3S17 B;  1MGS A;  3J7Y W;  3SR1 A;  4IUU A;  3T13 A;  4J6H A;  4OO1 G;  1CQF A;  2BA0 A;  3VA7 A;  1IW7 C;  4K2L A;  1CQV A;  5EGT A;  4WFN 3;  3OIQ A;  1Q12 A;  5CV5 A;  2NYZ D;  1KAA A;  1PTO B;  1WCM B;  4KN7 C;  5JEA J;  2FMM A;  4PMB A;  1STB A;  4G57 A;  1ZYR C;  5HUR A;  5C0X H;  1O7Z A;  1Z47 A;  3M7N A;  1NSN S;  4DF7 A;  1HQR D;  1H9R A;  1TU2 B;  1LT6 D;  1RF2 D;  1EOT A;  1QIL A;  1G2S A;  4K5X A;  2FIN B;  2BOS A;  5D3D A;  4OGQ C;  5C3X A;  2JEB I;  2BE5 D;  1PTO F;  4QCL A;  5EKL A;  1TY0 A;  1J8I A;  2B8F A;  1H9M A;  4DAP A;  4XIG S;  2E2J B;  2JEA I;  1S5B D;  3A8J E;  3G6J B;  3D6C A;  3SE0 A;  1B53 A;  1LT5 D;  3L7Z C;  4BY1 B;  3T56 B;  1ICW A;  3K59 A;  2CW0 D;  3P20 A;  4XQQ A;  5EKK A;  2F0V A;  1D6E C;  3KLR A;  2OF1 A;  1PLF A;  4KD3 A;  5M9O A;  4MIU A;  1DOL A;  2E74 C;  2A6E C;  1JR0 D;  3FDT A;  4FP5 D;  1WTR A;  4WJW A;  3MFG A;  5FO7 B;  1TVX A;  4LAA A;  2R6G A;  3PIO 3;  2F0G A;  1DJR D;  1F9R A;  1XWE A;  2KVM A;  5IOC A;  3T16 A;  1XXG A;  1EWH A;  3S1N B;  2K04 A;  1LV9 A;  2Q8R E;  2EJF C;  1FNU A;  2B8G A;  1HPC A;  3VYR A;  2FJ2 A;  5A35 A;  3GTJ B;  1Q1E A;  3CHB D;  4QUC A;  4GZY C;  2EY1 A;  4IZ8 A;  3I3C A;  1TY2 A;  3IKJ A;  1S4Z A;  3NTI A;  2I07 B;  1VCI A;  1LAC A;  3L3O C;  5M5W B;  1HA5 A;  5M3M B;  5KND A;  4RCN A;  1PFB A;  4DNR B;  3M4Y A;  2NBF A;  4A3D B;  4FXG C;  5JJZ A;  3NBI A;  1WTQ A;  1TS3 A;  1UEA B;  2A69 D;  3R3O A;  5FO8 B;  3H09 A;  4O1N A;  2F0E A;  2RSN A;  4HMI A;  5C0X G;  1UAP A;  1V1P B;  3D4W A;  2F0F A;  2MGS A;  1D2B A;  4C2M B;  1C48 A;  1B2T A;  5F2D A;  4JBW A;  1PRT D;  4A3J B;  2WAQ B;  3NQT A;  1ENC A;  2PNR C;  3MHB A;  3J81 L;  3FVQ A;  3EQL C;  3ERO A;  1PFM A;  1ZEQ X;  2KED A;  1EU3 A;  4RFB A;  5IT9 E;  5D65 A;  1DON A;  1S5E D;  1Y8N B;  3A8I E;  5CYU A;  1I50 B;  1F2Y A;  4OL7 A;  4A3F B;  2E75 C;  1SYC A;  1ML0 D;  5ELC A;  3SEB A;  1J9O A;  3GD7 A;  1DOM A;  2BDN A;  3PUY A;  1SYG A;  1IL8 A;  3PV0 A;  2C9O A;  1ENF A;  2A73 B;  3S9W A;  5C0X J;  3MWY W;  3OMG A;  2NTT A;  2WV6 D;  4S3S A;  1TKW B;  4C3H G;  2JA7 B;  2EYP A;  3VYU A;  3NXW A;  3NE5 B;  2NN6 H;  3EA6 A;  2ENB A;  1KDB A;  2VNU D;  1QB5 D;  1WD0 A;  1EZ8 A;  2NZ1 D;  1VF7 A;  3IFT A;  3C46 A;  1IKM A;  2LS0 1;  3V2T A;  3TP6 A;  5CBE E;  3NPP A;  1Q90 A;  2F3V A;  1ZKO A;  2XNA C;  4V0B A;  3GTL B;  2L55 A;  1SEB D;  2OXP A;  3TP5 