2TMPA

N-terminal domain of tissue inhibitor of metalloproteinase-2 (n-timp-2), nmr, 49 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TISSUE INHIBITOR OF METALLOPROTEINASES-2
publication title High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease inhibitor
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 1998-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tmpA00
2XWJB 3FRPB 3V96A 1GXDC 5JPMC 3CKIB 3HRZC 1JB3A 3L3OC 2A73B 3G6JB 2WINB 5FOBB 3CU7A 2ICEC 2J0TD 3OHXC 4FXKC 1XWEA 4FXGC 5FO7B 1UAPA 2QKIC 2XWBB 1UEAB 1JC7A 2E2DC 1PXUA 2WIIB 3HS0C 2I07B 3KLSA 5FO9B 1OO9B 2TMPA 2A74C 1BUVT 3MA2B 3T4AC 2B39A 1BQQT 1BR9A 5FO8B 5JPNC 3I70A 1D2BA 4ILWA
chains in the Genus database with same CATH superfamily
3P20A 1LO5D 2HD3A 5IOCA 3S15B 4X62Q 3PUXA 1ASZA 4OGQC 4JBJA 1STYA 5LMNQ 3SK4A 2K7VA 1PFBA 2Y0SB 3M9BA 5EPLA 1HFNA 1QG7A 4WJWA 3IKJA 1X3PA 4AYBG 4DR6Q 4NXMQ 4X3UA 2KOLA 2B2VA 2L11A 4DKAC 2DNCA 1Z6HA 2UU9L 1VF7A 1ZKOA 3X3NA 4BY1H 4K0KL 3KF8A 4IUNA 1XWEA 2DY7A 2K5WA 1L0XB 2KHSA 3GV6A 1YNNC 4R4IA 4DXGA 1PH9A 1N32L 3JAMi 2AWOA 2WIIB 4HJ5A 3S14H 3D4DA 1YNJD 4JVZA 2K05A 2RSOA 1H9JA 1BCPC 3C1EA 4HSPA 2NBFA 4XQQA 5GROA 4LFCQ 3OMGA 1SNCA 3FKIG 3GTLB 2CWPA 1SE2A 3I56A 1I4XA 2Z1CA 4DAMA 2D2CC 3CCVA 1QB5D 1WCMG 3TDQA 2E74C 4HMIA 1V1QA 2M2LA 3MAQA 3EVQA 4IFDH 5JAVA 1ICFB 3GD7A 4DV3L 3A7AB 1C9OA 2IW3A 4IPGA 3WDNA 2ZJRA 3GTGB 5AFWA 1MSGA 1FL0A 5IT9L 4KV6A 1JR0D 3A56A 4BA2I 3T16A 2BDNA 4LF5Q 5FKAC 2WKDA 4GOPC 1WJJA 3S24A 1DONA 4OONA 5AJ3L 4KKSA 4FXGC 1Z7TA 1IHZA 3S1QH 1B7YB 2B29A 2IHEA 4A3DH 1EZ8A 4RGNA 5BN5A 2F0VA 2UUBL 1U4MA 3EQLC 2NVYH 4JPBW 4IUPA 3FKIB 1ILPA 4NKLA 5HY6A 1PTOH 3TSSA 4DAVA 4FF4A 3CU7A 3BG3A 1OXXK 2A1AA 3HOYH 3R8BA 1EIFA 3S2HH 5DM63 5M9OA 4JYAL 2N55A 4RHRA 1OXVA 4C3IH 1I94L 1TWGB 4DK3C 4IFDJ 2NUCA 2YTVA 5C5MA 3ERQA 4KY5A 4XQNA 4HJAA 5EPKA 2I5LX 4N9TA 4YIJA 4NPSA 3W5OA 1YNND 1Y69U 4DPGA 5HURA 2R92B 4XDXA 3OTOQ 3S1MB 4AYBE 4C3JG 4IUVA 2NZHA 2UXBQ 1WTOA 1SEBD 1H9SB 1T5XD 1B1ZA 3TZUA 4FF2A 1BCPD 1IW7D 1PH5A 2JSOA 4QCLA 2XRQD 1L1OC 1WFQA 3HKSA 3DEOA 1CA6A 2B39A 5JVH3 2BA0A 1EIYB 4XXEA 5C4JH 2F3WA 1HJPA 2KHIA 1PFNA 2VW9A 3IRBA 3HOYB 1KTKA 3K7AH 1EIHA 3S2HB 1E2VA 3I4OA 4GN5A 1EYCA 4AQYQ 2X6GA 1HCZA 4LF9L 4JI6L 4H44C 1VQ5A 1KNAA 4DV2L 3PO2H 3ULLA 3GTKH 4K8JA 4APVA 1VQFA 3KLWA 1L0YB 5IGBA 1I6HH 1P8LA 3HS0C 5M5WH 1O7ZA 1W2BA 3T13A 3PGZA 4CKEA 3RZOH 1A0IA 3PF5A 2EYPA 4DR5Q 1EYGA 1XTDA 4R4QA 1EL0A 3FPPA 1VQ6A 4YY3Q 3HRZC 1R9TB 1JB7A 2ZXOA 4DV5L 3DLLA 4PZ6A 2UUCQ 5IP7H 4DR3L 2V4DA 1HTLD 2XWBB 2L5TA 3I91A 4B3ML 2UXCL 3STBC 4XIGS 1EFWA 3A7LA 2PNHA 1E2WA 5CBAE 2A74C 1GVPA 1EY8A 4A3JB 1YNXA 2BH2A 2Q2UA 4B3RQ 1ENFA 2L9HA 2PZUA 1I6HB 2JA7H 1QVFA 1AZQA 1EQRA 3R3OA 4JG2A 1MGSA 3A8JE 1E2ZA 2A8VA 2JQOA 1D5MC 2QF7A 1PZID 5BR8L 1FGUA 1S3OA 4B3SQ 4LAAA 3CHBD 1G2SA 3GTPB 1CZWA 1NE3A 1I50H 5GQOA 2CVRA 3S1RH 4FP5D 1F77A 4G4KA 1UE1A 1Q8KA 3PCOB 1QZHA 2ZXRA 2EY1A 4ME5A 3L3OC 5C5LA 4IPHA 4X6AH 3M7NA 1EY9A 1J8IA 2L0CA 4RGOS 4OELB 2LSSA 4IJLA 3RUZA 1RD9D 3DUZA 4ZK9B 1XMOQ 2B63H 1QNKA 5FO9B 1CKMA 3JAML 1FNVA 1U9RA 1NBWA 3BYTB 1WD1A 4S3SA 4RH6A 5TSSA 1TT2A 1Y1WH 4JI4Q 1WTHA 4CJ2C 4CDEC 1IYUA 2MO1A 1SE3A 3J80E 2QKIC 4XYQA 4A3EH 1A8VA 3L7ZC 3HKZG 1K8GA 2WP8J 3I8ZA 3S1RB 1X56A 2B2WC 2CW0D 4JI8Q 4IFDI 3VDYA 2H5XA 4QIWB 4FF1A 2F0UA 1IBKL 2QDLA 2HDLA 1WI5A 3C2PA 3EFXD 5FLXc 2VUMG 3I4MG 4H02A 1TXYA 3STBD 1J9OA 3KJOA 3NUCA 5M3MH 1LTAD 1IKLA 4IJHA 4IOCA 2VS1A 2OTJA 1PMRA 5KEEA 1I4RA 3PV0A 3FEWX 1SNOA 1NMGA 4U673 4F88A 5HGQA 1NR4A 4JOIA 4LWCA 1LV9A 1CTMA 4J8QA 3G6EA 3TRZA 4DUZL 2PW7A 3HG9A 1PYWD 2HIVA 4OO1I 2EJFC 3I4NH 2PO4A 5C3EH 4JV5Q 3LGJA 3I70A 3UDXA 4EQOA 4KMUC 3KF8B 2ZXPA 4XQJA 4YCUA 1LTTD 1V9PA 1NSNS 5D3DA 1B44D 2HQEA 4TKOB 1EWHA 3J81c 3GTOB 4FF3A 4MZ9A 2NWGA 2EYJA 2J0TD 4GKJQ 1N34L 2N78A 1MIUA 2Q8RE 3HOVH 3PF4A 5FJ8H 2Z0SA 1GD7A 3TP6A 3H3VC 2K03A 5M3MB 1RODA 3OWFA 3CQZH 2VUMB 5EQ0A 1TWHH 4JI2Q 3JC66 4A3CG 4PZ7A 3BDLA 1UUPA 1LTGD 2FINB 2PZWA 1PLFA 2EE1A 3D4RA 3R93A 2E2JB 2FJ2A 3P7JA 3IAYA 2ZT9C 1K73C 5M3FB 1Y8NB 1VQCA 2ZTEA 2Q2IA 5JOBA 5JJZA 4IQZA 3HEJA 2BE5C 3P75A 4CJ1B 1EQVA 4A3BH 4TVAB 3MA2B 1I4QA 1HXYD 4PG3A 3J81i 2KBNA 2BDOA 2B2YA 5IYDH 5CV7A 4BBSB 1W6KA 2F0SA 5G3LF 2NVXB 2HDMA 1SBBB 3IFDA 1VDZA 1SE4A 4FXKC 1D7QA 4UHVA 4RKLA 1ESFA 2F0IA 5M5XH 2NVTB 3M4QA 2XNAC 4XYOA 1NCVA 3VYTA 2Q2HA 1ET6A 1DOMA 1ONLA 1NUCA 2Z9HA 4JC0A 2K5QA 3CCJA 4LUVA 1CM9A 1EEFD 3S17B 4V0BA 3N52A 5EBCA 3OW7A 5C0XG 1NY4A 2EYMA 1RTNA 3E3XA 2AQ1B 2MGSA 2E75C 1MI2A 1FR3A 2LMCB 1I4PA 4DUYQ 5IGFA 1UAPA 4BXXH 4A3BB 4DK1A 4TRDA 4UP9A 3KDFB 4DR2L 1PH2A 2G9HD 1X3FA 2C35B 1TS5A 2AMCB 3D6CA 4A3IB 5FLMH 5NUCA 5I2XA 2R93G 3MZ5A 4I7ZC 2JA6G 4KD4A 1RDPD 3VYRA 1IKMA 5DM73 2ALYB 1C48A 4UPAA 3U50C 1PH6A 3NTKA 4LF8L 1GXDC 4GKKL 4R4OA 2SEBD 4HTHA 4DV6Q 4YCWA 2WINB 3TP8A 4A3FH 3H0GG 5IYCG 1RL2A 1BBXC 2WB1B 3MFGA 1S5BD 1HRJA 1JCKB 2D62A 3LWEA 1PH1A 5JEAH 1DM0B 3OOCA 4X3TA 2F0QA 1O7IA 3ITPA 4IZ8A 4FXDA 2VB3X 1L0WA 1FYCA 1ASYA 3QO2A 1HR0L 1LABA 1B8AA 2VZAA 3KF6A 4K14A 2WACA 1I3QH 2HCIA 2MP1A 2R7FA 4NXNL 4MIUA 1N9WA 2R93B 3CCMA 4HSVA 1MSHA 2I07B 3UDFA 1HQMC 5I6YA 4RKBA 4RHSA 2CFMA 4UP7A 2JA6B 1Y8PB 4CKCA 5BN4A 1K0RA 4KN4C 4A3FB 2MNAA 2PW5A 1Y1VG 3T1HQ 3J7ZC 3FRPB 1EY6A 1MJEA 5CV8A 1SYDA 4O42A 2B2TA 1XNRL 2E76C 2PMZB 3I2ZA 4YWLA 4EQ5A 1XMQQ 1HFGA 3CRKC 3KK7A 3KLSX 4RGTA 2B8GA 3NENA 3HOZB 1Q8IA 1V8QA 2CQAA 4DV0Q 5JEAJ 3GTMH 3U9OA 4YWKA 1B3QA 1I3QB 1S4ZA 3CP0A 3UI2A 1JT8A 3QR8A 4BBRG 1PFMA 4DNIA 1YVCA 1A2UA 3T51B 1XPOA 4X65Q 2VQEQ 1YNJC 1HNWQ 4ODGA 5DLQE 5LMUL 3NEMA 1B2TA 3BZDB 2OQKA 1VQGA 1DYQA 1VF5C 1KQSA 2R61A 1B4OA 1A3UA 4F8MA 2JA5H 2Y0SG 3KLSA 1LLRD 3K80C 2ZM6Q 1M90C 1MD2D 4K6LA 1YZ6A 1C0AA 1KIXA 1GUNA 3HOUH 1K8OA 4YHHQ 3SK8A 1RTOA 2NN6I 1K3RA 2KEDA 4C2MH 3N6RA 5J1ZA 2KJXA 2BA1A 2DY8A 2EJMA 4ZKCB 1EY4A 1NMFA 3J80L 1TWCH 1VQMA 5IE8A 4IOAA 4JI1L 5D14A 3T4AC 4R1JA 1JJCB 1SDFA 2PMZE 4EGVA 5FLXL 4I65A 5A2QE 5C44B 4A3KH 2QDBA 3C3LA 2RDGA 2SNSA 2JK8A 2XSCA 2Q8IB 3HOXH 3S2DB 2JA5B 4U68A 4XTCS 2UU9Q 1PTOF 4BS9A 5BN3A 1I5FA 4HCEA 5C4XH 2CHBD 4K0KQ 1E7ZA 3IFTA 3HOUB 1M8AA 2KENA 3TBIB 4F7XA 1Q82C 4OEMB 3F2CA 3T53B 1QCBD 3L2PA 1PRTF 3TS0A 1HZBA 1NAPA 3AFQA 1N32Q 3O13A 5CV5A 3S1NH 1Q90A 4LFBL 2LS01 1NJIC 3J81L 3NK9A 1STEA 3ONAB 1IZ6A 3PUWA 2E5LL 3QJYA 1AW7A 5IWAL 5IODA 1VQLA 1K3BC 5M5YB 2F0MA 2HCCA 1F9RA 3CMAA 1F9SA 1YBYA 1PVOA 1HNZL 3F2UA 4IPDA 1CHQD 3U4ZA 4AIMA 1JE5A 1DZ1A 1U4PA 3A8IE 3HOXB 3RLOA 2PNRC 2D5DA 3OWEB 4FDBA 4DV3Q 1IW7C 3V96A 5IGEA 3Q24A 1V1PA 1TR5A 3G6JB 2IY5B 1WTVA 4HJ9A 2ICEC 1FVIA 2X6LA 1EOTA 2F0PA 2SOBA 3F2DA 2XTIA 2K50A 5AJ3Q 4OIJA 2KVMA 2XGTA 5J3BA 2GVBA 4JW0A 4A3MH 1QILA 4BY1B 1VQHA 3J7YW 2YTYA 3BDCA 1D5ZC 2F0GA 1EWIA 2UUBQ 5JJLA 2Y0SE 4OHJA 2CWAA 4R4TA 1PDQA 2EDGA 2QEJC 3ZJYC 2R92G 3S14B 4A3DG 1X6OA 2EY2A 2XN9C 1WCMH 3RNUA 1TKWB 3A54A 5LMNW 3NHHA 1RCVD 5GADC 1KXLA 1H9MA 4LFCL 3NQTA 1IYVA 4LF6Q 4R9WA 1Q46A 3VR5A 1LTRD 1WTWA 2EYHA 2F3VA 3QIAA 4OO1H 2OTLA 2EPBA 2F4IA 3EN2A 2RCNA 1GJXA 1C7YA 5K36G 2Q2TA 3PUYA 1SYFA 4OWTB 4BY7H 3HOYG 2Z6KC 1G91A 2RKSA 3LX0A 4A3MB 5ELDA 1HZAA 2EIFA 3W1BA 1WTPA 3SDZA 4X3KA 1G2TA 2FMMA 3KDFA 1HH2P 3SHLA 4DXFA 4LF5L 3CC7A 1SLJA 1B50A 2QEXA 1GM5A 2FFKB 4JBWA 1PH4A 2LFNA 2OT2A 3S1QB 3OIQA 4A3DB 3K5MA 1CKOA 3H6MA 3TN2A 1LUZA 5IGCA 1BVSA 1B53A 1QVGA 3MC0B 4DV4L 4L5RC 3T56B 1SAPA 2YU9H 3MTSA 1WOCA 2NVYB 4YCVA 3Q0AA 5C4ZA 4JI6Q 4LF9Q 3SGIA 4DV7L 4DNRB 3OMCA 4M1UB 4CDCC 4BY7B 2F0DA 1PRTD 4IO9A 1AE3A 1PTOB 4KKTA 3Q23A 1ENAA 1QOHA 1EQTA 4A3JG 2NTSA 1SR3A 1T5EA 5EAYA 2F0EA 2KA7A 3A8KE 3ZYYX 4C3JH 1Z9FA 1PRTB 1BNZA 1VQAA 2HIXA 4C3IB 3EIVA 4IPCA 1CK1A 1F2ZA 4DV5Q 4C1NI 1UE5A 1OXTA 4DR3Q 1A62A 2OF1A 1ILQA 2N8NA 2PI2A 3CC4A 4KHPQ 3OTOL 2IWHA 1L2FA 1LM0A 5CMDA 3BVMA 3KF6B 5EBDA 2UXBL 4POGA 3I72A 1UNSA 1UE7A 1S40A 3SR1A 2CCZA 2CW0C 4DGZA 3K5NA 1XX8A 4WJ3M 4PQXA 3BZKA 3HOWH 4R8NA 4CGYB 3D0FA 2AHOB 1DD2A 2F0WA 4K5XA 1CHPD 5C4JB 1IBMQ 4B3TL 3T1YL 2NZOA 1WTRA 2B2VC 3K7AB 1Q86C 1N33L 1TY2A 