2TMPA

N-terminal domain of tissue inhibitor of metalloproteinase-2 (n-timp-2), nmr, 49 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease inhibitor
molecule keywords TISSUE INHIBITOR OF METALLOPROTEINASES-2
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 1998-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2tmpA00
1GXDC 2B39A 4FXGC 2TMPA 1BR9A 3G6JB 3CKIB 1PXUA 3V96A 2WIIB 2A74C 3FRPB 5FOBB 1D2BA 2XWBB 3KLSA 4FXKC 3L3OC 2ICEC 5FO7B 1UEAB 4ILWA 3HS0C 5FO8B 2WINB 2J0TD 3CU7A 5JPNC 5FO9B 2A73B 1BUVT 1JB3A 3T4AC 2I07B 2XWJB 3HRZC 2QKIC 3I70A 1BQQT 1OO9B 3OHXC 1XWEA 5JPMC 1JC7A 1UAPA 2E2DC 3MA2B
chains in the Genus database with same CATH superfamily
2IW3A 4G7OC 1H9RA 1WI5A 2R93H 4QIWB 3V05A 3CCRA 3ND9A 4TQUS 5C0XH 4A3FH 1X3EA 3L3OC 2NBFA 4JBKA 1I6HB 2K14A 2EJFC 1XTCD 3S1RB 1KLGD 2ALYB 4WJWA 1QVFA 5CGKA 4H02A 2ATWA 4DK1A 1FNWA 3FHWA 5G3LF 1SBBB 2F0TA 2KVMA 5KYLA 2ZJRA 1HCZA 2N55A 4C3IB 1SMYC 5FK9C 3V2TA 4LFBL 1WD1A 1K8OA 2OEOA 4A3GG 1EYDA 1B3QA 4BY1H 2DUDA 3H0GG 4JI3L 1H9SA 3STBD 3VR5A 4XIGS 5E4XA 4OXPA 2JA5B 2K7VA 3I70A 1RCVD 4ZUIA 1JT8A 1AEXA 3CP0A 2D0OA 3KLSX 3GTGH 4DPGA 3GTMH 1KAAA 5EJWA 3CCUA 4YHHQ 4DR3Q 3Q6SA 1QZGA 1D2BA 1J9OA 4UPAA 1Q82C 1CSQA 1QILA 1CA6A 4E6IA 2RHSB 2NB0A 4HSVA 1WFQA 1CHPD 1STHA 1JB3A 5EQ0A 2JK8A 5ELOA 2EOTA 1OO9B 3HKZB 3ZJYC 2NVTH 4HJ7A 2NVYB 1PH9A 2YTXA 4KHPL 4PMCA 4LUZA 3HOZH 1E1TA 5CBAE 2OQKA 5I2XA 1VQKA 2IX0A 3I2ZA 4MN3A 1VQHA 5CV8A 1PZJD 3UI2A 4LMQD 3U4ZA 5IYCG 1G2TA 2B2WC 1I4GA 2NVXH 3VA5A 2EYHA 3F2CA 3I72A 3U50C 5E4WC 2NN6G 1K0SA 2NZ1D 2AMCB 5DAUA 3T53B 4IFDI 1CUKA 3DLLA 4OL7A 1KTKA 3GO5A 2OCEA 1STYA 2F0JA 2VS1A 4HIOA 3CKIB 1GUNA 1DJRD 1U4LA 2QF7A 4ZK9B 4HIMA 3GTQH 1S3OA 2F0EA 5E3FA 3SXHA 3AEVA 3ERQA 4DK3C 4LFAQ 3KYHC 4IALA 4DR5Q 2NVQH 1UE7A 2KEEA 3MVVA 4GKJL 2Z1CA 3S16B 1YBYA 1I50H 4CJ0B 2L1BA 1RIPA 2FXQA 2CW0C 4FXDA 1UAPA 1U9RA 2C35B 3R3OA 3RN2A 3GTJH 4DUZL 4YCUA 1YJ9A 2IJ0A 1PH2A 4A3CH 3F2DA 3G6EA 2F0WA 3M3YH 2H5XA 1Q81C 3VR3A 1LUZA 5C44B 2UXCL 1LT3D 4JI8L 2LMCB 1G291 5IT9L 5DM73 4KTAA 3NBHB 1V1OA 3RZOB 4LF7L 2PZTA 3T1YQ 2K03A 4A4IA 1J5EQ 3PF4A 3HKZE 4N8FA 4XT3B 2AKWB 3EA6A 4GOPA 1PFNA 1CZWA 3J7AV 3J81L 3QOJA 1SJED 3HOYG 1WTXA 1PLFA 1EIFA 3J80c 4EX5A 1TWAB 3PUWA 4LUOA 4U68A 1X54A 2B8GA 5IYBG 3I8ZA 4IO9A 3HOVB 4KD3A 1SMXA 2KCMA 1YNND 3BDCA 5A2QL 1FNUA 4XYOA 2JEBI 3SK6A 4O2DA 3T1HL 3S2DB 4L5QA 4HAEA 4BS9A 1SYDA 5KIXA 1VQ4A 1SEBD 3NWTA 1OXTA 2E2HH 1JORA 4JYAQ 5EPLA 3OSOA 2JA8B 2J0TD 2RSOA 4DUYL 3QIAA 4UAIA 4IPHA 1N9WA 3RLOA 1GVPA 3J80E 2B63B 1NSNS 1I6VC 2PI2A 2Y0SB 5M3MG 3K59A 4X3UA 1R9TH 3PUVA 4JI7L 3W2DA 3TP5A 2UUBQ 3W5OA 2BDNA 3I3CA 2EDGA 2WAQE 1HJPA 1QWYA 2WACA 4G7HC 4B9WA 1ZYRC 4RCOA 2KQ3A 4DR4L 1VQ8A 3S17B 4R8IA 1NY4A 1SLJA 1T5EA 3BDOA 4DFAA 2F3IA 2A5HA 5JJKA 2F4IA 1PMRA 1Z47A 4A3FB 2Q2IA 3BVMA 1Y14B 4F88A 4JI1Q 1UNSA 1A2TA 1VQGA 5C3EB 1X55A 2ZT9C 1A8VA 1D6EC 4DV0L 2Z4IA 5A35A 4RG1A 2E75C 4OIJA 5C4XB 1EY7A 1X3PA 4JG2A 3MWYW 3PCOB 1JWUD 5FO7B 2LXJA 1Y69U 5LL6X 4P75A 2XN9C 3A8KE 5EBDA 3H3VC 2Y0SE 4KHPQ 3L7ZC 1II3A 5EKIA 3OPOA 4HJ8A 2HCIA 3MAQA 2L9HA 4CDDC 4UY8C 2RDGA 4DNIA 3LWEA 4C56C 3NXWA 4KN4C 1KDAA 3W1BA 2HCCA 2K5HA 4A3LG 4ME3A 4K8IA 5K5PA 3A7AB 3HOXH 3PIOA 4NB3A 3M4OB 1VS0A 4YHHL 2R92G 4A3DB 2F0UA 1SFOB 1VQ9A 5E7NA 5ISRA 4LF4L 1U4PA 4ZCKA 2K33A 1DGSA 1I4PA 3AMUA 2F0SA 2K5NA 3TSSA 3G7LA 1FD7D 3GTMB 1ET6A 1F2ZA 1SRUA 3K7AH 4A3EH 1PFBA 2AHOB 1ENAA 2K75A 3DUZA 1QCBD 4DV2Q 1X56A 1HH2P 1ASYA 3TS0A 1HTLD 5KRUA 3KF6B 4X65L 4DAPA 4FF1A 1TY0A 2WKDA 4K6LA 4XXEA 4X64Q 5M5WB 2XWBB 1HUNA 1XMOQ 1VQJA 1RKNA 4AYBB 1SNMA 1BCPF 2EY2A 4S3SA 3TZDA 1IKLA 2N3SA 3PMFA 1Q7YC 5NUCA 2K5DA 1ESRA 1E2VA 2SOBA 4A3KH 1Y8NB 4HEDA 1KDBA 5CORA 1XNRQ 4QUCA 5JAVA 3WOEA 1HNWQ 2CQOA 3C2PA 4C3JB 1O7LA 3NBIA 5IOCA 2NVXB 3R2TA 3NP8A 5EBCA 4QGUA 1K3RA 2XRSD 1DXMA 1G51A 5IY0A 1QOHA 1N8RC 4B3TL 5AJ3Q 3K8AA 4O0AA 4CKEA 2EYJA 3CU7A 1LTRD 3NTHA 4PNYA 4DV3L 2R93G 3KFUA 4BY7G 4DR6L 2DN8A 2KECA 2F0DA 3J81i 4BBRB 3CCEA 4LW1A 3K5MA 4N9TA 3CHBD 2LSSA 5BN5A 3K7UC 5KNBA 4EQPA 1SFOH 1ILQA 1XTDA 2BCOA 2Q8IB 3CC2A 1J6QA 5IGBA 1KXLA 4HJ9A 4R1JA 1N33L 4DR1L 2YYZA 1IZ6A 1EEFD 2Z6KA 4B3ML 4LF5L 5F2DA 3D6CA 4LK1C 1YNJD 2L15A 4M1UB 1K28A 5GAEC 2DNCA 4FYDA 3S9WA 2R7DA 2O5IC 3KJPA 1VQPA 1U5KA 1GD7A 5IYBH 1Y1WB 4RA8A 2CFMA 1EOVA 3IFTA 4QQBX 2KUMA 3FRPB 2ZM6L 4MHEA 3MXGA 4FXKC 2EE1A 5M3MH 4HCSA 1CA5A 5IGDA 2EVBA 4GLXA 1S72A 3KLWA 4HCEA 3T16A 1TXYA 5BR8Q 1EQQA 1Q1BA 1EY0A 1A2UA 4UHVA 1SJHD 4H13C 1FJGQ 4H0LC 2BDOA 2LFNA 4KK7A 1KRSA 4PZ8A 4IFDJ 4F87A 1PHJA 1AH9A 4XT1B 1EYGA 1CK1A 2B39A 3MXUA 4EQOA 1Q8KA 2A6ED 2G9HD 5T1IA 3QO2A 4LF8L 5D14A 4X66Q 1VQ5A 1XPRA 2QILA 5EGTA 4DV4L 5ELEA 2KHIA 4R4IA 4BBSH 1BBWA 1EUJA 2XWJB 1L0WA 3M9BA 2BH2A 1PRTC 3VR6A 5IYCH 2MO0A 3P7JA 4A3BG 4PMBA 1JCKB 1AW7A 5K36G 3PO2B 1VQMA 4LFCQ 1KD1C 2ID0A 4LNQA 4A3MB 1JMCA 1CQVA 3GTOH 4HN7A 1SNOA 2YU9H 1KLUD 1F9PA 1C48A 5C0XG 3EVQA 1BBXC 1S4ZA 4C2MB 1STNA 3C1EA 4XDXA 3D8GA 4DR3L 1YHAA 1WTHA 3TP7A 3T13A 4OELB 2TSSA 4JPBW 1M8AA 2KCCA 2UUBL 1CSPA 1TWFB 3I90A 2DY7A 4BXXG 3A0JA 4LFCL 2E5LQ 2JP1A 4RGTA 5IWAL 4OX9L 3NE5B 4DNRB 2IL8A 1B9MA 1W2BA 3I4NB 2AQ3B 4EVOA 1J5EL 2F0OA 2Q8TA 2K5QA 4OX9Q 4NDXA 2FINB 2K1BA 1IBKQ 3MXPA 5LMUL 1Y1VB 5COYA 2HHHL 4PZ6A 2WP8J 5M3FB 1N34L 4FXGC 1SMYD 1X3GA 3FKIG 4FP5D 4MIUA 3TP8A 1TVXA 4K0KQ 1SYCA 3Q22A 1Z6HA 1LACA 1PZKD 2J4XA 4C3IG 3OMCA 4PQXA 4DUZQ 1LABA 3HS0C 2FJ2A 4DU9A 4A3GB 1G2SA 3DXJC 3P75A 2VUMH 1GUSA 5CV9A 2VQEL 3H0GB 2JN4A 3Q23A 3K58A 1Q86C 1JOOA 1L0XB 3BVZA 2L0CA 1AE2A 1PYSB 1LTSD 4OHJA 2XNAC 4X62Q 5DM63 1VQCA 1JJ2A 4RKLA 4DR5L 1QUQB 1TKWB 3JAML 3DMUA 4EGVA 1QZHA 1BOSA 3ZYYX 1RJTA 2ICIA 4JI0Q 2E2JB 2AWNA 1TS3A 1MIUA 3BG3A 3GTLB 3QWNA 3P20A 3RZDB 2R7ZH 1B50A 1ESFA 1SAPA 1GHJA 2OTLA 4MNOA 4B3RL 1SNCA 4UP9A 5ELBA 2NZOA 2CW0D 2KA7A 4JI0L 4OEMB 1NR4A 3NENA 1O7IA 1I5FA 1B1ZA 4CHTB 1Q1EA 1VCIA 3IAYA 1PZID 4IUVA 5BN3A 5IT9E 1JOKA 1DOKA 4LFAL 4HMJA 2A19A 2SNSA 4AH6A 1LYLA 2Z6KC 4JVZA 5EPJA 2O5JC 3L9AX 5DNFA 5CYUA 5AJ3L 5IP7H 4FO2A 2NWGA 3PIO3 1YI2A 1I6HH 4DR7Q 5T1GA 1M1KC 1PH5A 2BA0A 3NSWA 3TRZA 4K14A 3G6JB 1AP0A 1IYVA 2B2VC 4A75A 4DN4M 2VUMB 3OMGA 1CKNB 1FJGL 5C0XI 3G71A 5EAYA 4Y52H 5FLXL 1N33Q 2B2YC 3NK9A 4XYQA 4IUTA 4JI4Q 2EYOA 4H7BA 2GA4B 2EJMA 1GKHA 2NUCA 1C8CA 1Z7TA 3SEBA 2ZM6Q 4A3JG 1CI3M 2A69C 2LS01 4RAUC 4HIKA 5M5XB 2MQHA 1GXDC 1F9RA 3DHQA 1WYDA 1EWIA 2GVBA 3HG9A 3NBHA 3NQTA 1D8LA 2R7ZB 3M7GA 2C5CA 2RDFA 3BZCA 1NBWA 3ER0A 5FLXE 5M5YB 1GHKA 1GUGA 4C3HH 2AQ1B 5FJ8G 4YY3L 3EN2A 4V0BA 2JEAI 4YWMA 2EZVA 3GTQB 5JJIA 2UUCQ 3D31A 4LAAA 1LT4D 1KDCA 1PA6A 4PV1C 1STGA 1KABA 2I5HA 1HNZL 3AQQA 1QG7A 4B08A 4WFN3 1V1PA 1PXUA 3G4SA 3K5NA 2NN6I 2K6AA 1SE2A 1RDPD 4TKOB 5KYIA 3URYA 1F2MA 4GN4B 1IW7C 2F0FA 1JJCB 3VYUA 2WB1B 2F0PA 4WORA 4X65Q 3PIPA 5ELCA 3J7ZC 3PO3B 1I4QA 4NP5A 2M2LA 5KNCA 3F1ZA 4KJOA 3KBGA 1H9SB 2OXPA 1M4VA 4I7ZC 4DV7Q 1A3UA 3WWVA 3E3XA 1H95A 3OTOL 2K5VA 4QJFA 1TWHH 3BYTB 4IURA 4A93G 3NHHA 1B70B 1JWMD 3W3AA 1BKBA 5GQOA 3F2UA 4R4CA 3E9HA 4C1NI 1D1KA 3HFZB 4GNXB 5DLQE 2PW5A 2QA4A 2M00A 3E5SA 2EYFA 2K05A 4X3TA 3KJOA 4IOCA 1YHQA 2B63G 2PMZE 1BR9A 3S1RH 3NWSA 1I4HA 3S16H 4OO1I 1S5CD 3DWAA 1HXYD 3KLRA 4FF2A 3CRKC 2JA7B 4ULLA 2G5DA 2R6GA 4BWGB 5CMDA 1SE4A 4CJ2C 1SNQA 1K83H 1PH1A 3K6OA 2CKZB 4A3FG 4XQJA 4C3HG 1BVSA 1VF7A 2QEXA 3KUPA 3MHBA 1BCPD 1EU3A 2IT1A 2YTYA 5C3WA 3K57A 2FMCA 3CCLA 1O7YA 3NEMA 4YWKA 3S15B 4G4KA 4GOPB 2UUCL 3FKIH 3SR1A 4JOIA 5I6YA 2KJXA 2PQAA 2LXKA 4FF3A 2CWAA 4AQYL 5J39A 1SYFA 2ZXPA 3CRLC 1OTCA 4X62L 4DV0Q 2VXWA 4BA1I 1KIXA 2I0QA 5IGEA 3GTPB 3OWFA 1H9KA 2O2LD 2F3VA 3I4MB 3H6MA 3MFGA 4KMUC 3I4LA 3A5UA 2J7ZA 3KF6A 2K28A 1RD9D 4QUFA 3T4AC 4K2LA 3EFXD 4ALPA 4UP7A 1SE8A 5C3XA 1X3FA 4GN5A 1B7YB 3E9IA 2WAQG 3MZ5A 1JICA 1N34Q 5I2YA 4DAVA 3MEHA 2E8GA 2HHHQ 1PFMA 4YCWA 1EQTA 4LUVA 1LTTD 2TMPA 4MTNA 4DV1Q 5C4HA 4JI7Q 1JE5A 2E2JH 1DOMA 2ES2A 4M8AA 1VQOA 4DR7L 1EZ6A 4A3JH 3A8JE 4JBMA 2F0QA 3S1MB 2A73B 2FHTA 3T56B 3OYYA 3DWQA 3S1NH 4JCVE 2F0MA 2JA5G 