A;  4A3E B;  4HMJ A;  4K6L A;  5K36 H;  3P1H A;  1SNQ A;  5IGE A;  1EIG A;  4KY5 A;  4NDX A;  1GUO A;  2RKS A;  3BDL A;  3QOL A;  1ESR A;  2F0L A;  3PO2 B;  3S2H B;  3AU7 A;  2PW7 A;  4B9X A;  4PNY A;  5J39 A;  5C4J B;  1BR9 A;  2NUC A;  1JWM D;  5G3L F;  3FKI B;  4HED A;  1B1Z A;  5C5M A;  1B50 A;  3VYT A;  3E6Z X;  3S1M B;  1DCZ A;  3DWQ A;  1H9K A;  3MFY A;  5E3F A;  1X3Q A;  4OIJ A;  4FF4 A;  1STE A;  1IYV A;  3SK8 A;  5ELB A;  2R93 B;  2VB2 X;  4IFD J;  1SJH D;  2AWN A;  1BXT A;  1CHP D;  2SNS A;  1STY A;  3BYT B;  2AWO A;  1SNM A;  4RHS A;  3F2U A;  2L11 A;  1LTG D;  1PZJ D;  2EVB A;  5I2X A;  1EL0 A;  1I4R A;  4X3T A;  1D1K A;  4FNF A;  3DWA A;  1U9R A;  3PIP 3;  1IHZ A;  2CW0 C;  1Q8I A;  2EOT A;  2E2I B;  1JWS D;  2PZW A;  4C1N I;  2Z1C A;  3HOX B;  2EZV A;  1PFN A;  3BYY B;  4A3M B;  5E4W C;  4XDX A;  4FF1 A;  1HHV A;  2F4I A;  2JYO A;  4MHE A;  4IUR A;  3HZX A;  5FLX L;  2CVR A;  1PXU A;  3J7A F;  1AZQ A;  2PCF B;  1QE6 A;  3ND9 A;  1L0X B;  1EY4 A;  4M1U B;  4QF4 A;  3GTG B;  1HTP A;  1UNS A;  1I6H B;  4C56 C;  5FLX E;  1WVL A;  1LLR D;  4L8J A;  3MTS A;  1MSH A;  5A2Q L;  4R8I A;  2NN6 I;  3VR6 A;  3SXH A;  4C3I G;  5K36 G;  4RGM A;  1S5D D;  1E0B A;  1STN A;  3U9O A;  4EQP A;  3IL8 A;  3KUP A;  4PMW A;  2SEB D;  4KY6 A;  4K8J A;  1SJE D;  1STG A;  2WII B;  1WTV A;  1LO5 D;  5CC4 A;  3JAM L;  1SYF A;  1OXX K;  4K8I A;  3R8B A;  5ELD A;  3WOF A;  3TSS A;  5IGD A;  1XTC D;  4G7Z C;  5I9P A;  3S2D B;  4L63 B;  5C3E B;  5EPJ A;  5M5X B;  1WTP A;  4KMU C;  1EYD A;  4IFD H;  2Z4H A;  5I9O A;  2XN9 C;  5E1F A;  3R2I A;  3P75 A;  3GO5 A;  4HR7 B;  5JEA G;  3HKZ B;  2F0K A;  3I4N B;  3ND8 A;  2IPK D;  2G9D A;  4PV1 C;  1R4Q B;  1ESF A;  2ZXR A;  1V43 A;  1E2W A;  2FHT A;  4KD4 A;  4YIJ A;  4DU9 A;  4DK0 A;  1G2T A;  1HQM C;  1SYE A;  4I65 A;  2GA4 B;  3GP7 A;  1S5C D;  1QWY A;  1QG7 A;  1JCK B;  2MUY A;  4BA2 I;  3MEH A;  4H44 C;  1LTT D;  2PZT A;  2B63 B;  3W2D A;  3RLF A;  3SK4 A;  4KV6 A;  5ELE A;  1A2T A;  1KTK A;  4IFD I;  5FKA C;  4XT1 B;  1GUN A;  2F03 A;  2QEJ C;  3M85 A;  5CMD A;  3CKI B;  3GTO B;  2KUM A;  1K8O A;  3I91 A;  1Z6H A;  2N88 A;  4ODG A;  4C1N K;  1TWG B;  2B2Y A;  3D31 A;  1STA A;  5CBA E;  4PMC A;  3SDZ A;  1H9S B;  2RDF A;  1Y8P B;  4U67 3;  1OXT A;  3VYS A;  5D14 A;  1RTO A;  3S16 B;  3K6O A;  1B9M A;  5G3L D;  3A7A B;  4X3S A;  4BBR B;  1NUC A;  4IUT A;  