3BVGA 4AQYL 3CMEA 3SXHA 2B2UA 2K1BA 4P71A 4KN7C 1EY7A 1KDAA 1CKNA 2K5DA 3PO2B 1X3GA 1S5DD 4A4IA 3GTKB 1W3SA 3FMCA 1IL8A 4QUCA 3VR3A 3A0JA 4B9XA 5HGTA 2GVAA 1BXTA 5M5WB 3M4OH 1VQJA 1S72A 5C4HA 3D3RA 5IP9H 1PXUA 3RZOB 4UAIA 4OL7A 1TWFH 2JP1A 4A3GH 1K83H 1PFSA 1CQVA 3GTJH 2OCEA 1Z47A 4LK1C 4BA1I 4YY3L 5KIXA 3A5ZB 2UUCL 3HOWB 2HUGA 3D31A 5E4WC 4R4CA 3SE0A 2ASBA 1P16A 2PQAA 2N88A 4DV1L 2VY3A 2B63G 4J6HA 1SYGA 2I46A 4PNYA 1DOKA 1O7LA 2MUYA 1R4QB 1GHJA 2LY7A 4GNXA 5D3IB 2A19A 2JA7B 4PMBA 3K5LA 5LHY1 2OEOA 1IBKQ 4G7OC 3RLFA 2DGYA 2UXDQ 1SMYC 2XIWA 1BBWA 4A3GB 1K83B 1QWYA 2UUAQ 2D0OA 4B3SL 2WKCA 1A3VA 2NZ1D 1I50B 1EU4A 3PIP3 3UDGA 3K7UC 3NXWA 4AH6A 3J80c 1QVCA 3WOFA 3K8AA 3VYSA 4F87A 2AUJD 2C5CA 4PZ8A 4ZRZA 1S5CD 3K5OA 2K6AA 3EA6A 1PV4A 4UY8C 4A93H 5M3MG 2F1MA 3CKIB 2F3IA 3MXUA 4PV1C 5A35A 1XMOL 3J7AF 2O5IC 4P75A 1AEXA 2B63B 4X66L 4E6IA 5IYBG 1EY0A 1I4GA 4ABNA 4DR4Q 5M3FG 4JK1C 5CC4A 1TWAH 3RN5A 1Y1WB 2B8FA 1WD0A 2E2IH 1BUVT 4L5SA 1BO0A 3EBEA 3AMUA 1HA6A 1QUQA 4KHZA 4JI7L 5DEHA 3S16H 4A3EB 2NN6H 4GN3B 3I4MH 2E2HH 4FNFA 1VQIA 2N49A 3AB9A 3J80i 4BBSG 1SJHD 2F0NA 2DNEA 4ME3A 1NR2A 4C3HH 3HOVG 5FJ8G 2RCFA 1QE6A 4X64Q 1OXSC 4OX9Q 4KK7A 1XTCD 1V1PB 2GN5A 4KHVA 4CDDC 3CCEA 1F2YA 3KYHC 1BKBA 4O2DA 3K0XA 4ZCKA 5IIFA 1RHPA 1DCZA 3SK5A 4QIWE 2DJFC 2F0KA 4G7HC 3ER0A 4J1MA 2J4XA 2MHVA 2LXJA 3I4NB 5C3EB 3AEVA 4P73A 1NNXA 5KNCA 4A3BG 3DWAA 1TY0A 2F0FA 1OO9B 3VYUA 2VNUD 1QNUA 2E2HB 1SMYD 1A3TA 3L0OA 5KNDA 4A3IG 1A15A 2NVQH 1HZ9A 2EY6A 3URYA 3VA5A 5JJIA 2E8GA 5ELNA 4GKJL 1YJ9A 2MJ8A 2KQ3A 1WVLA 2PQEA 4DAYA 5K5PA 4IN3A 3HOVB 1AFPA 1JWMD 3CD6A 4DFAA 1BDOA 3BU2A 1ZYRC 3R2TA 4LF7L 4HMJA 2J7ZA 2ZTDA 3CQZB 4DR1L 4JBMA 1SNMA 2K5VA 1Q12A 2WB1G 1TWHB 3GTQB 4DR7L 1V43A 5IT9E 3MXNA 1BQQT 1VMCA 1G6PA 3PSIA 3F2BA 4ID6A 1E1TA 4KKUA 2R7DA 1SNQA 1O7YA 4PMWA 3RZDH 4LFAL 3D6WA 3WWVA 4L63B 5CYUA 3PIPA 3DXJC 3V2TA 1HNXL 4LF8Q 1X54A 2QCPX 2RDHA 5FLMG 3BVZA 1KLGD 2HHHL 3E5SA 1EU3A 2RBMA 1J5EL 4WJ4A 2QW7A 1HUMA 4HJ7A 3CCUA 2WFWA 1YHBA 3CW2C 3H3VH 1C8CA 1X65A 2BCOA 5EKKA 5M5XB 4GN4B 2O5JC 5KYIA 1LTBD 2O4XA 4OXPA 4A3FG 2EYLA 4POFA 2CH4A 1HR0Q 1YITA 3GP7A 2Z4HA 4GLXA 2F4VL 4GLVB 4P74A 3K6OA 3ERSX 1KL9A 4Y7NH 2A5HA 4NXNQ 4NMZA 1N36L 2I5MX 2KCTA 3QG1A 1DOLA 3RZDB 3HOZG 3PUZA 1M1KC 1ICWA 4JI3L 4K8IA 2ZTCA 1SNDA 2AQ3B 4CJ0B 2RHSB 3NP8A 5D65A 3M3YH 1OTCA 4LF4L 4J15A 1CZGA 5DAUA 2H4OA 5KYLA 2X69A 3TP5A 1XNRQ 3PO3H 4NB3A 5EKLA 4RCNA 1VQEA 1YJWA 4OWXB 2TMPA 1CFMA 4A3LG 2RVLA 2WV6D 1VQBA 3G7LA 4C56C 1ZYRD 3NTIA 3TS2A 1PH8A 1LTSD 1SYEA 4UP8A 3D8GA 2RSNA 3I4LA 5J22A 5C3WA 5C0XJ 2A6HC 3U58A 4K5VA 2IJ0A 1IL2A 4TSSA 4GOPA 3BS1A 3TREA 4IUTA 4OWWB 2E2DC 2JA9A 3VA7A 3BZCA 2MO0A 1TU2B 2KECA 3HGBA 2EJGC 4LUOA 1XJVA 1CKNB 3M3YB 2JA8H 1SN8A 2A6EC 2R7ZH 2WB1E 4HEDA 4JI5Q 4N8X1 3F1ZA 5C44G 1PHJA 1EIGA 1SRUA 3ND9A 3RMHA 3UDIA 2GA4B 5G3LD 1GOZA 3UE0A 3I73A 1HR0W 2Z6KA 1RKNA 2JA5G 1JOKA 4JI0Q 1F9QA 3CCQA 4MTKA 1IBLL 5CV9A 2C9OA 3VR4A 3QB3A 1LACA 2LXKA 1PYBA 4QUFA 3HOUG 4EX5A 2IL8A 4XT1B 3J81j 3J7A5 1FJGL 2PQAB 2AKWB 1SROA 1U5KA 1XMQL 4RMFA 1EYDA 4BBRH 4BWGB 1XNQL 4C1NK 4UDUC 1H95A 3GTQH 1VQNA 3OHXC 1U4LA 1HHVA 4ZUJA 3S15H 2HT1A 1JWUD 1E0BA 3GTMB 5JVG3 1KDBA 1SSOA 4GNXB 2JA8B 1YJNA 2KCCA 3MXPA 3A5UA 4DAPA 2VQEL 2B2YC 2CQOA 3G48A 1L1OA 4A3KG 4KD3A 1MJCA 1TVXA 1J6QA 3HOXG 2PZTA 5T1GA 1JICA 3F8TA 4O0AA 5E1FA 2RA4A 1K9MC 1Y8OB 4ZUIA 3E9IA 5KGUA 1G51A 2VQFL 4LFBQ 3K57A 2RDFA 4QGUA 2ZM6L 5E3FA 2E5LQ 4N8FA 2K4KA 3JAME 4ULLA 3CXCA 4Y52H 2A69D 3E0JA 3V05A 4C2MB 2A6HD 1EUJA 2PCFB 1XPUA 1HNZQ 1RIPA 5I6WA 2D9UA 1K8AC 3BJUA 3DMUA 4BY1G 1HQRD 2A73B 4ZAIA 1TWCB 1BCPF 3PQIA 3GTLH 5I9OA 4H0LC 5EJWA 2A6ED 1JC7A 1KC8C 1GKHA 2FHTA 3AYHB 3CCLA 4V190 3DWQA 2AQ2B 2CKZB 5GAEC 4A3KB 1QUQB 1X55A 1FGBD 4HIMA 4X62L 1GUWA 1PTOC 1YEZA 1ML0D 3NELA 2DN8A 3ULPA 3C46A 3OYYA 1S5FD 3E0EA 2V1CC 5LMNL 5C4XB 2QA4A 3H91A 3GTGH 1LTLA 1VQDA 1PRTC 1EYAA 4KJNA 4DR6L 4NXML 2MPMA 3FP9A 4IFDG 3X3MA 3S1NB 3OPOA 4HIOA 4O1NA 1CSQA 4A3MG 1YI2A 2KCNA 4IUUA 1K8MA 5JPNC 1PH7A 4CBVA 2YV5A 1SMXA 3H3VI 3CPFA 4LMQD 4DA2A 3IL8A 5C0XI 1MBYA 2VB2X 3FKIH 1H9RA 3K0YA 4AYBB 1TS2A 3SVMA 4LJZC 4WFN3 4OO1G 2I0QA 2A68C 2K01A 1AH9A 4QF4A 2L1BA 4JYAQ 4HN7A 4DAYB 1STAA 1STNA 1I94Q 2F0OA 1I4HA 1TWGH 4BY7G 2B2TC 1D5XC 2VL6A 2H1EA 1WTQA 2BOSA 2K75A 1KRSA 1GHKA 2M9VA 2R92H 3S1MH 2K14A 4MHEA 3MXNB 2IT1A 4C3IG 3BDOA 4DV4Q 2B2WA 3FHWA 1O78A 3H94A 4RCOA 3M4YA 4DV7Q 3VR2A 4RFBA 2ID0A 3E9HA 1SE8A 4B9WA 2JN4A 1QZGA 1D8LA 3NWTA 1B9MA 2YTXA 5K36H 1EY5A 1WCMB 3MXGA 4N9PA 2IHFA 1GUOA 1HZCA 2R3ZA 3PUVA 4LF6L 1LT4D 2IX0A 3FDTA 3GDEA 4RWSC 1PTOD 3NE5B 1JOQA 4QY7A 3NPPA 2F0JA 5DNFA 5LL6X 4DV2Q 1AZPA 1BOSA 1KLUD 1HUNA 2K52A 1YHAA 2IX1A 1LT5D 4KY6A 4FYDA 3W2DA 4HAEA 1Q81C 3MEFA 1G8ZD 3K59A 1ZEQX 4QL5A 5EPJA 4DK0A 3PO2G 1STGA 4G57A 2XVSA 3MFYA 1R9TH 2L12A 2I5HA 3OIPA 4LUZA 1F2MA 1PZKD 1IXRA 1VQOA 3DM1A 3GV3A 4B3MQ 1BCPB 2Z8LA 2UXCQ 1BBUA 2R6GA 5COYA 4B3TQ 4L6TB 3T1YQ 1ZXTA 1N33Q 1WTXA 3NBHA 1X9NA 3A74A 4HIKA 4ALPA 4A3JH 2YU9B 3NSWA 5IP7G 1YHQA 3HOWG 2A68D 3KFUA 1F9PA 2ENBA 3KUPA 1TIID 1K0SA 4Z9CB 2RF4A 3TP7A 1BR9A 5BR8Q 5ISRA 4C3JB 2SNMA 4EQNA 1KD1C 1SXTA 2K32A 2K5NA 3GTPH 4X3SA 4CKBA 3S9WA 2JA7G 4GOPB 3H15A 1M4VA 2DUDA 4XT3B 5IGGA 3KOJA 5IP9G 4KHPL 4PMCA 3W3AA 4A3GG 3CF5A 3ICEA 1CUKA 4DV1Q 4DR5L 1G6ZA 5CBEE 2P5ZX 2EOTA 2AUKA 3FVQA 3M85A 2LKVA 3KJPA 5ELCA 1SYBA 1Q1EA 3VR6A 1IBML 3AQQA 2EXZA 2JEBI 1JQYD 1JMCA 1E3PA 4Q5VA 1EFID 1VQ8A 2O2LD 4HCSA 4B3RL 1Y1WG 1D1KA 1U4RA 3DEPA 4QJFA 2QILA 1JB3A 2L15A 3M4OB 5A2QL 1A2TA 1HA5A 4A3EG 1JORA 1TWFB 4ZKBB 4L5TA 1X3QA 4DK6C 3DWPA 3GTJB 4P2CB 3AU7A 4X66Q 3LWUA 1L1OB 2BH8A 4CHTB 2WAQG 4JCVE 1KAAA 1PYSB 2L55A 2KCMA 1S5ED 4A93G 2ZJPA 3D4WA 1Q7YC 2MQHA 4DUZQ 2QGQA 3ND8A 1LYLA 3KLRA 1VQ7A 1KDCA 1T9HA 2EYFA 4EQPA 2TSSA 4JI7Q 1CT1D 2ES2A 3TQYA 4DNTB 2F0TA 2K33A 3I55A 5IY0A 5ELOA 3A55A 3GTOH 1CQFA 4QB4A 1W6JA 1SYCA 1JJ2A 1FNWA 3G4SA 5FLXE 4JI4L 1N34Q 3I4NG 1VQ4A 5C3EG 2ATWA 2UXDL 3OW2A 1LTID 2NN6G 1JJGA 2G5DA 5CR3A 1A63A 2UUAL 3SEBA 1TS3A 2VUMH 4H13C 2FXQA 1DJRD 1HTPA 4C3HG 3GQBA 1MHWC 1FNUA 1X32A 4JI8L 2EQSA 5CORA 3CCSA 5IYBH 3HP3A 3E6ZX 2NYZD 2WAQB 1R4PB 1EZ6A 5ELEA 1VS0A 1Q1BA 2E2JH 1K28A 4IUQA 5M3FH 4A93B 2M00A 1UEBA 4DF7A 2AWNA 3J81E 5I4DA 1VQPA 5C6AA 4EVOA 2XWJB 4WRDA 2Q8TA 5E4XA 3I7FA 4RAUC 1PA6A 1VCIA 2JEAI 1X3EA 4TQUS 3TMEA 1B9NA 2PYKA 3CRLC 3HKZB 5I2YA 4A76A 4DR4L 1ESRA 2IX3A 4MTNA 1TWAB 3QOLA 1H9KA 4BBSH 1EQQA 2G9DA 1SFOH 2KHJA 2E2IB 3K58A 2NVXH 4DN4M 4M8AA 1TQOA 4ZLTF 2Z6BA 4GZYC 4JV5L 4LF7Q 3M7GA 2EY5A 4RG1A 2NVTH 3S16B 3G71A 4DR1Q 4JBKA 3I4MB 5IYDG 1PH3A 2JYOA 1SNPA 4DR7Q 2EVBA 4C3HB 1JWSD 4ZYSA 5CGKA 3S17H 4A3CH 4G7ZC 2F0HA 4HR7B 1MKHA 5FO7B 1F2LA 4X64L 1I6VC 2YYZA 3KBGA 4LFAQ 4OX9L 1KABA 1BF4A 1NTGA 1SJED 1E24A 1HNXQ 4NP5A 1G291 1LT3D 3K81C 5CV4A 4DR2Q 4JI2L 2KUMA 3L9AX 4LW1A 2B2UC 2HHHQ 1AP0A 1II3A 3TEHB 4A3IH 1DGSA 1J5EQ 1WYDA 4MNOA 2K04A 4QQBX 4KI0A 1KNEA 1SFOB 5IT9c 3GO5A 2WAQE 2EXDA 3MVVA 4H7BA 1HPCA 2XRSD 3ULJA 4BXXG 3BYYB 3RD4A 3MWYW 2RQXA 2OWOA 5ELFA 3CC2A 4GLAC 4GKKQ 2JJQA 2F4VQ 1EEID 4P72A 4A75A 2NVQB 1XYIA 4WORA 1JE4A 3HKZE 1B70B 4IALA 2OXPA 1N36Q 1B3AA 3Q6SA 3FPUB 5C0XH 4JI3Q 5EGTA 4HJ8A 1O80A 4LNQA 4K6DA 4KTAA 4QMGA 3QOJA 3RLNA 3Q8DA 4KY7A 2K5HA 5JEAG 3NWSA 4LF4Q 2N3SA 3EJIA 1H9SA 4GNXC 2FMCA 2EYOA 1STBA 1EOVA 4RA8A 2KEEA 3U9SA 5C3XA 3PIO3 1CA5A 2R93H 3PMFA 4K2KA 2JA6H 3OSOA 1UE6A 4DUYL 1YIJA 4GS3A 2Z4IA 1VQ9A 1E1OA 3CCRA 2L4NA 1U0LA 4KLKA 4NW2A 3PO3G 4FVMA 5ELBA 1KHIA 3H0GH 5IYCH 1XPRA 3P1HA 1UEAB 4K5WA 2F52A 3WOEA 2ICIA 1GUTA 2K28A 3NBHB 1C4QA 1AE2A 1QJOA 3UE1A 4OIKA 2NB0A 3MEHA 5FO8B 3HOZH 1RJTA 4DV6L 1GUSA 1Y14B 2OQ0A 3I3CA 3W1GA 4K2LA 2BE5D 1KAWA 3RR5A 4YWMA 2A69C 4Y7NB 3B6YA 5KNBA 3NTHA 4Q0FA 5GAHC 4JOIC 1STHA 1ENCA 1FD7D 4HIDA 1PZJD 2F0LA 5I9PA 5LMUQ 3LNNA 2JA8G 5KRUA 3CAMA 4A3LH 1IBLQ 2R7ZG 1D1IA 1GUGA 2JXMB 3SK6A 4L8JA 1IYJB 1KRTA 3H0GB 3KBXA 3J7AV 1Y1VH 4IURA 1FJGQ 3PO3B 2D0PA 1ET9A 1XNQQ 1VMPA 1UWVA 3MHBA 2B3GA 5FK9C 3EROA 5IGDA 2EZVA 1GO3E 1V1OA 4B08A 2MFIA 3I90A 3T1HL 2PPBC 2SDFA 3Q22A 4ZQ3A 2HQLA 5JJKA 3TZDA 1AN8A 5T1IA 5H1SE 4JI1Q 3CPWA 3RN2A 5JPMC 4I7AA 2PI2E 2CH4W 3QWNA 5C44H 3NBIA 1DXMA 3DM3A 4KJOA 5LL6S 3U4VA 4NDXA 5CV6A 3R2IA 4DV0L 3S2DH 2VQFQ 1LT6D 4MN3A 4DU9A 1N8RC 2JE6I 1XXGA 1VQKA 2R7ZB 1JOOA 3AFPA 1A6XA 1Y1VB 2NTTA 4JI5L 4X65L 5GAGC 2ZJQA 2F03A 1HNWL 3M4PA 5F2DA 2RHQB 3DHQA 3HFZB 1CSPA 4JI0L 5FOBB 2IPKD 1D6EC 5C4XG 4L5QA 1TS4A 5EKIA 5E7NA 5L37A 4FO2A 1CI3M 3PIOA 2VXWA 5J39A 1OXUA 3HZXA 1Q3LA 5IWAQ 3C1FA 4R8IA 4YHHL 4RGMA 1RF2D 5M5YH 1E22A 4BBRB 4CDFC 3H09A 3NQIA 1EWCA 3JAMc 1D2BA 2DJGC 4ILWA