4JYAL 3D4DA 2JQOA 5ELNA 2A68D 5IT9c 1IBLQ 2CH4W 2EIFA 4ZRZA 5TSSA 5CC4A 4LF7Q 1HHVA 4A3EG 4P71A 1I94Q 1N36Q 3S15H 2SNMA 3T1HQ 1GUWA 5I9OA 4WJ4A 3CXCA 4GNXA 1PDQA 3G48A 5M9OA 3MXNA 1I50B 3HOUG 1B9NA 5IP7G 5LHY1 3TREA 4YY3Q 5HY6A 3HOXG 3BYYB 1MHWC 1F9SA 4JV5Q 1LT5D 3KDFA 3K0YA 2N8NA 3TEHB 1ILPA 2HUGA 3HKZG 2YV5A 2L55A 4PMWA 2F03A 1NMGA 4ABNA 1CHQD 3CQZH 3J7AF 4A3KG 2G9DA 1KQSA 2KEDA 2MJ8A 3UDFA 2MNAA 4IZ8A 1ENCA 1WTOA 2CWPA 5IP9G 2KBNA 4V190 5CV5A 4K5VA 3AYHB 4MZ9A 3R93A 1PTOB 2SEBD 4POFA 1T9HA 1XYIA 1BCPC 3O13A 1RL2A 4A93H 1E7ZA 1E2WA 1NE3A 4KLKA 1O7ZA 1UE1A 2UU9Q 2YU9B 1SYGA 1STBA 3FPPA 2RDHA 3L0OA 3W1GA 4ZKCB 3ULPA 1VQIA 3HOZG 5J1ZA 3CCMA 4I65A 1ZYRD 2L5TA 2KCNA 3CCSA 2E76C 1PH4A 2AUKA 1HR0W 3CPFA 1LTLA 1HR0Q 1YJNA 2DY8A 1HNXL 1XMQL 4R4OA 4K5WA 2A1AA 4IFDG 5C5LA 3EQLC 4IJLA 2Q2UA 4PZ7A 1PRTB 3GDEA 5GADC 4PG3A 3NPPA 3I7FA 4LF5Q 1VQNA 1PTOD 5FLMH 1FGBD 1NUCA 4K2KA 5C44G 3PO3H 3DEPA 5C4JB 1WCMH 3OIQA 5CV4A 4JI6L 2F3WA 5JEAG 1BBUA 5LMUQ 1WTVA 1K3BC 2HD3A 1JC7A 2LKVA 5AFWA 3HOWB 4QCLA 4UP8A 2EQSA 5D65A 1E2ZA 4RGOS 2VQFQ 1IBLL 3RZOH 4QMGA 3S2HH 1YVCA 4LF9L 3N52A 2EXZA 2Q8RE 1NAPA 2XTIA 5KNDA 2I46A 2VNUD 1E3PA 3HOVG 4GLAC 3UE0A 2VY3A 3BDLA 1Q8IA 1AE3A 4CBVA 4IN3A 2BA1A 5CV7A 1HA6A 3LWUA 1RTOA 2PMZB 3S2DH 1A0IA 4GLVB 1AZQA 4C1NK 3AB9A 3PF5A 2KCTA 2KHSA 1KNEA 2UXBL 3A74A 2HQEA 4BY1B 3SGIA 1CKOA 1L0YB 1STAA 3OHXC 1A15A 4GKJQ 4KKUA 5M3MB 4IPGA 4HMIA 4QY7A 1SDFA 2WIIB 4IUUA 1EWHA 2CQAA 2OF1A 4GKKL 1WTPA 4IUPA 1YNNC 1WTWA 4X66L 1UWVA 2EJGC 2L4NA 2IHFA 1N32L 1QNUA 1DYQA 1PTOF 1TWFH 3I4OA 2CCZA 1VMCA 1PFSA 1K8AC 1YEZA 2B2WA 3I4MH 4TRDA 4RKBA 5JEAH 5C3EG 2JA6G 1X3QA 3CC7A 4G57A 4JI5L 3KBXA 4KHZA 1JQYD 3IFDA 3AFQA 4RHRA 1SYEA 4P74A 3CCQA 5M5XH 4KY7A 2XIWA 3KF8B 1EFWA 1QVGA 1SE3A 3M85A 5D3DA 3LNNA 2A6HC 1O80A 1HZ9A 1XJVA 1EYAA 4QIWE 1VQLA 3F8TA 1WOCA 4J1MA 1DONA 2JYOA 3S1NB 2D5DA 1A63A 4A3DG 4CDCC 1V1PB 3LX0A 2JA9A 1GM5A 1N32Q 2DJFC 4YWLA 5I4DA 4OIKA 1ENFA 2R3ZA 2MPMA 2NYZD 3HOUH 1CKNA 3A7LA 4DR6Q 5LL6S 4EQ5A 1ONLA 4X64L 1HA5A 4B3SL 3PUYA 1BO0A 4LFBQ 3EJIA 3HOYH 1ICWA 1L1OB 2IPKD 4Q5VA 3FDTA 2KOLA 2N78A 2PNHA 1C9OA 2I07B 3HRZC 2QKIC 1Y1WH 3M3YB 3A55A 3DM3A 3GD7A 3H3VH 1PRTD 1LM0A 1DCZA 2PYKA 2F0HA 1ZKOA 2I5MX 4ZYSA 4Q0FA 3S17H 2H4OA 4IJHA 1B4OA 1PTOH 3H0GH 4X3KA 2E2IH 1D7QA 4YCVA 4A3IB 4ILWA 1XXGA 3U4VA 2AUJD 3HEJA 5HGQA 2R7ZG 5IYDH 4JW0A 2E74C 3VR2A 5C3EH 4B3TQ 5JJZA 1BQQT 2B2YA 2K5WA 5JPMC 1HPCA 3JAMi 2DNEA 3VYSA 2VQFL 1YZ6A 3T1YL 4ODGA 1QJOA 3TZUA 4JI5Q 1Y8OB 1EY5A 5IE8A 2A6HD 3KDFB 3ONAB 3PIP3 4EQNA 4DR2L 2JA7H 4JI4L 4CKBA 2ICEC 4DGZA 2K32A 1EOTA 2WKCA 3MEFA 2VL6A 5IGFA 1EQRA 4POGA 1FL0A 4CGYB 4B3RQ 2ZTCA 4Y7NH 2X6GA 1SN8A 1LLRD 3SE0A 3DWPA 1EIGA 3VYTA 4OGQC 4J6HA 4KY6A 1EU4A 4A3MH 1YNJC 4OONA 2JE6I 2D0PA 3P1HA 1Y1WG 2B63H 1HUMA 1MJEA 1WCMB 3A8IE 1VDZA 2MP1A 4KJNA 1LTBD 4QB4A 1S5DD 3BS1A 4LF4Q 1QUQA 3FP9A 2RF4A 1A62A 1ASZA 1HZCA 2F0GA 4AIMA 2PO4A 2UXBQ 2ZJQA 1KNAA 2CH4A 4CJ1B 1TS2A 1JB7A 1JJGA 3S1QB 2ZTDA 4O42A 5K36H 1TR5A 1YHBA 2NVYH 3PUXA 3PQIA 5FOBB 3H15A 5IGGA 1EL0A 1CZGA 5FO8B 2WINB 1DOLA 3IKJA 1KRTA 1BXTA 2DJGC 2R7FA 3TDQA 3FPUB 3K5LA 4RFBA 4HIDA 2JA7G 1EY6A 4NW2A 3L2PA 4MTKA 4DUYQ 3D4WA 1L1OA 4IQZA 1TWAH 1EWCA 4DK6C 1HFGA 1V8QA 2MGSA 4JI1L 2GVAA 5GAHC 3KLSA 4IPDA 2F0VA 1XNQL 3J7A5 1FR3A 3NTIA 1A3VA 2HIXA 1HNZQ 3A54A 4BBSG 3CPWA 5FKAC 1VQFA 2ZJPA 2A6EC 5CR3A 1YJWA 4JI6Q 2F4VQ 1AZPA 5G3LD 5FLXc 1PYBA 1T5XD 1I94L 4RH6A 2RHQB 4DXGA 1F2YA 4NMZA 1S5ED 1RHPA 5HGTA 3I56A 1K8MA 1MI2A 1HQMC 2QDLA 3C46A 4APVA 2RCFA 2JA8G 2F0KA 1BNZA 3OWEB 3GTJB 1XX8A 1P16A 4ID6A 1XMQQ 1K73C 3E0JA 1HR0L 3J81c 2V1CC 2Y0SG 1FVIA 1GUOA 3CCVA 3SK8A 2BE5D 2E5LL 1BCPB 1Y1VG 2JA5H 1JE4A 3GV3A 1PRTF 2EYPA 4RCNA 5M3FG 1MBYA 1NJIC 2Z8LA 3FKIB 2IWHA 3TBIB 4U673 3B6YA 5CV6A 1Y1VH 3JAME 4L6TB 1OXUA 4WJ3M 4C3JH 2I5LX 3UDGA 1JWSD 2MUYA 3HP3A 1MD2D 3RNUA 3SHLA 1U4RA 2DGYA 5JVH3 1C7YA 2A68C 2QCPX 2V4DA 1ZXTA 4FNFA 3M4QA 1TQOA 3HOVH 3SDZA 5C4XG 5BN4A 2NVTB 4HTHA 2OWOA 2UUAL 5HURA 4HJ5A 1GO3E 3BU2A 2FFKB 3H3VI 1SXTA 1X32A 1NCVA 4ME5A 3GV6A 1YITA 3BVGA 1TT2A 4LF8Q 4JV5L 1KC8C 3E0EA 3SK5A 3TS2A 1BF4A 3HOXB 3C1FA 2JA8H 4OWWB 3IL8A 1VQ6A 3GTOB 5KEEA 4DR1Q 5FJ8H 1GOZA 3DEOA 3QOLA 5M5YH 4GZYC 4DR2Q 2PI2E 4GOPC 4L5SA 2R92B 4P72A 4R4TA 3J80L 1QNKA 5JOBA 3S24A 3K7AB 2Z6BA 2B2UA 4DAMA 3R2IA 1HRJA 1Q12A 2AWOA 4JK1C 1VQAA 2VB3X 1A3TA 1SNDA 2AQ2B 2RKSA 4P73A 3K5OA 4DK0A 5M5WH 4JI3Q 3E6ZX 1IBML 2ASBA 1PVOA 2NVQB 2OT2A 2E2DC 1V43A 1I4XA 4ZQ3A 3RN5A 4A3LH 5J3BA 2BE5C 4NXNQ 2UXDL 4LF6Q 1TWCH 1IXRA 2RQXA 5IODA 3RD4A 1BDOA 1VQDA 2MFIA 3NELA 1O78A 2NTTA 1JR0D 1NNXA 3BJUA 1DZ1A 1MJCA 4C3JG 4G7ZC 1EY4A 4A3JB 4IOAA 1E0BA 1F2LA 1I4RA 2ZXRA 3IRBA 3BZKA 1P8LA 3K81C 1LT6D 1XMOL 4DKAC 3S1MH 2OTJA 1LTAD 2PW7A 2PQAB 1B3AA 2A8VA 1G6ZA 1KHIA 2SDFA 2HQLA 2R93B 4BY7B 2OQ0A 4LF9Q 1LV9A 4BBRG 1LO5D 1V1QA 3BZDB 2IX3A 1J8IA 4K8JA 2D2CC 4QF4A 1PH3A 2EY5A 2RBMA 1S5FD 3CAMA 4X3SA 1QVCA 3SK4A 3I73A 3QR8A 3HOWG 4A3BH 5GROA 5IP9H 2Z9HA 5H1SE 2MHVA 4IFDH 1G91A 4RMFA 2KENA 3NQIA 4K5XA 1F77A 4LF6L 4NXNL 2UXDQ 1D1IA 3CQZB 4X6AH 4R4QA 4NXML 1K83B 1MGSA 3RLNA 4DF7A 3RUZA 1A6XA 5FLMG 3NTKA 1EIHA 3RMHA 2WB1G 4XTCS 4A3CG 3MFYA 3KF8A 1MKHA 2UUAQ 1UE5A 2QGQA 3H91A 2A74C 4IUQA 4FDBA 3I55A 1R9TB 4DV5L 3J80i 1S40A 4A93B 1S5BD 2B2TC 2MO1A 3WOFA 1VQ7A 2RVLA 1TWHB 1C4QA 2ZTEA 3ULLA 3GTPH 1V9PA 1XWEA 2EYMA 3SVMA 2CVRA 2IHEA 1H9MA 2N88A 4KKSA 4BY1G 2NTSA 3FMCA 1PH7A 2PZUA 1EZ8A 2PNRC 3H09A 2RSNA 4BY7H 1M90C 1IBMQ 1W6KA 2K01A 3OTOQ 4HSPA 2PQEA 5L37A 4IUNA 1EY9A 1YNXA 3EROA 1DD2A 2XGTA 1TWGH 3X3MA 1B2TA 5IIFA 1SR3A 3HZXA 2Q2HA 3M7NA 1HZAA 2F1MA 4FVMA 4A3BB 2B2TA 4NXMQ 1UE6A 2K04A 1RF2D 3U9SA 2R61A 1D5MC 3DM1A 3VR4A 5J22A 3RZDH 3HOYB 3OIPA 1IYUA 2L12A 4KKTA 1OXVA 1VQEA 4K6DA 3FVQA 4DAYB 3KK7A 3J81E 3PO2G 3EBEA 3QG1A 4C3HB 1G6PA 1ML0D 2WFWA 4A3MG 5KGUA 3D6WA 4KD4A 2IX1A 1UEAB 5EKLA 3LGJA 2F4VL 4JC0A 5ELFA 4UDUC 3QJYA 1K0RA 1N36L 4A3DH 1WJJA 1FGUA 1KAWA 3WDNA 2D9UA 1NMFA 2E2IB 3CMEA 1XNQQ 4OWTB 3PSIA 3Q8DA 4H44C 2X69A 5C0XJ 1L1OC 2B29A 2F52A 2VQEQ 3I4MG 3I4NG 1EYCA 4JBWA 2F0NA 3OW2A 2M9VA 5GAGC 2K4KA 4ZLTF 4JBJA 5C4ZA 1B44D 3M4PA 5M3FH 5E1FA 4XQQA 1W3SA 1U4MA 3FEWX 4JI2L 3UE1A 1XPUA 2EPBA 4FF4A 1XNRL 2IY5B 4CDFC 2WAQB 1E1OA 1NR2A 4RWSC 2KHJA 1AN8A 2FMMA 5I6WA 2VZAA 3ICEA 1AFPA 1GUTA 1EIYB 3CW2C 1SYBA 1W6JA 2WB1E 3S14H 5JPNC 2B8FA 2JXMB 1CFMA 3UDXA 2JSOA 2B2UC 1I3QB 1QB5D 3QB3A 4RGMA 5IWAQ 2R92H 4C2MH 3C3LA 2L11A 1E22A 1OXXK 1CQFA 4A3EB 1MSHA 4JI8Q 4B9XA 2C9OA 3HOUB 3T51B 4GN3B 4RHSA 2ZXOA 1PV4A 3CMAA 3U9OA 4BXXH 5LMNW 4KI0A 4A3IG 2LY7A 4CDEC 1ZEQX 4L5RC 2E2HB 3GQBA 4J8QA 1B8AA 1EY8A 3A5ZB 1IKMA 1RODA 4ZKBB 3ND8A 4I7AA 1ET9A 1Y8PB 5C5MA 1SSOA 3A56A 4DV6L 1EEID 5CBEE 3MC0B 4A3KB 1TS5A 4LJZC 2WV6D 3K80C 3K0XA 1HNXQ 1CKMA 1QE6A 2B3GA 4ZAIA 5I9PA 3GTGB 4OO1G 3ERSX 2N49A 4R8NA 4F7XA 4NPSA 5FO9B 4DXFA 3HOWH 1BUVT 1C0AA 1IHZA 4DV4Q 1FYCA 2Z0SA 1Q90A 3D0FA 1UUPA 3ULJA 4O1NA 3S2HB 3MTSA 2UU9L 1K8GA 4AYBG 1VMPA 2VUMG 3S14B 4KHVA 1CTMA 1HQRD 3U58A 4P2CB 1HTPA 3OOCA 4DR4Q 1IL8A 2B2VA 4K0KL 3HOZB 1TS4A 5BR8L 2F0IA 1I3QH 1Q46A 3I91A 2A69D 1WCMG 3TN2A 5C4XH 1PYWD 5A2QE 4DV5Q 1ICFB 1IBKL 4R9WA 2HDLA 4KV6A 1EFID 4KN7C 1TIID 4N9PA 1YIJA 4DV7L 2YTVA 1WVLA 1U0LA 3GTLH 3TP6A 1IW7D 4DV6Q 3PUZA 2D62A 1VF5C 3PV0A 5IGCA 2HT1A 1PH8A 2EYLA 5IYDG 3PO2H 2K50A 2Q2TA 2X6LA 3M4OH 3D4RA 1R4PB 1OXSC 3UDIA 2ENBA 3H94A 2K52A 4JI2Q 1HFNA 4LWCA 4OO1H 3MA2B 4A3IH 1B53A 2EY1A 1SROA 3RR5A 2BH8A 3KOJA 2RA4A 3TMEA 3AU7A 3GTKB 2F0LA 4Z9CB 2QEJC 2QDBA 5D3IB 4DNTB 4DV3Q 3EIVA 5LMNQ 1X65A 4TVAB 3HGBA 3M4YA 3D3RA 1JOQA 2JA6H 4NKLA 2EY6A 4B3SQ 1IYJB 2VW9A 1TU2B 4BA2I 1MSGA 2QW7A 3JAMc 5C44H 1E24A 3VDYA 4GNXC 1D5ZC 3PO3G 5EKKA 2XSCA 3I4NH 4KY5A 4BBSB 4DV1L 1CM9A 2XVSA 3J7YW 4A76A 1H9JA 1PTOC 2UXCQ 3PGZA 1HNWL 3OW7A 3VYRA 3JC66 1TWGB 2NN6H 5JVG3 5JJLA 3AFPA 1X6OA 2GN5A 1Q3LA 2HIVA 2O4XA 4Y7NB 3Q0AA 1K9MC 4IPCA 4TSSA 4ZUJA 1LTGD 4OWXB 1WTRA 1G8ZD 1GJXA 3TQYA 4YIJA 3MXNB 3Q24A 5EPKA 3CCJA 4CKCA 2H1EA 2RCNA 4F8MA 1STEA 5DEHA 1X9NA 4A3GH 1L2FA 3STBC 1WD0A 5JEAJ 4DV2L 4BBRH 4L63B 3HKSA 4XQNA 3J81j 4AQYQ 1CT1D 4HR7B 3N6RA 3VA7A 4C3IH 2CHBD 2JJQA 4WRDA 4DA2A 4AYBE 4L8JA 3X3NA 2P5ZX 2Z4HA 4GS3A 3S1QH 1KL9A 4QL5A 1SNPA 3NUCA 2NZHA 3ITPA 1LTID 3GTKH 4J15A 4B3MQ 1TWCB 2BOSA 3V96A 2VB2X 1HZBA 1Z9FA 2PPBC 5C4JH 1DM0B 2JA6B 3CF5A 1NTGA 2EXDA 1FNVA 1D5XC 2HDMA 2PCFB 5ELDA 4HJAA 1F9QA 1UEBA 1XPOA 1VQBA 4GKKQ 3F2BA 4DAYA 4RGNA 4JOIC 3RLFA 1RTNA 3GP7A 3R8BA 3CD6A 5C6AA 1TY2A 1EQVA 1PH6A 1R4QB 1WTQA 4N8X1 3CC4A 1IL2A 4L5TA 2XRQD 5LMNL 2PZWA