5EBD A;  5KNB A;  1KDC A;  3K5N A;  4A3B B;  3W3A A;  4ZRZ A;  5LHY 1;  1O7L A;  1EFI D;  1GUT A;  1XX8 A;  3HOY B;  1QNU A;  5AFW A;  3QO2 A;  1AFP A;  4IQZ A;  3OWE B;  3RZO B;  4ZUJ A;  2EYH A;  4EQN A;  4NP5 A;  4B08 A;  3EFX D;  1NR2 A;  2C5C A;  2G9H D;  3I8Z A;  1BCP C;  2FMC A;  3EJI A;  3IFD A;  2PMZ B;  3OMC A;  3DMU A;  1II3 A;  3TBI B;  2K7V A;  2F0P A;  1D1I A;  3ITP A;  3DUZ A;  5I6W A;  1JOR A;  1E2V A;  2MJ8 A;  1X3P A;  3OSO A;  1EQT A;  3GQB A;  4N9P A;  5EBC A;  1F2L A;  4P2C B;  3MXN A;  2O4X A;  5FO9 B;  4RA8 A;  2QIL A;  1FGB D;  3DXJ C;  1GXD C;  1U4L A;  3K5M A;  3J80 L;  2IW3 A;  1BCP B;  1I4P A;  4J8Q A;  5DAU A;  4O42 A;  4XYO A;  2F0N A;  5IOD A;  4KJO A;  5COY A;  2F0I A;  4DXG A;  2EXZ A;  4NMZ A;  2AQ3 B;  3PUZ A;  3DWP A;  3BZD B;  3MXU A;  1R4P B;  2WKC A;  5DM6 3;  3GV3 A;  4CKE A;  1AW7 A;  2B2T C;  3BDC A;  3GTP B;  4K6D A;  3QIA A;  4TQU S;  4K5V A;  2HCI A;  2WIN B;  2DNE A;  3Q6S A;  4EVO A;  2ZXP A;  4Z9C B;  1AP0 A;  1D5M C;  1B44 D;  5KIX A;  3HOW B;  5JPM C;  1SYD A;  4IN3 A;  1GHJ A;  3FMC A;  3N6R A;  3K57 A;  4TSS A;  4QMG A;  1GJX A;  4ZAI A;  4E6I A;  1KAB A;  2AQ2 B;  2IJ0 A;  5DNF A;  3NP8 A;  4ME5 A;  1LTR D;  3C2P A;  1A2U A;  1TT2 A;  2EYL A;  3RUZ A;  4LMQ D;  1AZP A;  2L4N A;  2IX0 A;  1ILP A;  5I6Y A;  3A8K E;  3MVV A;  4R8N A;  4A3K B;  1JQY D;  1Q3L A;  1CZG A;  4G7O C;  2JA6 B;  2ID0 A;  1ONL A;  3DHQ A;  3DM1 A;  2QCP X;  1D5Z C;  1B3A A;  1CM9 A;  2L0C A;  2N55 A;  5NUC A;  4CGY B;  4UDU C;  2K28 A;  3TZU A;  1GUG A;  1WTO A;  1EEI D;  1HTL D;  4XXE A;  3M3Y B;  2DN8 A;  1K83 B;  3MAQ A;  3URY A;  1ILQ A;  1CFM A;  1V1O A;  3Q24 A;  1W6J A;  1SNO A;  2AUK A;  1E2Z A;  4X3U A;  1BQQ T;  2X69 A;  2QKI C;  4F7X A;  5I4D A;  3QWN A;  4ABN A;  4ZLT F;  1C8C A;  3TN2 A;  5EPK A;  1BF4 A;  1TS5 A;  3E5S A;  2RDG A;  3KBG A;  2EYF A;  3H91 A;  1FR3 A;  1SDF A;  4U68 A;  1Q1B A;  3WOE A;  1PZK D;  3NTH A;  4ILW A;  1EYC A;  2K32 A;  5FK9 C;  4HCS A;  1RCV D;  1MSG A;  1SXT A;  4I7Z C;  5LL6 X;  1TR5 A;  1BO0 A;  1YNJ D;  4HTH A;  3H3V C;  1VMC A;  2NVQ B;  3DEP A;  4ZKC B;  5BN5 A;  3QB3 A;  3GTM B;  1NAP A;  2B2U C;  3C1E A;  3UI2 A;  3M7G A;  4TKO B;  1CT1 D;  2EY6 A;  2L1B A;  3I90 A;  2IT1 A;  3KBX A;  3TME A;  2M00 A;  2WP8 J;  4WOR A;  5LL6 S;  5COR A;  1BDO A;  1IYU A;  1TWC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...