chains in the Genus database with same CATH topology
3P20A 1LO5D 5IOCA 3S15B 3PUXA 4OGQC 1STYA 3SK4A 2K7VA 1PFBA 2Y0SB 5EPLA 1HFNA 1QG7A 4WJWA 3IKJA 1X3PA 4X3UA 2KOLA 2B2VA 2L11A 2DNCA 1Z6HA 1VF7A 1ZKOA 3X3NA 3KF8A 4IUNA 1XWEA 2DY7A 2K5WA 1L0XB 2KHSA 3GV6A 1YNNC 4DXGA 2AWOA 2WIIB 3D4DA 1YNJD 2K05A 2RSOA 1H9JA 1BCPC 3C1EA 4HSPA 2NBFA 4XQQA 3OMGA 1SNCA 3GTLB 1SE2A 1I4XA 2Z1CA 2D2CC 1QB5D 3TDQA 2E74C 4HMIA 2M2LA 3MAQA 3EVQA 4IFDH 5JAVA 3GD7A 3A7AB 2IW3A 3WDNA 3GTGB 5AFWA 1MSGA 5IT9L 4KV6A 1JR0D 3A56A 4BA2I 3T16A 2BDNA 5FKAC 2WKDA 1DONA 4KKSA 4FXGC 1Z7TA 1IHZA 1EZ8A 4RGNA 5BN5A 2F0VA 1U4MA 3EQLC 4IUPA 3FKIB 1ILPA 4NKLA 1PTOH 3TSSA 4DAVA 4FF4A 3CU7A 3BG3A 1OXXK 3R8BA 5DM63 5M9OA 2N55A 4RHRA 1OXVA 1TWGB 4IFDJ 2NUCA 5C5MA 3ERQA 4KY5A 4XQNA 5EPKA 4YIJA 4N9TA 1YNND 1Y69U 5HURA 2R92B 4XDXA 3S1MB 4C3JG 4IUVA 1WTOA 1SEBD 1H9SB 1T5XD 1B1ZA 3TZUA 4FF2A 1BCPD 1IW7D 2JSOA 4QCLA 2XRQD 3DEOA 1CA6A 2B39A 5JVH3 2BA0A 4XXEA 2F3WA 1PFNA 3HOYB 1KTKA 1EIHA 3S2HB 1E2VA 1EYCA 2X6GA 1HCZA 4H44C 1KNAA 4K8JA 1L0YB 5IGBA 3HS0C 1O7ZA 3T13A 4CKEA 2EYPA 1EL0A 3FPPA 3HRZC 1R9TB 2ZXOA 2V4DA 1HTLD 2XWBB 2L5TA 3I91A 4XIGS 3A7LA 1E2WA 5CBAE 2A74C 1EY8A 4A3JB 1ENFA 2L9HA 2PZUA 1I6HB 1AZQA 3R3OA 1MGSA 3A8JE 1E2ZA 1D5MC 2QF7A 1PZID 4LAAA 3CHBD 1G2SA 3GTPB 1CZWA 2CVRA 4FP5D 1F77A 4G4KA 2ZXRA 2EY1A 4ME5A 3L3OC 5C5LA 3M7NA 1EY9A 1J8IA 2L0CA 4RGOS 3RUZA 1RD9D 3DUZA 4ZK9B 1QNKA 5FO9B 3JAML 1FNVA 1U9RA 3BYTB 1WD1A 4S3SA 4RH6A 5TSSA 1TT2A 4CJ2C 1IYUA 1SE3A 3J80E 2QKIC 4XYQA 3L7ZC 2WP8J 3I8ZA 3S1RB 2B2WC 2CW0D 4IFDI 4QIWB 4FF1A 2F0UA 2HDLA 3C2PA 3EFXD 1J9OA 3NUCA 1LTAD 1IKLA 1PMRA 5KEEA 1I4RA 3PV0A 3FEWX 1SNOA 4U673 4F88A 1NR4A 1LV9A 1CTMA 4J8QA 2PW7A 3HG9A 1PYWD 4OO1I 2EJFC 2PO4A 3I70A 4EQOA 4KMUC 2ZXPA 4XQJA 1LTTD 1NSNS 5D3DA 1B44D 2HQEA 4TKOB 1EWHA 3GTOB 4FF3A 2NWGA 2EYJA 2J0TD 2Q8RE 3TP6A 3H3VC 2K03A 5M3MB 1RODA 3OWFA 2VUMB 5EQ0A 3BDLA 1UUPA 1LTGD 2FINB 2PZWA 1PLFA 2EE1A 3D4RA 3R93A 2E2JB 2FJ2A 3P7JA 3IAYA 2ZT9C 5M3FB 1Y8NB 5JOBA 5JJZA 4IQZA 3HEJA 2BE5C 3P75A 4CJ1B 1EQVA 3MA2B 1I4QA 1HXYD 2BDOA 2B2YA 5CV7A 4BBSB 1W6KA 2F0SA 5G3LF 2NVXB 2HDMA 1SBBB 3IFDA 1VDZA 1SE4A 4FXKC 4RKLA 1ESFA 2F0IA 2NVTB 2XNAC 4XYOA 1NCVA 3VYTA 1ET6A 1DOMA 1ONLA 1NUCA 2K5QA 1CM9A 1EEFD 3S17B 4V0BA 3N52A 5EBCA 3OW7A 5C0XG 2EYMA 1RTNA 2AQ1B 2MGSA 2E75C 1MI2A 1FR3A 2LMCB 1I4PA 5IGFA 1UAPA 4A3BB 4DK1A 4TRDA 2G9HD 1TS5A 3D6CA 4A3IB 5I2XA 5NUCA 3MZ5A 4I7ZC 4KD4A 1RDPD 3VYRA 1IKMA 5DM73 1C48A 3NTKA 1GXDC 2SEBD 4HTHA 2WINB 3TP8A 1BBXC 2WB1B 3MFGA 1S5BD 1HRJA 1JCKB 2D62A 3LWEA 5JEAH 1DM0B 3OOCA 4X3TA 2F0QA 3ITPA 4IZ8A 4FXDA 2VB3X 1FYCA 3QO2A 1LABA 4K14A 2WACA 2HCIA 2MP1A 4MIUA 2R93B 4HSVA 1MSHA 2I07B 5I6YA 1HQMC 2JA6B 4RKBA 4RHSA 1Y8PB 4CKCA 5BN4A 4KN4C 4A3FB 2PW5A 3FRPB 1EY6A 5CV8A 1SYDA 4O42A 2B2TA 2E76C 2PMZB 1HFGA 3CRKC 3KK7A 3KLSX 4RGTA 2B8GA 3HOZB 1Q8IA 1V8QA 2CQAA 5JEAJ 3U9OA 1I3QB 1S4ZA 3UI2A 1PFMA 1A2UA 3T51B 1YNJC 4ODGA 1B2TA 3BZDB 1DYQA 1VF5C 2R61A 1B4OA 1A3UA 4F8MA 3KLSA 1LLRD 1MD2D 4K6LA 1GUNA 1K8OA 3SK8A 1RTOA 2NN6I 2KEDA 3N6RA 5J1ZA 2KJXA 2BA1A 2DY8A 2EJMA 4ZKCB 1EY4A 3J80L 5D14A 3T4AC 1SDFA 5FLXL 4EGVA 5C44B 4I65A 5A2QE 2QDBA 3C3LA 2RDGA 2SNSA 2XSCA 2Q8IB 3S2DB 2JA5B 4U68A 4XTCS 1PTOF 4BS9A 5BN3A 4HCEA 2CHBD 3IFTA 3HOUB 1M8AA 4F7XA 3TBIB 3T53B 1QCBD 1PRTF 1NAPA 3O13A 5CV5A 1Q90A 2LS01 3J81L 3NK9A 1STEA 3ONAB 3PUWA 3QJYA 1AW7A 5IODA 5M5YB 2F0MA 2HCCA 1F9RA 1F9SA 3F2UA 1CHQD 1DZ1A 1U4PA 3A8IE 3HOXB 2PNRC 2D5DA 3OWEB 1IW7C 3V96A 5IGEA 3Q24A 1V1PA 1TR5A 3G6JB 1WTVA 2ICEC 2X6LA 1EOTA 2F0PA 2SOBA 4OIJA 2KVMA 1QILA 4BY1B 3J7YW 3BDCA 1D5ZC 2F0GA 4OHJA 1PDQA 2EDGA 2QEJC 3S14B 2EY2A 2XN9C 1TKWB 3A54A 3NHHA 1RCVD 1H9MA 1IYVA 3NQTA 4R9WA 3VR5A 1LTRD 1WTWA 2EYHA 2F3VA 3QIAA 4OO1H 2EPBA 2F4IA 1GJXA 5K36G 3PUYA 1SYFA 1G91A 2RKSA 3LX0A 4A3MB 5ELDA 1WTPA 3SDZA 4X3KA 1G2TA 2FMMA 3SHLA 4DXFA 1B50A 2FFKB 4JBWA 2LFNA 2OT2A 3S1QB 3OIQA 4A3DB 3K5MA 3H6MA 3TN2A 5IGCA 1B53A 3MC0B 3T56B 1SAPA 3MTSA 2NVYB 3Q0AA 5C4ZA 4DNRB 3OMCA 4M1UB 4BY7B 2F0DA 1PRTD 4KKTA 1PTOB 3Q23A 1ENAA 1QOHA 1EQTA 2NTSA 1T5EA 2F0EA 2KA7A 3A8KE 3ZYYX 1BNZA 1PRTB 4C3IB 1CK1A 1F2ZA 4C1NI 1OXTA 2OF1A 1ILQA 2IWHA 5CMDA 3BVMA 5EBDA 3I72A 1UNSA 3SR1A 2CW0C 4DGZA 3K5NA 1XX8A 4PQXA 4R8NA 4CGYB 1DD2A 2F0WA 4K5XA 1CHPD 5C4JB 1WTRA 2B2VC 3K7AB 1TY2A 3BVGA 3SXHA 2B2UA 2K1BA 4KN7C 1EY7A 1KDAA 3PO2B 2K5DA 3GTKB 1S5DD 3FMCA 1IL8A 4QUCA 3VR3A 4B9XA 5HGTA 1BXTA 5M5WB 5C4HA 3D3RA 1PXUA 3RZOB 4UAIA 4OL7A 2JP1A 1CQVA 1Z47A 4LK1C 4BA1I 5KIXA 3HOWB 2HUGA 3D31A 5E4WC 3SE0A 2N88A 4J6HA 1SYGA 2I46A 4PNYA 1DOKA 1O7LA 2MUYA 1R4QB 1GHJA 2LY7A 5D3IB 2JA7B 4PMBA 3K5LA 5LHY1 2OEOA 4G7OC 3RLFA 1SMYC 2XIWA 4A3GB 1K83B 1QWYA 2WKCA 1A3VA 2NZ1D 1I50B 1EU4A 3PIP3 3NXWA 3WOFA 3VYSA 4F87A 2AUJD 2C5CA 4ZRZA 1S5CD 3K5OA 2K6AA 3EA6A 2F1MA 3CKIB 3MXUA 4PV1C 5A35A 3J7AF 2O5IC 1AEXA 2B63B 4E6IA 1EY0A 1I4GA 4ABNA 4JK1C 5CC4A 1Y1WB 2B8FA 1WD0A 1BUVT 1BO0A 1HA6A 3AMUA 4KHZA 5DEHA 4A3EB 2NN6H 4FNFA 3AB9A 1SJHD 2F0NA 2DNEA 1NR2A 1QE6A 1OXSC 4KK7A 1XTCD 1V1PB 4KHVA 1F2YA 5IIFA 1RHPA 1DCZA 3SK5A 2F0KA 4G7HC 4J1MA 2J4XA 2MHVA 3I4NB 5C3EB 5KNCA 3DWAA 1TY0A 2F0FA 1OO9B 3VYUA 2VNUD 1QNUA 2E2HB 1SMYD 1A3TA 5KNDA 1A15A 2EY6A 3URYA 3VA5A 2MJ8A 2KQ3A 1WVLA 2PQEA 4DAYA 5K5PA 4IN3A 3HOVB 1AFPA 1JWMD 4DFAA 1BDOA 1ZYRC 3R2TA 4HMJA 2J7ZA 3CQZB 1SNMA 1Q12A 1TWHB 1V43A 5IT9E 3MXNA 1BQQT 1VMCA 4ID6A 4KKUA 1SNQA 1O7YA 4PMWA 3D6WA 4L63B 5CYUA 3DXJC 3V2TA 2QCPX 2RDHA 3BVZA 1KLGD 3E5SA 1EU3A 2RBMA 1HUMA 1C8CA 2BCOA 5EKKA 5M5XB 2O5JC 5KYIA 1LTBD 2O4XA 2EYLA 3GP7A 2Z4HA 3K6OA 2A5HA 4NMZA 3QG1A 1DOLA 3RZDB 3PUZA 1ICWA 4K8IA 1SNDA 2AQ3B 4CJ0B 3NP8A 5D65A 1CZGA 5DAUA 2H4OA 5KYLA 2X69A 3TP5A 5EKLA 4RCNA 2TMPA 1CFMA 2RVLA 2WV6D 3G7LA 4C56C 1ZYRD 3NTIA 1LTSD 1SYEA 3D8GA 2RSNA 3I4LA 5J22A 5C3WA 5C0XJ 2A6HC 4K5VA 2IJ0A 4TSSA 3BS1A 4IUTA 2E2DC 3VA7A 1TU2B 2KECA 3HGBA 2EJGC 3M3YB 2A6EC 4HEDA 1EIGA 3ND9A 3RMHA 2GA4B 5G3LD 1GOZA 3I73A 1RKNA 1JOKA 1F9QA 5CV9A 2C9OA 3VR4A 3QB3A 1LACA 4QUFA 2IL8A 4XT1B 1EYDA 4BWGB 4C1NK 4UDUC 3OHXC 1U4LA 1HHVA 4ZUJA 1JWUD 1E0BA 3GTMB 5JVG3 1KDBA 1SSOA 2JA8B 2KCCA 3MXPA 4DAPA 2B2YC 4KD3A 1TVXA 2PZTA 5T1GA 1JICA 5E1FA 2RA4A 1Y8OB 4ZUIA 5KGUA 3K57A 2RDFA 5E3FA 3JAME 4ULLA 2A69D 3E0JA 3V05A 4C2MB 2A6HD 2PCFB 5I6WA 2D9UA 3DMUA 1HQRD 2A73B 4ZAIA 1TWCB 1BCPF 5I9OA 4H0LC 5EJWA 2A6ED 1JC7A 2FHTA 4V190 3DWQA 2AQ2B 4A3KB 1FGBD 1GUWA 1PTOC 1ML0D 2DN8A 3C46A 1S5FD 5C4XB 3H91A 1PRTC 1EYAA 4KJNA 2MPMA 4IFDG 3X3MA 3S1NB 3OPOA 4O1NA 2KCNA 4IUUA 1K8MA 5JPNC 4CBVA 4LMQD 4DA2A 3IL8A 5C0XI 1MBYA 2VB2X 1H9RA 3K0YA 4AYBB 1TS2A 3SVMA 4LJZC 4WFN3 4OO1G 2A68C 2K01A 4QF4A 2L1BA 4HN7A 1STAA 1STNA 2F0OA 1I4HA 2B2TC 1D5XC 2H1EA 1WTQA 2BOSA 1GHKA 2M9VA 4MHEA 2IT1A 4C3IG 3BDOA 2B2WA 1O78A 3H94A 4RCOA 3M4YA 3VR2A 4RFBA 2ID0A 4B9WA 3NWTA 1B9MA 5K36H 1EY5A 1WCMB 3MXGA 4N9PA 1GUOA 2R3ZA 3PUVA 1LT4D 2IX0A 3FDTA 4RWSC 1PTOD 3NE5B 1JOQA 5LL6X 3NPPA 2F0JA 5DNFA 1AZPA 1BOSA 1KLUD 1HUNA 2IX1A 1LT5D 4KY6A 4FYDA 3W2DA 4HAEA 1G8ZD 3K59A 1ZEQX 5EPJA 4DK0A 1STGA 4G57A 2XVSA 3MFYA 2L12A 3OIPA 1F2MA 1PZKD 3DM1A 3GV3A 1BCPB 2Z8LA 2R6GA 5COYA 4L6TB 1ZXTA 1WTXA 3NBHA 2YU9B 3NSWA 2A68D 1F9PA 2ENBA 3KUPA 1TIID 4Z9CB 3TP7A 1BR9A 5ISRA 4C3JB 2SNMA 4EQNA 1SXTA 2K32A 4X3SA 4CKBA 3S9WA 1M4VA 4XT3B 5IGGA 4PMCA 3W3AA 1G6ZA 5CBEE 2EOTA 2AUKA 3FVQA 3M85A 2LKVA 5ELCA 1SYBA 1Q1EA 3VR6A 2EXZA 2JEBI 