chains in the Genus database with same CATH topology
2IW3A 4G7OC 1H9RA 4QIWB 3V05A 3ND9A 4TQUS 5C0XH 3L3OC 2NBFA 1I6HB 2EJFC 1XTCD 3S1RB 1KLGD 4WJWA 5CGKA 4DK1A 1FNWA 5G3LF 1SBBB 2F0TA 2KVMA 5KYLA 1HCZA 2N55A 4C3IB 1SMYC 5FK9C 3V2TA 1WD1A 1K8OA 2OEOA 1EYDA 1H9SA 3VR5A 4XIGS 5E4XA 2JA5B 2K7VA 3I70A 1RCVD 4ZUIA 1AEXA 3KLSX 1KAAA 5EJWA 3Q6SA 1D2BA 1J9OA 1QILA 1CA6A 4E6IA 2NB0A 4HSVA 1CHPD 1STHA 1JB3A 5EQ0A 2EOTA 1OO9B 3HKZB 2NVYB 4PMCA 5CBAE 5I2XA 2IX0A 4MN3A 5CV8A 1PZJD 3UI2A 4LMQD 1G2TA 2B2WC 1I4GA 3VA5A 2EYHA 3I72A 5E4WC 2NN6G 2NZ1D 5DAUA 3T53B 4IFDI 4OL7A 1KTKA 3GO5A 1STYA 2F0JA 3CKIB 1GUNA 1DJRD 1U4LA 2QF7A 4ZK9B 2F0EA 5E3FA 3SXHA 3ERQA 4IALA 2KEEA 3MVVA 2Z1CA 3S16B 4CJ0B 2L1BA 2CW0C 4FXDA 1UAPA 1U9RA 3R3OA 2IJ0A 2F0WA 3VR3A 5C44B 1LT3D 2LMCB 1G291 5IT9L 5DM73 4KTAA 1V1OA 3RZOB 2PZTA 2K03A 4XT3B 3EA6A 1PFNA 1CZWA 3J7AV 3J81L 3QOJA 1SJED 1WTXA 1PLFA 1TWAB 3PUWA 4U68A 3HOVB 2B8GA 3I8ZA 4KD3A 1YNND 3BDCA 5A2QL 1FNUA 4XYOA 2JEBI 3SK6A 3S2DB 4HAEA 4BS9A 1SYDA 5KIXA 1SEBD 3NWTA 1OXTA 1JORA 5EPLA 3OSOA 2JA8B 2J0TD 2RSOA 3QIAA 4UAIA 3J80E 2B63B 1NSNS 1I6VC 2Y0SB 3K59A 4X3UA 3PUVA 3W2DA 3TP5A 2BDNA 3I3CA 2EDGA 1QWYA 2WACA 4G7HC 4B9WA 1ZYRC 4RCOA 2KQ3A 3S17B 4R8IA 1T5EA 3BDOA 4DFAA 2A5HA 2F4IA 1PMRA 1Z47A 4A3FB 3BVMA 4F88A 1UNSA 1A2TA 5C3EB 2ZT9C 1D6EC 2Z4IA 5A35A 2E75C 4OIJA 5C4XB 1EY7A 1X3PA 3MWYW 1JWUD 5FO7B 1Y69U 5LL6X 2XN9C 3A8KE 5EBDA 3H3VC 3L7ZC 1II3A 5EKIA 3OPOA 2HCIA 3MAQA 2L9HA 2RDGA 3LWEA 4C56C 3NXWA 4KN4C 1KDAA 2HCCA 4K8IA 5K5PA 3A7AB 3M4OB 4A3DB 2F0UA 1SFOB 5ISRA 1U4PA 2K33A 1I4PA 3AMUA 2F0SA 3TSSA 3G7LA 1FD7D 3GTMB 1ET6A 1F2ZA 1PFBA 1ENAA 3DUZA 1QCBD 1HTLD 5KRUA 4DAPA 4FF1A 1TY0A 2WKDA 4K6LA 4XXEA 5M5WB 1HUNA 2XWBB 1RKNA 4AYBB 1SNMA 1BCPF 2EY2A 4S3SA 3TZDA 1IKLA 3PMFA 5NUCA 2K5DA 1ESRA 1E2VA 2SOBA 1Y8NB 4HEDA 1KDBA 5CORA 4QUCA 5JAVA 3WOEA 3C2PA 4C3JB 1O7LA 3NBIA 5IOCA 2NVXB 3R2TA 3NP8A 5EBCA 2XRSD 1DXMA 1QOHA 4CKEA 2EYJA 3CU7A 1LTRD 3NTHA 4PNYA 2DN8A 2KECA 2F0DA 4BBRB 3K5MA 4N9TA 3CHBD 5BN5A 5KNBA 4EQPA 1ILQA 2BCOA 2Q8IB 5IGBA 2YYZA 1EEFD 5F2DA 3D6CA 4LK1C 1YNJD 4M1UB 2DNCA 4FYDA 3S9WA 2O5IC 1Y1WB 4RA8A 3IFTA 2KUMA 3FRPB 4MHEA 3MXGA 4FXKC 2EE1A 4HCSA 1CA5A 5IGDA 2EVBA 4HCEA 3T16A 1Q1BA 1EY0A 1A2UA 1SJHD 4H13C 2BDOA 4H0LC 2LFNA 4KK7A 4IFDJ 4F87A 4XT1B 1CK1A 2B39A 3MXUA 4EQOA 2A6ED 2G9HD 5T1IA 3QO2A 5D14A 2QILA 5EGTA 5ELEA 2XWJB 1PRTC 3VR6A 3P7JA 4PMBA 1JCKB 1AW7A 5K36G 3PO2B 2ID0A 4A3MB 1CQVA 4HN7A 1SNOA 1KLUD 1F9PA 1C48A 5C0XG 3EVQA 1BBXC 1S4ZA 4C2MB 1STNA 3C1EA 4XDXA 3D8GA 3TP7A 3T13A 2TSSA 1M8AA 2KCCA 1TWFB 3I90A 2DY7A 2JP1A 4RGTA 3NE5B 4DNRB 2IL8A 1B9MA 3I4NB 2AQ3B 4EVOA 2F0OA 2Q8TA 2K5QA 4NDXA 2FINB 2K1BA 3MXPA 1Y1VB 5COYA 2WP8J 5M3FB 4FXGC 1SMYD 4FP5D 4MIUA 3TP8A 1TVXA 1SYCA 3Q22A 1Z6HA 1LACA 1PZKD 2J4XA 4C3IG 3OMCA 4PQXA 1LABA 3HS0C 2FJ2A 4DU9A 4A3GB 1G2SA 3DXJC 3P75A 1GUSA 5CV9A 3H0GB 3Q23A 3K58A 1JOOA 1L0XB 3BVZA 2L0CA 1LTSD 4OHJA 2XNAC 5DM63 4RKLA 1TKWB 3JAML 3DMUA 4EGVA 1BOSA 3ZYYX 1RJTA 2ICIA 2E2JB 2AWNA 1TS3A 3BG3A 3GTLB 3QWNA 3P20A 3RZDB 1B50A 1ESFA 1SAPA 1GHJA 1SNCA 5ELBA 2CW0D 2KA7A 1NR4A 1B1ZA 4CHTB 1Q1EA 1VCIA 3IAYA 1PZID 4IUVA 5BN3A 5IT9E 1JOKA 1DOKA 4HMJA 2SNSA 5EPJA 2O5JC 3L9AX 5DNFA 5CYUA 4FO2A 2NWGA 3PIO3 5T1GA 2BA0A 3NSWA 4K14A 3G6JB 1AP0A 1IYVA 2B2VC 4DN4M 2VUMB 3OMGA 5C0XI 5FLXL 2B2YC 3NK9A 4XYQA 4IUTA 2EYOA 4H7BA 2GA4B 2EJMA 2NUCA 1C8CA 1Z7TA 3SEBA 1CI3M 2A69C 2LS01 4RAUC 5M5XB 1GXDC 1F9RA 3DHQA 3HG9A 3NBHA 3NQTA 2R7ZB 3M7GA 2C5CA 2RDFA 5FLXE 5M5YB 1GHKA 1GUGA 2AQ1B 4V0BA 2JEAI 2EZVA 3GTQB 3D31A 4LAAA 1LT4D 1KDCA 4PV1C 1STGA 1KABA 1QG7A 4B08A 4WFN3 1V1PA 1PXUA 3K5NA 2NN6I 2K6AA 1SE2A 1RDPD 4TKOB 5KYIA 3URYA 1F2MA 1IW7C 2F0FA 3VYUA 2WB1B 2F0PA 4WORA 5ELCA 3PO3B 1I4QA 4NP5A 2M2LA 5KNCA 4KJOA 3KBGA 1H9SB 2OXPA 1M4VA 4I7ZC 1A3UA 3BYTB 4IURA 3NHHA 1JWMD 3W3AA 3F2UA 4C1NI 1D1KA 2PW5A 2M00A 3E5SA 2EYFA 2K05A 4X3TA 1BR9A 3NWSA 1I4HA 4OO1I 1S5CD 3DWAA 1HXYD 3KLRA 4FF2A 3CRKC 2JA7B 4ULLA 2R6GA 4BWGB 5CMDA 1SE4A 4CJ2C 1SNQA 3K6OA 4XQJA 4C3HG 1VF7A 3KUPA 3MHBA 1BCPD 1EU3A 3K57A 2IT1A 5C3WA 2FMCA 1O7YA 3S15B 4G4KA 3SR1A 5I6YA 2KJXA 4FF3A 5J39A 1SYFA 2ZXPA 3CRLC 2VXWA 4BA1I 3GTPB 5IGEA 3OWFA 1H9KA 2O2LD 2F3VA 3I4MB 3H6MA 3MFGA 4KMUC 3I4LA 2J7ZA 2K28A 1RD9D 4QUFA 3T4AC 4K2LA 3EFXD 5C3XA 3MZ5A 1JICA 5I2YA 4DAVA 3MEHA 1PFMA 1EQTA 1LTTD 2TMPA 5C4HA 1DOMA 4M8AA 1EZ6A 3A8JE 2F0QA 3S1MB 2A73B 2FHTA 3T56B 3DWQA 2F0MA 3D4DA 2A68D 4ZRZA 5TSSA 5CC4A 1HHVA 2SNMA 1GUWA 5I9OA 1PDQA 5M9OA 3MXNA 1I50B 1B9NA 5LHY1 3BYYB 1F9SA 1LT5D 3K0YA 1ILPA 2HUGA 2L55A 4PMWA 2F03A 4ABNA 1CHQD 3J7AF 2G9DA 2KEDA 2MJ8A 4IZ8A 1ENCA 1WTOA 4V190 5CV5A 4K5VA 3R93A 1PTOB 2SEBD 1XYIA 1BCPC 3O13A 1E2WA 1O7ZA 2YU9B 1SYGA 1STBA 3FPPA 2RDHA 4ZKCB 5J1ZA 4I65A 1ZYRD 2L5TA 2KCNA 2E76C 2AUKA 2DY8A 4K5WA 4IFDG 5C5LA 3EQLC 1PRTB 3NPPA 1PTOD 1FGBD 1NUCA 4K2KA 3DEPA 5C4JB 3OIQA 5CV4A 2F3WA 5JEAG 1WTVA 1JC7A 2LKVA 5AFWA 3HOWB 4QCLA 5D65A 1E2ZA 4RGOS 4QMGA 3N52A 2EXZA 2Q8RE 1NAPA 5KNDA 2I46A 2VNUD 3BDLA 1Q8IA 4CBVA 4IN3A 2BA1A 5CV7A 1HA6A 3LWUA 1RTOA 2PMZB 1AZQA 4C1NK 3AB9A 2KHSA 1KNEA 2HQEA 4BY1B 1L0YB 1STAA 3OHXC 1A15A 4KKUA 5M3MB 4HMIA 1SDFA 2WIIB 4IUUA 1EWHA 2CQAA 2OF1A 1WTPA 4IUPA 1YNNC 1WTWA 2EJGC 2L4NA 1QNUA 1DYQA 1PTOF 1VMCA 2B2WA 4TRDA 4RKBA 5JEAH 1X3QA 4G57A 3KBXA 4KHZA 1JQYD 3IFDA 4RHRA 1SYEA 4KY7A 2XIWA 1SE3A 3M85A 5D3DA 3LNNA 2A6HC 1O80A 1EYAA 4J1MA 1DONA 2JYOA 3S1NB 2D5DA 1V1PB 3LX0A 5I4DA 4OIKA 1ENFA 2R3ZA 2MPMA 2NYZD 3A7LA 5LL6S 1ONLA 1HA5A 3PUYA 1BO0A 3EJIA 1ICWA 2IPKD 4Q5VA 3FDTA 2KOLA 2I07B 3HRZC 2QKIC 3M3YB 3A55A 3GD7A 1PRTD 2PYKA 1DCZA 2F0HA 1ZKOA 4ZYSA 4Q0FA 2H4OA 1B4OA 1PTOH 4X3KA 4A3IB 4ILWA 1XXGA 2AUJD 3HEJA 2E74C 3VR2A 5JJZA 1BQQT 2B2YA 2K5WA 5JPMC 1HPCA 2DNEA 3VYSA 4ODGA 1QJOA 3TZUA 1Y8OB 1EY5A 2A6HD 3ONAB 3PIP3 4EQNA 4CKBA 2ICEC 4DGZA 2K32A 1EOTA 2WKCA 5IGFA 4CGYB 2X6GA 1LLRD 3SE0A 3DWPA 1EIGA 3VYTA 4OGQC 4J6HA 4KY6A 1EU4A 1YNJC 2JE6I 3P1HA 1HUMA 1WCMB 3A8IE 1VDZA 2MP1A 4KJNA 1LTBD 4QB4A 1S5DD 3BS1A 2F0GA 2PO4A 1KNAA 4CJ1B 1TS2A 3S1QB 4O42A 5K36H 1TR5A 3PUXA 5FOBB 5IGGA 1EL0A 1CZGA 5FO8B 2WINB 1DOLA 3IKJA 1BXTA 3TDQA 3FPUB 3K5LA 4RFBA 1EY6A 4NW2A 3D4WA 4IQZA 1EWCA 1HFGA 1V8QA 2MGSA 3KLSA 2F0VA 1FR3A 3NTIA 1A3VA 3A54A 5FKAC 2A6EC 5CR3A 1AZPA 5G3LD 1T5XD 4RH6A 4DXGA 1F2YA 4NMZA 1S5ED 1RHPA 5HGTA 1K8MA 1MI2A 1HQMC 3C46A 2F0KA 1BNZA 3OWEB 3GTJB 1XX8A 4ID6A 3E0JA 1GUOA 3SK8A 2BE5D 1BCPB 1JE4A 3GV3A 1PRTF 2EYPA 4RCNA 1MBYA 2Z8LA 3FKIB 2IWHA 3TBIB 4U673 5CV6A 3JAME 4L6TB 1OXUA 1JWSD 2MUYA 3HP3A 1MD2D 3SHLA 1U4RA 5JVH3 2A68C 2QCPX 2V4DA 1ZXTA 4FNFA 1TQOA 3SDZA 5BN4A 2NVTB 4HTHA 5HURA 2FFKB 1SXTA 1X32A 1NCVA 4ME5A 3GV6A 3BVGA 1TT2A 3SK5A 1BF4A 3HOXB 3C1FA 3IL8A 3GTOB 5KEEA 1GOZA 3DEOA 3QOLA 4GZYC 2R92B 3J80L 1QNKA 5JOBA 3K7AB 2B2UA 3R2IA 1HRJA 1Q12A 2AWOA 4JK1C 2VB3X 1A3TA 1SNDA 2AQ2B 2RKSA 3K5OA 4DK0A 3E6ZX 2NVQB 2OT2A 2E2DC 1V43A 1I4XA 4ZQ3A 2BE5C 2RQXA 5IODA 3RD4A 1BDOA 1O78A 2NTTA 1JR0D 1DZ1A 4C3JG 4G7ZC 1EY4A 4A3JB 1E0BA 1F2LA 1I4RA 2ZXRA 1LT6D 1LTAD 2PW7A 1B3AA 1G6ZA 2SDFA 2R93B 4BY7B 1LV9A 1LO5D 3BZDB 2IX3A 1J8IA 4K8JA 2D2CC 4QF4A 2EY5A 2RBMA 1S5FD 4X3SA 3SK4A 3I73A 2MHVA 4IFDH 1G91A 3NQIA 4K5XA 1F77A 1D1IA 3CQZB 1K83B 1MGSA 4DF7A 3RUZA 1A6XA 3NTKA 1EIHA 3RMHA 4XTCS 3MFYA 3KF8A 3H91A 2A74C 4IUQA 1R9TB 4A93B 1S5BD 2B2TC 3WOFA 2RVLA 1TWHB 1C4QA 1XWEA 2EYMA 3SVMA 2CVRA 1H9MA 2N88A 4KKSA 2NTSA 3FMCA 2PZUA 1EZ8A 2PNRC 3H09A 2RSNA 1W6KA 2K01A 4HSPA 2PQEA 4IUNA 1EY9A 3EROA 1DD2A 3X3MA 1B2TA 5IIFA 3HZXA 3M7NA 4FVMA 2F1MA 4A3BB 2B2TA 2K04A 1RF2D 3U9SA 2R61A 1D5MC 3DM1A 3VR4A 5J22A 3HOYB 3OIPA 1IYUA 2L12A 4KKTA 1OXVA 4K6DA 3FVQA 3J81E 3KK7A 3QG1A 4C3HB 1ML0D 5KGUA 3D6WA 4KD4A 2IX1A 1UEAB 5EKLA 5ELFA 4UDUC 3QJYA 3WDNA 2D9UA 2E2IB 4H44C 2X69A 5C0XJ 1EYCA 4JBWA 2F0NA 2M9VA 4ZLTF 5C4ZA 1B44D 5E1FA 4XQQA 1U4MA 3FEWX 2EPBA 4FF4A 2WAQB 1NR2A 4RWSC 1AN8A 2FMMA 5I6WA 1AFPA 1GUTA 1SYBA 1W6JA 5JPNC 2B8FA 2JXMB 1CFMA 2JSOA 2B2UC 1I3QB 1QB5D 3QB3A 4RGMA 3C3LA 2L11A 1OXXK 1CQFA 4A3EB 1MSHA 4B9XA 2C9OA 3HOUB 3T51B 4RHSA 2ZXOA 3U9OA 4KI0A 2LY7A 1ZEQX 2E2HB 3GQBA 4J8QA 1EY8A 1IKMA 1RODA 4ZKBB 3ND8A 1ET9A 1Y8PB 5C5MA 1SSOA 3A56A 1EEID 5CBEE 3MC0B 4A3KB 1TS5A 4LJZC 2WV6D 1QE6A 4ZAIA 5I9PA 3GTGB 4OO1G 4R8NA 4F7XA 5FO9B 4DXFA 1BUVT 1IHZA 1FYCA 1Q90A 1UUPA 4O1NA 3S2HB 3MTSA 1VMPA 3S14B 4KHVA 1CTMA 1HQRD 1HTPA 3OOCA 4P2CB 1IL8A 2B2VA 3HOZB 1TS4A 2F0IA 3I91A 2A69D 3TN2A 5A2QE 1PYWD 4R9WA 2HDLA 4KV6A 1EFID 4KN7C 1TIID 4N9PA 1WVLA 3TP6A 1IW7D 3PUZA 2D62A 1VF5C 3PV0A 5IGCA 2EYLA 2X6LA 3D4RA 1R4PB 1OXSC 2ENBA 3H94A 1HFNA 4OO1H 3MA2B 1B53A 2EY1A 2RA4A 3TMEA 3AU7A 3GTKB 2F0LA 4Z9CB 2QEJC 2QDBA 5D3IB 4DNTB 3HGBA 3M4YA 3D3RA 1JOQA 2EY6A 4NKLA 1TU2B 4BA2I 1MSGA 1D5ZC 5EKKA 2XSCA 4KY5A 4BBSB 1CM9A 2XVSA 3J7YW 1H9JA 1PTOC 3OW7A 3VYRA 1TWGB 2NN6H 5JVG3 1Q3LA 2O4XA 4Y7NB 3Q0AA 4TSSA 4ZUJA 1LTGD 1WTRA 1G8ZD 1GJXA 4YIJA 3Q24A 5EPKA 4CKCA 2H1EA 4F8MA 1STEA 5DEHA 1WD0A 5JEAJ 4L63B 4XQNA 1CT1D 4HR7B 3N6RA 3VA7A 2CHBD 4WRDA 4DA2A 4L8JA 3X3NA 2Z4HA 1SNPA 3NUCA 3ITPA 1LTID 1TWCB 2BOSA 3V96A 2VB2X 2PPBC 1DM0B 2JA6B 1FNVA 1D5XC 2HDMA 2PCFB 5ELDA 1F9QA 4DAYA 4RGNA 3RLFA 1RTNA 3GP7A 3R8BA 5C6AA 1TY2A 1EQVA 1R4QB 1WTQA 2XRQD 2PZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXD C;  2B39 A;  4FXG C;  2TMP A;  1BR9 A;  3G6J B;  3CKI B;  1PXU A;  3V96 A;  2WII B;  2A74 C;  3FRP B;  5FOB B;  1D2B A;  2XWB B;  3KLS A;  4FXK C;  3L3O C;  2ICE C;  5FO7 B;  1UEA B;  4ILW A;  3HS0 C;  5FO8 B;  2WIN B;  2J0T D;  3CU7 A;  5JPN C;  5FO9 B;  2A73 B;  1BUV T;  1JB3 A;  3T4A C;  2I07 B;  2XWJ B;  3HRZ C;  2QKI C;  3I70 A;  1BQQ T;  1OO9 B;  3OHX C;  1XWE A;  5JPM C;  1JC7 A;  1UAP A;  2E2D C;  3MA2 B; 
#chains in the Genus database with same CATH topology
 2IW3 A;  4G7O C;  1H9R A;  1WI5 A;  2R93 H;  4QIW B;  3V05 A;  3CCR A;  3ND9 A;  4TQU S;  5C0X H;  4A3F H;  1X3E A;  3L3O C;  2NBF A;  4JBK A;  1I6H B;  2K14 A;  2EJF C;  1XTC D;  3S1R B;  1KLG D;  2ALY B;  4WJW A;  1QVF A;  5CGK A;  4H02 A;  2ATW A;  4DK1 A;  1FNW A;  3FHW A;  5G3L F;  1SBB B;  2F0T A;  2KVM A;  5KYL A;  2ZJR A;  1HCZ A;  2N55 A;  4C3I B;  1SMY C;  5FK9 C;  3V2T A;  4LFB L;  1WD1 A;  1K8O A;  2OEO A;  4A3G G;  1EYD A;  1B3Q A;  4BY1 H;  2DUD A;  3H0G G;  4JI3 L;  1H9S A;  3STB D;  3VR5 A;  4XIG S;  5E4X A;  4OXP A;  2JA5 B;  2K7V A;  3I70 A;  1RCV D;  4ZUI A;  1JT8 A;  1AEX A;  3CP0 A;  2D0O A;  3KLS X;  3GTG H;  4DPG A;  3GTM H;  1KAA A;  5EJW A;  3CCU A;  4YHH Q;  4DR3 Q;  3Q6S A;  1QZG A;  1D2B A;  1J9O A;  4UPA A;  1Q82 C;  1CSQ A;  1QIL A;  1CA6 A;  4E6I A;  2RHS B;  2NB0 A;  4HSV A;  1WFQ A;  1CHP D;  1STH A;  1JB3 A;  5EQ0 A;  2JK8 A;  5ELO A;  2EOT A;  1OO9 B;  3HKZ B;  3ZJY C;  2NVT H;  4HJ7 A;  2NVY B;  1PH9 A;  2YTX A;  4KHP L;  4PMC A;  4LUZ A;  3HOZ H;  1E1T A;  5CBA E;  2OQK A;  5I2X A;  1VQK A;  2IX0 A;  3I2Z A;  4MN3 A;  1VQH A;  5CV8 A;  1PZJ D;  3UI2 A;  4LMQ D;  3U4Z A;  5IYC G;  1G2T A;  2B2W C;  1I4G A;  2NVX H;  3VA5 A;  2EYH A;  3F2C A;  3I72 A;  3U50 C;  5E4W C;  2NN6 G;  1K0S A;  2NZ1 D;  2AMC B;  5DAU A;  3T53 B;  4IFD I;  1CUK A;  3DLL A;  4OL7 A;  1KTK A;  3GO5 A;  2OCE A;  1STY A;  2F0J A;  2VS1 A;  4HIO A;  3CKI B;  1GUN A;  1DJR D;  1U4L A;  2QF7 A;  4ZK9 B;  4HIM A;  3GTQ H;  1S3O A;  2F0E A;  5E3F A;  3SXH A;  3AEV A;  3ERQ A;  4DK3 C;  4LFA Q;  3KYH C;  4IAL A;  4DR5 Q;  2NVQ H;  1UE7 A;  2KEE A;  3MVV A;  4GKJ L;  2Z1C A;  3S16 B;  1YBY A;  1I50 H;  4CJ0 B;  2L1B A;  1RIP A;  2FXQ A;  2CW0 C;  4FXD A;  1UAP A;  1U9R A;  2C35 B;  3R3O A;  3RN2 A;  3GTJ H;  4DUZ L;  4YCU A;  1YJ9 A;  2IJ0 A;  1PH2 A;  4A3C H;  3F2D A;  3G6E A;  2F0W A;  3M3Y H;  2H5X A;  1Q81 C;  3VR3 A;  1LUZ A;  5C44 B;  2UXC L;  1LT3 D;  4JI8 L;  2LMC B;  1G29 1;  5IT9 L;  5DM7 3;  4KTA A;  3NBH B;  1V1O A;  3RZO B;  4LF7 L;  2PZT A;  3T1Y Q;  2K03 A;  4A4I A;  1J5E Q;  3PF4 A;  3HKZ E;  4N8F A;  4XT3 B;  2AKW B;  3EA6 A;  4GOP A;  1PFN A;  1CZW A;  3J7A V;  3J81 L;  3QOJ A;  1SJE D;  3HOY G;  1WTX A;  1PLF A;  1EIF A;  3J80 c;  4EX5 A;  1TWA B;  3PUW A;  4LUO A;  4U68 A;  1X54 A;  2B8G A;  5IYB G;  3I8Z A;  4IO9 A;  3HOV B;  4KD3 A;  1SMX A;  2KCM A;  1YNN D;  3BDC A;  5A2Q L;  1FNU A;  4XYO A;  2JEB I;  3SK6 A;  4O2D A;  3T1H L;  3S2D B;  4L5Q A;  4HAE A;  4BS9 A;  1SYD A;  5KIX A;  1VQ4 A;  1SEB D;  3NWT A;  1OXT A;  2E2H H;  1JOR A;  4JYA Q;  5EPL A;  3OSO A;  2JA8 B;  2J0T D;  2RSO A;  4DUY L;  3QIA A;  4UAI A;  4IPH A;  1N9W A;  3RLO A;  1GVP A;  3J80 E;  2B63 B;  1NSN S;  1I6V C;  2PI2 A;  2Y0S B;  5M3M G;  3K59 A;  4X3U A;  1R9T H;  3PUV A;  4JI7 L;  3W2D A;  3TP5 A;  2UUB Q;  3W5O A;  2BDN A;  3I3C A;  2EDG A;  2WAQ E;  1HJP A;  1QWY A;  2WAC A;  4G7H C;  4B9W A;  1ZYR C;  4RCO A;  2KQ3 A;  4DR4 L;  1VQ8 A;  3S17 B;  4R8I A;  1NY4 A;  1SLJ A;  1T5E A;  3BDO A;  4DFA A;  2F3I A;  2A5H A;  5JJK A;  2F4I A;  1PMR A;  1Z47 A;  4A3F B;  2Q2I A;  3BVM A;  1Y14 B;  4F88 A;  4JI1 Q;  1UNS A;  1A2T A;  1VQG A;  5C3E B;  1X55 A;  2ZT9 C;  1A8V A;  1D6E C;  4DV0 L;  2Z4I A;  5A35 A;  4RG1 A;  2E75 C;  4OIJ A;  5C4X B;  1EY7 A;  1X3P A;  4JG2 A;  3MWY W;  3PCO B;  1JWU D;  5FO7 B;  2LXJ A;  1Y69 U;  5LL6 X;  4P75 A;  2XN9 C;  3A8K E;  5EBD A;  3H3V C;  2Y0S E;  4KHP Q;  3L7Z C;  1II3 A;  5EKI A;  3OPO A;  4HJ8 A;  2HCI A;  3MAQ A;  2L9H A;  4CDD C;  4UY8 C;  2RDG A;  4DNI A;  3LWE A;  4C56 C;  3NXW A;  4KN4 C;  1KDA A;  3W1B A;  2HCC A;  2K5H A;  4A3L G;  4ME3 A;  4K8I A;  5K5P A;  3A7A B;  3HOX H;  3PIO A;  4NB3 A;  3M4O B;  1VS0 A;  4YHH L;  2R92 G;  4A3D B;  2F0U A;  1SFO B;  1VQ9 A;  5E7N A;  5ISR A;  4LF4 L;  1U4P A;  4ZCK A;  2K33 A;  1DGS A;  1I4P A;  3AMU A;  2F0S A;  2K5N A;  3TSS A;  3G7L A;  1FD7 D;  3GTM B;  1ET6 A;  1F2Z A;  1SRU A;  3K7A H;  4A3E H;  1PFB A;  2AHO B;  1ENA A;  2K75 A;  3DUZ A;  1QCB D;  4DV2 Q;  1X56 A;  1HH2 P;  1ASY A;  3TS0 A;  1HTL D;  5KRU A;  3KF6 B;  4X65 L;  4DAP A;  4FF1 A;  1TY0 A;  2WKD A;  4K6L A;  4XXE A;  4X64 Q;  5M5W B;  2XWB B;  1HUN A;  1XMO Q;  1VQJ A;  1RKN A;  4AYB B;  1SNM A;  1BCP F;  2EY2 A;  4S3S A;  3TZD A;  1IKL A;  2N3S A;  3PMF A;  1Q7Y C;  5NUC A;  2K5D A;  1ESR A;  1E2V A;  2SOB A;  4A3K H;  1Y8N B;  4HED A;  1KDB A;  5COR A;  1XNR Q;  4QUC A;  5JAV A;  3WOE A;  1HNW Q;  2CQO A;  3C2P A;  4C3J B;  1O7L A;  3NBI A;  5IOC A;  2NVX B;  3R2T A;  3NP8 A;  5EBC A;  4QGU A;  1K3R A;  2XRS D;  1DXM A;  1G51 A;  5IY0 A;  1QOH A;  1N8R C;  4B3T L;  5AJ3 Q;  3K8A A;  4O0A A;  4CKE A;  2EYJ A;  3CU7 A;  1LTR D;  3NTH A;  4PNY A;  4DV3 L;  2R93 G;  3KFU A;  4BY7 G;  4DR6 L;  2DN8 A;  2KEC A;  2F0D A;  3J81 i;  4BBR B;  3CCE A;  4LW1 A;  3K5M A;  4N9T A;  3CHB D;  2LSS A;  5BN5 A;  3K7U C;  5KNB A;  4EQP A;  1SFO H;  1ILQ A;  1XTD A;  2BCO A;  2Q8I B;  3CC2 A;  1J6Q A;  5IGB A;  1KXL A;  4HJ9 A;  4R1J A;  1N33 L;  4DR1 L;  2YYZ A;  1IZ6 A;  1EEF D;  2Z6K A;  4B3M L;  4LF5 L;  5F2D A;  3D6C A;  4LK1 C;  1YNJ D;  2L15 A;  4M1U B;  1K28 A;  5GAE C;  2DNC A;  4FYD A;  3S9W A;  2R7D A;  2O5I C;  3KJP A;  1VQP A;  1U5K A;  1GD7 A;  5IYB H;  1Y1W B;  4RA8 A;  2CFM A;  1EOV A;  3IFT A;  4QQB X;  2KUM A;  3FRP B;  2ZM6 L;  4MHE A;  3MXG A;  4FXK C;  2EE1 A;  5M3M H;  4HCS A;  1CA5 A;  5IGD A;  2EVB A;  4GLX A;  1S72 A;  3KLW A;  4HCE A;  3T16 A;  1TXY A;  5BR8 Q;  1EQQ A;  1Q1B A;  1EY0 A;  