1JQYD 4Q5VA 1EFID 2O2LD 4HCSA 1D1KA 1U4RA 3DEPA 2QILA 1JB3A 3M4OB 5A2QL 1A2TA 1HA5A 1JORA 1TWFB 4ZKBB 1X3QA 3DWPA 3GTJB 4P2CB 3AU7A 3LWUA 4CHTB 1KAAA 2L55A 1S5ED 3D4WA 3ND8A 3KLRA 1KDCA 2EYFA 4EQPA 2TSSA 1CT1D 4DNTB 2F0TA 2K33A 3A55A 1CQFA 4QB4A 1W6JA 1SYCA 1FNWA 5FLXE 1LTID 2NN6G 5CR3A 3SEBA 1TS3A 4H13C 1DJRD 1HTPA 4C3HG 3GQBA 1X32A 1FNUA 5CORA 3HP3A 3E6ZX 2NYZD 2WAQB 1R4PB 1EZ6A 5ELEA 1Q1BA 4IUQA 4A93B 2M00A 4DF7A 2AWNA 3J81E 5I4DA 5C6AA 4EVOA 2XWJB 4WRDA 2Q8TA 5E4XA 4RAUC 1VCIA 2JEAI 4TQUS 3TMEA 1B9NA 2PYKA 3CRLC 3HKZB 5I2YA 1ESRA 2IX3A 1TWAB 3QOLA 1H9KA 2G9DA 2E2IB 3K58A 4DN4M 4M8AA 1TQOA 4ZLTF 4GZYC 3M7GA 2EY5A 3S16B 3I4MB 2JYOA 1SNPA 2EVBA 4C3HB 1JWSD 4ZYSA 5CGKA 4G7ZC 2F0HA 4HR7B 5FO7B 1F2LA 1I6VC 2YYZA 3KBGA 1KABA 1BF4A 1SJED 4NP5A 1G291 1LT3D 5CV4A 2KUMA 3L9AX 2B2UC 1AP0A 1II3A 2K04A 4KI0A 1KNEA 1SFOB 3GO5A 3MVVA 4H7BA 1HPCA 2XRSD 3BYYB 3RD4A 3MWYW 2RQXA 5ELFA 1EEID 2NVQB 1XYIA 4WORA 1JE4A 4IALA 2OXPA 1B3AA 3Q6SA 3FPUB 5C0XH 5EGTA 1O80A 4K6DA 4KTAA 4QMGA 3QOJA 4KY7A 5JEAG 3NWSA 3EJIA 1H9SA 2FMCA 2EYOA 1STBA 4RA8A 2KEEA 3U9SA 5C3XA 3PIO3 1CA5A 3PMFA 4K2KA 3OSOA 2Z4IA 2L4NA 4NW2A 4FVMA 5ELBA 3P1HA 1UEAB 4K5WA 3WOEA 2ICIA 1GUTA 2K28A 1C4QA 1QJOA 4OIKA 2NB0A 3MEHA 5FO8B 1RJTA 1GUSA 3I3CA 4K2LA 2BE5D 2A69C 4Y7NB 5KNBA 3NTHA 4Q0FA 1STHA 1ENCA 1FD7D 1PZJD 2F0LA 5I9PA 3LNNA 5KRUA 1D1IA 1GUGA 2JXMB 3SK6A 4L8JA 3H0GB 3KBXA 3J7AV 4IURA 3PO3B 1ET9A 1VMPA 3MHBA 5FK9C 3EROA 5IGDA 2EZVA 1V1OA 4B08A 3I90A 2PPBC 2SDFA 3Q22A 4ZQ3A 3TZDA 1AN8A 5T1IA 5JPMC 3QWNA 3NBIA 1DXMA 4KJOA 5LL6S 4NDXA 5CV6A 3R2IA 1LT6D 4MN3A 4DU9A 2JE6I 1XXGA 2R7ZB 1JOOA 1A6XA 1Y1VB 2NTTA 2F03A 5F2DA 3DHQA 5FOBB 2IPKD 1D6EC 1TS4A 5EKIA 4FO2A 1CI3M 2VXWA 5J39A 1OXUA 3HZXA 1Q3LA 3C1FA 4R8IA 4RGMA 1RF2D 4BBRB 3H09A 3NQIA 1EWCA 1D2BA 3GTQB 4ILWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWJ B;  3FRP B;  3V96 A;  1GXD C;  5JPM C;  3CKI B;  3HRZ C;  1JB3 A;  3L3O C;  2A73 B;  3G6J B;  2WIN B;  5FOB B;  3CU7 A;  2ICE C;  2J0T D;  3OHX C;  4FXK C;  1XWE A;  4FXG C;  5FO7 B;  1UAP A;  2QKI C;  2XWB B;  1UEA B;  1JC7 A;  2E2D C;  1PXU A;  2WII B;  3HS0 C;  2I07 B;  3KLS A;  5FO9 B;  1OO9 B;  2TMP A;  2A74 C;  1BUV T;  3MA2 B;  3T4A C;  2B39 A;  1BQQ T;  1BR9 A;  5FO8 B;  5JPN C;  3I70 A;  1D2B A;  4ILW A; 
#chains in the Genus database with same CATH topology
 3P20 A;  1LO5 D;  2HD3 A;  5IOC A;  3S15 B;  4X62 Q;  3PUX A;  1ASZ A;  4OGQ C;  4JBJ A;  1STY A;  5LMN Q;  3SK4 A;  2K7V A;  1PFB A;  2Y0S B;  3M9B A;  5EPL A;  1HFN A;  1QG7 A;  4WJW A;  3IKJ A;  1X3P A;  4AYB G;  4DR6 Q;  4NXM Q;  4X3U A;  2KOL A;  2B2V A;  2L11 A;  4DKA C;  2DNC A;  1Z6H A;  2UU9 L;  1VF7 A;  1ZKO A;  3X3N A;  4BY1 H;  4K0K L;  3KF8 A;  4IUN A;  1XWE A;  2DY7 A;  2K5W A;  1L0X B;  2KHS A;  3GV6 A;  1YNN C;  4R4I A;  4DXG A;  1PH9 A;  1N32 L;  3JAM i;  2AWO A;  2WII B;  4HJ5 A;  3S14 H;  3D4D A;  1YNJ D;  4JVZ A;  2K05 A;  2RSO A;  1H9J A;  1BCP C;  3C1E A;  4HSP A;  2NBF A;  4XQQ A;  5GRO A;  4LFC Q;  3OMG A;  1SNC A;  3FKI G;  3GTL B;  2CWP A;  1SE2 A;  3I56 A;  1I4X A;  2Z1C A;  4DAM A;  2D2C C;  3CCV A;  1QB5 D;  1WCM G;  3TDQ A;  2E74 C;  4HMI A;  1V1Q A;  2M2L A;  3MAQ A;  3EVQ A;  4IFD H;  5JAV A;  1ICF B;  3GD7 A;  4DV3 L;  3A7A B;  1C9O A;  2IW3 A;  4IPG A;  3WDN A;  2ZJR A;  3GTG B;  5AFW A;  1MSG A;  1FL0 A;  5IT9 L;  4KV6 A;  1JR0 D;  3A56 A;  4BA2 I;  3T16 A;  2BDN A;  4LF5 Q;  5FKA C;  2WKD A;  4GOP C;  1WJJ A;  3S24 A;  1DON A;  4OON A;  5AJ3 L;  4KKS A;  4FXG C;  1Z7T A;  1IHZ A;  3S1Q H;  1B7Y B;  2B29 A;  2IHE A;  4A3D H;  1EZ8 A;  4RGN A;  5BN5 A;  2F0V A;  2UUB L;  1U4M A;  3EQL C;  2NVY H;  4JPB W;  4IUP A;  3FKI B;  1ILP A;  4NKL A;  5HY6 A;  1PTO H;  3TSS A;  4DAV A;  4FF4 A;  3CU7 A;  3BG3 A;  1OXX K;  2A1A A;  3HOY H;  3R8B A;  1EIF A;  3S2H H;  5DM6 3;  5M9O A;  4JYA L;  2N55 A;  4RHR A;  1OXV A;  4C3I H;  1I94 L;  1TWG B;  4DK3 C;  4IFD J;  2NUC A;  2YTV A;  5C5M A;  3ERQ A;  4KY5 A;  4XQN A;  4HJA A;  5EPK A;  2I5L X;  4N9T A;  4YIJ A;  4NPS A;  3W5O A;  1YNN D;  1Y69 U;  4DPG A;  5HUR A;  2R92 B;  4XDX A;  3OTO Q;  3S1M B;  4AYB E;  4C3J G;  4IUV A;  2NZH A;  2UXB Q;  1WTO A;  1SEB D;  1H9S B;  1T5X D;  1B1Z A;  3TZU A;  4FF2 A;  1BCP D;  1IW7 D;  1PH5 A;  2JSO A;  4QCL A;  2XRQ D;  1L1O C;  1WFQ A;  3HKS A;  3DEO A;  1CA6 A;  2B39 A;  5JVH 3;  2BA0 A;  1EIY B;  4XXE A;  5C4J H;  2F3W A;  1HJP A;  2KHI A;  1PFN A;  2VW9 A;  3IRB A;  3HOY B;  1KTK A;  3K7A H;  1EIH A;  3S2H B;  1E2V A;  3I4O A;  4GN5 A;  1EYC A;  4AQY Q;  2X6G A;  1HCZ A;  4LF9 L;  4JI6 L;  4H44 C;  1VQ5 A;  1KNA A;  4DV2 L;  3PO2 H;  3ULL A;  3GTK H;  4K8J A;  4APV A;  1VQF A;  3KLW A;  1L0Y B;  5IGB A;  1I6H H;  1P8L A;  3HS0 C;  5M5W H;  1O7Z A;  1W2B A;  3T13 A;  3PGZ A;  4CKE A;  3RZO H;  1A0I A;  3PF5 A;  2EYP A;  4DR5 Q;  1EYG A;  1XTD A;  4R4Q A;  1EL0 A;  3FPP A;  1VQ6 A;  4YY3 Q;  3HRZ C;  1R9T B;  1JB7 A;  2ZXO A;  4DV5 L;  3DLL A;  4PZ6 A;  2UUC Q;  5IP7 H;  4DR3 L;  2V4D A;  1HTL D;  2XWB B;  2L5T A;  3I91 A;  4B3M L;  2UXC L;  3STB C;  4XIG S;  1EFW A;  3A7L A;  2PNH A;  1E2W A;  5CBA E;  2A74 C;  1GVP A;  1EY8 A;  4A3J B;  1YNX A;  2BH2 A;  2Q2U A;  4B3R Q;  1ENF A;  2L9H A;  2PZU A;  1I6H B;  2JA7 H;  1QVF A;  1AZQ A;  1EQR A;  3R3O A;  4JG2 A;  1MGS A;  3A8J E;  1E2Z A;  2A8V A;  2JQO A;  1D5M C;  2QF7 A;  1PZI D;  5BR8 L;  1FGU A;  1S3O A;  4B3S Q;  4LAA A;  3CHB D;  1G2S A;  3GTP B;  1CZW A;  1NE3 A;  1I50 H;  5GQO A;  2CVR A;  3S1R H;  4FP5 D;  1F77 A;  4G4K A;  1UE1 A;  1Q8K A;  3PCO B;  1QZH A;  2ZXR A;  2EY1 A;  4ME5 A;  3L3O C;  5C5L A;  4IPH A;  4X6A H;  3M7N A;  1EY9 A;  1J8I A;  2L0C A;  4RGO S;  4OEL B;  2LSS A;  4IJL A;  3RUZ A;  1RD9 D;  3DUZ A;  4ZK9 B;  1XMO Q;  2B63 H;  1QNK A;  5FO9 B;  1CKM A;  3JAM L;  1FNV A;  1U9R A;  1NBW A;  3BYT B;  1WD1 A;  4S3S A;  4RH6 A;  5TSS A;  1TT2 A;  1Y1W H;  4JI4 Q;  1WTH A;  4CJ2 C;  4CDE C;  1IYU A;  2MO1 A;  1SE3 A;  3J80 E;  2QKI C;  4XYQ A;  4A3E H;  1A8V A;  3L7Z C;  3HKZ G;  1K8G A;  2WP8 J;  3I8Z A;  3S1R B;  1X56 A;  2B2W C;  2CW0 D;  4JI8 Q;  4IFD I;  3VDY A;  2H5X A;  4QIW B;  4FF1 A;  2F0U A;  1IBK L;  2QDL A;  2HDL A;  1WI5 A;  3C2P A;  3EFX D;  5FLX c;  2VUM G;  3I4M G;  4H02 A;  1TXY A;  3STB D;  1J9O A;  3KJO A;  3NUC A;  5M3M H;  1LTA D;  1IKL A;  4IJH A;  4IOC A;  2VS1 A;  2OTJ A;  1PMR A;  5KEE A;  1I4R A;  3PV0 A;  3FEW X;  1SNO A;  1NMG A;  4U67 3;  4F88 A;  5HGQ A;  1NR4 A;  4JOI A;  4LWC A;  1LV9 A;  1CTM A;  4J8Q A;  3G6E A;  3TRZ A;  4DUZ L;  2PW7 A;  3HG9 A;  1PYW D;  2HIV A;  4OO1 I;  2EJF C;  3I4N H;  2PO4 A;  5C3E H;  4JV5 Q;  3LGJ A;  3I70 A;  3UDX A;  4EQO A;  4KMU C;  3KF8 B;  2ZXP A;  4XQJ A;  4YCU A;  1LTT D;  1V9P A;  1NSN S;  5D3D A;  1B44 D;  2HQE A;  4TKO B;  1EWH A;  3J81 c;  3GTO B;  4FF3 A;  4MZ9 A;  2NWG A;  2EYJ A;  2J0T D;  4GKJ Q;  1N34 L;  2N78 A;  1MIU A;  2Q8R E;  3HOV H;  3PF4 A;  5FJ8 H;  2Z0S A;  1GD7 A;  3TP6 A;  3H3V C;  2K03 A;  5M3M B;  1ROD A;  3OWF A;  3CQZ H;  2VUM B;  5EQ0 A;  1TWH H;  4JI2 Q;  3JC6 6;  4A3C G;  4PZ7 A;  3BDL A;  1UUP A;  1LTG D;  2FIN B;  2PZW A;  1PLF A;  2EE1 A;  3D4R A;  3R93 A;  2E2J B;  2FJ2 A;  3P7J A;  3IAY A;  2ZT9 C;  1K73 C;  5M3F B;  1Y8N B;  1VQC A;  2ZTE A;  2Q2I A;  5JOB A;  5JJZ A;  4IQZ A;  3HEJ A;  2BE5 C;  3P75 A;  4CJ1 B;  1EQV A;  4A3B H;  4TVA B;  3MA2 B;  1I4Q A;  1HXY D;  4PG3 A;  3J81 i;  2KBN A;  2BDO A;  2B2Y A;  5IYD H;  5CV7 A;  4BBS B;  1W6K A;  2F0S A;  5G3L F;  2NVX B;  2HDM A;  1SBB B;  3IFD A;  1VDZ A;  1SE4 A;  4FXK C;  1D7Q A;  4UHV A;  4RKL A;  1ESF A;  2F0I A;  5M5X H;  2NVT B;  3M4Q A;  2XNA C;  4XYO A;  1NCV A;  3VYT A;  2Q2H A;  1ET6 A;  1DOM A;  1ONL A;  1NUC A;  2Z9H A;  4JC0 A;  2K5Q A;  3CCJ A;  4LUV A;  1CM9 A;  1EEF D;  3S17 B;  4V0B A;  3N52 A;  5EBC A;  3OW7 A;  5C0X G;  1NY4 A;  2EYM A;  1RTN A;  3E3X A;  2AQ1 B;  