1A2U A;  4UHV A;  1SJH D;  4H13 C;  1FJG Q;  4H0L C;  2BDO A;  2LFN A;  4KK7 A;  1KRS A;  4PZ8 A;  4IFD J;  4F87 A;  1PHJ A;  1AH9 A;  4XT1 B;  1EYG A;  1CK1 A;  2B39 A;  3MXU A;  4EQO A;  1Q8K A;  2A6E D;  2G9H D;  5T1I A;  3QO2 A;  4LF8 L;  5D14 A;  4X66 Q;  1VQ5 A;  1XPR A;  2QIL A;  5EGT A;  4DV4 L;  5ELE A;  2KHI A;  4R4I A;  4BBS H;  1BBW A;  1EUJ A;  2XWJ B;  1L0W A;  3M9B A;  2BH2 A;  1PRT C;  3VR6 A;  5IYC H;  2MO0 A;  3P7J A;  4A3B G;  4PMB A;  1JCK B;  1AW7 A;  5K36 G;  3PO2 B;  1VQM A;  4LFC Q;  1KD1 C;  2ID0 A;  4LNQ A;  4A3M B;  1JMC A;  1CQV A;  3GTO H;  4HN7 A;  1SNO A;  2YU9 H;  1KLU D;  1F9P A;  1C48 A;  5C0X G;  3EVQ A;  1BBX C;  1S4Z A;  4C2M B;  1STN A;  3C1E A;  4XDX A;  3D8G A;  4DR3 L;  1YHA A;  1WTH A;  3TP7 A;  3T13 A;  4OEL B;  2TSS A;  4JPB W;  1M8A A;  2KCC A;  2UUB L;  1CSP A;  1TWF B;  3I90 A;  2DY7 A;  4BXX G;  3A0J A;  4LFC L;  2E5L Q;  2JP1 A;  4RGT A;  5IWA L;  4OX9 L;  3NE5 B;  4DNR B;  2IL8 A;  1B9M A;  1W2B A;  3I4N B;  2AQ3 B;  4EVO A;  1J5E L;  2F0O A;  2Q8T A;  2K5Q A;  4OX9 Q;  4NDX A;  2FIN B;  2K1B A;  1IBK Q;  3MXP A;  5LMU L;  1Y1V B;  5COY A;  2HHH L;  4PZ6 A;  2WP8 J;  5M3F B;  1N34 L;  4FXG C;  1SMY D;  1X3G A;  3FKI G;  4FP5 D;  4MIU A;  3TP8 A;  1TVX A;  4K0K Q;  1SYC A;  3Q22 A;  1Z6H A;  1LAC A;  1PZK D;  2J4X A;  4C3I G;  3OMC A;  4PQX A;  4DUZ Q;  1LAB A;  3HS0 C;  2FJ2 A;  4DU9 A;  4A3G B;  1G2S A;  3DXJ C;  3P75 A;  2VUM H;  1GUS A;  5CV9 A;  2VQE L;  3H0G B;  2JN4 A;  3Q23 A;  3K58 A;  1Q86 C;  1JOO A;  1L0X B;  3BVZ A;  2L0C A;  1AE2 A;  1PYS B;  1LTS D;  4OHJ A;  2XNA C;  4X62 Q;  5DM6 3;  1VQC A;  1JJ2 A;  4RKL A;  4DR5 L;  1QUQ B;  1TKW B;  3JAM L;  3DMU A;  4EGV A;  1QZH A;  1BOS A;  3ZYY X;  1RJT A;  2ICI A;  4JI0 Q;  2E2J B;  2AWN A;  1TS3 A;  1MIU A;  3BG3 A;  3GTL B;  3QWN A;  3P20 A;  3RZD B;  2R7Z H;  1B50 A;  1ESF A;  1SAP A;  1GHJ A;  2OTL A;  4MNO A;  4B3R L;  1SNC A;  4UP9 A;  5ELB A;  2NZO A;  2CW0 D;  2KA7 A;  4JI0 L;  4OEM B;  1NR4 A;  3NEN A;  1O7I A;  1I5F A;  1B1Z A;  4CHT B;  1Q1E A;  1VCI A;  3IAY A;  1PZI D;  4IUV A;  5BN3 A;  5IT9 E;  1JOK A;  1DOK A;  4LFA L;  4HMJ A;  2A19 A;  2SNS A;  4AH6 A;  1LYL A;  2Z6K C;  4JVZ A;  5EPJ A;  2O5J C;  3L9A X;  5DNF A;  5CYU A;  5AJ3 L;  5IP7 H;  4FO2 A;  2NWG A;  3PIO 3;  1YI2 A;  1I6H H;  4DR7 Q;  5T1G A;  1M1K C;  1PH5 A;  2BA0 A;  3NSW A;  3TRZ A;  4K14 A;  3G6J B;  1AP0 A;  1IYV A;  2B2V C;  4A75 A;  4DN4 M;  2VUM B;  3OMG A;  1CKN B;  1FJG L;  5C0X I;  3G71 A;  5EAY A;  4Y52 H;  5FLX L;  1N33 Q;  2B2Y C;  3NK9 A;  4XYQ A;  4IUT A;  4JI4 Q;  2EYO A;  4H7B A;  2GA4 B;  2EJM A;  1GKH A;  2NUC A;  1C8C A;  1Z7T A;  3SEB A;  2ZM6 Q;  4A3J G;  1CI3 M;  2A69 C;  2LS0 1;  4RAU C;  4HIK A;  5M5X B;  2MQH A;  1GXD C;  1F9R A;  3DHQ A;  1WYD A;  1EWI A;  2GVB A;  3HG9 A;  3NBH A;  3NQT A;  1D8L A;  2R7Z B;  3M7G A;  2C5C A;  2RDF A;  3BZC A;  1NBW A;  3ER0 A;  5FLX E;  5M5Y B;  1GHK A;  1GUG A;  4C3H H;  2AQ1 B;  5FJ8 G;  4YY3 L;  3EN2 A;  4V0B A;  2JEA I;  4YWM A;  2EZV A;  3GTQ B;  5JJI A;  2UUC Q;  3D31 A;  4LAA A;  1LT4 D;  1KDC A;  1PA6 A;  4PV1 C;  1STG A;  1KAB A;  2I5H A;  1HNZ L;  3AQQ A;  1QG7 A;  4B08 A;  4WFN 3;  1V1P A;  1PXU A;  3G4S A;  3K5N A;  2NN6 I;  2K6A A;  1SE2 A;  1RDP D;  4TKO B;  5KYI A;  3URY A;  1F2M A;  4GN4 B;  1IW7 C;  2F0F A;  1JJC B;  3VYU A;  2WB1 B;  2F0P A;  4WOR A;  4X65 Q;  3PIP A;  5ELC A;  3J7Z C;  3PO3 B;  1I4Q A;  4NP5 A;  2M2L A;  5KNC A;  3F1Z A;  4KJO A;  3KBG A;  1H9S B;  2OXP A;  1M4V A;  4I7Z C;  4DV7 Q;  1A3U A;  3WWV A;  3E3X A;  1H95 A;  3OTO L;  2K5V A;  4QJF A;  1TWH H;  3BYT B;  4IUR A;  4A93 G;  3NHH A;  1B70 B;  1JWM D;  3W3A A;  1BKB A;  5GQO A;  3F2U A;  4R4C A;  3E9H A;  4C1N I;  1D1K A;  3HFZ B;  4GNX B;  5DLQ E;  2PW5 A;  2QA4 A;  2M00 A;  3E5S A;  2EYF A;  2K05 A;  4X3T A;  3KJO A;  4IOC A;  1YHQ A;  2B63 G;  2PMZ E;  1BR9 A;  3S1R H;  3NWS A;  1I4H A;  3S16 H;  4OO1 I;  1S5C D;  3DWA A;  1HXY D;  3KLR A;  4FF2 A;  3CRK C;  2JA7 B;  4ULL A;  2G5D A;  2R6G A;  4BWG B;  5CMD A;  1SE4 A;  4CJ2 C;  1SNQ A;  1K83 H;  1PH1 A;  3K6O A;  2CKZ B;  4A3F G;  4XQJ A;  4C3H G;  1BVS A;  1VF7 A;  2QEX A;  3KUP A;  3MHB A;  1BCP D;  1EU3 A;  2IT1 A;  2YTY A;  5C3W A;  3K57 A;  2FMC A;  3CCL A;  1O7Y A;  3NEM A;  4YWK A;  3S15 B;  4G4K A;  4GOP B;  2UUC L;  3FKI H;  3SR1 A;  4JOI A;  5I6Y A;  2KJX A;  2PQA A;  2LXK A;  4FF3 A;  2CWA A;  4AQY L;  5J39 A;  1SYF A;  2ZXP A;  3CRL C;  1OTC A;  4X62 L;  4DV0 Q;  2VXW A;  4BA1 I;  1KIX A;  2I0Q A;  5IGE A;  3GTP B;  3OWF A;  1H9K A;  2O2L D;  2F3V A;  3I4M B;  3H6M A;  3MFG A;  4KMU C;  3I4L A;  3A5U A;  2J7Z A;  3KF6 A;  2K28 A;  1RD9 D;  4QUF A;  3T4A C;  4K2L A;  3EFX D;  4ALP A;  4UP7 A;  1SE8 A;  5C3X A;  1X3F A;  4GN5 A;  1B7Y B;  3E9I A;  2WAQ G;  3MZ5 A;  1JIC A;  1N34 Q;  5I2Y A;  4DAV A;  3MEH A;  2E8G A;  2HHH Q;  1PFM A;  4YCW A;  1EQT A;  4LUV A;  1LTT D;  2TMP A;  4MTN A;  4DV1 Q;  5C4H A;  4JI7 Q;  1JE5 A;  2E2J H;  1DOM A;  2ES2 A;  4M8A A;  1VQO A;  4DR7 L;  1EZ6 A;  4A3J H;  3A8J E;  4JBM A;  2F0Q A;  3S1M B;  2A73 B;  2FHT A;  3T56 B;  3OYY A;  3DWQ A;  3S1N H;  4JCV E;  2F0M A;  2JA5 G;  4JYA L;  3D4D A;  2JQO A;  5ELN A;  2A68 D;  5IT9 c;  1IBL Q;  2CH4 W;  2EIF A;  4ZRZ A;  5TSS A;  5CC4 A;  4LF7 Q;  1HHV A;  4A3E G;  4P71 A;  1I94 Q;  1N36 Q;  3S15 H;  2SNM A;  3T1H Q;  1GUW A;  5I9O A;  4WJ4 A;  3CXC A;  4GNX A;  1PDQ A;  3G48 A;  5M9O A;  3MXN A;  1I50 B;  3HOU G;  1B9N A;  5IP7 G;  5LHY 1;  3TRE A;  4YY3 Q;  5HY6 A;  3HOX G;  3BYY B;  1MHW C;  1F9S A;  4JV5 Q;  1LT5 D;  3KDF A;  3K0Y A;  2N8N A;  3TEH B;  1ILP A;  2HUG A;  3HKZ G;  2YV5 A;  2L55 A;  4PMW A;  2F03 A;  1NMG A;  4ABN A;  1CHQ D;  3CQZ H;  3J7A F;  4A3K G;  2G9D A;  1KQS A;  2KED A;  2MJ8 A;  3UDF A;  2MNA A;  4IZ8 A;  1ENC A;  1WTO A;  2CWP A;  5IP9 G;  2KBN A;  4V19 0;  5CV5 A;  4K5V A;  3AYH B;  4MZ9 A;  3R93 A;  1PTO B;  2SEB D;  4POF A;  1T9H A;  1XYI A;  1BCP C;  3O13 A;  1RL2 A;  4A93 H;  1E7Z A;  1E2W A;  1NE3 A;  4KLK A;  1O7Z A;  1UE1 A;  2UU9 Q;  2YU9 B;  1SYG A;  1STB A;  3FPP A;  2RDH A;  3L0O A;  3W1G A;  4ZKC B;  3ULP A;  1VQI A;  3HOZ G;  5J1Z A;  3CCM A;  4I65 A;  1ZYR D;  2L5T A;  2KCN A;  3CCS A;  2E76 C;  1PH4 A;  2AUK A;  1HR0 W;  3CPF A;  1LTL A;  1HR0 Q;  1YJN A;  2DY8 A;  1HNX L;  1XMQ L;  4R4O A;  4K5W A;  2A1A A;  4IFD G;  5C5L A;  3EQL C;  4IJL A;  2Q2U A;  4PZ7 A;  1PRT B;  3GDE A;  5GAD C;  4PG3 A;  3NPP A;  3I7F A;  4LF5 Q;  1VQN A;  1PTO D;  5FLM H;  1FGB D;  1NUC A;  4K2K A;  5C44 G;  3PO3 H;  3DEP A;  5C4J B;  1WCM H;  3OIQ A;  5CV4 A;  4JI6 L;  2F3W A;  5JEA G;  1BBU A;  5LMU Q;  1WTV A;  1K3B C;  2HD3 A;  1JC7 A;  2LKV A;  5AFW A;  3HOW B;  4QCL A;  4UP8 A;  2EQS A;  5D65 A;  1E2Z A;  4RGO S;  2VQF Q;  1IBL L;  3RZO H;  4QMG A;  3S2H H;  1YVC A;  4LF9 L;  3N52 A;  2EXZ A;  2Q8R E;  1NAP A;  2XTI A;  5KND A;  2I46 A;  2VNU D;  1E3P A;  3HOV G;  4GLA C;  3UE0 A;  2VY3 A;  3BDL A;  1Q8I A;  1AE3 A;  4CBV A;  4IN3 A;  2BA1 A;  5CV7 A;  1HA6 A;  3LWU A;  1RTO A;  2PMZ B;  3S2D H;  1A0I A;  4GLV B;  1AZQ A;  4C1N K;  3AB9 A;  3PF5 A;  2KCT A;  2KHS A;  1KNE A;  2UXB L;  3A74 A;  2HQE A;  4BY1 B;  3SGI A;  1CKO A;  1L0Y B;  1STA A;  3OHX C;  1A15 A;  4GKJ Q;  4KKU A;  5M3M B;  4IPG A;  4HMI A;  4QY7 A;  1SDF A;  2WII B;  4IUU A;  1EWH A;  2CQA A;  2OF1 A;  4GKK L;  1WTP A;  4IUP A;  1YNN C;  1WTW A;  4X66 L;  1UWV A;  2EJG C;  2L4N A;  2IHF A;  1N32 L;  1QNU A;  1DYQ A;  1PTO F;  1TWF H;  3I4O A;  2CCZ A;  1VMC A;  1PFS A;  1K8A C;  1YEZ A;  2B2W A;  3I4M H;  4TRD A;  4RKB A;  5JEA H;  5C3E G;  2JA6 G;  1X3Q A;  3CC7 A;  4G57 A;  4JI5 L;  3KBX A;  4KHZ A;  1JQY D;  3IFD A;  3AFQ A;  4RHR A;  1SYE A;  4P74 A;  3CCQ A;  5M5X H;  4KY7 A;  2XIW A;  3KF8 B;  1EFW A;  1QVG A;  1SE3 A;  3M85 A;  5D3D A;  3LNN A;  2A6H C;  1O80 A;  1HZ9 A;  1XJV A;  1EYA A;  4QIW E;  1VQL A;  3F8T A;  1WOC A;  4J1M A;  1DON A;  2JYO A;  3S1N B;  2D5D A;  1A63 A;  4A3D G;  4CDC C;  1V1P B;  3LX0 A;  2JA9 A;  1GM5 A;  1N32 Q;  2DJF C;  4YWL A;  5I4D A;  4OIK A;  1ENF A;  2R3Z A;  2MPM A;  2NYZ D;  3HOU H;  1CKN A;  3A7L A;  4DR6 Q;  5LL6 S;  4EQ5 A;  1ONL A;  4X64 L;  1HA5 A;  4B3S L;  3PUY A;  1BO0 A;  4LFB Q;  3EJI A;  3HOY H;  1ICW A;  1L1O B;  2IPK D;  4Q5V A;  3FDT A;  2KOL A;  2N78 A;  2PNH A;  1C9O A;  2I07 B;  3HRZ C;  2QKI C;  1Y1W H;  3M3Y B;  3A55 A;  3DM3 A;  3GD7 A;  3H3V H;  1PRT D;  1LM0 A;  1DCZ A;  2PYK A;  2F0H A;  1ZKO A;  2I5M X;  4ZYS A;  4Q0F A;  3S17 H;  2H4O A;  4IJH A;  1B4O A;  1PTO H;  3H0G H;  4X3K A;  2E2I H;  1D7Q A;  4YCV A;  4A3I B;  4ILW A;  1XXG A;  3U4V A;  2AUJ D;  3HEJ A;  5HGQ A;  2R7Z G;  5IYD H;  4JW0 A;  2E74 C;  3VR2 A;  5C3E H;  4B3T Q;  5JJZ A;  1BQQ T;  2B2Y A;  2K5W A;  5JPM C;  1HPC A;  3JAM i;  2DNE A;  3VYS A;  2VQF L;  1YZ6 A;  3T1Y L;  4ODG A;  1QJO A;  3TZU A;  4JI5 Q;  1Y8O B;  1EY5 A;  5IE8 A;  2A6H D;  3KDF B;  3ONA B;  3PIP 3;  4EQN A;  4DR2 L;  2JA7 H;  4JI4 L;  4CKB A;  2ICE C;  4DGZ A;  2K32 A;  1EOT A;  2WKC A;  3MEF A;  2VL6 A;  5IGF A;  1EQR A;  4POG A;  1FL0 A;  4CGY B;  4B3R Q;  2ZTC A;  4Y7N H;  2X6G A;  1SN8 A;  1LLR D;  3SE0 A;  3DWP A;  1EIG A;  3VYT A;  4OGQ C;  4J6H A;  4KY6 A;  1EU4 A;  4A3M H;  1YNJ C;  4OON A;  2JE6 I;  2D0P A;  3P1H A;  1Y1W G;  2B63 H;  1HUM A;  1MJE A;  1WCM B;  3A8I E;  1VDZ A;  2MP1 A;  4KJN A;  1LTB D;  4QB4 A;  1S5D D;  3BS1 A;  4LF4 Q;  1QUQ A;  3FP9 A;  2RF4 A;  1A62 A;  1ASZ A;  1HZC A;  2F0G A;  4AIM A;  2PO4 A;  2UXB Q;  2ZJQ A;  1KNA A;  2CH4 A;  4CJ1 B;  1TS2 A;  1JB7 A;  1JJG A;  3S1Q B;  2ZTD A;  4O42 A;  5K36 H;  1TR5 A;  1YHB A;  2NVY H;  3PUX A;  3PQI A;  5FOB B;  3H15 A;  5IGG A;  1EL0 A;  1CZG A;  5FO8 B;  2WIN B;  1DOL A;  3IKJ A;  1KRT A;  1BXT A;  2DJG C;  2R7F A;  3TDQ A;  3FPU B;  3K5L A;  4RFB A;  4HID A;  2JA7 G;  1EY6 A;  4NW2 A;  3L2P A;  4MTK A;  4DUY Q;  3D4W A;  1L1O A;  4IQZ A;  1TWA H;  1EWC A;  4DK6 C;  1HFG A;  1V8Q A;  2MGS A;  4JI1 L;  2GVA A;  5GAH C;  3KLS A;  4IPD A;  2F0V A;  1XNQ L;  3J7A 5;  1FR3 A;  3NTI A;  1A3V A;  2HIX A;  1HNZ Q;  3A54 A;  4BBS G;  3CPW A;  5FKA C;  1VQF A;  2ZJP A;  2A6E C;  5CR3 A;  1YJW A;  4JI6 Q;  2F4V Q;  1AZP A;  5G3L D;  5FLX c;  1PYB A;  1T5X D;  1I94 L;  4RH6 A;  2RHQ B;  4DXG A;  1F2Y A;  4NMZ A;  1S5E D;  1RHP A;  5HGT A;  3I56 A;  1K8M A;  1MI2 A;  1HQM C;  2QDL A;  3C46 A;  4APV A;  2RCF A;  2JA8 G;  2F0K A;  1BNZ A;  3OWE B;  3GTJ B;  1XX8 A;  1P16 A;  4ID6 A;  1XMQ Q;  1K73 C;  3E0J A;  1HR0 L;  3J81 c;  2V1C C;  2Y0S G;  1FVI A;  1GUO A;  3CCV A;  3SK8 A;  2BE5 D;  2E5L L;  1BCP B;  1Y1V G;  2JA5 H;  1JE4 A;  3GV3 A;  1PRT F;  2EYP A;  4RCN A;  5M3F G;  1MBY A;  1NJI C;  2Z8L A;  3FKI B;  2IWH A;  3TBI B;  4U67 3;  3B6Y A;  5CV6 A;  1Y1V H;  3JAM E;  4L6T B;  1OXU A;  4WJ3 M;  4C3J H;  2I5L X;  3UDG A;  1JWS D;  2MUY A;  3HP3 A;  1MD2 D;  3RNU A;  3SHL A;  1U4R A;  2DGY A;  5JVH 3;  1C7Y A;  2A68 C;  2QCP X;  2V4D A;  1ZXT A;  4FNF A;  3M4Q A;  1TQO A;  3HOV H;  3SDZ A;  5C4X G;  5BN4 A;  2NVT B;  4HTH A;  2OWO A;  2UUA L;  5HUR A;  4HJ5 A;  1GO3 E;  3BU2 A;  2FFK B;  3H3V I;  1SXT A;  1X32 A;  1NCV A;  4ME5 A;  3GV6 A;  1YIT A;  3BVG A;  1TT2 A;  4LF8 Q;  4JV5 L;  1KC8 C;  3E0E A;  3SK5 A;  3TS2 A;  1BF4 A;  3HOX B;  3C1F A;  2JA8 H;  4OWW B;  3IL8 A;  1VQ6 A;  3GTO B;  5KEE A;  4DR1 Q;  5FJ8 H;  1GOZ A;  3DEO A;  3QOL A;  5M5Y H;  4GZY C;  4DR2 Q;  2PI2 E;  4GOP C;  4L5S A;  2R92 B;  4P72 A;  4R4T A;  3J80 L;  1QNK A;  5JOB A;  3S24 A;  3K7A B;  2Z6B A;  2B2U A;  4DAM A;  3R2I A;  1HRJ A;  1Q12 A;  2AWO A;  4JK1 C;  1VQA A;  2VB3 X;  1A3T A;  1SND A;  2AQ2 B;  2RKS A;  4P73 A;  3K5O A;  4DK0 A;  5M5W H;  4JI3 Q;  3E6Z X;  1IBM L;  2ASB A;  1PVO A;  2NVQ B;  2OT2 A;  2E2D C;  1V43 A;  1I4X A;  4ZQ3 A;  3RN5 A;  4A3L H;  5J3B A;  2BE5 C;  4NXN Q;  2UXD L;  4LF6 Q;  1TWC H;  1IXR A;  2RQX A;  5IOD A;  3RD4 A;  1BDO A;  1VQD A;  2MFI A;  3NEL A;  1O78 A;  2NTT A;  1JR0 D;  1NNX A;  3BJU A;  1DZ1 A;  1MJC A;  4C3J G;  4G7Z C;  1EY4 A;  4A3J B;  4IOA A;  1E0B A;  1F2L A;  1I4R A;  2ZXR A;  3IRB A;  3BZK A;  1P8L A;  3K81 C;  1LT6 D;  1XMO L;  4DKA C;  3S1M H;  2OTJ A;  1LTA D;  2PW7 A;  2PQA B;  1B3A A;  2A8V A;  1G6Z A;  1KHI A;  2SDF A;  2HQL A;  2R93 B;  4BY7 B;  2OQ0 A;  4LF9 Q;  1LV9 A;  4BBR G;  1LO5 D;  1V1Q A;  3BZD B;  2IX3 A;  1J8I A;  4K8J A;  2D2C C;  4QF4 A;  1PH3 A;  2EY5 A;  2RBM A;  1S5F D;  3CAM A;  4X3S A;  1QVC A;  3SK4 A;  3I73 A;  3QR8 A;  3HOW G;  4A3B H;  5GRO A;  5IP9 H;  2Z9H A;  5H1S E;  2MHV A;  4IFD H;  1G91 A;  4RMF A;  2KEN A;  3NQI A;  4K5X A;  1F77 A;  4LF6 L;  4NXN L;  2UXD Q;  1D1I A;  3CQZ B;  4X6A H;  4R4Q A;  4NXM L;  1K83 B;  1MGS A;  3RLN A;  4DF7 A;  3RUZ A;  1A6X A;  5FLM G;  3NTK A;  1EIH A;  3RMH A;  2WB1 G;  4XTC S;  4A3C G;  3MFY A;  3KF8 A;  1MKH A;  2UUA Q;  1UE5 A;  2QGQ A;  3H91 A;  2A74 C;  4IUQ A;  4FDB A;  3I55 A;  1R9T B;  4DV5 L;  3J80 i;  1S40 A;  4A93 B;  1S5B D;  2B2T C;  2MO1 A;  3WOF A;  1VQ7 A;  2RVL A;  1TWH B;  1C4Q A;  2ZTE A;  3ULL A;  3GTP H;  1V9P A;  1XWE A;  2EYM A;  3SVM A;  2CVR A;  2IHE A;  1H9M A;  2N88 A;  4KKS A;  4BY1 G;  2NTS A;  3FMC A;  1PH7 A;  2PZU A;  1EZ8 A;  2PNR C;  3H09 A;  2RSN A;  4BY7 H;  1M90 C;  1IBM Q;  1W6K A;  2K01 A;  3OTO Q;  4HSP A;  2PQE A;  5L37 A;  4IUN A;  1EY9 A;  1YNX A;  3ERO A;  1DD2 A;  2XGT A;  1TWG H;  3X3M A;  1B2T A;  5IIF A;  1SR3 A;  3HZX A;  2Q2H A;  3M7N A;  1HZA A;  2F1M A;  4FVM A;  4A3B B;  2B2T A;  4NXM Q;  1UE6 A;  2K04 A;  1RF2 D;  3U9S A;  2R61 A;  1D5M C;  3DM1 A;  3VR4 A;  5J22 A;  3RZD H;  3HOY B;  3OIP A;  1IYU A;  2L12 A;  4KKT A;  1OXV A;  1VQE A;  4K6D A;  3FVQ A;  4DAY B;  3KK7 A;  3J81 E;  3PO2 G;  3EBE A;  3QG1 A;  4C3H B;  1G6P A;  1ML0 D;  2WFW A;  4A3M G;  5KGU A;  3D6W A;  4KD4 A;  2IX1 A;  1UEA B;  5EKL A;  3LGJ A;  2F4V L;  4JC0 A;  5ELF A;  4UDU C;  3QJY A;  1K0R A;  1N36 L;  4A3D H;  1WJJ A;  1FGU A;  1KAW A;  3WDN A;  2D9U A;  1NMF A;  2E2I B;  3CME A;  1XNQ Q;  4OWT B;  3PSI A;  3Q8D A;  4H44 C;  2X69 A;  5C0X J;  1L1O C;  2B29 A;  2F52 A;  2VQE Q;  3I4M G;  3I4N G;  1EYC A;  4JBW A;  2F0N A;  3OW2 A;  2M9V A;  5GAG C;  2K4K A;  4ZLT F;  4JBJ A;  5C4Z A;  1B44 D;  3M4P A;  5M3F H;  5E1F A;  4XQQ A;  1W3S A;  1U4M A;  3FEW X;  4JI2 L;  3UE1 A;  1XPU A;  2EPB A;  4FF4 A;  1XNR L;  2IY5 B;  4CDF C;  2WAQ B;  1E1O A;  1NR2 A;  4RWS C;  2KHJ A;  1AN8 A;  2FMM A;  5I6W A;  2VZA A;  3ICE A;  1AFP A;  1GUT A;  1EIY B;  3CW2 C;  1SYB A;  1W6J A;  2WB1 E;  3S14 H;  5JPN C;  2B8F A;  2JXM B;  1CFM A;  3UDX A;  2JSO A;  2B2U C;  1I3Q B;  1QB5 D;  3QB3 A;  4RGM A;  5IWA Q;  2R92 H;  4C2M H;  3C3L A;  2L11 A;  1E22 A;  1OXX K;  1CQF A;  4A3E B;  1MSH A;  4JI8 Q;  4B9X A;  2C9O A;  3HOU B;  3T51 B;  4GN3 B;  4RHS A;  2ZXO A;  1PV4 A;  3CMA A;  3U9O A;  4BXX H;  5LMN W;  4KI0 A;  4A3I G;  2LY7 A;  4CDE C;  1ZEQ X;  4L5R C;  2E2H B;  3GQB A;  4J8Q A;  1B8A A;  1EY8 A;  3A5Z B;  1IKM A;  1ROD A;  4ZKB B;  3ND8 A;  4I7A A;  1ET9 A;  1Y8P B;  5C5M A;  1SSO A;  3A56 A;  4DV6 L;  1EEI D;  5CBE E;  3MC0 B;  4A3K B;  1TS5 A;  4LJZ C;  2WV6 D;  3K80 C;  3K0X A;  1HNX Q;  1CKM A;  1QE6 A;  2B3G A;  4ZAI A;  5I9P A;  3GTG B;  4OO1 G;  3ERS X;  2N49 A;  4R8N A;  4F7X A;  4NPS A;  5FO9 B;  4DXF A;  3HOW H;  1BUV T;  1C0A A;  1IHZ A;  4DV4 Q;  1FYC A;  2Z0S A;  1Q90 A;  3D0F A;  1UUP A;  3ULJ A;  4O1N A;  3S2H B;  3MTS A;  2UU9 L;  1K8G A;  4AYB G;  1VMP A;  2VUM G;  3S14 B;  4KHV A;  1CTM A;  1HQR D;  3U58 A;  4P2C B;  1HTP A;  3OOC A;  4DR4 Q;  1IL8 A;  2B2V A;  4K0K L;  3HOZ B;  1TS4 A;  5BR8 L;  2F0I A;  1I3Q H;  1Q46 A;  3I91 A;  2A69 D;  1WCM G;  3TN2 A;  5C4X H;  1PYW D;  5A2Q