2MGS A;  2E75 C;  1MI2 A;  1FR3 A;  2LMC B;  1I4P A;  4DUY Q;  5IGF A;  1UAP A;  4BXX H;  4A3B B;  4DK1 A;  4TRD A;  4UP9 A;  3KDF B;  4DR2 L;  1PH2 A;  2G9H D;  1X3F A;  2C35 B;  1TS5 A;  2AMC B;  3D6C A;  4A3I B;  5FLM H;  5NUC A;  5I2X A;  2R93 G;  3MZ5 A;  4I7Z C;  2JA6 G;  4KD4 A;  1RDP D;  3VYR A;  1IKM A;  5DM7 3;  2ALY B;  1C48 A;  4UPA A;  3U50 C;  1PH6 A;  3NTK A;  4LF8 L;  1GXD C;  4GKK L;  4R4O A;  2SEB D;  4HTH A;  4DV6 Q;  4YCW A;  2WIN B;  3TP8 A;  4A3F H;  3H0G G;  5IYC G;  1RL2 A;  1BBX C;  2WB1 B;  3MFG A;  1S5B D;  1HRJ A;  1JCK B;  2D62 A;  3LWE A;  1PH1 A;  5JEA H;  1DM0 B;  3OOC A;  4X3T A;  2F0Q A;  1O7I A;  3ITP A;  4IZ8 A;  4FXD A;  2VB3 X;  1L0W A;  1FYC A;  1ASY A;  3QO2 A;  1HR0 L;  1LAB A;  1B8A A;  2VZA A;  3KF6 A;  4K14 A;  2WAC A;  1I3Q H;  2HCI A;  2MP1 A;  2R7F A;  4NXN L;  4MIU A;  1N9W A;  2R93 B;  3CCM A;  4HSV A;  1MSH A;  2I07 B;  3UDF A;  1HQM C;  5I6Y A;  4RKB A;  4RHS A;  2CFM A;  4UP7 A;  2JA6 B;  1Y8P B;  4CKC A;  5BN4 A;  1K0R A;  4KN4 C;  4A3F B;  2MNA A;  2PW5 A;  1Y1V G;  3T1H Q;  3J7Z C;  3FRP B;  1EY6 A;  1MJE A;  5CV8 A;  1SYD A;  4O42 A;  2B2T A;  1XNR L;  2E76 C;  2PMZ B;  3I2Z A;  4YWL A;  4EQ5 A;  1XMQ Q;  1HFG A;  3CRK C;  3KK7 A;  3KLS X;  4RGT A;  2B8G A;  3NEN A;  3HOZ B;  1Q8I A;  1V8Q A;  2CQA A;  4DV0 Q;  5JEA J;  3GTM H;  3U9O A;  4YWK A;  1B3Q A;  1I3Q B;  1S4Z A;  3CP0 A;  3UI2 A;  1JT8 A;  3QR8 A;  4BBR G;  1PFM A;  4DNI A;  1YVC A;  1A2U A;  3T51 B;  1XPO A;  4X65 Q;  2VQE Q;  1YNJ C;  1HNW Q;  4ODG A;  5DLQ E;  5LMU L;  3NEM A;  1B2T A;  3BZD B;  2OQK A;  1VQG A;  1DYQ A;  1VF5 C;  1KQS A;  2R61 A;  1B4O A;  1A3U A;  4F8M A;  2JA5 H;  2Y0S G;  3KLS A;  1LLR D;  3K80 C;  2ZM6 Q;  1M90 C;  1MD2 D;  4K6L A;  1YZ6 A;  1C0A A;  1KIX A;  1GUN A;  3HOU H;  1K8O A;  4YHH Q;  3SK8 A;  1RTO A;  2NN6 I;  1K3R A;  2KED A;  4C2M H;  3N6R A;  5J1Z A;  2KJX A;  2BA1 A;  2DY8 A;  2EJM A;  4ZKC B;  1EY4 A;  1NMF A;  3J80 L;  1TWC H;  1VQM A;  5IE8 A;  4IOA A;  4JI1 L;  5D14 A;  3T4A C;  4R1J A;  1JJC B;  1SDF A;  2PMZ E;  4EGV A;  5FLX L;  4I65 A;  5A2Q E;  5C44 B;  4A3K H;  2QDB A;  3C3L A;  2RDG A;  2SNS A;  2JK8 A;  2XSC A;  2Q8I B;  3HOX H;  3S2D B;  2JA5 B;  4U68 A;  4XTC S;  2UU9 Q;  1PTO F;  4BS9 A;  5BN3 A;  1I5F A;  4HCE A;  5C4X H;  2CHB D;  4K0K Q;  1E7Z A;  3IFT A;  3HOU B;  1M8A A;  2KEN A;  3TBI B;  4F7X A;  1Q82 C;  4OEM B;  3F2C A;  3T53 B;  1QCB D;  3L2P A;  1PRT F;  3TS0 A;  1HZB A;  1NAP A;  3AFQ A;  1N32 Q;  3O13 A;  5CV5 A;  3S1N H;  1Q90 A;  4LFB L;  2LS0 1;  1NJI C;  3J81 L;  3NK9 A;  1STE A;  3ONA B;  1IZ6 A;  3PUW A;  2E5L L;  3QJY A;  1AW7 A;  5IWA L;  5IOD A;  1VQL A;  1K3B C;  5M5Y B;  2F0M A;  2HCC A;  1F9R A;  3CMA A;  1F9S A;  1YBY A;  1PVO A;  1HNZ L;  3F2U A;  4IPD A;  1CHQ D;  3U4Z A;  4AIM A;  1JE5 A;  1DZ1 A;  1U4P A;  3A8I E;  3HOX B;  3RLO A;  2PNR C;  2D5D A;  3OWE B;  4FDB A;  4DV3 Q;  1IW7 C;  3V96 A;  5IGE A;  3Q24 A;  1V1P A;  1TR5 A;  3G6J B;  2IY5 B;  1WTV A;  4HJ9 A;  2ICE C;  1FVI A;  2X6L A;  1EOT A;  2F0P A;  2SOB A;  3F2D A;  2XTI A;  2K50 A;  5AJ3 Q;  4OIJ A;  2KVM A;  2XGT A;  5J3B A;  2GVB A;  4JW0 A;  4A3M H;  1QIL A;  4BY1 B;  1VQH A;  3J7Y W;  2YTY A;  3BDC A;  1D5Z C;  2F0G A;  1EWI A;  2UUB Q;  5JJL A;  2Y0S E;  4OHJ A;  2CWA A;  4R4T A;  1PDQ A;  2EDG A;  2QEJ C;  3ZJY C;  2R92 G;  3S14 B;  4A3D G;  1X6O A;  2EY2 A;  2XN9 C;  1WCM H;  3RNU A;  1TKW B;  3A54 A;  5LMN W;  3NHH A;  1RCV D;  5GAD C;  1KXL A;  1H9M A;  4LFC L;  3NQT A;  1IYV A;  4LF6 Q;  4R9W A;  1Q46 A;  3VR5 A;  1LTR D;  1WTW A;  2EYH A;  2F3V A;  3QIA A;  4OO1 H;  2OTL A;  2EPB A;  2F4I A;  3EN2 A;  2RCN A;  1GJX A;  1C7Y A;  5K36 G;  2Q2T A;  3PUY A;  1SYF A;  4OWT B;  4BY7 H;  3HOY G;  2Z6K C;  1G91 A;  2RKS A;  3LX0 A;  4A3M B;  5ELD A;  1HZA A;  2EIF A;  3W1B A;  1WTP A;  3SDZ A;  4X3K A;  1G2T A;  2FMM A;  3KDF A;  1HH2 P;  3SHL A;  4DXF A;  4LF5 L;  3CC7 A;  1SLJ A;  1B50 A;  2QEX A;  1GM5 A;  2FFK B;  4JBW A;  1PH4 A;  2LFN A;  2OT2 A;  3S1Q B;  3OIQ A;  4A3D B;  3K5M A;  1CKO A;  3H6M A;  3TN2 A;  1LUZ A;  5IGC A;  1BVS A;  1B53 A;  1QVG A;  3MC0 B;  4DV4 L;  4L5R C;  3T56 B;  1SAP A;  2YU9 H;  3MTS A;  1WOC A;  2NVY B;  4YCV A;  3Q0A A;  5C4Z A;  4JI6 Q;  4LF9 Q;  3SGI A;  4DV7 L;  4DNR B;  3OMC A;  4M1U B;  4CDC C;  4BY7 B;  2F0D A;  1PRT D;  4IO9 A;  1AE3 A;  1PTO B;  4KKT A;  3Q23 A;  1ENA A;  1QOH A;  1EQT A;  4A3J G;  2NTS A;  1SR3 A;  1T5E A;  5EAY A;  2F0E A;  2KA7 A;  3A8K E;  3ZYY X;  4C3J H;  1Z9F A;  1PRT B;  1BNZ A;  1VQA A;  2HIX A;  4C3I B;  3EIV A;  4IPC A;  1CK1 A;  1F2Z A;  4DV5 Q;  4C1N I;  1UE5 A;  1OXT A;  4DR3 Q;  1A62 A;  2OF1 A;  1ILQ A;  2N8N A;  2PI2 A;  3CC4 A;  4KHP Q;  3OTO L;  2IWH A;  1L2F A;  1LM0 A;  5CMD A;  3BVM A;  3KF6 B;  5EBD A;  2UXB L;  4POG A;  3I72 A;  1UNS A;  1UE7 A;  1S40 A;  3SR1 A;  2CCZ A;  2CW0 C;  4DGZ A;  3K5N A;  1XX8 A;  4WJ3 M;  4PQX A;  3BZK A;  3HOW H;  4R8N A;  4CGY B;  3D0F A;  2AHO B;  1DD2 A;  2F0W A;  4K5X A;  1CHP D;  5C4J B;  1IBM Q;  4B3T L;  3T1Y L;  2NZO A;  1WTR A;  2B2V C;  3K7A B;  1Q86 C;  1N33 L;  1TY2 A;  3BVG A;  4AQY L;  3CME A;  3SXH A;  2B2U A;  2K1B A;  4P71 A;  4KN7 C;  1EY7 A;  1KDA A;  1CKN A;  2K5D A;  3PO2 B;  1X3G A;  1S5D D;  4A4I A;  3GTK B;  1W3S A;  3FMC A;  1IL8 A;  4QUC A;  3VR3 A;  3A0J A;  4B9X A;  5HGT A;  2GVA A;  1BXT A;  5M5W B;  3M4O H;  1VQJ A;  1S72 A;  5C4H A;  3D3R A;  5IP9 H;  1PXU A;  3RZO B;  4UAI A;  4OL7 A;  1TWF H;  2JP1 A;  4A3G H;  1K83 H;  1PFS A;  1CQV A;  3GTJ H;  2OCE A;  1Z47 A;  4LK1 C;  4BA1 I;  4YY3 L;  5KIX A;  3A5Z B;  2UUC L;  3HOW B;  2HUG A;  3D31 A;  5E4W C;  4R4C A;  3SE0 A;  2ASB A;  1P16 A;  2PQA A;  2N88 A;  4DV1 L;  2VY3 A;  2B63 G;  4J6H A;  1SYG A;  2I46 A;  4PNY A;  1DOK A;  1O7L A;  2MUY A;  1R4Q B;  1GHJ A;  2LY7 A;  4GNX A;  5D3I B;  2A19 A;  2JA7 B;  4PMB A;  3K5L A;  5LHY 1;  2OEO A;  1IBK Q;  4G7O C;  3RLF A;  2DGY A;  2UXD Q;  1SMY C;  2XIW A;  1BBW A;  4A3G B;  1K83 B;  1QWY A;  2UUA Q;  2D0O A;  4B3S L;  2WKC A;  1A3V A;  2NZ1 D;  1I50 B;  1EU4 A;  3PIP 3;  3UDG A;  3K7U C;  3NXW A;  4AH6 A;  3J80 c;  1QVC A;  3WOF A;  3K8A A;  3VYS A;  4F87 A;  2AUJ D;  2C5C A;  4PZ8 A;  4ZRZ A;  1S5C D;  3K5O A;  2K6A A;  3EA6 A;  1PV4 A;  4UY8 C;  4A93 H;  5M3M G;  2F1M A;  3CKI B;  2F3I A;  3MXU A;  4PV1 C;  5A35 A;  1XMO L;  3J7A F;  2O5I C;  4P75 A;  1AEX A;  2B63 B;  4X66 L;  4E6I A;  5IYB G;  1EY0 A;  1I4G A;  4ABN A;  4DR4 Q;  5M3F G;  4JK1 C;  5CC4 A;  1TWA H;  3RN5 A;  1Y1W B;  2B8F A;  1WD0 A;  2E2I H;  1BUV T;  4L5S A;  1BO0 A;  3EBE A;  3AMU A;  1HA6 A;  1QUQ A;  4KHZ A;  4JI7 L;  5DEH A;  3S16 H;  4A3E B;  2NN6 H;  4GN3 B;  3I4M H;  2E2H H;  4FNF A;  1VQI A;  2N49 A;  3AB9 A;  3J80 i;  4BBS G;  1SJH D;  2F0N A;  2DNE A;  4ME3 A;  1NR2 A;  4C3H H;  3HOV G;  5FJ8 G;  2RCF A;  1QE6 A;  4X64 Q;  1OXS C;  4OX9 Q;  4KK7 A;  1XTC D;  1V1P B;  2GN5 A;  4KHV A;  4CDD C;  3CCE A;  1F2Y A;  3KYH C;  1BKB A;  4O2D A;  3K0X A;  4ZCK A;  5IIF A;  1RHP A;  1DCZ A;  3SK5 A;  4QIW E;  2DJF C;  2F0K A;  4G7H C;  3ER0 A;  4J1M A;  2J4X A;  2MHV A;  2LXJ A;  3I4N B;  5C3E B;  3AEV A;  4P73 A;  1NNX A;  5KNC A;  4A3B G;  3DWA A;  1TY0 A;  2F0F A;  1OO9 B;  3VYU A;  2VNU D;  1QNU A;  2E2H B;  1SMY D;  1A3T A;  3L0O A;  5KND A;  4A3I G;  1A15 A;  2NVQ H;  1HZ9 A;  2EY6 A;  3URY A;  3VA5 A;  5JJI A;  2E8G A;  5ELN A;  4GKJ L;  1YJ9 A;  2MJ8 A;  2KQ3 A;  1WVL A;  2PQE A;  4DAY A;  5K5P A;  4IN3 A;  3HOV B;  1AFP A;  1JWM D;  3CD6 A;  4DFA A;  1BDO A;  3BU2 A;  1ZYR C;  3R2T A;  4LF7 L;  4HMJ A;  2J7Z A;  2ZTD A;  3CQZ B;  4DR1 L;  4JBM A;  1SNM A;  2K5V A;  1Q12 A;  2WB1 G;  1TWH B;  3GTQ B;  4DR7 L;  1V43 A;  5IT9 E;  3MXN A;  1BQQ T;  1VMC A;  1G6P A;  3PSI A;  3F2B A;  4ID6 A;  1E1T A;  4KKU A;  2R7D A;  1SNQ A;  1O7Y A;  4PMW A;  3RZD H;  4LFA L;  3D6W A;  3WWV A;  4L63 B;  5CYU A;  3PIP A;  3DXJ C;  3V2T A;  1HNX L;  4LF8 Q;  1X54 A;  2QCP X;  2RDH A;  5FLM G;  3BVZ A;  1KLG D;  2HHH L;  3E5S A;  1EU3 A;  2RBM A;  1J5E L;  4WJ4 A;  2QW7 A;  1HUM A;  4HJ7 A;  3CCU A;  2WFW A;  1YHB A;  3CW2 C;  3H3V H;  1C8C A;  1X65 A;  2BCO A;  5EKK A;  5M5X B;  4GN4 B;  2O5J C;  5KYI A;  1LTB D;  2O4X A;  4OXP A;  4A3F G;  2EYL A;  4POF A;  2CH4 A;  1HR0 Q;  1YIT A;  3GP7 A;  2Z4H A;  4GLX A;  2F4V L;  4GLV B;  4P74 A;  3K6O A;  3ERS X;  1KL9 A;  4Y7N H;  2A5H A;  4NXN Q;  4NMZ A;  1N36 L;  2I5M X;  2KCT A;  3QG1 A;  1DOL A;  3RZD B;  3HOZ G;  3PUZ A;  1M1K C;  1ICW A;  4JI3 L;  4K8I A;  2ZTC A;  1SND A;  2AQ3 B;  4CJ0 B;  2RHS B;  3NP8 A;  5D65 A;  3M3Y H;  1OTC A;  4LF4 L;  4J15 A;  1CZG A;  5DAU A;  2H4O A;  5KYL A;  2X69 A;  3TP5 A;  1XNR Q;  3PO3 H;  4NB3 A;  5EKL A;  4RCN A;  1VQE A;  1YJW A;  4OWX B;  2TMP A;  1CFM A;  4A3L G;  2RVL A;  2WV6 D;  1VQB A;  3G7L A;  4C56 C;  1ZYR D;  3NTI A;  3TS2 A;  1PH8 A;  1LTS D;  1SYE A;  4UP8 A;  3D8G A;  2RSN A;  3I4L A;  5J22 A;  5C3W A;  5C0X J;  2A6H C;  3U58 A;  4K5V A;  2IJ0 A;  1IL2 A;  4TSS A;  4GOP A;  3BS1 A;  3TRE A;  4IUT A;  4OWW B;  2E2D C;  2JA9 A;  3VA7 A;  3BZC A;  2MO0 A;  1TU2 B;  2KEC A;  3HGB A;  2EJG C;  4LUO A;  1XJV A;  1CKN B;  3M3Y B;  2JA8 H;  1SN8 A;  2A6E C;  2R7Z H;  2WB1 E;  4HED A;  4JI5 Q;  4N8X 1;  3F1Z A;  5C44 G;  1PHJ A;  1EIG A;  1SRU A;  3ND9 A;  3RMH A;  3UDI A;  2GA4 B;  5G3L D;  1GOZ A;  3UE0 A;  3I73 A;  1HR0 W;  2Z6K A;  1RKN A;  2JA5 G;  1JOK A;  4JI0 Q;  1F9Q A;  3CCQ A;  4MTK A;  1IBL L;  5CV9 A;  2C9O A;  3VR4 A;  3QB3 A;  1LAC A;  2LXK A;  1PYB A;  4QUF A;  3HOU G;  4EX5 A;  2IL8 A;  4XT1 B;  3J81 j;  3J7A 5;  1FJG L;  2PQA B;  2AKW B;  1SRO A;  1U5K A;  1XMQ L;  4RMF A;  1EYD A;  4BBR H;  4BWG B;  1XNQ L;  4C1N K;  4UDU C;  1H95 A;  3GTQ H;  1VQN A;  3OHX C;  1U4L A;  1HHV A;  4ZUJ A;  3S15 H;  2HT1 A;  1JWU D;  1E0B A;  3GTM B;  5JVG 3;  1KDB A;  1SSO A;  4GNX B;  2JA8 B;  1YJN A;  2KCC A;  3MXP A;  3A5U A;  4DAP A;  2VQE L;  2B2Y C;  2CQO A;  3G48 A;  1L1O A;  4A3K G;  4KD3 A;  1MJC A;  1TVX A;  1J6Q A;  3HOX G;  2PZT A;  5T1G A;  1JIC A;  3F8T A;  4O0A A;  5E1F A;  2RA4 A;  1K9M C;  1Y8O B;  4ZUI A;  3E9I A;  5KGU A;  1G51 A;  2VQF L;  4LFB Q;  3K57 A;  2RDF A;  4QGU A;  2ZM6 L;  5E3F A;  2E5L Q;  4N8F A;  2K4K A;  3JAM E;  4ULL A;  3CXC A;  4Y52 H;  2A69 D;  3E0J A;  3V05 A;  4C2M B;  2A6H D;  1EUJ A;  2PCF B;  1XPU A;  1HNZ Q;  1RIP A;  5I6W A;  2D9U A;  1K8A C;  3BJU A;  3DMU A;  4BY1 G;  1HQR D;  2A73 B;  4ZAI A;  1TWC B;  1BCP F;  3PQI A;  3GTL H;  5I9O A;  4H0L C;  5EJW A;  2A6E D;  1JC7 A;  1KC8 C;  1GKH A;  2FHT A;  3AYH B;  3CCL A;  4V19 0;  3DWQ A;  2AQ2 B;  2CKZ B;  5GAE C;  4A3K B;  1QUQ B;  1X55 A;  1FGB D;  4HIM A;  4X62 L;  1GUW A;  1PTO C;  1YEZ A;  1ML0 D;  3NEL A;  2DN8 A;  3ULP A;  3C46 A;  3OYY A;  1S5F D;  3E0E A;  2V1C C;  5LMN L;  5C4X B;  2QA4 A;  3H91 A;  3GTG H;  1LTL A;  1VQD A;  1PRT C;  1EYA A;  4KJN A;  4DR6 L;  4NXM L;  2MPM A;  3FP9 A;  4IFD G;  3X3M A;  3S1N B;  3OPO A;  4HIO A;  4O1N A;  1CSQ A;  4A3M G;  1YI2 A;  2KCN A;  4IUU A;  1K8M A;  5JPN C;  1PH7 A;  4CBV A;  2YV5 A;  1SMX A;  3H3V I;  3CPF A;  4LMQ D;  4DA2 A;  3IL8 A;  5C0X I;  1MBY A;  2VB2 X;  3FKI H;  1H9R A;  3K0Y A;  4AYB B;  1TS2 A;  3SVM A;  4LJZ C;  4WFN 3;  4OO1 G;  2I0Q A;  2A68 C;  2K01 A;  1AH9 A;  4QF4 A;  2L1B A;  4JYA Q;  4HN7 A;  4DAY B;  1STA A;  1STN A;  1I94 Q;  2F0O A;  1I4H A;  1TWG H;  4BY7 G;  2B2T C;  1D5X C;  2VL6 A;  2H1E A;  1WTQ A;  2BOS A;  2K75 A;  1KRS A;  1GHK A;  2M9V A;  2R92 H;  3S1M H;  2K14 A;  4MHE A;  3MXN B;  2IT1 A;  4C3I G;  3BDO A;  4DV4 Q;  2B2W A;  3FHW A;  1O78 A;  3H94 A;  4RCO A;  3M4Y A;  4DV7 Q;  3VR2 A;  4RFB A;  2ID0 A;  3E9H A;  1SE8 A;  4B9W A;  2JN4 A;  1QZG A;  1D8L A;  3NWT A;  1B9M A;  2YTX A;  5K36 H;  1EY5 A;  1WCM B;  3MXG A;  4N9P A;  2IHF A;  1GUO A;  1HZC A;  2R3Z A;  3PUV A;  4LF6 L;  1LT4 D;  2IX0 A;  3FDT A;  3GDE A;  4RWS C;  1PTO D;  3NE5 B;  1JOQ A;  4QY7 A;  3NPP A;  2F0J A;  5DNF A;  5LL6 X;  4DV2 Q;  1AZP A;  1BOS A;  1KLU D;  1HUN A;  2K52 A;  1YHA A;  2IX1 A;  1LT5 D;  4KY6 A;  4FYD A;  3W2D A;  4HAE A;  1Q81 C;  3MEF A;  1G8Z D;  3K59 A;  1ZEQ X;  4QL5 A;  5EPJ A;  4DK0 A;  3PO2 G;  1STG A;  4G57 A;  2XVS A;  3MFY A;  1R9T H;  2L12 A;  2I5H A;  3OIP A;  4LUZ A;  1F2M A;  1PZK D;  1IXR A;  1VQO A;  3DM1 A;  3GV3 A;  4B3M Q;  1BCP B;  2Z8L A;  2UXC Q;  1BBU A;  2R6G A;  5COY A;  4B3T Q;  4L6T B;  3T1Y Q;  1ZXT A;  1N33 Q;  1WTX A;  3NBH A;  1X9N A;  3A74 A;  4HIK A;  4ALP A;  4A3J H;  2YU9 B;  3NSW A;  5IP7 G;  1YHQ A;  3HOW G;  2A68 D;  3KFU A;  1F9P A;  2ENB A;  3KUP A;  1TII D;  1K0S A;  4Z9C B;  2RF4 A;  3TP7 A;  1BR9 A;  5BR8 Q;  5ISR A;  4C3J B;  2SNM A;  4EQN A;  1KD1 C;  1SXT A;  2K32 A;  2K5N A;  3GTP H;  4X3S A;  4CKB A;  3S9W A;  2JA7 G;  4GOP B;  3H15 A;  1M4V A;  2DUD A;  4XT3 B;  5IGG A;  3KOJ A;  5IP9 G;  4KHP L;  4PMC A;  3W3A A;  4A3G G;  3CF5 A;  3ICE A;  1CUK A;  4DV1 Q;  4DR5 L;  1G6Z A;  5CBE E;  2P5Z X;  2EOT A;  2AUK A;  3FVQ A;  3M85 A;  2LKV A;  3KJP A;  5ELC A;  1SYB A;  1Q1E A;  3VR6 A;  1IBM L;  3AQQ A;  2EXZ A;  2JEB I;  1JQY D;  1JMC A;  1E3P A;  4Q5V A;  1EFI D;  1VQ8 A;  2O2L D;  4HCS A;  4B3R L;  1Y1W G;  1D1K A;  1U4R A;  3DEP A;  4QJF A;  2QIL A;  1JB3 A;  2L15 A;  3M4O B;  5A2Q L;  1A2T A;  1HA5 A;  4A3E G;  1JOR A;  1TWF B;  4ZKB B;  4L5T A;  1X3Q A;  4DK6 C;  3DWP A;  3GTJ B;  4P2C B;  3AU7 A;  4X66 Q;  3LWU A;  1L1O B;  2BH8 A;  4CHT B;  2WAQ G;  4JCV E;  1KAA A;  1PYS B;  2L55 A;  2KCM A;  1S5E D;  4A93 G;  2ZJP A;  3D4W A;  1Q7Y C;  2MQH A;  4DUZ Q;  2QGQ A;  3ND8 A;  1LYL A;  3KLR A;  1VQ7 A;  1KDC A;  1T9H A;  2EYF A;  4EQP A;  2TSS A;  4JI7 Q;  1CT1 D;  2ES2 A;  3TQY A;  4DNT B;  2F0T A;  2K33 A;  3I55 A;  5IY0 A;  5ELO A;  3A55 A;  3GTO H;  1CQF A;  4QB4 A;  1W6J A;  1SYC A;  1JJ2 A;  1FNW A;  3G4S A;  5FLX E;  4JI4 L;  1N34 Q;  3I4N G;  1VQ4 A;  5C3E G;  2ATW A;  2UXD L;  3OW2 A;  1LTI D;  2NN6 G;  1JJG A;  2G5D A;  5CR3 A;  1A63 A;  2UUA L;  3SEB A;  1TS3 A;  2VUM H;  4H13 C;  2FXQ A;  1DJR D;  1HTP A;  4C3H G;  3GQB A;  1MHW C;  1FNU A;  1X32 A;  4JI8 L;  2EQS A;  5COR A;  3CCS A;  5IYB H;  3HP3 A;  3E6Z X;  2NYZ D;  2WAQ B;  1R4P B;  1EZ6 A;  5ELE A;  1VS0 A;  1Q1B A;  2E2J H;  1K28 A;  4IUQ A;  5M3F H;  4A93 B;  2M00 A;  1UEB A;  4DF7 A;  2AWN A;  3J81 E;  5I4D A;  1VQP A;  5C6A A;  4EVO A;  2XWJ B;  4WRD A;  2Q8T A;  5E4X A;  3I7F A;  4RAU C;  1PA6 A;  1VCI A;  2JEA I;  1X3E A;  4TQU S;  3TME A;  1B9N A;  2PYK A;  3CRL C;  3HKZ B;  5I2Y A;  4A76 A;  4DR4 L;  1ESR A;  2IX3 A;  4MTN A;  1TWA B;  3QOL A;  1H9K A;  4BBS H;  1EQQ A;  2G9D A;  1SFO H;  2KHJ A;  2E2I B;  3K58 A;  2NVX H;  4DN4 M;  4M8A A;  1TQO A;  4ZLT F;  2Z6B A;  4GZY C;  4JV5 L;  4LF7 Q;  3M7G A;  2EY5 A;  4RG1 A;  2NVT H;  3S16 B;  3G71 A;  4DR1 Q;  4JBK A;  3I4M B;  5IYD G;  1PH3 A;  2JYO A;  1SNP A;  4DR7 Q;  2EVB A;  4C3H B;  1JWS D;  4ZYS A;  5CGK A;  3S17 H;  4A3C H;  4G7Z C;  2F0H A;  4HR7 B;  1MKH A;  5FO7 B;  1F2L A;  4X64 L;  1I6V C;  2YYZ A;  3KBG A;  4LFA Q;  4OX9 L;  1KAB A;  1BF4 A;  1NTG A;  1SJE D;  1E24 A;  1HNX Q;  4NP5 A;  1G29 1;  1LT3 D;  3K81 C;  5CV4 A;  4DR2 Q;  4JI2 L;  2KUM A;  3L9A X;  4LW1 A;  2B2U C;  2HHH Q;  1AP0 A;  1II3 A;  3TEH B;  4A3I H;  1DGS A;  1J5E Q;  1WYD A;  4MNO A;  2K04 A;  4QQB X;  4KI0 A;  1KNE A;  1SFO B;  5IT9 c;  3GO5 A;  2WAQ E;  2EXD A;  3MVV A;  4H7B A;  1HPC A;  2XRS D;  3ULJ A;  4BXX G;  3BYY B;  3RD4 A;  3MWY W;  2RQX A;  2OWO A;  5ELF A;  3CC2 A;  4GLA C;  4GKK Q;  2JJQ A;  2F4V Q;  1EEI D;  4P72 A;  4A75 A;  2NVQ B;  1XYI A;  4WOR A;  1JE4 A;  3HKZ E;  1B70 B;  4IAL A;  2OXP A;  1N36 Q;  1B3A A;  3Q6S A;  3FPU B;  5C0X H;  4JI3 Q;  5EGT A;  4HJ8 A;  