E;  4DV5 Q;  1ICF B;  1IBK L;  4R9W A;  2HDL A;  4KV6 A;  1EFI D;  4KN7 C;  1TII D;  4N9P A;  1YIJ A;  4DV7 L;  2YTV A;  1WVL A;  1U0L A;  3GTL H;  3TP6 A;  1IW7 D;  4DV6 Q;  3PUZ A;  2D62 A;  1VF5 C;  3PV0 A;  5IGC A;  2HT1 A;  1PH8 A;  2EYL A;  5IYD G;  3PO2 H;  2K50 A;  2Q2T A;  2X6L A;  3M4O H;  3D4R A;  1R4P B;  1OXS C;  3UDI A;  2ENB A;  3H94 A;  2K52 A;  4JI2 Q;  1HFN A;  4LWC A;  4OO1 H;  3MA2 B;  4A3I H;  1B53 A;  2EY1 A;  1SRO A;  3RR5 A;  2BH8 A;  3KOJ A;  2RA4 A;  3TME A;  3AU7 A;  3GTK B;  2F0L A;  4Z9C B;  2QEJ C;  2QDB A;  5D3I B;  4DNT B;  4DV3 Q;  3EIV A;  5LMN Q;  1X65 A;  4TVA B;  3HGB A;  3M4Y A;  3D3R A;  1JOQ A;  2JA6 H;  4NKL A;  2EY6 A;  4B3S Q;  1IYJ B;  2VW9 A;  1TU2 B;  4BA2 I;  1MSG A;  2QW7 A;  3JAM c;  5C44 H;  1E24 A;  3VDY A;  4GNX C;  1D5Z C;  3PO3 G;  5EKK A;  2XSC A;  3I4N H;  4KY5 A;  4BBS B;  4DV1 L;  1CM9 A;  2XVS A;  3J7Y W;  4A76 A;  1H9J A;  1PTO C;  2UXC Q;  3PGZ A;  1HNW L;  3OW7 A;  3VYR A;  3JC6 6;  1TWG B;  2NN6 H;  5JVG 3;  5JJL A;  3AFP A;  1X6O A;  2GN5 A;  1Q3L A;  2HIV A;  2O4X A;  4Y7N B;  3Q0A A;  1K9M C;  4IPC A;  4TSS A;  4ZUJ A;  1LTG D;  4OWX B;  1WTR A;  1G8Z D;  1GJX A;  3TQY A;  4YIJ A;  3MXN B;  3Q24 A;  5EPK A;  3CCJ A;  4CKC A;  2H1E A;  2RCN A;  4F8M A;  1STE A;  5DEH A;  1X9N A;  4A3G H;  1L2F A;  3STB C;  1WD0 A;  5JEA J;  4DV2 L;  4BBR H;  4L63 B;  3HKS A;  4XQN A;  3J81 j;  4AQY Q;  1CT1 D;  4HR7 B;  3N6R A;  3VA7 A;  4C3I H;  2CHB D;  2JJQ A;  4WRD A;  4DA2 A;  4AYB E;  4L8J A;  3X3N A;  2P5Z X;  2Z4H A;  4GS3 A;  3S1Q H;  1KL9 A;  4QL5 A;  1SNP A;  3NUC A;  2NZH A;  3ITP A;  1LTI D;  3GTK H;  4J15 A;  4B3M Q;  1TWC B;  2BOS A;  3V96 A;  2VB2 X;  1HZB A;  1Z9F A;  2PPB C;  5C4J H;  1DM0 B;  2JA6 B;  3CF5 A;  1NTG A;  2EXD A;  1FNV A;  1D5X C;  2HDM A;  2PCF B;  5ELD A;  4HJA A;  1F9Q A;  1UEB A;  1XPO A;  1VQB A;  4GKK Q;  3F2B A;  4DAY A;  4RGN A;  4JOI C;  3RLF A;  1RTN A;  3GP7 A;  3R8B A;  3CD6 A;  5C6A A;  1TY2 A;  1EQV A;  1PH6 A;  1R4Q B;  1WTQ A;  4N8X 1;  3CC4 A;  1IL2 A;  4L5T A;  2XRQ D;  5LMN L;  2PZW A; 
#chains in the Genus database with same CATH homology
 2IW3 A;  4G7O C;  1H9R A;  4QIW B;  3V05 A;  3ND9 A;  4TQU S;  5C0X H;  3L3O C;  2NBF A;  1I6H B;  2EJF C;  1XTC D;  3S1R B;  1KLG D;  4WJW A;  5CGK A;  4DK1 A;  1FNW A;  5G3L F;  1SBB B;  2F0T A;  2KVM A;  5KYL A;  1HCZ A;  2N55 A;  4C3I B;  1SMY C;  5FK9 C;  3V2T A;  1WD1 A;  1K8O A;  2OEO A;  1EYD A;  1H9S A;  3VR5 A;  4XIG S;  5E4X A;  2JA5 B;  2K7V A;  3I70 A;  1RCV D;  4ZUI A;  1AEX A;  3KLS X;  1KAA A;  5EJW A;  3Q6S A;  1D2B A;  1J9O A;  1QIL A;  1CA6 A;  4E6I A;  2NB0 A;  4HSV A;  1CHP D;  1STH A;  1JB3 A;  5EQ0 A;  2EOT A;  1OO9 B;  3HKZ B;  2NVY B;  4PMC A;  5CBA E;  5I2X A;  2IX0 A;  4MN3 A;  5CV8 A;  1PZJ D;  3UI2 A;  4LMQ D;  1G2T A;  2B2W C;  1I4G A;  3VA5 A;  2EYH A;  3I72 A;  5E4W C;  2NN6 G;  2NZ1 D;  5DAU A;  3T53 B;  4IFD I;  4OL7 A;  1KTK A;  3GO5 A;  1STY A;  2F0J A;  3CKI B;  1GUN A;  1DJR D;  1U4L A;  2QF7 A;  4ZK9 B;  2F0E A;  5E3F A;  3SXH A;  3ERQ A;  4IAL A;  2KEE A;  3MVV A;  2Z1C A;  3S16 B;  4CJ0 B;  2L1B A;  2CW0 C;  4FXD A;  1UAP A;  1U9R A;  3R3O A;  2IJ0 A;  2F0W A;  3VR3 A;  5C44 B;  1LT3 D;  2LMC B;  1G29 1;  5IT9 L;  5DM7 3;  4KTA A;  1V1O A;  3RZO B;  2PZT A;  2K03 A;  4XT3 B;  3EA6 A;  1PFN A;  1CZW A;  3J7A V;  3J81 L;  3QOJ A;  1SJE D;  1WTX A;  1PLF A;  1TWA B;  3PUW A;  4U68 A;  3HOV B;  2B8G A;  3I8Z A;  4KD3 A;  1YNN D;  3BDC A;  5A2Q L;  1FNU A;  4XYO A;  2JEB I;  3SK6 A;  3S2D B;  4HAE A;  4BS9 A;  1SYD A;  5KIX A;  1SEB D;  3NWT A;  1OXT A;  1JOR A;  5EPL A;  3OSO A;  2JA8 B;  2J0T D;  2RSO A;  3QIA A;  4UAI A;  3J80 E;  2B63 B;  1NSN S;  1I6V C;  2Y0S B;  3K59 A;  4X3U A;  3PUV A;  3W2D A;  3TP5 A;  2BDN A;  3I3C A;  2EDG A;  1QWY A;  2WAC A;  4G7H C;  4B9W A;  1ZYR C;  4RCO A;  2KQ3 A;  3S17 B;  4R8I A;  1T5E A;  3BDO A;  4DFA A;  2A5H A;  2F4I A;  1PMR A;  1Z47 A;  4A3F B;  3BVM A;  4F88 A;  1UNS A;  1A2T A;  5C3E B;  2ZT9 C;  1D6E C;  2Z4I A;  5A35 A;  2E75 C;  4OIJ A;  5C4X B;  1EY7 A;  1X3P A;  3MWY W;  1JWU D;  5FO7 B;  1Y69 U;  5LL6 X;  2XN9 C;  3A8K E;  5EBD A;  3H3V C;  3L7Z C;  1II3 A;  5EKI A;  3OPO A;  2HCI A;  3MAQ A;  2L9H A;  2RDG A;  3LWE A;  4C56 C;  3NXW A;  4KN4 C;  1KDA A;  2HCC A;  4K8I A;  5K5P A;  3A7A B;  3M4O B;  4A3D B;  2F0U A;  1SFO B;  5ISR A;  1U4P A;  2K33 A;  1I4P A;  3AMU A;  2F0S A;  3TSS A;  3G7L A;  1FD7 D;  3GTM B;  1ET6 A;  1F2Z A;  1PFB A;  1ENA A;  3DUZ A;  1QCB D;  1HTL D;  5KRU A;  4DAP A;  4FF1 A;  1TY0 A;  2WKD A;  4K6L A;  4XXE A;  5M5W B;  1HUN A;  2XWB B;  1RKN A;  4AYB B;  1SNM A;  1BCP F;  2EY2 A;  4S3S A;  3TZD A;  1IKL A;  3PMF A;  5NUC A;  2K5D A;  1ESR A;  1E2V A;  2SOB A;  1Y8N B;  4HED A;  1KDB A;  5COR A;  4QUC A;  5JAV A;  3WOE A;  3C2P A;  4C3J B;  1O7L A;  3NBI A;  5IOC A;  2NVX B;  3R2T A;  3NP8 A;  5EBC A;  2XRS D;  1DXM A;  1QOH A;  4CKE A;  2EYJ A;  3CU7 A;  1LTR D;  3NTH A;  4PNY A;  2DN8 A;  2KEC A;  2F0D A;  4BBR B;  3K5M A;  4N9T A;  3CHB D;  5BN5 A;  5KNB A;  4EQP A;  1ILQ A;  2BCO A;  2Q8I B;  5IGB A;  2YYZ A;  1EEF D;  5F2D A;  3D6C A;  4LK1 C;  1YNJ D;  4M1U B;  2DNC A;  4FYD A;  3S9W A;  2O5I C;  1Y1W B;  4RA8 A;  3IFT A;  2KUM A;  3FRP B;  4MHE A;  3MXG A;  4FXK C;  2EE1 A;  4HCS A;  1CA5 A;  5IGD A;  2EVB A;  4HCE A;  3T16 A;  1Q1B A;  1EY0 A;  1A2U A;  1SJH D;  4H13 C;  2BDO A;  4H0L C;  2LFN A;  4KK7 A;  4IFD J;  4F87 A;  4XT1 B;  1CK1 A;  2B39 A;  3MXU A;  4EQO A;  2A6E D;  2G9H D;  5T1I A;  3QO2 A;  5D14 A;  2QIL A;  5EGT A;  5ELE A;  2XWJ B;  1PRT C;  3VR6 A;  3P7J A;  4PMB A;  1JCK B;  1AW7 A;  5K36 G;  3PO2 B;  2ID0 A;  4A3M B;  1CQV A;  4HN7 A;  1SNO A;  1KLU D;  1F9P A;  1C48 A;  5C0X G;  3EVQ A;  1BBX C;  1S4Z A;  4C2M B;  1STN A;  3C1E A;  4XDX A;  3D8G A;  3TP7 A;  3T13 A;  2TSS A;  1M8A A;  2KCC A;  1TWF B;  3I90 A;  2DY7 A;  2JP1 A;  4RGT A;  3NE5 B;  4DNR B;  2IL8 A;  1B9M A;  3I4N B;  2AQ3 B;  4EVO A;  2F0O A;  2Q8T A;  2K5Q A;  4NDX A;  2FIN B;  2K1B A;  3MXP A;  1Y1V B;  5COY A;  2WP8 J;  5M3F B;  4FXG C;  1SMY D;  4FP5 D;  4MIU A;  3TP8 A;  1TVX A;  1SYC A;  3Q22 A;  1Z6H A;  1LAC A;  1PZK D;  2J4X A;  4C3I G;  3OMC A;  4PQX A;  1LAB A;  3HS0 C;  2FJ2 A;  4DU9 A;  4A3G B;  1G2S A;  3DXJ C;  3P75 A;  1GUS A;  5CV9 A;  3H0G B;  3Q23 A;  3K58 A;  1JOO A;  1L0X B;  3BVZ A;  2L0C A;  1LTS D;  4OHJ A;  2XNA C;  5DM6 3;  4RKL A;  1TKW B;  3JAM L;  3DMU A;  4EGV A;  1BOS A;  3ZYY X;  1RJT A;  2ICI A;  2E2J B;  2AWN A;  1TS3 A;  3BG3 A;  3GTL B;  3QWN A;  3P20 A;  3RZD B;  1B50 A;  1ESF A;  1SAP A;  1GHJ A;  1SNC A;  5ELB A;  2CW0 D;  2KA7 A;  1NR4 A;  1B1Z A;  4CHT B;  1Q1E A;  1VCI A;  3IAY A;  1PZI D;  4IUV A;  5BN3 A;  5IT9 E;  1JOK A;  1DOK A;  4HMJ A;  2SNS A;  5EPJ A;  2O5J C;  3L9A X;  5DNF A;  5CYU A;  4FO2 A;  2NWG A;  3PIO 3;  5T1G A;  2BA0 A;  3NSW A;  4K14 A;  3G6J B;  1AP0 A;  1IYV A;  2B2V C;  4DN4 M;  2VUM B;  3OMG A;  5C0X I;  5FLX L;  2B2Y C;  3NK9 A;  4XYQ A;  4IUT A;  2EYO A;  4H7B A;  2GA4 B;  2EJM A;  2NUC A;  1C8C A;  1Z7T A;  3SEB A;  1CI3 M;  2A69 C;  2LS0 1;  4RAU C;  5M5X B;  1GXD C;  1F9R A;  3DHQ A;  3HG9 A;  3NBH A;  3NQT A;  2R7Z B;  3M7G A;  2C5C A;  2RDF A;  5FLX E;  5M5Y B;  1GHK A;  1GUG A;  2AQ1 B;  4V0B A;  2JEA I;  2EZV A;  3GTQ B;  3D31 A;  4LAA A;  1LT4 D;  1KDC A;  4PV1 C;  1STG A;  1KAB A;  1QG7 A;  4B08 A;  4WFN 3;  1V1P A;  1PXU A;  3K5N A;  2NN6 I;  2K6A A;  1SE2 A;  1RDP D;  4TKO B;  5KYI A;  3URY A;  1F2M A;  1IW7 C;  2F0F A;  3VYU A;  2WB1 B;  2F0P A;  4WOR A;  5ELC A;  3PO3 B;  1I4Q A;  4NP5 A;  2M2L A;  5KNC A;  4KJO A;  3KBG A;  1H9S B;  2OXP A;  1M4V A;  4I7Z C;  1A3U A;  3BYT B;  4IUR A;  3NHH A;  1JWM D;  3W3A A;  3F2U A;  4C1N I;  1D1K A;  2PW5 A;  2M00 A;  3E5S A;  2EYF A;  2K05 A;  4X3T A;  1BR9 A;  3NWS