1O80 A;  4LNQ A;  4K6D A;  4KTA A;  4QMG A;  3QOJ A;  3RLN A;  3Q8D A;  4KY7 A;  2K5H A;  5JEA G;  3NWS A;  4LF4 Q;  2N3S A;  3EJI A;  1H9S A;  4GNX C;  2FMC A;  2EYO A;  1STB A;  1EOV A;  4RA8 A;  2KEE A;  3U9S A;  5C3X A;  3PIO 3;  1CA5 A;  2R93 H;  3PMF A;  4K2K A;  2JA6 H;  3OSO A;  1UE6 A;  4DUY L;  1YIJ A;  4GS3 A;  2Z4I A;  1VQ9 A;  1E1O A;  3CCR A;  2L4N A;  1U0L A;  4KLK A;  4NW2 A;  3PO3 G;  4FVM A;  5ELB A;  1KHI A;  3H0G H;  5IYC H;  1XPR A;  3P1H A;  1UEA B;  4K5W A;  2F52 A;  3WOE A;  2ICI A;  1GUT A;  2K28 A;  3NBH B;  1C4Q A;  1AE2 A;  1QJO A;  3UE1 A;  4OIK A;  2NB0 A;  3MEH A;  5FO8 B;  3HOZ H;  1RJT A;  4DV6 L;  1GUS A;  1Y14 B;  2OQ0 A;  3I3C A;  3W1G A;  4K2L A;  2BE5 D;  1KAW A;  3RR5 A;  4YWM A;  2A69 C;  4Y7N B;  3B6Y A;  5KNB A;  3NTH A;  4Q0F A;  5GAH C;  4JOI C;  1STH A;  1ENC A;  1FD7 D;  4HID A;  1PZJ D;  2F0L A;  5I9P A;  5LMU Q;  3LNN A;  2JA8 G;  5KRU A;  3CAM A;  4A3L H;  1IBL Q;  2R7Z G;  1D1I A;  1GUG A;  2JXM B;  3SK6 A;  4L8J A;  1IYJ B;  1KRT A;  3H0G B;  3KBX A;  3J7A V;  1Y1V H;  4IUR A;  1FJG Q;  3PO3 B;  2D0P A;  1ET9 A;  1XNQ Q;  1VMP A;  1UWV A;  3MHB A;  2B3G A;  5FK9 C;  3ERO A;  5IGD A;  2EZV A;  1GO3 E;  1V1O A;  4B08 A;  2MFI A;  3I90 A;  3T1H L;  2PPB C;  2SDF A;  3Q22 A;  4ZQ3 A;  2HQL A;  5JJK A;  3TZD A;  1AN8 A;  5T1I A;  5H1S E;  4JI1 Q;  3CPW A;  3RN2 A;  5JPM C;  4I7A A;  2PI2 E;  2CH4 W;  3QWN A;  5C44 H;  3NBI A;  1DXM A;  3DM3 A;  4KJO A;  5LL6 S;  3U4V A;  4NDX A;  5CV6 A;  3R2I A;  4DV0 L;  3S2D H;  2VQF Q;  1LT6 D;  4MN3 A;  4DU9 A;  1N8R C;  2JE6 I;  1XXG A;  1VQK A;  2R7Z B;  1JOO A;  3AFP A;  1A6X A;  1Y1V B;  2NTT A;  4JI5 L;  4X65 L;  5GAG C;  2ZJQ A;  2F03 A;  1HNW L;  3M4P A;  5F2D A;  2RHQ B;  3DHQ A;  3HFZ B;  1CSP A;  4JI0 L;  5FOB B;  2IPK D;  1D6E C;  5C4X G;  4L5Q A;  1TS4 A;  5EKI A;  5E7N A;  5L37 A;  4FO2 A;  1CI3 M;  3PIO A;  2VXW A;  5J39 A;  1OXU A;  3HZX A;  1Q3L A;  5IWA Q;  3C1F A;  4R8I A;  4YHH L;  4RGM A;  1RF2 D;  5M5Y H;  1E22 A;  4BBR B;  4CDF C;  3H09 A;  3NQI A;  1EWC A;  3JAM c;  1D2B A;  2DJG C;  4ILW A; 
#chains in the Genus database with same CATH homology
 3P20 A;  1LO5 D;  5IOC A;  3S15 B;  3PUX A;  4OGQ C;  1STY A;  3SK4 A;  2K7V A;  1PFB A;  2Y0S B;  5EPL A;  1HFN A;  1QG7 A;  4WJW A;  3IKJ A;  1X3P A;  4X3U A;  2KOL A;  2B2V A;  2L11 A;  2DNC A;  1Z6H A;  1VF7 A;  1ZKO A;  3X3N A;  3KF8 A;  4IUN A;  1XWE A;  2DY7 A;  2K5W A;  1L0X B;  2KHS A;  3GV6 A;  1YNN C;  4DXG A;  2AWO A;  2WII B;  3D4D A;  1YNJ D;  2K05 A;  2RSO A;  1H9J A;  1BCP C;  3C1E A;  4HSP A;  2NBF A;  4XQQ A;  3OMG A;  1SNC A;  3GTL B;  1SE2 A;  1I4X A;  2Z1C A;  2D2C C;  1QB5 D;  3TDQ A;  2E74 C;  4HMI A;  2M2L A;  3MAQ A;  3EVQ A;  4IFD H;  5JAV A;  3GD7 A;  3A7A B;  2IW3 A;  3WDN A;  3GTG B;  5AFW A;  1MSG A;  5IT9 L;  4KV6 A;  1JR0 D;  3A56 A;  4BA2 I;  3T16 A;  2BDN A;  5FKA C;  2WKD A;  1DON A;  4KKS A;  4FXG C;  1Z7T A;  1IHZ A;  1EZ8 A;  4RGN A;  5BN5 A;  2F0V A;  1U4M A;  3EQL C;  4IUP A;  3FKI B;  1ILP A;  4NKL A;  1PTO H;  3TSS A;  4DAV A;  4FF4 A;  3CU7 A;  3BG3 A;  1OXX K;  3R8B A;  5DM6 3;  5M9O A;  2N55 A;  4RHR A;  1OXV A;  1TWG B;  4IFD J;  2NUC A;  5C5M A;  3ERQ A;  4KY5 A;  4XQN A;  5EPK A;  4YIJ A;  4N9T A;  1YNN D;  1Y69 U;  5HUR A;  2R92 B;  4XDX A;  3S1M B;  4C3J G;  4IUV A;  1WTO A;  1SEB D;  1H9S B;  1T5X D;  1B1Z A;  3TZU A;  4FF2 A;  1BCP D;  1IW7 D;  2JSO A;  4QCL A;  2XRQ D;  3DEO A;  1CA6 A;  2B39 A;  5JVH 3;  2BA0 A;  4XXE A;  2F3W A;  1PFN A;  3HOY B;  1KTK A;  1EIH A;  3S2H B;  1E2V A;  1EYC A;  2X6G A;  1HCZ A;  4H44 C;  1KNA A;  4K8J A;  1L0Y B;  5IGB A;  3HS0 C;  1O7Z A;  3T13 A;  4CKE A;  2EYP A;  1EL0 A;  3FPP A;  3HRZ C;  1R9T B;  2ZXO A;  2V4D A;  1HTL D;  2XWB B;  2L5T A;  3I91 A;  4XIG S;  3A7L A;  1E2W A;  5CBA E;  2A74 C;  1EY8 A;  4A3J B;  1ENF A;  2L9H A;  2PZU A;  1I6H B;  1AZQ A;  3R3O A;  1MGS A;  3A8J E;  1E2Z A;  1D5M C;  2QF7 A;  1PZI D;  4LAA A;  3CHB D;  1G2S A;  3GTP B;  1CZW A;  2CVR A;  4FP5 D;  1F77 A;  4G4K A;  2ZXR A;  2EY1 A;  4ME5 A;  3L3O C;  5C5L A;  3M7N A;  1EY9 A;  1J8I A;  2L0C A;  4RGO S;  3RUZ A;  1RD9 D;  3DUZ A;  4ZK9 B;  1QNK A;  5FO9 B;  3JAM L;  1FNV A;  1U9R A;  3BYT B;  1WD1 A;  4S3S A;  4RH6 A;  5TSS A;  1TT2 A;  4CJ2 C;  1IYU A;  1SE3 A;  3J80 E;  2QKI C;  4XYQ A;  3L7Z C;  2WP8 J;  3I8Z A;  3S1R B;  2B2W C;  2CW0 D;  4IFD I;  4QIW B;  4FF1 A;  2F0U A;  2HDL A;  3C2P A;  3EFX D;  1J9O A;  3NUC A;  1LTA D;  1IKL A;  1PMR A;  5KEE A;  1I4R A;  3PV0 A;  3FEW X;  1SNO A;  4U67 3;  4F88 A;  1NR4 A;  1LV9 A;  1CTM A;  4J8Q A;  2PW7 A;  3HG9 A;  1PYW D;  4OO1 I;  2EJF C;  2PO4 A;  3I70 A;  4EQO A;  4KMU C;  2ZXP A;  4XQJ A;  1LTT D;  1NSN S;  5D3D A;  1B44 D;  2HQE A;  4TKO B;  1EWH A;  3GTO B;  4FF3 A;  2NWG A;  2EYJ A;  2J0T D;  2Q8R E;  3TP6 A;  3H3V C;  2K03 A;  5M3M B;  1ROD A;  3OWF A;  2VUM B;  5EQ0 A;  3BDL A;  1UUP A;  1LTG D;  2FIN B;  2PZW A;  1PLF A;  2EE1 A;  3D4R A;  3R93 A;  2E2J B;  2FJ2 A;  3P7J A;  3IAY A;  2ZT9 C;  5M3F B;  1Y8N B;  5JOB A;  5JJZ A;  4IQZ A;  3HEJ A;  2BE5 C;  3P75 A;  4CJ1 B;  1EQV A;  3MA2 B;  1I4Q A;  1HXY D;  2BDO A;  2B2Y A;  5CV7 A;  4BBS B;  1W6K A;  2F0S A;  5G3L F;  2NVX B;  2HDM A;  1SBB B;  3IFD A;  1VDZ A;  1SE4 A;  4FXK C;  4RKL A;  1ESF A;  2F0I A;  2NVT B;  2XNA C;  4XYO A;  1NCV A;  3VYT A;  1ET6 A;  1DOM A;  1ONL A;  1NUC A;  2K5Q A;  1CM9 A;  1EEF D;  3S17 B;  4V0B A;  3N52 A;  5EBC A;  3OW7 A;  5C0X G;  2EYM A;  1RTN A;  2AQ1 B;  2MGS A;  2E75 C;  1MI2 A;  1FR3 A;  2LMC B;  1I4P A;  5IGF A;  1UAP A;  4A3B B;  4DK1 A;  4TRD A;  2G9H D;  1TS5 A;  3D6C A;  4A3I B;  5I2X A;  5NUC A;  3MZ5 A;  4I7Z C;  4KD4 A;  1RDP D;  3VYR A;  1IKM A;  5DM7 3;  1C48 A;  3NTK A;  1GXD C;  2SEB D;  4HTH A;  2WIN B;  3TP8 A;  1BBX C;  2WB1 B;  3MFG A;  1S5B D;  1HRJ A;  1JCK B;  2D62 A;  3LWE A;  5JEA H;  1DM0 B;  3OOC A;  4X3T A;  2F0Q A;  3ITP A;  4IZ8 A;  4FXD A;  2VB3 X;  1FYC A;  3QO2 A;  1LAB A;  4K14 A;  2WAC A;  2HCI A;  2MP1 A;  4MIU A;  2R93 B;  4HSV A;  1MSH A;  2I07 B;  5I6Y A;  1HQM C;  2JA6 B;  4RKB A;  4RHS A;  1Y8P B;  4CKC A;  5BN4 A;  4KN4 C;  4A3F B;  2PW5 A;  3FRP B;  1EY6 A;  5CV8 A;  1SYD A;  4O42 A;  2B2T A;  2E76 C;  2PMZ B;  1HFG A;  3CRK C;  3KK7 A;  3KLS X;  4RGT A;  2B8G A;  3HOZ B;  1Q8I A;  1V8Q A;  2CQA A;  5JEA J;  3U9O A;  1I3Q B;  1S4Z A;  3UI2 A;  1PFM A;  1A2U A;  3T51 B;  1YNJ C;  4ODG A;  1B2T A;  3BZD B;  1DYQ A;  1VF5 C;  2R61 A;  1B4O A;  1A3U A;  4F8M A;  3KLS A;  1LLR D;  1MD2 D;  4K6L A;  1GUN A;  1K8O A;  3SK8 A;  1RTO A;  2NN6 I;  2KED A;  3N6R A;  5J1Z A;  2KJX A;  2BA1 A;  2DY8 A;  2EJM A;  4ZKC B;  1EY4 A;  3J80 L;  5D14 A;  3T4A C;  1SDF A;  5FLX L;  4EGV A;  5C44 B;  4I65 A;  5A2Q E;  2QDB A;  3C3L A;  2RDG A;  2SNS A;  2XSC A;  2Q8I B;  3S2D B;  2JA5 B;  4U68 A;  4XTC S;  1PTO F;  4BS9 A;  5BN3 A;  4HCE A;  2CHB D;  3IFT A;  3HOU B;  1M8A A;  4F7X A;  3TBI B;  3T53 B;  1QCB D;  1PRT F;  1NAP A;  3O13 A;  5CV5 A;  1Q90 A;  2LS0 1;  3J81 L;  3NK9 A;  1STE A;  3ONA B;  3PUW A;  3QJY A;  1AW7 A;  5IOD A;  5M5Y B;  2F0M A;  2HCC A;  1F9R A;  1F9S A;  3F2U A;  1CHQ D;  1DZ1 A;  1U4P A;  3A8I E;  3HOX B;  2PNR C;  2D5D A;  3OWE B;  1IW7 C;  3V96 A;  5IGE A;  3Q24 A;  1V1P A;  1TR5 A;  3G6J B;  1WTV A;  2ICE C;  2X6L A;  1EOT A;  2F0P A;  2SOB A;  4OIJ A;  2KVM A;  1QIL A;  4BY1 B;  3J7Y W;  3BDC A;  1D5Z C;  2F0G A;  4OHJ A;  1PDQ A;  2EDG A;  2QEJ C;  3S14 B;  2EY2 A;  2XN9 C;  1TKW B;  3A54 A;  3NHH A;  1RCV D;  1H9M A;  1IYV A;  3NQT A;  4R9W A;  3VR5 A;  1LTR D;  1WTW A;  2EYH A;  2F3V A;  3QIA A;  4OO1 H;  2EPB A;  2F4I A;  1GJX A;  5K36 G;  3PUY A;  1SYF A;  1G91 A;  2RKS A;  3LX0 A;  4A3M B;  5ELD A;  1WTP A;  3SDZ A;  4X3K A;  1G2T A;  2FMM A;  3SHL A;  4DXF A;  1B50 A;  2FFK B;  4JBW A;  2LFN A;  2OT2 A;  3S1Q B;  3OIQ A;  4A3D B;  3K5M A;  3H6M A;  3TN2 A;  5IGC A;  1B53 A;  3MC0 B;  3T56 B;  1SAP A;  3MTS A;  2NVY B;  3Q0A A;  5C4Z A;  4DNR B;  3OMC A;  4M1U B;  4BY7 B;  2F0D A;  1PRT D;  4KKT A;  1PTO B;  3Q23 A;  1ENA A;  1QOH A;  1EQT A;  2NTS A;  1T5E A;  2F0E A;  2KA7 A;  3A8K E;  3ZYY X;  1BNZ A;  1PRT B;  4C3I B;  1CK1 A;  1F2Z A;  4C1N I;  1OXT A;  2OF1 A;  1ILQ A;  2IWH A;  5CMD A;  3BVM A;  5EBD A;  3I72 A;  1UNS A;  3SR1 A;  2CW0 C;  4DGZ A;  3K5N A;  1XX8 A;  4PQX A;  4R8N A;  4CGY B;  1DD2 A;  2F0W A;  4K5X A;  1CHP D;  5C4J B;  1WTR A;  2B2V C;  3K7A B;  1TY2 A;  3BVG A;  3SXH A;  2B2U A;  2K1B A;  4KN7 C;  1EY7 A;  1KDA A;  3PO2 B;  2K5D A;  3GTK B;  1S5D D;  3FMC A;  1IL8 A;  4QUC A;  3VR3 A;  4B9X A;  5HGT A;  1BXT A;  5M5W B;  5C4H A;  3D3R A;  1PXU A;  3RZO B;  4UAI A;  4OL7 A;  2JP1 A;  1CQV A;  1Z47 A;  4LK1 C;  4BA1 I;  5KIX A;  3HOW B;  2HUG A;  3D31 A;  5E4W C;  3SE0 A;  2N88 A;  4J6H A;  1SYG A;  2I46 A;  4PNY A;  1DOK A;  1O7L A;  2MUY A;  1R4Q B;  1GHJ A;  2LY7 A;  5D3I B;  2JA7 B;  4PMB A;  3K5L A;  5LHY 1;  2OEO A;  4G7O C;  3RLF A;  1SMY C;  2XIW A;  4A3G B;  1K83 B;  1QWY A;  2WKC A;  1A3V A;  2NZ1 D;  1I50 B;  1EU4 A;  3PIP 3;  3NXW A;  3WOF A;  3VYS A;  4F87 A;  2AUJ D;  2C5C A;  4ZRZ A;  1S5C D;  3K5O A;  2K6A A;  3EA6 A;  2F1M A;  3CKI B;  3MXU A;  4PV1 C;  5A35 A;  3J7A F;  2O5I C;  1AEX A;  2B63 B;  4E6I A;  1EY0 A;  1I4G A;  4ABN A;  4JK1 C;  5CC4 A;  1Y1W B;  2B8F A;  1WD0 A;  1BUV T;  1BO0 A;  1HA6 A;  3AMU A;  4KHZ A;  5DEH A;  4A3E B;  2NN6 H;  4FNF A;  3AB9 A;  1SJH D;  2F0N A;  2DNE A;  1NR2 A;  1QE6 A;  1OXS C;  4KK7 A;  1XTC D;  1V1P B;  4KHV A;  1F2Y A;  5IIF A;  1RHP A;  1DCZ A;  3SK5 A;  2F0K A;  4G7H C;  4J1M A;  2J4X A;  2MHV A;  3I4N B;  5C3E B;  5KNC A;  3DWA A;  1TY0 A;  2F0F A;  1OO9 B;  3VYU A;  2VNU D;  1QNU A;  2E2H B;  1SMY D;  1A3T A;  5KND A;  1A15 A;  2EY6 A;  3URY A;  3VA5 A;  2MJ8 A;  2KQ3 A;  1WVL A;  2PQE A;  4DAY A;  5K5P A;  4IN3 A;  3HOV B;  1AFP A;  1JWM D;  4DFA A;  1BDO A;  1ZYR C;  3R2T A;  4HMJ A;  2J7Z A;  3CQZ B;  1SNM A;  1Q12 A;  1TWH B;  1V43 A;  5IT9 E;  3MXN A;  1BQQ T;  1VMC A;  4ID6 A;  4KKU A;  1SNQ A;  1O7Y A;  4PMW A;  3D6W A;  4L63 B;  5CYU A;  3DXJ C;  3V2T A;  2QCP X;  2RDH A;  3BVZ A;  1KLG D;  3E5S A;  1EU3 A;  2RBM A;  1HUM A;  1C8C A;  2BCO A;  5EKK A;  5M5X B;  2O5J C;  5KYI A;  1LTB D;  2O4X A;  2EYL A;  3GP7 A;  2Z4H A;  3K6O A;  2A5H A;  4NMZ A;  3QG1 A;  1DOL A;  3RZD B;  3PUZ A;  1ICW A;  4K8I A;  1SND A;  2AQ3 B;  4CJ0 B;  3NP8 A;  5D65 A;  1CZG A;  5DAU A;  2H4O A;  5KYL A;  2X69 A;  3TP5 A;  5EKL A;  4RCN A;  2TMP A;  1CFM A;  2RVL A;  2WV6 D;  3G7L A;  4C56 C;  1ZYR D;  3NTI A;  1LTS D;  1SYE A;  3D8G A;  2RSN A;  3I4L A;  5J22 A;  5C3W A;  5C0X J;  2A6H C;  4K5V A;  2IJ0 A;  4TSS A;  3BS1 A;  4IUT A;  2E2D C;  3VA7 A;  1TU2 B;  2KEC A;  3HGB A;  2EJG C;  3M3Y B;  2A6E C;  4HED A;  1EIG A;  3ND9 A;  3RMH A;  2GA4 B;  5G3L D;  1GOZ A;  3I73 A;  1RKN A;  1JOK A;  1F9Q A;  5CV9 A;  2C9O A;  3VR4 A;  3QB3 A;  1LAC A;  4QUF A;  2IL8 A;  4XT1 B;  1EYD A;  4BWG B;  4C1N K;  4UDU C;  3OHX C;  1U4L A;  1HHV A;  4ZUJ A;  1JWU D;  1E0B A;  3GTM B;  5JVG 3;  1KDB A;  1SSO A;  2JA8 B;  2KCC A;  3MXP A;  4DAP A;  2B2Y C;  4KD3 A;  1TVX A;  2PZT A;  5T1G A;  1JIC A;  5E1F A;  2RA4 A;  1Y8O B;  4ZUI A;  5KGU A;  3K57 A;  2RDF A;  5E3F A;  3JAM E;  4ULL A;  2A69 D;  3E0J A;  3V05 A;  4C2M B;  2A6H D;  2PCF B;  5I6W A;  2D9U A;  3DMU A;  1HQR D;  2A73 B;  4ZAI A;  1TWC B;  1BCP F;  5I9O A;  4H0L C;  5EJW A;  2A6E D;  1JC7 A;  2FHT A;  4V19 0;  3DWQ A;  2AQ2 B;  4A3K B;  1FGB D;  1GUW A;  1PTO C;  1ML0 D;  2DN8 A;  3C46 A;  1S5F D;  5C4X B;  3H91 A;  1PRT C;  1EYA A;  4KJN A;  2MPM A;  4IFD G;  3X3M A;  3S1N B;  3OPO A;  4O1N A;  2KCN A;  4IUU A;  1K8M A;  5JPN C;  4CBV A;  4LMQ D;  4DA2 A;  3IL8 A;  5C0X I;  1MBY A;  2VB2 X;  1H9R A;  3K0Y A;  4AYB B;  1TS2 A;  3SVM A;  4LJZ C;  4WFN 3;  4OO1 G;  2A68 C;  2K01 A;  4QF4 A;  2L1B A;  4HN7 A;  1STA A;  1STN A;  2F0O A;  1I4H A;  2B2T C;  1D5X C;  2H1E A;  1WTQ A;  2BOS A;  1GHK A;  2M9V A;  4MHE A;  2IT1 A;  4C3I G;  3BDO A;  2B2W A;  1O78 A;  3H94 A;  4RCO A;  3M4Y A;  3VR2 A;  4RFB A;  2ID0 A;  4B9W A;  3NWT A;  1B9M A;  5K36 H;  1EY5 A;  1WCM B;  3MXG A;  4N9P A;  1GUO A;  2R3Z A;  3PUV A;  1LT4 D;  2IX0 A;  3FDT A;  4RWS C;  1PTO D;  3NE5 B;  1JOQ A;  5LL6 X;  3NPP A;  2F0J A;  5DNF A;  1AZP A;  1BOS A;  1KLU D;  1HUN A;  2IX1 A;  1LT5 D;  4KY6 A;  4FYD A;  3W2D A;  4HAE A;  1G8Z D;  3K59 A;  1ZEQ X;  5EPJ A;  4DK0 A;  1STG A;  4G57 A;  2XVS A;  3MFY A;  2L12 A;  3OIP A;  1F2M A;  1PZK D;  3DM1 A;  3GV3 A;  1BCP B;  2Z8L A;  2R6G A;  5COY A;  4L6T B;  1ZXT A;  1WTX A;  3NBH A;  2YU9 B;  3NSW A;  2A68 D;  1F9P A;  2ENB A;  3KUP A;  1TII D;  4Z9C B;  3TP7 A;  1BR9 A;  5ISR A;  4C3J B;  2SNM A;  4EQN A;  1SXT A;  2K32 A;  4X3S A;  4CKB A;  3S9W A;  1M4V A;  4XT3 B;  5IGG A;  4PMC A;  3W3A A;  1G6Z A;  5CBE E;  2EOT A;  2AUK A;  3FVQ A;  3M85 A;  2LKV A;  5ELC A;  1SYB A;  1Q1E A;  3VR6 A;  2EXZ A;  2JEB I;  1JQY D;  4Q5V A;  1EFI D;  2O2L D;  4HCS A;  1D1K A;  1U4R A;  3DEP A;  2QIL A;  1JB3 A;  3M4O B;  5A2Q L;  1A2T A;  1HA5 A;  1JOR A;  1TWF B;  4ZKB B;  1X3Q A;  3DWP A;  3GTJ B;  4P2C B;  3AU7 A;  3LWU A;  4CHT B;  1KAA A;  2L55 A;  1S5E D;  3D4W A;  3ND8 A;  3KLR A;  1KDC A;  2EYF A;  4EQP A;  2TSS A;  1CT1 D;  4DNT B;  2F0T A;  2K33 A;  3A55 A;  1CQF A;  4QB4 A;  1W6J A;  1SYC A;  1FNW A;  5FLX E;  1LTI D;  2NN6 G;  5CR3 A;  3SEB A;  1TS3 A;  4H13 C;  1DJR D;  1HTP A;  4C3H G;  3GQB A;  1X32 A;  1FNU A;  5COR A;  3HP3 A;  3E6Z X;  2NYZ D;  2WAQ B;  1R4P B;  1EZ6 A;  5ELE A;  1Q1B A;  4IUQ A;  4A93 B;  2M00 A;  4DF7 A;  2AWN A;  3J81 E;  5I4D A;  5C6A A;  4EVO A;  2XWJ B;  4WRD A;  2Q8T A;  5E4X A;  4RAU C;  1VCI A;  2JEA I;  4TQU S;  3TME A;  1B9N A;  2PYK A;  3CRL C;  3HKZ B;  5I2Y A;  1ESR A;  2IX3 A;  1TWA B;  3QOL A;  1H9K A;  2G9D A;  2E2I B;  3K58 A;  4DN4 M;  4M8A A;  1TQO A;  4ZLT F;  4GZY C;  3M7G A;  2EY5 A;  3S16 B;  3I4M B;  2JYO A;  1SNP A;  2EVB A;  4C3H B;  1JWS D;  4ZYS A;  5CGK A;  4G7Z C;  2F0H A;  4HR7 B;  5FO7 B;  1F2L A;  1I6V C;  2YYZ A;  3KBG A;  1KAB A;  1BF4 A;  1SJE D;  4NP5 A;  1G29 1;  1LT3 D;  5CV4 A;  2KUM A;  3L9A X;  2B2U C;  1AP0 A;  1II3 A;  2K04 A;  4KI0 A;  1KNE A;  1SFO B;  3GO5 A;  3MVV A;  4H7B A;  1HPC A;  2XRS D;  3BYY B;  3RD4 A;  3MWY W;  2RQX A;  5ELF A;  1EEI D;  2NVQ B;  1XYI A;  4WOR A;  1JE4 A;  4IAL A;  2OXP A;  1B3A A;  3Q6S A;  3FPU B;  5C0X H;  5EGT A;  1O80 A;  4K6D A;  4KTA A;  4QMG A;  3QOJ A;  4KY7 A;  5JEA G;  3NWS A;  3EJI A;  1H9S A;  2FMC A;  2EYO A;  1STB A;  4RA8 A;  2KEE A;  3U9S A;  5C3X A;  3PIO 3;  1CA5 A;  3PMF A;  4K2K A;  3OSO A;  2Z4I A;  2L4N A;  4NW2 A;  4FVM A;  5ELB A;  3P1H A;  1UEA B;  4K5W A;  3WOE A;  2ICI A;  1GUT A;  2K28 A;  1C4Q A;  1QJO A;  4OIK A;  2NB0 A;  3MEH A;  5FO8 B;  1RJT A;  1GUS A;  3I3C A;  4K2L A;  2BE5 D;  2A69 C;  4Y7N B;  5KNB A;  3NTH A;  4Q0F A;  1STH A;  1ENC A;  1FD7 D;  1PZJ D;  2F0L A;  5I9P A;  3LNN A;  5KRU A;  1D1I A;  1GUG A;  2JXM B;  3SK6 A;  4L8J A;  3H0G B;  3KBX A;  3J7A V;  4IUR A;  3PO3 B;  1ET9 A;  1VMP A;  3MHB A;  5FK9 C;  3ERO A;  5IGD A;  2EZV A;  1V1O A;  4B08 A;  3I90 A;  2PPB C;  2SDF A;  3Q22 A;  4ZQ3 A;  3TZD A;  1AN8 A;  5T1I A;  5JPM C;  3QWN A;  3NBI A;  1DXM A;  4KJO A;  5LL6 S;  4NDX A;  5CV6 A;  3R2I A;  1LT6 D;  4MN3 A;  4DU9 A;  2JE6 I;  1XXG A;  2R7Z B;  1JOO A;  1A6X A;  1Y1V B;  2NTT A;  2F03 A;  5F2D A;  3DHQ A;  5FOB B;  2IPK D;  1D6E C;  1TS4 A;  5EKI A;  4FO2 A;  1CI3 M;  2VXW A;  5J39 A;  1OXU A;  3HZX A;  1Q3L A;  3C1F A;  4R8I A;  4RGM A;  1RF2 D;  4BBR B;  3H09 A;  3NQI A;  1EWC A;  1D2B A;  3GTQ B;  4ILW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...