A;  1I4H A;  4OO1 I;  1S5C D;  3DWA A;  1HXY D;  3KLR A;  4FF2 A;  3CRK C;  2JA7 B;  4ULL A;  2R6G A;  4BWG B;  5CMD A;  1SE4 A;  4CJ2 C;  1SNQ A;  3K6O A;  4XQJ A;  4C3H G;  1VF7 A;  3KUP A;  3MHB A;  1BCP D;  1EU3 A;  3K57 A;  2IT1 A;  5C3W A;  2FMC A;  1O7Y A;  3S15 B;  4G4K A;  3SR1 A;  5I6Y A;  2KJX A;  4FF3 A;  5J39 A;  1SYF A;  2ZXP A;  3CRL C;  2VXW A;  4BA1 I;  3GTP B;  5IGE A;  3OWF A;  1H9K A;  2O2L D;  2F3V A;  3I4M B;  3H6M A;  3MFG A;  4KMU C;  3I4L A;  2J7Z A;  2K28 A;  1RD9 D;  4QUF A;  3T4A C;  4K2L A;  3EFX D;  5C3X A;  3MZ5 A;  1JIC A;  5I2Y A;  4DAV A;  3MEH A;  1PFM A;  1EQT A;  1LTT D;  2TMP A;  5C4H A;  1DOM A;  4M8A A;  1EZ6 A;  3A8J E;  2F0Q A;  3S1M B;  2A73 B;  2FHT A;  3T56 B;  3DWQ A;  2F0M A;  3D4D A;  2A68 D;  4ZRZ A;  5TSS A;  5CC4 A;  1HHV A;  2SNM A;  1GUW A;  5I9O A;  1PDQ A;  5M9O A;  3MXN A;  1I50 B;  1B9N A;  5LHY 1;  3BYY B;  1F9S A;  1LT5 D;  3K0Y A;  1ILP A;  2HUG A;  2L55 A;  4PMW A;  2F03 A;  4ABN A;  1CHQ D;  3J7A F;  2G9D A;  2KED A;  2MJ8 A;  4IZ8 A;  1ENC A;  1WTO A;  4V19 0;  5CV5 A;  4K5V A;  3R93 A;  1PTO B;  2SEB D;  1XYI A;  1BCP C;  3O13 A;  1E2W A;  1O7Z A;  2YU9 B;  1SYG A;  1STB A;  3FPP A;  2RDH A;  4ZKC B;  5J1Z A;  4I65 A;  1ZYR D;  2L5T A;  2KCN A;  2E76 C;  2AUK A;  2DY8 A;  4K5W A;  4IFD G;  5C5L A;  3EQL C;  1PRT B;  3NPP A;  1PTO D;  1FGB D;  1NUC A;  4K2K A;  3DEP A;  5C4J B;  3OIQ A;  5CV4 A;  2F3W A;  5JEA G;  1WTV A;  1JC7 A;  2LKV A;  5AFW A;  3HOW B;  4QCL A;  5D65 A;  1E2Z A;  4RGO S;  4QMG A;  3N52 A;  2EXZ A;  2Q8R E;  1NAP A;  5KND A;  2I46 A;  2VNU D;  3BDL A;  1Q8I A;  4CBV A;  4IN3 A;  2BA1 A;  5CV7 A;  1HA6 A;  3LWU A;  1RTO A;  2PMZ B;  1AZQ A;  4C1N K;  3AB9 A;  2KHS A;  1KNE A;  2HQE A;  4BY1 B;  1L0Y B;  1STA A;  3OHX C;  1A15 A;  4KKU A;  5M3M B;  4HMI A;  1SDF A;  2WII B;  4IUU A;  1EWH A;  2CQA A;  2OF1 A;  1WTP A;  4IUP A;  1YNN C;  1WTW A;  2EJG C;  2L4N A;  1QNU A;  1DYQ A;  1PTO F;  1VMC A;  2B2W A;  4TRD A;  4RKB A;  5JEA H;  1X3Q A;  4G57 A;  3KBX A;  4KHZ A;  1JQY D;  3IFD A;  4RHR A;  1SYE A;  4KY7 A;  2XIW A;  1SE3 A;  3M85 A;  5D3D A;  3LNN A;  2A6H C;  1O80 A;  1EYA A;  4J1M A;  1DON A;  2JYO A;  3S1N B;  2D5D A;  1V1P B;  3LX0 A;  5I4D A;  4OIK A;  1ENF A;  2R3Z A;  2MPM A;  2NYZ D;  3A7L A;  5LL6 S;  1ONL A;  1HA5 A;  3PUY A;  1BO0 A;  3EJI A;  1ICW A;  2IPK D;  4Q5V A;  3FDT A;  2KOL A;  2I07 B;  3HRZ C;  2QKI C;  3M3Y B;  3A55 A;  3GD7 A;  1PRT D;  2PYK A;  1DCZ A;  2F0H A;  1ZKO A;  4ZYS A;  4Q0F A;  2H4O A;  1B4O A;  1PTO H;  4X3K A;  4A3I B;  4ILW A;  1XXG A;  2AUJ D;  3HEJ A;  2E74 C;  3VR2 A;  5JJZ A;  1BQQ T;  2B2Y A;  2K5W A;  5JPM C;  1HPC A;  2DNE A;  3VYS A;  4ODG A;  1QJO A;  3TZU A;  1Y8O B;  1EY5 A;  2A6H D;  3ONA B;  3PIP 3;  4EQN A;  4CKB A;  2ICE C;  4DGZ A;  2K32 A;  1EOT A;  2WKC A;  5IGF A;  4CGY B;  2X6G A;  1LLR D;  3SE0 A;  3DWP A;  1EIG A;  3VYT A;  4OGQ C;  4J6H A;  4KY6 A;  1EU4 A;  1YNJ C;  2JE6 I;  3P1H A;  1HUM A;  1WCM B;  3A8I E;  1VDZ A;  2MP1 A;  4KJN A;  1LTB D;  4QB4 A;  1S5D D;  3BS1 A;  2F0G A;  2PO4 A;  1KNA A;  4CJ1 B;  1TS2 A;  3S1Q B;  4O42 A;  5K36 H;  1TR5 A;  3PUX A;  5FOB B;  5IGG A;  1EL0 A;  1CZG A;  5FO8 B;  2WIN B;  1DOL A;  3IKJ A;  1BXT A;  3TDQ A;  3FPU B;  3K5L A;  4RFB A;  1EY6 A;  4NW2 A;  3D4W A;  4IQZ A;  1EWC A;  1HFG A;  1V8Q A;  2MGS A;  3KLS A;  2F0V A;  1FR3 A;  3NTI A;  1A3V A;  3A54 A;  5FKA C;  2A6E C;  5CR3 A;  1AZP A;  5G3L D;  1T5X D;  4RH6 A;  4DXG A;  1F2Y A;  4NMZ A;  1S5E D;  1RHP A;  5HGT A;  1K8M A;  1MI2 A;  1HQM C;  3C46 A;  2F0K A;  1BNZ A;  3OWE B;  3GTJ B;  1XX8 A;  4ID6 A;  3E0J A;  1GUO A;  3SK8 A;  2BE5 D;  1BCP B;  1JE4 A;  3GV3 A;  1PRT F;  2EYP A;  4RCN A;  1MBY A;  2Z8L A;  3FKI B;  2IWH A;  3TBI B;  4U67 3;  5CV6 A;  3JAM E;  4L6T B;  1OXU A;  1JWS D;  2MUY A;  3HP3 A;  1MD2 D;  3SHL A;  1U4R A;  5JVH 3;  2A68 C;  2QCP X;  2V4D A;  1ZXT A;  4FNF A;  1TQO A;  3SDZ A;  5BN4 A;  2NVT B;  4HTH A;  5HUR A;  2FFK B;  1SXT A;  1X32 A;  1NCV A;  4ME5 A;  3GV6 A;  3BVG A;  1TT2 A;  3SK5 A;  1BF4 A;  3HOX B;  3C1F A;  3IL8 A;  3GTO B;  5KEE A;  1GOZ A;  3DEO A;  3QOL A;  4GZY C;  2R92 B;  3J80 L;  1QNK A;  5JOB A;  3K7A B;  2B2U A;  3R2I A;  1HRJ A;  1Q12 A;  2AWO A;  4JK1 C;  2VB3 X;  1A3T A;  1SND A;  2AQ2 B;  2RKS A;  3K5O A;  4DK0 A;  3E6Z X;  2NVQ B;  2OT2 A;  2E2D C;  1V43 A;  1I4X A;  4ZQ3 A;  2BE5 C;  2RQX A;  5IOD A;  3RD4 A;  1BDO A;  1O78 A;  2NTT A;  1JR0 D;  1DZ1 A;  4C3J G;  4G7Z C;  1EY4 A;  4A3J B;  1E0B A;  1F2L A;  1I4R A;  2ZXR A;  1LT6 D;  1LTA D;  2PW7 A;  1B3A A;  1G6Z A;  2SDF A;  2R93 B;  4BY7 B;  1LV9 A;  1LO5 D;  3BZD B;  2IX3 A;  1J8I A;  4K8J A;  2D2C C;  4QF4 A;  2EY5 A;  2RBM A;  1S5F D;  4X3S A;  3SK4 A;  3I73 A;  2MHV A;  4IFD H;  1G91 A;  3NQI A;  4K5X A;  1F77 A;  1D1I A;  3CQZ B;  1K83 B;  1MGS A;  4DF7 A;  3RUZ A;  1A6X A;  3NTK A;  1EIH A;  3RMH A;  4XTC S;  3MFY A;  3KF8 A;  3H91 A;  2A74 C;  4IUQ A;  1R9T B;  4A93 B;  1S5B D;  2B2T C;  3WOF A;  2RVL A;  1TWH B;  1C4Q A;  1XWE A;  2EYM A;  3SVM A;  2CVR A;  1H9M A;  2N88 A;  4KKS A;  2NTS A;  3FMC A;  2PZU A;  1EZ8 A;  2PNR C;  3H09 A;  2RSN A;  1W6K A;  2K01 A;  4HSP A;  2PQE A;  4IUN A;  1EY9 A;  3ERO A;  1DD2 A;  3X3M A;  1B2T A;  5IIF A;  3HZX A;  3M7N A;  4FVM A;  2F1M A;  4A3B B;  2B2T A;  2K04 A;  1RF2 D;  3U9S A;  2R61 A;  1D5M C;  3DM1 A;  3VR4 A;  5J22 A;  3HOY B;  3OIP A;  1IYU A;  2L12 A;  4KKT A;  1OXV A;  4K6D A;  3FVQ A;  3J81 E;  3KK7 A;  3QG1 A;  4C3H B;  1ML0 D;  5KGU A;  3D6W A;  4KD4 A;  2IX1 A;  1UEA B;  5EKL A;  5ELF A;  4UDU C;  3QJY A;  3WDN A;  2D9U A;  2E2I B;  4H44 C;  2X69 A;  5C0X J;  1EYC A;  4JBW A;  2F0N A;  2M9V A;  4ZLT F;  5C4Z A;  1B44 D;  5E1F A;  4XQQ A;  1U4M A;  3FEW X;  2EPB A;  4FF4 A;  2WAQ B;  1NR2 A;  4RWS C;  1AN8 A;  2FMM A;  5I6W A;  1AFP A;  1GUT A;  1SYB A;  1W6J A;  5JPN C;  2B8F A;  2JXM B;  1CFM A;  2JSO A;  2B2U C;  1I3Q B;  1QB5 D;  3QB3 A;  4RGM A;  3C3L A;  2L11 A;  1OXX K;  1CQF A;  4A3E B;  1MSH A;  4B9X A;  2C9O A;  3HOU B;  3T51 B;  4RHS A;  2ZXO A;  3U9O A;  4KI0 A;  2LY7 A;  1ZEQ X;  2E2H B;  3GQB A;  4J8Q A;  1EY8 A;  1IKM A;  1ROD A;  4ZKB B;  3ND8 A;  1ET9 A;  1Y8P B;  5C5M A;  1SSO A;  3A56 A;  1EEI D;  5CBE E;  3MC0 B;  4A3K B;  1TS5 A;  4LJZ C;  2WV6 D;  1QE6 A;  4ZAI A;  5I9P A;  3GTG B;  4OO1 G;  4R8N A;  4F7X A;  5FO9 B;  4DXF A;  1BUV T;  1IHZ A;  1FYC A;  1Q90 A;  1UUP A;  4O1N A;  3S2H B;  3MTS A;  1VMP A;  3S14 B;  4KHV A;  1CTM A;  1HQR D;  1HTP A;  3OOC A;  4P2C B;  1IL8 A;  2B2V A;  3HOZ B;  1TS4 A;  2F0I A;  3I91 A;  2A69 D;  3TN2 A;  5A2Q E;  1PYW D;  4R9W A;  2HDL A;  4KV6 A;  1EFI D;  4KN7 C;  1TII D;  4N9P A;  1WVL A;  3TP6 A;  1IW7 D;  3PUZ A;  2D62 A;  1VF5 C;  3PV0 A;  5IGC A;  2EYL A;  2X6L A;  3D4R A;  1R4P B;  1OXS C;  2ENB A;  3H94 A;  1HFN A;  4OO1 H;  3MA2 B;  1B53 A;  2EY1 A;  2RA4 A;  3TME A;  3AU7 A;  3GTK B;  2F0L A;  4Z9C B;  2QEJ C;  2QDB A;  5D3I B;  4DNT B;  3HGB A;  3M4Y A;  3D3R A;  1JOQ A;  2EY6 A;  4NKL A;  1TU2 B;  4BA2 I;  1MSG A;  1D5Z C;  5EKK A;  2XSC A;  4KY5 A;  4BBS B;  1CM9 A;  2XVS A;  3J7Y W;  1H9J A;  1PTO C;  3OW7 A;  3VYR A;  1TWG B;  2NN6 H;  5JVG 3;  1Q3L A;  2O4X A;  4Y7N B;  3Q0A A;  4TSS A;  4ZUJ A;  1LTG D;  1WTR A;  1G8Z D;  1GJX A;  4YIJ A;  3Q24 A;  5EPK A;  4CKC A;  2H1E A;  4F8M A;  1STE A;  5DEH A;  1WD0 A;  5JEA J;  4L63 B;  4XQN A;  1CT1 D;  4HR7 B;  3N6R A;  3VA7 A;  2CHB D;  4WRD A;  4DA2 A;  4L8J A;  3X3N A;  2Z4H A;  1SNP A;  3NUC A;  3ITP A;  1LTI D;  1TWC B;  2BOS A;  3V96 A;  2VB2 X;  2PPB C;  1DM0 B;  2JA6 B;  1FNV A;  1D5X C;  2HDM A;  2PCF B;  5ELD A;  1F9Q A;  4DAY A;  4RGN A;  3RLF A;  1RTN A;  3GP7 A;  3R8B A;  5C6A A;  1TY2 A;  1EQV A;  1R4Q B;  1WTQ A;  2XRQ D;  2PZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...